1S3FA

Purine 2'-deoxyribosyltransferase + selenoinosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
165
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
molecule keywords purine trans deoxyribosylase
total genus 50
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s3fA00
5AJUA 4PFKA 3O8OB 2Q4DA 6PFKA 1S3FA 1F8XA 4A3SA 4WL0A 2KHZA 1S2GA 3EHDA 3OPYA 1S2DA 1WEKA 3SBXA 4LJRA 3PFKA 4FYKA 4KXNA 4P5DA 4P5EA 4LJLA 4FYHA 1F8YA 2F2TA 2F64A 2Q4OA 4JENA 4NPAA 1ZXXA 5ITSA 4KXLA 1KZHA 4JEMA 4OHBA 3HNOA 4MEJA 1S2IA 2IZ6A 1S2LA 1T35A 3IMKA 1RCUA 4KXMA 1WEHA 3MAJA 3O8LA 3O8NA 2F62A 2IZ7A 2PFKA 5AJTA 2PMBA 3GH1A 4I7EA 2IZ5A 4HX9A 3O8OA 3F5MA 2F67A 4MCJA 4OHRA 4FYIA 3K2QA 3QUAA 2A0KA 3UQZA 4I36A 2NX2A 3OPYB 2A33A 4I4IA 2F48A 2KLHA 3U39A 4RH3A 1MTOA 1YDHA 4JELA 3BQ9A 2HIGA 1PFKA 4U1RA 4LJKA
chains in the Genus database with same CATH superfamily
1O54A 2IU4A 3TCXB 4PLFA 1H3EA 1ZQ9A 3I04M 1YMQA 5IHPA 4KLAA 3EVGA 5E9QA 1AK2A 2COEA 2Y6UA 3CUUA 5HFAA 4Z6KA 3TL3A 3RJZA 4NZYA 3V9AA 1GNQA 2W4MA 3EXG2 1ECGA 2GA9A 4YRBA 1PR2A 4IWYA 2PJZA 1BQEA 4JIMA 3I6QA 4C0BA 1BXZA 4JKIA 4LZJA 4CNBA 1CF4A 2CUTA 3NWBA 4GS5A 4QJIA 1AKNA 1W47A 1MC4A 5DBOA 1NOIA 1TW2A 1VMKA 2FZVA 5FL3A 5IUJC 1RMYA 4YO7A 1OFUX 4HMPA 4EF5A 2FMTA 4BVAA 5K0BA 1WB9A 4G07A 3CWQA 5L4LA 5M7EA 1SK8A 2FCRA 3TK1A 3D6JA 4BBAA 1EFLA 2FKAA 3GWZA 2E5LB 1DTSA 4DOMA 3SFTA 2BZSA 4PAGA 5BN5B 3RFVA 4II7A 2GEBA 1U8ZA 2YWFA 3JR3A 3C0KA 3COZA 2R11A 3UHJA 3VNQA 1GCGA 2FPSA 4XLTA 4DY4A 1CQIB 3TB4A 5T6BA 1QF7A 3HCFA 5EZSA 4DY6A 1O96B 2PCLA 2R9VA 3WIUA 2B1QA 2A58A 3RBZA 3CXUA 3QYAA 4BQIA 4KO4S 1M75A 3OJWA 3SSNA 2CL0X 3UW3A 3LBYA 3W7AA 4B4DA 3AXSA 3FPAA 2YWBA 3DL2A 4UQOA 3GUCA 1OA1A 3C1AA 2A1UB 4FZ3A 3NAQA 5DH9A 4YP9A 4GP7A 1R37A 4AP5A 3ZU2A 4NV3A 3GGOA 1Z2OX 4RANA 3AI1A 3DEFA 4KXWA 2QORA 1OPXA 4XXHA 3AFMA 5BYBA 2AQIA 4X64B 2HKIA 4DHEA 4ATNA 3O9ZA 5CEFA 3QBJA 4MUEA 1XFDA 3M1IA 4NATA 5J5VA 3BS4A 4KWTA 3B8EA 4YJHA 3PFFA 1JHQA 4ZYWA 4TKUA 4CETA 4UM7A 1JPVA 2AZMA 1VI6A 1R0KA 3EF3A 4LOJA 5DWVA 5K8UA 4FJ2A 2HM7A 1BXRB 3OFKA 3EEBA 1W30A 1SURA 1Z45A 2PFKA 4RVCA 2XAAA 1KJZA 1TYZA 3LE8A 3EB9A 1N8NA 3OHMA 4RVOA 5ABPA 3FNEA 5CFRA 3TTXA 3UHAA 2I3ZA 1G5TA 5K6AC 5FQOA 3QF7A 1QFMA 4UM9B 5LA6F 3L0IB 2RHLA 5AVXA 4L76A 1H0RA 2AG8A 3LQ2A 5KYUA 3H2IA 2BFDB 1RAEA 2VJBA 1NE7A 3BOSA 1NN1A 3SIRA 5DCLA 4ZQHA 2GEUA 4E08A 4ZO8A 4EJSC 2X1LA 2PVPA 5JR3A 5BVHA 1SCDA 2HSEA 4QM7A 1NJSA 3QA3E 3LW8A 3USCS 1T9AA 3V4OA 3QE3A 4OQYA 3Q98A 2DBYA 3NKLA 3N2NA 2BRUA 1GHTA 1WCWA 2XDYA 4NENB 4NMMA 2ZJFA 4BWVA 5IBQA 4O2BA 4F4DA 4YAGA 5K0SA 3U2QA 3S1SA 3IGFA 3WLOA 3E1SA 2BMFA 4EO9A 1E0DA 2V7QA 5A4MS 2IYWA 1O94D 3GU3A 4IQGA 4EK9A 2GD2A 1ODCA 4P3YA 4NMXB 1E2KA 5JVDB 3BH6A 4IDEA 2Q3MA 4MMZB 3MF4A 1J8MF 1A5SB 1R8QA 2BH9A 3BTOA 4Y0VA 3DDUA 5E2IA 4GVLA 1XXHE 5DI3B 1EFKA 4UAGA 1JEJA 4RIFA 3C6KA 2YDYA 1WL8A 4K6FA 3S6JA 4TQUS 5JYEA 1TJ4A 3O3CA 3VM6A 5IZCA 1FMCA 1VMAA 2IUTA 4MLCA 3LL4A 3UMMA 1ZUNA 3H9GA 5IH7A 3TLGB 1RJGA 4KP7A 4I3FA 4LGYA 3TD6A 3WGVA 4DKJA 1LPPA 3MGAA 3H5NA 2W6NA 5G4KA 3JQFC 1T8YA 3LHIA 1VJ1A 1MO6A 1U4OA 4OREX 1EVQA 2VF8A 5A7GA 4O1IA 1DMRA 2I4MA 1A9XB 3JQ9C 1HDIA 3LT0A 2LCIA 2PU7A 4U7FA 1G2IA 1R9NA 3LWDA 4IJVA 4HLDA 2BR3A 5F1OA 3K70B 4XYGA 1U5AA 1DKMA 1P72A 5JOQA 3G8AA 1EK0A 5IKOA 2OCGA 4EG4A 3CNOA 3AFGA 5CJPA 5KYGA 2Y0DA 2XZOA 4OMUA 4EVQA 1U7DA 4CG0A 5JNSA 2QXUA 3NHZA 3S1AA 4QOGA 4C4SA 3JSAA 4EKYA 5AUOB 3LUFA 1N2CB 2HCJB 5EIAA 5D8DA 5FP0A 3UB4A 5CYPA 1F2UA 3EY4A 1OHHD 3F6PA 4PYMA 1N2CE 2JIZD 2WIGA 4L5YA 3W05A 4DQKA 1RWNA 2AA3A 2C84A 2NU6B 4NEGA 1EJ6A 4ZAZA 5D5QA 3ZTWA 4F3CA 1WCIB 4Z4EA 3QPWA 1P60A 4HH4A 4L16A 4YROA 3B9RA 4EECA 4B3GA 1S2MA 3JAKB 1UL1X 1TADA 2PT9A 3GFSA 3ORFA 3H9JA 4JBNA 3QYFA 5LB4A 3HH8A 1QP0A 2FMXA 2VDWB 4C0LA 5KBYA 2OTCA 3PS9A 2C2KA 2IYUA 4K6MA 4ABTA 1F0PA 4ZWNA 2TMYA 4IXMA 2IUUA 1PR0A 3OTGA 4CIWA 3HKEB 4XIFA 1NKVA 4Z7JA 5C8DA 4TKLA 1KI7A 3UENA 5I9LA 5JYCA 1OBFO 1ELOA 3FOAA 3GAFA 1JHOA 4IG4A 1SQFA 3M2PA 2G6BA 3D54D 3O1IC 4GMFA 1RWPA 1BQ3A 4QOEA 2CL6X 3ELWA 3ZVLA 2C1ZA 4ND7A 3GZTB 3OLXA 1NXPA 1OREA 1JHMA 3QVMA 1A7AA 4US1R 5IANA 4EUSA 1C50A 2RH9B 4L8VA 3ZQUA 1ADCA 2WG0A 3IMGA 4Y9TA 4C1BA 3I5YA 1KQ3A 2I3DA 4L3OA 1BWPA 4B09A 1QPZA 1GPWB 1D7AA 3K73O 1CUEA 2NT3A 3CLSD 3F6SA 3UWSA 4TV8A 3GRCA 1F8UA 4C01A 1M2JA 3IP6A 1MJGM 1HTTA 2O2DA 3A7DA 1Y37A 3DXXA 3H1EA 4NC9A 1Z0SA 1GTVA 4IO1A 3RUAA 3VTAA 2HL6A 2CNKA 3MERA 3CH6A 4QYXA 5C1DA 1X7WB 4N48A 1TQ4A 3QEBZ 3QBEA 1ZZGA 4GX5A 3RTAA 1UBCA 1F06A 3X3HA 4Z54A 5E4JA 4C7OB 2P1RA 2V8BA 3CO5A 3FZEA 3OT1B 3QFHA 4BNVA 4PFQA 1WZEA 1Q1BA 1VRCA 2QN7A 3RIGA 3UJPA 1QFYA 4C2BA 1YV9A 1PV4A 3ICPA 3U1VA 1U0TA 5K3OA 3PEYA 3CW9A 1O7JA 4TX1A 3RIYA 4FDUA 1JEQB 4DZZA 2C9CA 3A28A 4IICA 3IUNA 2A9OA 3C7AA 3JD1A 4MVXA 4FC7A 3BAZA 2MSDB 2FRXA 4KV9A 4NYJQ 3K9FC 1R00A 3QX3A 1QIIA 2XKBA 2QSYA 3M1LA 1YSCA 5HFJA 4GRAA 3C6XA 5JXHA 4LE1A 2QUIA 2VWHA 1FS4A 3HCDA 3JQ8B 3OQBA 3R5TA 4RAQA 4BKOA 1BGWA 4XZ3A 1V4BA 3WRVA 3HI4A 1E5DA 3FSEA 4KQMA 4OD0A 1C4WA 3E9YA 4QYIA 2VUIB 1Y4SA 4MVJE 2WDPA 1NXOA 3BMCA 3IUQA 1ABBA 1D0IA 3K5PA 1HFJA 3DNPA 2YVAA 1PZHA 1Z74A 3GEGA 4UVGA 3T7JA 1UOPA 3VGJA 3WJ7A 3NHBA 4HWPA 4G5SA 5FLYA 4F5DA 1FP2A 1Y6QA 3FMGA 1AF7A 3LK7A 3LPDA 3RV4A 5IJZA 2OAEA 3DWEX 5DN9A 1I2AA 4LQCA 4D8YA 3K15A 3CVVA 1DV1A 2DWQA 2QD1A 3KSRA 4HUQB 5KYNA 4CM6A 4OAOA 2CWDA 4QYSA 1TLTA 1VIDA 4JGGA 4YAWA 1GDTA 4MGKR 1P7ZA 5B3JC 2FW1A 2FWJA 2YN2A 1RT9A 1LZLA 4NI5A 1QVAA 2P8JA 1EZZA 1PFUA 3C6ZA 3MOIA 5ICGA 5IT4A 3E8MA 2BEKA 2O9JA 2NYRA 2Z2KA 1LBSA 1ZK3A 2IPLA 1O58A 3PHHA 3CUSA 3EH1A 3C15C 3U3DA 1OYWA 3N0WA 4H16A 3KT6A 3T5PA 2JFPA 2VRCD 2I2DA 1ACJA 4Q9IA 2ZWVA 3R7NA 1GPNA 3ME5A 1O6ZA 1UEJA 2Z4SA 1K2VN 1UPFA 4IW3B 1L5WA 3H86A 4JVMA 1T2EA 2VVTA 2VXCA 3VVMA 5JPCA 2XR1A 2QY6A 1MDFA 1X14A 3EFHA 2A1UA 3AJEA 3EYWA 4HZUB 4IXDA 1XU9A 1MHTA 1A8PA 1K1EA 4BFTA 1PK9A 4GI3A 3NOQA 1QYCA 1JDNA 2FZWA 1ESCA 4PSKA 2ENWA 3MTJA 4MO2A 2C9OA 1ATIA 1XLTC 3RYFB 1TX4B 1P17A 4AFNA 2WQ7A 1ZD2P 4JLBA 4OXIA 4P54A 3UC9A 5EYPA 4KQXA 3GHYA 1H22A 4OY3A 1I51A 4P7GA 4BO6A 5I7EA 1B23P 4E11A 3X1DA 2YV4A 4RA6B 1I2BA 3DMRA 2AG5A 1A4IA 3AB3A 3UJ7A 5K6AA 2A5DA 4U1RA 2ZS8A 4EKIA 1Q7GA 3NH9A 1MT0A 3G17A 2IE0A 3GIWA 4DMFA 5K4HA 4GPEA 1XSEA 4QXPA 4WW0A 1O97C 2G9VA 2R1VB 1JJVA 4GKBA 5D7NA 4A8JC 2AYZA 5DYYA 5BR8B 1Z63A 2YYYA 1L5GB 3E9MA 1PT6A 2BFDA 4IXWA 2EYQA 3AEZA 1WO8A 1NQOA 3JD4A 4LPSA 1QX3A 3NTRA 3IT0A 3RLIA 3UM9A 1L8XA 3HZRA 1M2GA 5ESRA 4F45A 3Q9UA 3G89A 1QHFA 5CXQA 4C2UA 1PV1A 3OVMA 4JBLA 4F46A 2X9GA 3MJVA 4GZMA 4LDQA 4XB2A 4YTEA 4P3KA 3UGQA 3NATA 1U6JA 3FPHA 1TUEA 2CK3D 3X43A 1KYZA 3G5LA 3HSSA 2QJFA 2V7BA 3AUTA 4JEUA 4LBVA 3VNUA 3UKJA 2W2MA 3K8YA 2QTVB 5CVTA 2L69A 4QTZA 4L0QA 2C20A 3P97A 4MB6A 1ZVKA 3QBVA 3WSWA 3H6KA 2V55B 3OM9A 1GYQA 1KEZA 1VKJA 4QGFA 4Q4LA 1NRXA 4OP1A 4YV2A 1J2EA 1JIIA 2COKA 3H8WA 1HDGO 4NX2A 2OKGA 1JHUA 2HBYA 3M4YA 4BQFA 5FULA 1Y8CA 4E2FA 1RP7A 1XZLA 3L1KA 4GMKA 2G07A 4JT8A 4V24A 3HVKA 2ZATA 1U7OA 5HDBB 4I3HA 1JLLA 1NW9B 1U0LA 2QROA 1D1QA 1N6IA 2HIHA 3A2NA 4C22A 5B6JA 4OLBA 3L8HA 4ZU6X 4KFSA 1K8ZB 5K0EA 4I8DA 3IPLA 3TLKA 3KUXA 1NF9A 4NV1A 4UMDA 5EKSA 3A9VA 1KF0A 4H1WA 1EVZA 2HFJA 4O2BF 4C04A 4JOSA 1BZYA 3W2FA 4EIWA 1U3FA 4YJGB 1QP8A 1T34A 2FY8A 2PMCA 3G0HA 3LL7A 1DAOA 3SZ3A 4OHFA 4YT5A 1XLUA 3WLKX 4M55A 1T1RA 3HU1A 1NBMD 2DEUA 1OFUA 2OO5C 1JHZA 1YO6A 2RGDA 1NVKA 1JTEA 1TI7A 1NDQA 2QRZA 3LQ1A 5A9RA 2HPAA 4TVSA 1X7ZB 4Q66C 4EW6A 5KX5A 2RBKA 1Y80A 4PRZA 2RHJA 2V65A 2JGAA 1P6QA 3BHIA 1NY6A 3RVNA 1ZEMA 3KWFA 3VYVA 4FDVA 4DCUA 2H85A 3K4PA 1UT5A 1FFXA 1XNGA 1Z68A 2EJCA 2VNKA 4GKAA 3WGJA 5BVGB 3Q8LA 2UZ3A 2A3RA 4HDKB 4KI0A 4XM0A 3ZE8A 1XO1A 4JIGA 1Q2UA 2DFTA 1PWZA 5HBGA 4TMFA 2Z6UA 3PDHA 5TMBA 1IB6A 2C4NA 3SXJA 4E46A 5DDIP 1D1TA 3LHDA 1CF2O 1ZNXA 1P4GA 2QTAA 1U5BB 4L0MA 3H3JA 4U00A 5EIOA 2YIDA 3BWBA 3N9IA 4ALMA 2XTAA 2A35A 4C20A 4J16A 3V1TC 3IMEA 5CFMA 2DAPA 3AEYA 1VHQA 4BV3A 3NYIA 3OEHD 3A4YA 1QCCA 2V5VA 3R8XA 4OFBA 5LFAA 1E1NA 4KEAA 2OCAA 4FDMA 2FWIA 3PGLA 1ZGZA 1XDWA 5FBRB 3IUBA 1SELA 4D74A 2C3YA 3PC8A 5JQGB 3I92A 2YHIA 5DTIA 5BN3A 3WOVA 2ZT8A 2WJYA 4Y1EA 2P67A 2P4EA 4KXYA 4R0MA 5LM3A 1Q7TA 3BCHA 1V8ZA 4LZLA 4KPYA 2Y68A 2HLHA 3K0FA 1BXGB 2G5PA 2IPXA 2X5OA 4PC2A 1MN6A 1P29A 3FAKA 1D03A 5IF3A 1N8SA 2WTXA 4BASA 1CRWG 1XZPA 3HO6A 4P3XA 4DCSA 2ZYWX 3DFUA 1P0PA 2A4MA 1KY2A 4RM2A 5EGNA 2N0SA 4HEHA 3LGAA 3N05A 4LOIA 2Z8YM 2IGBA 4QTXA 3HV2A 4M1ZA 3LVQE 1NVEA 3PTLA 3KK0A 2XQKA 5ALOA 3UXHA 1PWEA 5LXTA 1A50B 2Q6TA 1UC5B 3MS2A 4MDYA 3LECA 1JDVA 2HN9A 1IN6A 2NO1A 4NJMA 2WD7B 3GFBA 3ZLTA 2JAQA 1JYEA 1TK2A 1U7UA 5B12A 2MR6A 1QO0A 1FYVA 2JLYA 3GIDA 1CUDA 3RFTA 4S0ZA 2VTBB 1T6ZA 4PG4A 3CJRA 2JVKA 4MVJP 4QODA 1AO3A 1F0NA 1IXSB 1YQDA 2AT1A 3CUTA 3OT1A 1OAKA 1S9HA 4P08A 1E98A 1T5DX 2A9KA 2ODAA 3PUIA 3THOA 1W85A 5TXGA 1E9FA 2QZJA 1V3VA 3ETCA 3F96A 3FI9A 4P31A 2J0UB 4BU0A 1QGED 4CN8A 5E9AA 9LDTA 4J3JA 3DGEC 1VJ0A 4JGIA 3DONA 5FUWA 4HVLA 2ZBDA 3FOBA 5JZBA 1T9KA 1CQPA 2GWRA 2KSQA 2VJAA 3VNSA 3DOCA 5E8JA 3K4HA 1IVYA 3EE6A 2VFAA 2WA2A 4LOHA 3K0CA 4M0EA 1SQ5A 3BL5A 4DMLA 5LSAA 4RF2A 1TRKA 1Z83A 4I6GA 1R3DA 3PWSA 4QDOA 4DLNA 4I4TA 3D4NA 4RIHA 1RLUA 1Y3AA 2C2ZA 2DX7A 4Q9HA 2GHIA 4ZAGA 2Q3HA 5CHEA 4DR2B 5CYOA 5FI1B 3TW0A 4EY4A 3COYA 4HB3A 5EUQB 2DF8A 4M0FA 4BO5A 4PNPA 3OO0A 3O8LA 1MO3A 3FVRA 3ND5A 4GM1A 4JBIA 3B3AA 4Y18A 5B3AA 5HMMA 2IWHA 3SFVA 5CT6A 3T5BA 4E70A 5LZ2A 3G0OA 1VCIA 2D2VA 2I1WA 2K4MA 2ZYIA 3CG0A 3JQGA 2PZFA 4IFTA 4B83A 4DF3A 5JQGA 1PT7A 3SDZA 4FEAA 3WLFA 4J1QA 2AZXA 1QK3A 2IIPA 4EPYA 5JVDA 3B89A 2R1TA 2Q3JA 3HBNA 2G17A 1U0JA 2VTEA 1AUXA 4N8DA 3H1GA 1Y8AA 2OWDA 2ZRLA 3IP1A 4WOKA 4XYMA 5LMNB 1LLDA 3G2LA 1YS9A 4MUBA 2B25A 1NVUQ 1E3WA 4D0GA 1ZR4A 3CV3A 2C98A 2WF7A 2C4VA 2XUAA 5SICE 2AVNA 4ZYVA 5AVTA 5A1TA 2O3SA 4LRSB 2UKDA 5G41A 4EJ0A 4JITA 3UQZA 1M7GA 4FFBA 5AVSA 2EWMA 2W2KA 3JQ7B 4B81A 2RJNA 2VHEA 3INTA 1ETHA 3FCEA 3RH0A 2OM6A 4MGEA 5LZ4A 2XJ4A 3E1GA 3PUWA 5HJ7A 1OLXB 5KWIA 2I55A 2VBFA 3E48A 4UBNA 4AG5A 3R9WA 2NQTA 4LDAA 1JJ7A 3W2IA 4L78A 4IHQA 4LJAA 3GFQA 3N0RA 2R6GA 3AINA 1YBVA 3JQDA 4GNKA 4P4TA 5F35A 2AIRA 2JVIA 4OUDA 3V00A 1NPYA 2AZTA 4G0UA 5IU6A 4KR0A 5CH3A 1QLHA 3ICCA 3QM1A 4G5OA 4YAKA 3IE1A 3BXHA 3OFNA 1M6YA 3CHYA 1JLSA 4HO1X 4ISBA 3MOGA 4MVJH 5IAOA 2B98A 2QGFA 5EHQA 1F8XA 1RQPA 1U98A 2PX2A 3RS2A 4DW8A 5K0GA 1FDOA 5FUBA 1IPFA 5JSZB 2IZ0A 1C9JA 3QKRA 4GH5A 5F1PA 3SI7A 1YF3A 1KZ7B 3D8UA 1SY7A 4DAEA 1LW7A 2VO1A 2JRCA 5BNTA 1MU0A 2PZEA 1P1KA 3IJPA 4DSOA 1D9ZA 2XE7A 2FUNB 3JQCA 4RMHA 1E7MA 1A71A 2ZB4A 2R96A 4INPA 3S7ZA 1XVAA 3NT2A 5DE3A 1NJ6A 2XUZA 2O8CA 5KNBH 4MV3A 2W6JD 3C4QA 1RBYA 1S89A 1XRRA 4GZ3A 1PG2A 4F11A 4UNRA 5HMLA 1GGEA 2QPOA 2R6ZA 5JARA 4P5EA 2V3WA 3JQBA 3N5CA 4HCJA 1P1IA 2C4HA 2JLZA 2P5YA 4PZCA 2YXBA 2OCLA 5HM8A 5LMCA 4PN7A 1IVNA 2Z6VA 4YMWA 3H1TA 1G3MA 4JC4A 4NPAA 3LC0A 3CW8X 3CTPA 4EQ6A 1UAAA 5AUNB 4XIGS 2HHHB 1DIGA 4MVCA 1NFQA 3T34A 2BBOA 3HG7A 3QY9A 3VNBA 1TAUA 3IKVA 3MZ0A 4KFUA 4XRRA 3H9CA 3IMCA 2P6OA 4E31A 5DTJA 1KJ8A 4J7AA 5TQ0B 4ZI7F 5I47A 1Q50A 3ZY5A 2ZDGA 1VA5A 1EE1A 3DMNA 3R74A 4UBOA 4BATA 5LUBA 4MKFA 3DCYA 1F6BA 3DFZA 4LMBA 1J0CA 4N12A 4R40A 3P0FA 2FX5A 3RUDA 4PN3A 2AJCA 2OHVA 2R751 3D9QX 5JDCA 1XD8A 1XZMA 2FSPA 3QNWA 4KXFB 5FTKA 2WBLC 3V3TA 1UDBA 2ORVA 4ZKEA 3UJNA 4UDXX 1JZTA 4IKOA 1E2MA 1SCNE 2V45A 4G26A 3QKSB 1Q22A 3WE7A 1Z4IA 1MZVA 5CXUA 3TGLA 2NO0A 3LWNA 3GT3A 2FMUA 1B1AA 4PNZA 1P2TA 1ZM9A 5EJMA 3CZQA 2NVUB 4UFOA 5DXJA 4RDXA 1E6KA 4PC1A 1QHEA 3GJ5A 3I61A 1IZ9A 1I7PA 3AERA 4N7RA 2FPLA 1LSOA 1ISJA 1N5LA 3NRJA 1QRUA 1SCQA 3O38A 1YXMA 3FRIA 1AXGA 1WZCA 4DKXA 3DFKA 1AHHA 1EM8A 2JGDB 2WSSD 2AMVA 3FR8A 4NCHA 3FZGA 4EYOA 2IS1A 4TLCA 1ZWKA 5BN1A 2HWXA 3PQ8A 3KJQA 2YZGA 1UEXC 5ALKA 1Z2EA 1GL3A 5KWEA 5JCOC 1SJ9A 1OXSC 2ZSIA 3DW1X 4UDYX 4XTCS 1N7HA 1Q7CA 2AF4C 2C58A 1ICEA 2PUHA 1CP3A 3PDWA 5LIPA 3WIOA 2FDCA 1PG5A 2C7BA 4YCJA 4ZARA 1X15A 3AF2A 2CXHA 2PNFA 4YUVA 3GLGB 1U0GA 3EBOA 4FGJA 1GU1A 5FUQA 1DC6A 2H18A 5KTNA 1GCOA 1RKVA 1YDHA 1RQLA 4ZZ2A 1SC9A 4BMNA 4CF4A 1RAGA 3K7EA 1CK4A 1UM9B 4RFLA 4CR8A 5LDDC 5C18A 4WJKB 4IQ4A 2IYNA 4LUCA 2HA4A 4X93A 3RU2A 2OKCA 3UJDA 3PX7A 2XQGA 4Y2PA 4B3RB 2NPIA 1LDGA 2GD6A 2HADA 4WHMA 4PR0A 3SF8A 1L9XA 1ULBA 1NI4A 2YOHA 3JASA 3RAEC 3ND9A 4NH4A 2XZLA 1VBNA 2Q2NA 1UOQA 2CXUA 2ZXUA 2BFAA 1Y4ZA 1JSRA 2X5XA 3RT7A 2OYCA 3T54A 1DJMA 1FQKA 2GCPA 2QM0A 4LOAA 4BBJA 4I4LA 4J6EA 1YMVA 4AY4A 4QTYA 2ODEA 1UQUA 1YFLA 1DJOA 1C30A 2ONYA 3NKFA 1JHYA 4NZOA 1F2DA 3WBKA 4QFBA 4FD3A 5FYQA 1SCIA 4HFMA 3K0SA 1YUNA 2IE8A 3PGVA 5BY2A 5INTA 2JBAB 3P9SA 4OX9Y 1TMGE 4EGFA 4HZGA 1BN7A 3IBCA 4GL4A 1YNSA 4WN9A 1XZ8A 3K35A 1CC1S 3OLWA 1IM8A 4IDAA 3S2SA 3WL5A 4MVJG 3SE0A 2CT8A 1PJ4A 2PZ8A 2H2IA 4FMPA 2YQZA 4REQA 1FFGA 5A6SA 2QZPA 4ZZ3A 1N1EA 2CL5A 1AM4D 1PTKA 2MYUA 3A9WA 4B74A 3H5AA 2IIBA 3WGMA 2ZIXA 1W0KA 1J8QA 2H00A 1APBA 2YWJA 1LVHA 4GSLA 1CXZA 2DE0X 1NSTA 3LHFA 4UVIA 2AFIA 2OZKA 1ECFA 3MJFA 1ILWA 3F9CA 5AWFC 2WWFA 1VLZA 4KPGA 1AT1A 1PLJA 3R3UA 3PDIA 3DC7A 5F77A 3SF0A 4M4SA 3VX3A 4NBNA 4XFJA 5J3JA 1FUUA 1NBEA 4IFIA 4I1PA 4L57A 2WINI 4X8MA 1ZJJA 1UADA 2F1HA 2OD7A 3ETDA 2ZM5A 5DYGA 1NUTA 4RV5A 4D42A 3EOAI 5BMVB 1EBUA 3RWMB 3LFHA 3CEAA 1Z35A 4RA9B 3EZGA 3FNHA 3O03A 2EIXA 2RGGA 1LH0A 5A3SA 3U5ZB 1ZM4A 3A4VA 2ZG6A 4X90A 4A2QA 3CR7A 1JIJA 4OJTA 4ZCQA 4F1WA 5F2OA 5JDIA 1RBMA 4MARA 4COOA 2OUKA 1OH5A 4G56A 3LX6A 1D5CA 2PYIA 4MW6A 4BGDA 1OZHA 4E5SA 4UPVA 5G3ZA 1OGIA 4OBBA 4KH0A 1A9TA 4PQGA 4O3FA 1NRWA 1B0PA 3K9QO 2QR5A 2FWRA 3IOMA 4J7XA 5DM2A 1GGNA 1CJMA 1W88A 2QT9A 3GR6A 1V8DA 2NXNA 1I7DA 4MCIA 4X7RA 2C4TA 1DX4A 1VI5A 3A4NA 5DSZA 3NGMA 3A06A 3I39X 3ZHXA 3FYUC 1VXRA 3NV9A 3UH0A 4P5PA 2OFPA 3WC4A 3SJAA 5DBEX 4MR7A 3IB6A 3IJRA 3YASA 4WVFA 1SFRA 5HTOA 1KO5A 1WBBA 4AS1A 3FDIA 5AXCA 2G67A 3PC3A 5FPPA 2GFIA 2PK3A 2ZJ0A 3PD7A 4JBYA 5EHIA 5KVVA 1RAFA 4N9QA 2Y8EA 3JYHA 4PPQA 4TXNA 2D7JA 1P80A 5AXDA 3AXTA 2GILA 2GVNA 3L7OA 2UVPA 4QQKA 3QVWA 2CUNA 5FUYA 4ZVSA 3E3NA 1V11B 3GNQA 4KSYA 1D4OA 1CR2A 1KVTA 4YCAA 1E2HA 1F1BA 1R1DA 2W83A 5GY7A 4FN4A 2B78A 4BKUA 3MJEA 3NCTA 5BPHA 4GYKA 1GUBA 2NOAA 4Z53A 1JH9A 4QXOA 2XOXA 2ZVPX 4URFA 4XQ0A 3O21A 2D62A 2ZJAA 4LYGA 5DHQA 4XE5A 4CKEB 1DJNA 1Q83A 3CZCA 3O4VA 4IFBA 1HEYA 2L42A 5D84A 3C8MA 3SHVA 3GLUA 1O87A 1TEVA 2HY7A 1ODIA 5HKOA 2HHJA 2P1ZA 2EKZA 2Y67A 3DKPA 3E9DA 3GT7A 4LHWA 5EKTA 1NVBA 2CF5A 4INJA 3ETEA 3T06B 5KSOA 1PQPA 3EEYA 1XZFA 1ZZEA 2Z5LA 1UMDB 3GN1A 5DF1A 7AT1A 1WR8A 5LP6A 5EIWA 4QAJA 3Q3CA 1X86B 3TINA 3IB3A 3ULKA 4LKRA 2OZPA 2BFFB 2E18A 1U1CA 1Z4PX 3T5CA 3NUZA 5ADUS 1V43A 1CS4C 3F6YA 1XK7A 2O2ZA 4XVQA 7ABPA 2P2YA 3DB1A 1PK8A 3R8CA 1NBIA 1ZD1A 3DPSA 2WM3A 3UV3A 1LF5A 3FLAA 1LRLA 2NUBA 2CVQA 1THGA 2BR5A 2I7VA 3I04A 3K6KA 4FYHA 4CKWA 3U4QA 2ZVQX 3T5DA 4PYNA 4DCJA 1DAFA 3IUJA 3UAVA 3GBPA 5JS1A 3GZNA 3HR4A 3JY6A 1Z8FA 4BFXA 3CX7A 2JFWA 2JARA 1H2AS 3HU3A 4YRPA 3F47A 3IL2A 3Q0TA 3M3DA 4GUDA 1OX5A 1MQAA 3ZGNA 3P8ZA 2BTQB 2GSDA 3OJLA 4IIYA 1VCHA 1WDLA 2HHLA 5UKDA 3QVGA 3KJEA 4ZJZA 2BFFA 1VG8A 1WXEA 2ZRCA 1U9IA 3H0KA 4BX8A 3H9UA 3JPYA 2JFBA 4NXNB 1H2ZA 3D4PA 3KPVA 5EXSA 3WKDA 1W59A 2R00C 4QT0A 2FMIA 4BB6A 3E5NA 3QLUC 1ZISA 4V2UA 3UMJA 3EXAA 4CHTA 2VJNA 5A03A 1YVRA 3V48A 1DC5A 1BS1A 5TDHA 1ST3A 3WLNA 5AM4A 3B6ZA 4TS3A 4AJOA 1BH6A 4P4GA 5B6PA 1XD2A 4OKIA 1A1VA 2PGOA 2DPHA 4FP9A 4Q47A 3P0IA 3T3MB 3OT4A 2B4RO 4IVPA 4HN9A 3B6KA 4MHOA 1YBHA 4HSEA 3PUVA 4YIHA 4OQEA 4DPKA 4DLPA 2LP4Y 1AUVA 3QYJA 4B73A 2C5EA 2WSYB 3CNNA 2Q27A 3A2LA 2OR3A 2VSXA 5C7LO 1NVVQ 1Y98A 3GARA 4O2LA 2UXCB 3R3SA 2V7TA 4HTAA 2CJWA 2W6MA 3WGYA 3AF1A 2C99A 3FAZA 1TK3A 4AJLA 4AXBA 2A0UA 3DTVA 4C9BA 4OQDA 4A9AA 3ZHSA 4EVRA 3G0IA 3A9SA 4DIDA 1DCKA 4PC7A 1YKGA 2XUJA 2I4IA 1NLMA 4FZRA 2VRNA 4BWYA 2JGRA 2H65A 2OE2A 4N4AA 4NYIQ 3JTEA 1BU5A 2X0FA 2CLFB 4DRZA 4KK3A 4I50A 2CCJA 4MWEA 1FS6A 4UXJA 4RLSA 3BMCB 2WKWA 1ZW1A 4J0HA 3NM6B 4L08A 5AJUA 4ZT4A 4OHYA 3ZJUA 4EG6A 4XFKA 3VHLB 3U19A 4U2BA 2LRHA 2X4GA 5I7WA 1RYDA 1OCEA 4PPYA 5FBLB 5JCOA 4JSTA 2I65A 1JEAA 5ESXA 1IY2A 3LCRA 1EHIA 4X8HA 3RASA 1YA8A 4HFRA 5ICMA 1WUTA 1NZJA 1ZICA 2FW8A 1GQ2A 3IP8A 5LQDA 3ZQKA 1P1BA 2DT8A 1S8OA 2B2XA 4XB1A 1JQAA 2LUOA 1RKBA 3S55A 4F4JA 821PA 1XU4A 3O0TA 5AI6A 5D3MA 3MIIA 5GQSA 1SOUA 2VRWA 2EF1A 4RM3A 3AUYA 3R75A 2IPAB 4N5DA 5JTTA 1A9OA 4HH0A 1Y33E 5IS2A 3MTEA 1US8A 2X6RA 3OZIA 4NZNA 4LK2A 4DIKA 10MHA 5JYDA 1NXSA 1CBUA 1RWKA 3FHJA 1KJ9A 3HJCA 3R5XA 3QW4B 4QGHA 1JFLA 2FJPA 3CGWA 3E5RA 1U80A 2GM9A 3MJDA 1ODKA 4JBHA 2DG2A 2V0NA 2VWQA 4XWTA 3Q4GA 1XKTA 2ZU6A 1A1SA 3CX3A 3FBWA 3MINB 1YS7A 2YJTD 1MO5A 3Q7IA 4G4GA 4W8OA 3AKZA 5KYKA 3T7EA 2XDAA 3ZHZA 1K5HA 4NBUA 1S1MA 1OD6A 3KOWA 4N5IX 3GGCA 3HNPA 4R16A 3X0DA 3CMMA 4Q4HB 5BP7A 1ZOPA 2C31A 3EEQA 3TKYA 5FHRA 5K9ZA 3C7DB 1XL1A 2AFIE 1KMMA 3GDOA 3OJ0A 4Y1RB 2SKDA 3PDUA 2EWWA 3DE2X 3EVNA 3W5IA 4BZZA 4G2TA 3WSVA 5DO9A 5AVJA 2AJBA 5K4GA 1KDVA 5EJ5A 2CYBA 1H2YA 2EJUA 3LTNC 1WV1A 1J1IA 4DREA 2HRRA 1T36B 1MQ8B 2WTBA 1XAIA 2X5KO 1YQXA 1NW6A 2QB5A 4JJ8A 1G6HA 2E3JA 2FW6A 2ZJ4A 2PX5A 4GNRA 2AYYA 3DYVA 4D98A 4HPJB 2V97A 2CJYA 4MVJM 2IYZA 2PBRA 4NZZA 5JAUA 1PU2A 2FWPA 3D4BA 4CEHA 4QVKA 5H68A 1SC4A 1UBMS 1Z6QA 1D8TA 1YE8A 2EJVA 4YLGA 3FPEA 2HEGA 3DLCA 1KU6A 4FX2A 4ZC8A 5EJEA 3JYLA 1DOZA 4OJKA 2XTJA 3B3QA 4Q03A 3LKDA 1XALA 2NU9B 1QONA 3UKOA 1UBNA 2IIVA 2VUUA 1SXJC 5CH5A 1TCCA 2WTNA 4Q7EA 2CHUA 4NOKA 5ECDA 1N6LA 2WEKA 5CJJA 3RADC 1EDOA 1N5JA 1RVV1 4MQ6A 3CRVA 3R20A 5U1PA 3OKAA 1H9CA 1QHGA 1UUFA 1YL5A 1L3BA 4KPFC 3HS3A 1QUFA 1JKMA 2J5RA 5AK6A 1Z4MA 1MPXA 5AMXA 4OBEA 3SXUB 3LPAA 3UGTA 5EZYF 4C4TA 4L6IA 4YMGA 1YS1X 4KBYA 1Y81A 4UNPA 4IG9A 3T4UA 1CVRA 4B47A 4DG5A 4H08A 1KYYA 1SQGA 1CG6A 1E1CA 3M5CA 4QG3A 1W2WB 5K0JA 5CBKA 1ZNYA 4JD5A 3EASA 2D0PB 4X85A 4H9GA 3W3AD 4PICA 1NQTA 2EQBA 1IVSA 2O5VA 5BYKA 2EIHA 4OBXA 5LDGA 3CZAA 5IJ0A 3D0OA 1NHGA 3HABA 4FFDA 5DYNA 1V4VA 3QITA 4QOJA 1TKAA 2QAIA 2PYDA 4UBIA 1KYQA 3LLVA 3VV3A 4RDIA 4CEIA 5I48A 3N2KB 4BL5A 2HR1A 1KEWA 3A36A 3GFFA 4JODA 5K3CA 1NBHA 4LRUA 2CVZA 3GJ4A 1Q3TA 4I6EA 4Z0HO 3RGGA 3WKBA 4B35A 1EVYA 1W93A 3SC3A 1Y5LA 3O8CA 1XKLA 4N0EA 2NVWA 4ZOEA 3OE4A 4LYEA 4U7WA 2J8ZA 1MJGA 2QTTA 1QHHA 1UKZA 4RSHA 4YASA 5BMVA 5I9NA 1U2TA 3B36A 4CIVA 5K3BA 4YMIA 4FE3A 4R2LA 5FHQA 4J3NA 1QMGA 4CM9A 3ISVA 2G09A 4CKCB 2H0RA 3NNSA 3QQ5A 3QHPA 4HRYA 4NENA 2ZRJA 4KJZA 3P0HA 4F4FA 1RWQA 4IXNA 1YVEI 1Z13A 1L7QA 1X8XA 4LSZA 4GC9A 3W2TA 1NC3A 1GM5A 2CV1A 2HQ1A 2ZUDA 3SC4A 2VJKA 1H6DA 1PLLA 1GGHA 2X0IA 2VJYA 3D1JA 4HDMA 3VR4A 5KYYB 4CV1A 1R6XA 1QRSA 1QH1A 1C5KA 1KOLA 4S2EA 1I33A 2O54A 1JJIA 1DZIA 4G5XA 1B3BA 2H5IA 1EDEA 2L0XA 2Q8PA 4GLLA 3C43A 1PFQA 4LV8B 4K88A 4PAQA 5E6SB 1UP7A 3ZWPA 1KNQA 1MRZA 4FEEA 4U3JA 3EMBA 2CLLB 1D0SA 2X9NA 3KQVA 2GPTA 4TTAA 3WYEA 3VR6D 1I5EA 4OUKX 3TQQA 4MTCA 1OZGA 1IBKB 1ZK2A 4AJ9A 4NK4A 2F1RA 3LC2O 3KKNA 1XQWA 1X74A 2IHYA 4QREA 2VK2A 3GUHA 1NN3A 4UZFA 3NP7A 4X7PA 4LVNA 2ZTUA 1PVVA 2UUPA 3QLEA 4XGKA 3B6IA 2YINC 2QY9A 3NEJA 2ASVA 4IVRA 5EYPB 1TW3A 3HM9A 4LFBB 3N8IA 4CLOB 1T2UA 4JUAA 1PHPA 1JMYA 1YJ8A 5EPEA 3ZBQA 5L4SA 2FFRA 4BHTA 4YYEA 1THTA 1YR8A 2J6BA 4RYDA 3N28A 3NLLA 2OSVA 3EDCA 1SM4A 5CVEA 3OCYA 2PUGA 3R0IA 3U40A 2GCOA 4MUKA 4ARUA 1Y6JA 3I9V1 3QE2A 4RVNA 2HJRA 4MYSA 5ALUA 1DIBA 2GCNA 2ZJ3A 3GLVA 1DLJA 3GPIA 3GFTA 5E7QA 4DDTA 4EHHA 3E0QA 1O89A 5FOXA 4QT4A 5JU6A 1I8TA 3KTAA 3ZC3A 2ERYA 1VL8A 2D54A 2C2HA 1MEEA 3TDKA 4I1VA 5FTNA 3NDIA 3GDHA 3IUSA 1S01A 3TLYA 2V74B 3MWKA 3QUAA 3M81A 4PYQA 3CBQA 4GICA 2BFWA 3WY9A 4DJFC 3RS0A 4DVJA 4IM7A 4MYUA 4EUHA 5HF6A 3PZBA 1E69A 2CYAA 5I51A 5CFOA 2FFJA 3UFXB 1M34A 1H9BA 1NQUA 2JLQA 1E0SA 2GAFA 4QPPA 5D3ZA 3ROQA 2R0QC 1J7KA 3CYFA 1JKJB 4B8WA 1J90A 4JNKA 1QRTA 4PC6A 4Q93A 1E62A 2HT6A 3A25A 2DOKA 3Q1LA 4LY3A 3TLBA 4DS3A 3EFOA 1JDBC 4NYJR 1P8JA 1YIDA 1LPMA 2FPGB 2HCRA 4KVFA 2NP6A 2F8MA 4IX1A 1B8PA 1II9A 2HH9A 4F91B 3KZXA 2VT2A 3QU9A 3OKFA 3P9RA 1BDBA 2O2YA 3FSRA 4G5QA 2D59A 4UAUA 3TD2A 4BVGA 4DMGA 2J3KA 4HRVA 3BFXA 4D81A 1UKCA 5JMTA 4I5DA 1SHLA 4DR5B 5BRJA 4J1SA 1ZD4A 4CM8A 1Q0PA 1G3RA 2CXOA 2H1SA 5C80A 3QJ5A 2V9CA 3AHDA 1NVTA 1QO9A 5COAA 2H2WA 3E53A 3SG0A 4C2AA 1M0SA 4B3SB 3OIDA 1OWLA 3BN3A 2E4YA 2D7DA 1NLUA 2BTQA 1EIZA 3DHWC 5ALJA 2OB1A 4E88A 4GVPA 1G5RA 1ZGJA 3CNEA 3DOOA 2XE8A 4JYCA 3ZPXA 5K4AA 2W8BA 4XQCA 2QRKA 3HKDA 1DKRA 3D3KA 3SE7A 3V42A 4Z7NB 1B8NA 2J3LA 2AGVA 4DLSA 3AR9A 4PXSA 1HMYA 1M2EA 2ID4A 1W52X 4HQOA 4JBXA 2G4LA 2R66A 3GNSA 3ONDA 2G76A 3B70A 4IHKA 1AQ6A 5HF5A 4DDHA 3H9BA 1P0IA 4DMKA 2F2TA 1CRQA 4EL5A 1LV7A 2FSHA 2I7DA 3BXEA 3MUNA 5KHAA 4PO8A 3R7BA 2WWRA 3MJ4A 2FEKA 3PNYA 4R1UA 2ASEA 4U9IS 1Q15A 3G5AA 5IFKA 3BWDD 5JRZA 3J7AC 3K96A 1YCHA 3RROA 3VUEA 2MSLA 1GNLA 2O8NA 4IQ8A 5EE1A 3RJTA 3UMVA 3C3WA 3EG5A 3I45A 2B1RA 2D8AA 4MV9A 1R8SA 2DLNA 4MLDA 1UC9A 5IVKA 1N0UA 2AHOA 3KFLA 3EC1A 3HKDB 4HNAA 4Y6PA 1QIEA 5TS3A 2YKGA 5AW5A 3KQMA 1RHRA 4MWCA 4QX6A 1A8UA 1OT3A 4RVUA 1ZKMA 2ODBA 3DBLB 4QPNA 4U2KA 4RVFA 4UM8B 4IWXA 3ZTTA 4ESHA 4Z9AA 4C07A 5AFSA 5BQPA 2JGEA 1ADFA 1HMPA 2WMOB 3UMFA 1UBJS 4PPFA 2RK3A 3I42A 1AZSC 1B41A 3LPLA 2QHXA 3NAZA 3TJMA 2Y1FA 3B20A 3IIEA 3VZDA 4D92A 1U3DA 2UZAA 3CT4A 3KQOA 3ZXYA 1SXGA 1ZIPA 5BWNA 1T1EA 1Q44A 3MUEA 3OQ1A 3TB6A 3KJZA 3K05A 4KODA 5BSEA 3SFZA 5IJWA 4JUIA 2DERA 2CNWD 3WS7A 2A5FA 5K3AA 4EG5A 1AS3A 2PWPA 2AR9A 4QOIA 5LIRA 5HQ3B 5C52B 4BNDA 3HU2A 4LZPA 4EPXA 5GTDA 2EGUA 1LBQA 2NU7B 4P7KA 4G5GA 1SA0B 3ASYA 3JWGA 1Q1GA 3IVCA 4Q1AA 3ZHQA 2UUAB 2G80A 1ESNA 1XJ0A 4WBXC 4AY3A 1XTKA 2Z6AA 4WA8A 3HPQA 1LK7A 5L3SB 2UV8A 1YFKA 4TGLA 4RVHA 4XR4A 4AMBA 4CTJA 1M1NA 3ZY2A 4BX2A 3VTZA 3WHIA 3HB4X 1CZOA 2OCXA 3DE1X 4BO8A 2DBVO 3G8YA 4QEZA 2O1WA 4C05A 2IGTA 1IATA 4BO9A 1N2OA 2DKFA 4EELA 5HZHA 4WNIA 1UBLS 2WB4A 1V1RB 3RUHA 4AO7A 5CDFE 5IJAA 1HK7A 3IEXA 3BDAA 2PSSA 4DBLC 2WKPA 1MT3A 2QLBA 2QVZX 5AKEA 1ZA2A 1JDUA 3BULA 4CHGA 3KKZA 4OPMA 3KDSE 3GROA 4RVSA 2P9CA 4EGJA 5J40A 2AH5A 3RK0A 4ZHSA 3RABA 3NX4A 3I9FA 2WUFA 5DOZA 2FPIB 1EGAA 4XCQA 3RYCA 1AUPA 3L18A 3BTSA 1U7WA 3JCZA 3DZKA 1Y8QB 1PZGA 3PNSA 1O5OA 1O5TA 1S2GA 4DR4B 1MG5A 3GLGA 2ROQA 2RHRA 4KE8A 3FVVA 3T0FA 4PPGA 4YO8A 1F0KA 1X1AA 2CJFA 1NN0A 3DVRX 1Q14A 1A9YA 4C2TA 3A1WA 1I2CA 3DAFA 1HDXA 2P5UA 4C29A 1E77A 3D4OA 3WLIA 1SBNE 3TWOA 1SXPA 1FLAA 1G5FA 1H6CA 1IY0A 3KQWA 3O8DA 4V03A 1H94A 3OE7D 3C8DA 1QFZA 2A9RA 3WBBA 1XUOA 2W6ID 4JENA 2CFOA 1TVKB 2XGGA 1N2ZA 4PY2A 1OIXA 5THXA 4Z7OB 3TCKA 5JADA 5K3DA 3O95A 4ECAA 4QPJC 1P91A 4NCXA 4KI7A 3LY5A 3VR3D 4ZCTA 5EVJA 2POQX 3FNGA 4IVQA 4XD7D 3RLFA 3IQEA 5HK9A 1VQ1A 3WR5A 3KL4A 5DNEA 1W5SA 2FSVC 3QXCA 2IV7A 3NDRA 3RSHA 4E15A 1NLZA 4QOHA 5HQ3A 1U1DA 1KYTA 1SVNA 3AZPA 4UQLA 3L7MA 1PL7A 2NU7A 4UBJA 3SQLA 3ZD8A 4DDWA 5KQLA 4WLUA 1UAGA 2NUAA 3QK7A 5K0FA 1PJRA 2E4AA 3MT8A 3WKCA 4JJZA 5F7OA 2YUIA 1Z8HA 1KE1A 1R5NA 3WNVA 1MV5A 5GGYA 5C3MA 2P6RA 3LG2A 3LGXA 1UXKA 4NJEB 4ZEOA 3TGWA 1F5NA 4J7UA 3JALA 2NZ2A 2VAXA 1UKBA 2ZI9A 3LNCA 2K7FA 5TGZA 3AOEA 4NTZA 3CZ5A 3D1LA 1XWWA 5EZQA 2DFVA 4HDRA 4IQFA 4LXYA 3FYTA 3NHRA 3WB2A 3II6X 1K5PA 4HXYA 2IZ5A 3OZ7A 3SQDA 4HX9A 1R9GA 5AHKA 3I0MA 2YVQA 5HTKA 2J0EA 4C3ZA 4GOJA 5TMEA 4B6RA 3M3PA 3OCVA 1U94A 4XA8A 2XJ9A 4FCWA 4IZHA 4BN4A 1NSFA 2GH1A 4ZV4A 1JBQA 4BMZA 5CB6A 4RGVA 1EYZA 3IURA 3T1OA 3OLYA 4KAAA 1SHJA 2OBNA 2R8ZA 4CM5A 1QV9A 5T4FA 3SJ7A 2AJDA 4UHCA 4JYPA 3WMXA 2DETA 4U0KA 3N6XA 4C3UA 3ZDFA 3I9JA 1XDZA 3KQNA 4MI6A 1Y7LA 1RJ9A 1SC3A 1DIAA 1CX9B 3B1KA 2Z8YA 3CY6A 3EXFB 3F3SA 3ZGOA 3ONVA 1G5HA 5E7MA 5A04A 5KNBD 1ULUA 4IDPA 1SKMA 3GPCA 4EA8A 1ZHOA 3OFJA 1F20A 4IOLA 1S3SA 1TZ2A 3Q7SA 1P9RA 3F2IA 1Y1RA 4OIFA 3SS7X 5AVVA 1EFDN 3QG1A 3VDRA 1KOFA 3GXOA 1N2HA 4KYIB 4W82A 3UA4A 3LH5A 1GAEO 4G81A 4O59O 2RARA 3W2HA 1FQJA 2DTDA 3P52A 1UOOA 5TSDA 4BLSA 1XDBA 1ZU5A 3HLKA 2R7NA 3KCQA 2DY0A 1KK3A 1I4LD 5CTAA 4H7HA 4GE0A 4K6KA 1R0BA 4X1OA 3S2EA 3VV2A 3D8TA 1MIHA 5AQEA 4D8VA 5U9CA 5EKDA 3OX1A 4W5TA 2C4KA 5THQA 4UBKA 3BE5A 4NCKA 3WRWA 4EF6A 4KSCA 3SC2A 2OBLA 5K7SA 5IJXA 5DXAA 2GXSA 2YV3A 4WLNA 4Y9SA 3LX8A 2I8CA 3MJHA 1M2OB 3MJTA 3PF9A 4G4JA 1ISSA 2PGNA 3E3LA 2HYDA 5DN6A 3SU8A 2YJGA 4KFCA 1TIPA 4URUR 3DE5X 2CNWA 3FUVA 3UAOA 4DJTA 1QTNA 1KI6A 1FFAA 2GJ9A 1WS6A 3ZH9B 2J07A 3IHLA 4YRIA 4B3TB 3FKQA 5FJIA 2FXIA 4J9UE 2V3VA 1G4HA 1FRNA 3BL8A 4HADA 4YR9A 5LWHA 3EVBA 4CKXA 4IUYA 3S2IA 3IOBA 3KIPA 4FGWA 4JJGA 5FR1A 4KAFA 3KEQA 3T9FA 1SCAA 2XWPA 3R76A 5HUQA 4UMVA 2GJAA 1GZ3A 1UF9A 2DFKB 3BXFA 2M9MA 3DBVO 5ARDA 2C3UA 2IBMA 1YTUA 4MB2A 3VPDA 2QW8A 3LY7A 2O4CA 3FNQA 4AP9A 2PV7A 3EISA 4PGMA 1R7RA 3NQ41 4I8IA 2FF7A 1LLCA 3I5MA 5CK5A 3JATB 4QNNA 4G4SO 2EHJA 1TTPB 2VNAA 3F7TA 1U7ZA 5EWMA 1T35A 1Z9BA 4HQLA 1EFPB 1M2WA 1WZ2A 4W6QA 5K8CA 3L7AA 5HUHA 1TUBA 1QG0A 4EY3A 4JVSB 3IQFA 5CGZA 5JDCC 4NBKA 2V0CA 3B7GA 3F8TA 3QTTA 2VG8A 4MVYA 4BX3A 1JPUA 4QQRA 2O8EA 4G24A 5TQJA 2YWDA 3GPBA 1BMFA 5EXDA 4BMSA 1ZH8A 4AK9A 4PZAA 5DRYA 3ZWYA 3OIFA 3RYHB 1RDFA 2ZYUX 4H7JA 5KWJA 2ZBQA 3BGDA 1ZOOA 2C1XA 4QARA 4BCDA 1HLGA 2GPSA 3NJ8A 4OI4A 4I7EA 3UJAA 3GEIA 4CTMA 1V96A 1VI2A 2WA1A 3W9UA 5K51A 4P32A 1DBSA 3AEKB 1E4EB 3F0TA 2J6HA 3MCWA 4F7DA 3W0LB 1PZNA 3UMSA 2BF7A 2HLDD 2IYEA 1RM5A 2JAUA 1QVZA 1RJWA 4P34A 2Z09A 3HCPA 3RF7A 1XA3A 3KOMA 2R6R1 4R6XA 3U3OA 1TUBB 1KFBB 4RL4A 1QU3A 2Z2YA 2QPLA 1I1QB 3AKYA 1GL9B 1SCUA 4CCYA 4CGYA 2IUFA 2RDMA 5JATA 1YR3A 3O9VA 3NANA 4WASA 3R7DA 1NZFA 1Q11A 4C21A 3V80A 5CVUA 4DVGA 5IK2D 2QZSA 3LDGA 3LZ6A 4LNHA 3V55A 3KVYA 221PA 4I99A 4LJSA 1PVDA 3RYIB 1WP9A 2BWJA 2ZIZA 4WI1A 2I7XA 3RHZA 3ZK8A 2I2FA 2ZROA 2GTIA 3KL2A 3WK8A 2JZNA 1S2NA 1E7RA 2EZ4A 3D81A 3Q8XB 2FPKA 2Q5CA 4JLNA 4X1YA 1R0CA 5BW6B 4YCMA 4E32A 2EFHB 2EWVA 2HGZA 4CDMA 2P79A 1U3TA 3D8RA 4HKTA 3O3OB 4H0CA 4LQDA 4ZQIA 3AHHA 2EW2A 3PUHA 4Q12A 1VGVA 3KLOA 4CV3A 3ZWCA 1BMQA 4MVJI 5BSTA 4V0NA 4MDEA 2ATXA 2W6JA 4TYQA 3CLSC 4I5EA 3V4PB 4AZ3B 1VG1A 3GRZA 1TJ5A 2QE7A 2QM7A 4OQMA 4V0QA 1HDEA 1IUNA 2VJMA 4XYLA 4K0KB 1MH1A 3PCRB 5LNK6 1OU0A 4LTMA 4PYOA 2FLKA 4QHSA 5CA0B 2E2WA 3U3KA 4Z9YA 3RS8A 1WDKA 1SU4A 4XYEA 4P5DA 4JJKA 4GPBA 5JANA 3QHQA 3G9UA 5AVRA 1AGPA 4H1UA 1ZU4A 5JXGA 1A96A 3G5TA 1P4HA 4RGYA 2ZUWA 3SZRA 5JPDA 1C9NA 4ES6A 1EZ4A 4DEXA 3GG9A 1H66A 4AP6A 1KK1A 5FOVA 4Q4CA 1AGYA 3A1UA 3A9TA 4TZKA 1FW6A 1AZWA 4CT4B 4E07A 4HDQB 1E2NA 2XV1A 1J22A 3NZEA 3OWOA 4MUAA 4AC9A 3IAS1 4MO9A 5HJEA 1NP6A 4GOOD 4MR7B 4TYWA 1DDIA 3H97A 1KDZA 1F5SA 3P26A 5CIQA 4X1IB 4DB2A 4HGOA 2GEKA 2XNJA 4DNQA 2W58A 2SICE 2Y0CA 3BUSA 1II0A 3FCAA 3K53A 3W3AA 4P4UA 1WMAA 2Y9PB 4PO1A 4WH0A 5CIWA 5HKAA 2XB6A 2PX3A 3KSMA 1NI3A 1QZXA 4OYRA 3TPZA 3ZX4A 4PHCA 1GADO 1T0JB 4R41A 3O8NA 1RLIA 2VRBA 3R41A 1CY8A 3IPRA 2CXQA 2Z2ZA 4ZO7A 1UODA 5M04A 2O0JA 4UU7A 4ZOBA 1E3QA 2GI4A 2YJZA 2PANA 2BGJA 2YCBA 3D0QA 3W4KA 4BGVA 2HMWA 1V11A 1BJKA 4PZLA 4Z1MA 3ITNA 2AV6A 1LTQA 3PJGA 2PMEA 4D3XA 4LN1A 4UUQA 1WXIA 2BR4A 2BFMA 3DP7A 3N58A 1N9KA 1LU9A 3BHNA 4CVNA 4F2WA 3WGTA 4RD3A 2C03A 1IWOA 1LRJA 1UQTA 4KXXA 1K4YA 3DT9A 1F6DA 1KC1A 4EHAA 4HN2A 4P8RA 2HLPA 3A1FA 4ZRNA 5LU9A 4NAUA 1ZSNA 3OE1A 1GQOA 3L84A 3QVKA 3SKVA 4EI9A 3GCXA 1V6SA 3L07A 5KVSA 1HZZC 1GPMA 2MT9A 3P2YA 4YJDA 2FW7A 3QBTA 4GFDA 4MYRA 3R7WA 4M1WA 3VJKA 1Y9ZA 3SZOA 5KDDA 1KETA 1SR8A 1W1IA 4CKZA 1L5LA 4YUAA 4BVKA 1TC2A 3EWAA 1X39A 4KQCA 2F48A 1CIJA 4A1OA 1TJNA 1VJTA 4JLSA 2EBUA 2OILA 3MBIA 4MQLA 1GGFA 5BSMA 1X1BA 4CN9A 3SD7A 3AVVA 2C8JA 2LWIA 4KXQA 4GC5A 1CETA 4PZEA 4ZZ0A 1FNCA 3C3DA 3KR0A 3FUTA 3HZOA 2TS1A 4V3BA 4K9QA 2YVLA 1JQBA 3I2IA 3D59A 2VQSA 3DLTA 4R9RA 4A4DA 2ZBFA 4WACA 3O4FA 4XPIB 1QYIA 3DOHA 4D9HA 5BMVF 2FEPA 3O8OB 4KWHA 3DC2A 4R2JA 1OI4A 1X0XA 3I9NA 4ZCPA 1IDN1 4D5EA 1HE5A 2X8LA 3AY0A 1EZ1A 3P2OA 5H70A 1CR0A 1Z5UA 2G9NA 2OOSA 2HJGA 4LZNA 4O4JA 3ANLA 1KYIA 3ZYZA 3W5DA 3CCBA 4XWGA 4TXHA 2ZYVX 3ET4A 5A0VA 1QIKA 5EUCA 4KZKA 4BAUA 4UREA 4DM4A 3O4JA 1NT4A 4WKBA 4OQNA 4S1PA 4B0PA 4F21A 4FFRA 3KUUA 4QSMA 4YP6A 3FPCA 3MUFA 2NSLA 2PKYX 5L3ZA 1YACA 4EG1A 3VPAA 4H7PA 3B6JA 1FL9A 3KQYA 3N5KA 3QW2A 5IXJA 1H2WA 3PX2A 3TMYA 4D99A 3HPRA 1NNUA 3I2FA 3L79A 5SY6A 3ZJTA 3CVUA 3DMYA 1AHNA 1W2GA 1GPAA 2D1SA 2G1UA 3IR7A 3V8EA 1LX6A 3AVUA 3FYCA 2HSWA 4N18A 1ZIOA 3ZG6A 1T29A 1VPDA 3GZ4A 3RK1A 1YBAA 3LJKA 4NDZA 1Z4JA 1X80B 3QI2A 5I7AA 3ILXA 1JFFA 4B4OA 3PXDA 2PKXA 3HI6A 2V9PA 4U5QA 5EXPA 3W2GA 3NHUA 3FTCA 1YAJA 5EIEA 2H8GA 3EPKA 4H1TA 3M8KA 3TZHA 3Q72A 2PRJA 2R84A 2WD9A 2R86A 4BEWA 3VHXB 1XZCA 3GP5A 1VLJA 4C0QC 4IWNA 4QGBA 5A6SB 1VKZA 1IAQA 3JWEA 3KQUA 5COQA 2BEWB 1XF1A 8GPBA 5KQSA 4J1NA 1E9VA 4PEVA 2X86A 3DR5A 5ADVA 1RKUA 2P78A 3PIIA 4RK7A 1GKYA 3Q15C 4Y6RA 3QPCA 5F7ZA 1EFVA 4IINA 1DCFA 1R64A 3FDJA 3W3ZB 1QO0D 1VKRA 4KKVA 3FYHA 4XGRA 4YRJA 3MT7A 3SQWA 2CW5A 3VPGA 4BECA 5G02A 3OY2A 4Q48A 3UGKA 4Q9DA 5K8VA 1E9AA 3AYXB 4RF3A 5CLIA 5J1TB 1JQ5A 2XCTB 2EKQA 4M1SA 1LDBA 3D43A 3WLAA 4OAQA 3KXKA 3BMXA 2BL4A 2AQHA 2GZ3A 3HGMA 4BB9A 4BFSA 1W5BA 4R2HA 2WE7A 2BSQA 3E03A 1Q74A 2VJOA 1RYBA 1BVUA 3KCNA 4YRQA 4O4IA 3RSSA 3D3WB 5REQB 4BAZA 4BLRA 1RKXA 4BVBA 5HZGA 1RI2A 2DM6A 3NEYA 3L0CA 4DA9A 3PJEA 1H05A 3FLMA 3SZLA 4MKZA 4CEJB 5EE9A 4LRXA 1EUQA 2J7KA 5BN4A 5F9FA 5CJ2A 1LF0A 1ECBA 3DL7A 4NBRA 5A3QA 2BDTA 5IJ9A 2QX4A 1V16A 1GRRA 1B0AA 3S28A 1DXQA 3LUPA 2Y9MB 1N5KA 2BD0A 2XRYA 2PT7A 3DXZA 3OEWA 4MTLA 1ETUA 2O0LA 3KQPA 4RZUA 5HUJA 3DKRA 3IEPA 1C8LA 3BPSA 3PFCA 5EQFA 2VK8A 3QUTA 4N1AA 5JCJD 2GYUA 2LKCA 3LLCA 2WYUA 4DUGD 4G23A 2Q5QA 5E0KB 4F3TA 5A5GA 3L7NA 1H42A 1JRLA 4M49A 5CCXA 5C7YA 4RPJA 1QTQA 2IYSA 4C4PA 4IZOA 1BU8A 4L73A 5LLTA 2AF3C 2EKLA 1USGA 4G37A 2GAJA 2HMSA 4RZSA 1NJGA 2YC2C 3CF4G 4EMBA 1Y8RA 1QXSA 2BMWA 2QL9A 2QN1A 2EX4A 4FW8A 4HMOA 4DB4A 2GNAA 3M49A 1VSQA 3C97A 5H3HA 1CB7A 3JRWA 4NCIA 3DEAA 3I6IA 4PLPA 2N46A 2JBWA 3ZOKA 2AEMA 3EMKA 4YRNA 4NQZA 4FCCA 1YR2A 1QCZA 2R4QA 3FVWA 5ENVA 5FCDA 3TM4A 4FE4A 4M9ZA 2V7GA 4HS4A 3DOFA 3ZCTA 4G0MA 1I7SB 3CVXA 4WFIA 3ZWVA 4D44A 3DHEA 4PLVA 2D6FA 3P4UA 4Z4FA 1UZLA 1PL6A 1Z4OA 2QW1A 3IO3A 4WESA 1SOWA 2CMHA 2PD6A 2R7AA 1J5XA 3PQFA 3ZU5A 1QB7A 1X7HA 2A0WA 2VSFA 1GLVA 5HCIA 5LB2A 5I4KA 3ZE0B 5JNRA 1JSZA 4JAVC 3IPAA 3DUWA 3MWEB 4RFSB 4YI3A 4KR7A 3A2MA 4UULA 3U7RA 4LF6B 2Q5JA 2O3RA 3MW8A 5LDHA 3KJHA 2FMHA 1P0MA 1T6XA 2KI5A 5IP5A 3JQ6A 2REXB 3A2KA 3MAAC 5A4KA 1NMZA 4Z0NA 1G8HA 1FRVA 3KQKA 2XMCA 1P31A 1SKYB 2XVMA 3MS7A 4DPMA 1W87A 4QDUA 2GHTA 2YVUA 1N2CA 4D9MA 3H1PA 2OD9A 3DUFB 3VH3A 1BS9A 1I30A 1U65A 4YLYA 1KZ6A 1A9SA 1AU9A 2R5NA 3DPIA 1QDLB 2PA3A 1RVDA 4NONA 4B7ZA 5HYVA 2O2HA 4BNYA 4EFLA 1N3YA 4KYUA 4HV4A 4G0OA 4LBYA 2C29D 1ADBA 4FWIB 1W8IA 4WY2A 4HSGA 3RVJA 3PKJA 1TF5A 3MG9A 5FD8A 1JEYA 2O52A 4RHTA 2WD7A 3FSGD 2GXUA 3MT9A 3UT6A 3ZWWA 4ZZIA 1BVHA 1U28A 4TROA 3W34A 1QQAA 1Y6RA 1ONNA 3NHPA 4YAEA 3SPXA 4TTTS 3K9GA 1FZQA 1XCJA 5CXXA 1FX1A 3PQ2A 4L22A 4Z4IA 1I2MA 1M3SA 2RFLA 3KHUA 4P38A 2FR1A 4Q4AB 3CX6A 3T7KA 3ZV4A 1QNLA 1HOXA 2J9YB 4TWJA 2XW6A 1P6XA 3I4LA 3RREA 3ZLBA 2AZDA 1CHNA 2BUBA 3FHOA 3MT0A 1MVOA 1BRTA 1UPTA 5KSPA 3BJEA 5LBIA 5JAHA 3RVRA 5MGNA 1JDZA 3MUOA 2GN6A 3A37A 3NVDA 1DAHA 3BRWA 3O4HA 1Z12A 1IULA 3QFCA 4E2YA 3GLHB 2V6FA 4JLPA 1WOYA 1CNEA 2YUTA 4UCQA 5L3SA 5KOIA 2CXNA 1LJLA 1SB8A 3MSCA 1LCIA 4GPZA 4K05A 4NYIR 4RHCA 5CTJA 1JVBA 4YGXB 3WRXA 4LGMA 1H65A 3K9LA 1RYYA 1JLKA 4M1KA 1XWIA 4P4SB 4Q82A 121PA 1CE8B 1T15A 1VJ5A 3W1EA 2BW0A 3ZKWA 4LXTA 2FZGA 4AULA 3FTQA 4DADA 3UTCA 3S5JA 3VR4H 3ZWMA 3HJRA 1R74A 3HFJA 3VO9A 4B6GA 1NF2A 4J0GA 5FWDA 3HDTA 1LSSA 1PUXA 5EZ5A 4CG3A 4AMUA 2IDMA 3V34A 5EJGA 1CEEA 1A82A 1UMCB 3PIDA 4DIUA 4B6SA 3WYNA 1DRUA 1O94C 1PIWA 1ZRMA 4H2DA 1NPTO 4KGZA 3U6KA 1K7CA 3N8KA 3WVNA 4IYJA 4D8TA 3MLEA 2XYRA 1FFXB 2JLBA 5I4CA 2QVYX 3HY4A 3KWMA 3LQYA 1FZTA 5C3UA 2FPIA 5IDYA 1DBIA 1FW8A 1MX3A 4DWWA 1ECLA 3ENNA 2XVXA 3QVVA 4HD8A 1E6MA 5CEJA 1XRPA 2JAXA 1I9GA 3WQRA 1NJ1A 4NMLA 3BA1A 5EA2A 3GLRA 2CE2X 3F67A 1YK1A 4ZDJA 4GLJA 2C7RA 1JDJA 2DHEA 4FU0A 2Q5OA 2RKOA 4G4SP 4C6SA 2ENUA 4F5YA 1M34B 1M72A 1K6IA 5C1IA 4FVTA 4TSKA 3TRHA 1JWLA 5AHRA 1LWNA 4HN4B 4KQ9A 5DSTA 2BFBB 4ARCA 3SKYA 1WY7A 2GF0A 3NNNA 1Z5NA 4D8XA 5C1OA 4RTRA 3K70C 2UVPB 3DSRA 4RY9A 3F3KA 4QGSA 4LDNA 5IASA 1MTZA 1XZAA 2NSJA 1SGWA 2CLCX 3KKMA 4R2XA 4RJJA 2UZIR 1ISFA 3RRMA 2V7WA 4MICA 4RQTA 1WXWA 3RRZA 1LA2A 2VCEA 4E12A 4RABA 4YWJA 4QBIA 1EH5A 2YWXA 1HRKA 5AKZA 1MGOA 1HNXB 4NY1A 1JB1A 1DIHA 1BCRA 3W6UA 2E4ZA 4CMGA 3UAWA 3KHSA 1XI2A 1Y4DE 3FD8A 3K0FB 2H06A 2NO5A 3WX0A 2H0AA 1ZEJA 5A3VA 1KWKA 1TCAA 2OFWA 2QENA 5IWAB 4DMUB 4DQVA 2EJWA 3QRWA 1OT5A 1XRMA 1RJFA 1GWNA 1XRLA 5ALYA 3Q2OA 4KQFA 3WLTA 3KD2A 4MRNA 4Y6OA 1XPRA 1WE2A 2H17A 2BOVA 2VHXA 2H1LA 4ZTBA 5EMJA 4MWBA 5LP6B 5EJ7A 2IA5A 5ED4A 4PFJA 3G13A 4P22A 1FBNA 2HUNA 4UFPA 4R84A 5DTRA 1NXTA 1VPEA 2CVPA 3WICA 3KTFA 1IN8A 1N0HA 3WKEA 1M1YE 1HV8A 5LL6P 4WXMA 4B44A 4TV9A 3C87A 5EMMA 4PSVA 1OYYA 5B7GA 5JSUA 4Z4GA 1GUAA 2CGEA 2D4AA 2D5BA 3DMHA 3IUMA 3L6EA 1K0FA 4G9GA 5JS2A 3V4SA 5MF6A 4M0DA 4MKGA 4KKXB 4ND3A 1NNLA 4PHFA 4Y2GA 4RD1A 1D6NA 4B3FX 1YJQA 3W8NA 2HCBA 2JANA 1Q0ZA 3DFFA 5EEHA 5FNVB 5J4HA 5KVAA 4QUIA 1M0WA 2V3CC 1FSGA 1I1OA 4Z4CA 2VYFA 2WMDA 1T3SA 3B7WA 3Q3VA 1ONOA 4O63O 1W581 3GEEA 3SJZA 3NHMA 5CH8A 2HV9A 1ES9A 2KB0A 2Q6VA 5JD6A 1MHPA 5TT1A 1M6VB 1AK1A 3WWPA 1I5OA 3PPYA 2BN4A 3G2IA 4BMCA 2XGOA 4LYJA 5DNAA 2DTXA 3RC2A 1R50A 5DM4A 1ISPA 2IT1A 1T5TA 3M4NA 5L3QB 2QRGA 2ZSFA 3B2NA 4G65A 1C9EA 1TZJA 1XJWA 1Z8NA 2BHLA 5A4JA 1Z0KA 2FP3A 3WSTA 2DQ4A 1C3LA 2JCVA 1RXWA 2IHKA 1ZY2A 3CLTD 4H7FA 1TQ2A 4DT1A 2HMTA 1JMKC 1QZ3A 5FKJA 2ALJA 2W6CX 2PBLA 4F72A 4KDEA 5AM0A 5ALWA 3SR3A 4GP6A 2Q2WA 3OX3A 4YVFA 4MHTA 5AM2A 4LFAB 2Q4RA 3NVMB 3EPRA 4I19A 5EUMA 4AKSA 2PM8A 4FX5A 3HGTA 4GM0A 6ABPA 3EVEA 2O7QA 3LPMA 1I2DA 4D9BA 3HXTA 5BQ5A 3PE4A 1C30B 2J6CA 1K8YB 3K9NA 4WZZA 3WXMA 3FVTA 4ZT3A 3RC8A 1K7SN 2OBMA 1H0KA 2IFTA 1OHHA 4DWVA 4ZREA 3KE8A 2CXTA 2ID8A 1Y4AE 5M34A 4MP6A 4D4MA 3TFWA 2O2JA 2PL1A 1VMEA 3L9XA 3ZNPA 3NNDA 2KE5A 4AJ4A 1R5BA 1VHDA 2P4QA 3B53X 3OCZA 5CW2A 3MAJA 3REGA 4EY6A 4NEQA 1NBAA 4D45A 2HF9A 1W19A 4IOJA 4LIPD 4HQNA 4ADSG 1J1ZA 3CLUC 5TIIA 1XDSA 4M87A 2Q4BA 3TZLA 4C5AA 5BV2P 1LW6E 3KOUA 2GNOA 4Y2RA 3WGQA 3FOWA 3IDZA 4G5FA 1YKSA 4AG3A 5ADWA 5BYAA 5LN1A 3O75A 3GCZA 2AS0A 3WGKA 1C0LA 1JZQA 3C3PA 2Y0EA 4ARVA 1S9DA 2R62A 1Y5NA 1UPCA 2GZ1A 2XEXA 3Q5EA 4QEDA 3VVBA 4ZCRA 1GAJA 3L7CA 2JKZA 1KAHA 1ZSVA 3CZRA 4ID3A 1JNYA 1G66A 3ZH2A 3BFVA 1F14A 3T35A 5BV1A 4LBWA 2UUCB 5LR6A 4IF4A 5AOCA 1QUEA 4TKZA 3ZCSA 5EMKA 2X58A 5MFPA 3PNPA 2H5JA 2WUWE 4TLEA 3FX2A 3DHVA 3QXJA 2PZAA 4GXNA 4H60A 4K9MA 4PO9A 3RKSA 1YU6A 3P9XA 4RTLA 4R71A 2G04A 5ECGC 2VZLA 2SECE 5H0IA 1JEEA 5JIBA 4Y0NA 1AOXA 2CDNA 3C6BA 3G1UA 1FS5A 2Z08A 4U2DA 3REOA 1BHSA 1G2PA 1P2UA 1PBTA 1RAAA 1TZBA 3BQ9A 5T6MA 3RU3A 1D4AA 1C9DB 1Q12A 2PSEA 4EUNA 1X8LA 1AHPA 2B8TA 3EGDB 1LUAA 4HOYA 2YRXA 2IY8A 3H5TA 5BOVA 1OH8A 3F9IA 4NFSA 2B61A 2IHNA 2J3QA 3LFTA 4A8JA 2JBHA 2JD2A 3MTQA 5HQJA 1QIJA 4F2DA 4Q7QA 2VPYA 3C8HA 4B71A 3FGZA 1TVKA 2ONKA 4ZIRB 4JKOA 1DLIA 1JAIA 1JR2A 1I3MA 1UT8A 3AI3A 3GV0A 4K8OA 5TR9A 5F64A 3ZOZA 1J8YF 3PC6A 3KLBA 3PKIA 4EG7A 4TWRA 1IN5A 4UVDA 5DIFA 4EJMA 3Q6MA 1GUZA 3OQPA 4QUGA 4XGNA 4FKBA 5H9VA 2X3YA 4IY1A 5B1HA 4C0WA 2QYOA 3LI2A 3KX2A 1A9QA 3STYA 1EWTA 4N5NA 1T5BA 3LC1O 4JCCA 2AI1A 4FWBA 4ZVLA 4M0CA 3HB1A 4MPPA 3T4PA 4TLDA 5KMGA 1UOEA 2IP4A 3LA8A 4FB5A 5KSZA 1UWKA 2B1JA 4WOJA 1U2DA 4M7WA 3AJRA 3K6SA 9MHTA 4HRAA 1O4VA 1RI3A 2G0TA 5BN3B 3B1WA 4WK6A 3C6MA 3TR0A 1PZFA 2F43B 2PEZA 1QGUA 3Q9SA 4XFDA 4CKBA 4B31A 4FFWA 5C37A 3U0VA 4XVUA 4Y6SA 1AK9A 2FWBA 4WKOA 1XMQB 4J9VA 5CG2A 3L93A 1ENOA 1ZXXA 2I3GA 4HJXA 3R3HA 2CN1A 5ALDA 4LI3X 1Z6AA 5EN4A 5LNK1 1YONA 1K27A 1YS6A 2Z1MA 1J24A 4DDUA 3U7FB 3C4JA 2LVBA 2EQAA 3WMGA 2QL5A 3IDQA 4ND1A 3C3JA 4PSDA 1RAIA 1VJRA 2ZRBA 4KK4A 4D9GA 3CKYA 3H5RA 5EIBC 5ARCA 1ZH6A 2NZ8A 5BNIA 3IMKA 3DKVA 3KZMA 1NKSA 3AO0B 2X76A 4LDZA 4KXMA 3O4RA 3P45A 4JUDX 4ZFNA 4H6PA 5ER6A 3R3YA 4OAPA 4IDQA 2BSAA 2FLVA 3A1CA 1KEPA 1DC8A 1TA0A 1RQ2A 3EQ2A 3G8BA 4GPAA 5SZHB 2AEFA 2Q3BA 2W2PA 3EFOB 4QXMA 5DX0A 1LLFA 4U8GA 3NTOA 4CUZA 1RI1A 2C9DA 1BC5A 2P2DA 3T41A 3T9CA 1GZDA 1QFSA 5JH7B 4OI0A 2FSIA 5CM8B 4AI6A 4MEBA 2XZPA 4Q1BA 3FOEC 3JASB 3GYBA 2VSQA 3DB2A 1EINA 2FW9A 2CSXA 1OZFA 4YFYA 4QVIA 2ZBUA 3ANYB 1QVVA 4ENVA 2H1RA 1VLLA 2VYVD 2XQJA 4TXMA 4EKGA 2GN1A 4MDHA 4MQ5A 2LE0A 1TYCA 2RIRA 4MCJA 2R8YA 3OE5A 1BW9A 2J6IA 3K72B 4CV0A 3A1VA 3JQPA 4PU0A 5KC9A 4JB2A 1TTHA 2GK3A 2R4UA 4O2AB 2PSDA 1V1MB 4WX2B 3L1JA 1N7JA 3IP3A 1CUWA 4CQNA 5LBTA 1XPUA 2FA9A 3ZDAA 1XLWA 1MO4A 3RIHA 5G4KB 1RQRA 2R8PA 2WDZA 2YCLA 4JJ4A 1R4NB 5SV2A 1UWVA 4QU8A 5BT8A 3ND8A 4WLOA 1F51E 2A30A 4DSTA 1PFKA 3RKUA 2NO4A 4LMPA 4EBBA 5LQSA 2QUHA 3EYAA 4UEKA 2B4QA 1GA1A 1Z6PA 4C0KA 1ZONA 3U4QB 1RJDA 2ZR7A 1HDZA 3CR8A 3GMTA 3CLRD 1U1EA 4HWOA 4EENA 1Z5OA 4YAUA 5L95A 4M46A 4FQ7A 5DRTA 2PFGA 3FDZA 2DJIA 2HGSA 2SCUA 2OLEA 3E8XA 2I0FA 1PR6A 3H11B 1CUGA 1ST2A 2FEWB 4ZVTA 3X1WA 2QUJA 2MWMA 3JD2A 5DM1A 2QIOA 2XITA 2OBXA 4Q24A 3KHTA 3NHLA 3UT0A 5IN4A 1P1FA 5JROA 2FFBA 2E89A 1ZCAA 2PX0A 4OMDA 5TB5A 1VMIA 2VLBA 3GW8A 4URXR 1XMXA 3IA2A 2RGXA 3NBYC 5K01A 2DWUA 1TQHA 4XI9A 5FWAA 2GEFA 4OP2A 4LRQA 3JAKA 4MHSA 521PA 4Z3OA 5JISA 2BTOA 1XZKA 3I58A 2Q5EA 1T6YA 1N3LA 5AESA 1YB2A 2J3IA 4G67A 2FJ0A 4U2CA 1OBCA 1HQYE 4OGWA 2ZJOA 1BD3A 1OLUB 4DCPA 3DYIA 2AB0A 4ESVA 4V1CB 2WF6A 1JPNA 1NJ8A 2OHGA 5PGMA 4A1FA 2XMPA 3LLSA 1PRYA 5TPWA 3AVYA 1I7QB 2PRZA 2ES4A 3AP1A 3HCEA 4YP7A 5KIAA 1WLYA 2CUKA 4IIFA 4BY9E 2VZ8A 1N5DA 3V8MA 5BXQC 3BXGA 5D2CA 1ENYA 2HDNB 3HADA 3NTQA 3KE9A 4E03A 3EUWA 3T3NA 4BUCA 3KT8A 4NCBA 1T8UA 2YC4C 3TEJA 2C2WA 3CB2A 4AZ0A 5LWQA 4I1UA 1GQRA 1KFCB 3VJRA 2WLSA 4MEJA 5DIZA 4BFCA 4JUCA 2ONJA 2Z5VA 2JLWA 3V97A 3UJ6A 3N2GA 1QS0A 3KZOA 1WB5A 2ZSBA 3B5EA 4ESEA 2A6PA 3DL4A 3I83A 4A7PA 3MHPA 3PC4A 5F4ZA 3FWYA 1L8QA 2KMLA 1YQQA 2EC5A 4PE5B 1ZFNA 3SIXA 5I4IA 2QN8A 4I5FA 3N59A 5IG2A 4WECA 2FR0A 1WPRA 3EBLA 2VC2B 4BJ5A 1VFNA 2QRPA 2YJ6A 3MINA 4FHDA 4Y9UA 3NTUA 2OGTA 1BHJA 4A10A 5I6DA 5E1MA 3PNBA 2YZKA 3JARB 2OOKA 5JAOA 6ADHA 1RRMA 3D7NA 2W6ZA 1MAVA 3WK4A 1CR4A 5ALLA 5I9BA 2IYYA 3RSQA 4XUGB 2WPDA 4EITA 4ZD6A 5JW6A 2X8AA 1ZH0A 4R1NA 4QPZA 4L1KA 2GLTA 1TIKA 4DDMA 4C0JA 4M7PA 4ZKDA 4JA2A 5EJ9A 2H2FA 5SZIA 4KQGA 1GGVA 1CZKA 3U17A 2CHVA 2PL9A 4QIHA 5AW8A 1PI3A 3FRJA 4FSDA 1N77A 1AMNA 3HXKA 2WF8A 4H1HA 1MD9A 3KB2A 5BO5A 2HMVA 4P0PB 1VSVA 2FK8A 3QKWA 4F8JA 4R0NA 2V54A 2ZRFA 4S1VA 2RMKA 4S2UA 4UOQA 3RVDA 4X6XA 2PS1A 3IP7A 4PM4A 3EGXB 1L6RA 4WFQA 4ND8B 2YMLA 5SYNA 3TZ6A 3DBHB 1P1RA 3DAGA 1XG5A 1J0DA 4CMEC 1G1MA 2PH1A 2PVCA 2NO7A 4MW7A 4U8HA 3TUJC 4BUJA 4PFKA 4F3YA 4IV8A 5IDQA 3F5FA 5B1YA 3S5UA 4C6HA 2Z8XA 4EABA 3RVOA 1CNMA 2XLCA 1Q0SA 2AN4A 3VOBA 2ZEJA 3K8ZA 3ITKA 5EP2A 3SSOA 2ISSD 5IT9A 3STHA 4A3SA 3AGQA 2GLUA 1M5TA 2VZEA 1P3Y1 1X9HA 3SCZA 5B64A 3QSYA 4MRPA 3QMWA 3H3XA 2WW8A 1N5RA 3HJUA 4X7BA 5DNDA 1YQUA 4LCBA 2I6TA 3IQIX 3LDHA 3T1HB 1SZCA 4QPCA 3GCWA 1YZLA 3E0XA 1DARA 1HE1C 3V7YA 2IHJA 4IOMA 4FGKA 3GB9A 4URWR 5CDGA 2BELA 1VB3A 2R97A 2L19A 3U3RA 4IO0A 3PDCA 1O0SA 3LXUX 3FKJA 5LA6A 4AURA 1JDBB 4YJ2F 5IJ0B 3DBHA 5B2FA 3C5WP 4TKMA 3FIJA 3C3EA 1B16A 3HCOA 3LT2A 5IUKC 4JP2A 1T3TA 3WQQA 1PSWA 2W70A 2XUQA 4DYHA 1SC6A 3PFWO 4JVNA 5DTEA 4EM6A 4BFYA 3I72A 4G85A 2O3TA 5AVUA 3I5AA 3TUZC 4PZ9A 1WCYA 1B6TA 2I3BA 5BV0A 2X3FA 3UXEA 5IUNC 4LA4A 4E14A 3C74A 3ACDA 4LNAA 4MQFB 3PVCA 4REMA 2C3MA 5FFFA 1WRBA 2ZWIA 1DFIA 3I12A 2WJWA 3PRJA 4C0SA 3KYCB 2FZ5A 1U4NA 1B8OA 2CHQA 3N8DA 3KNZA 1W1WA 4AXXA 1WTAA 2EU8A 1D1SA 2A9PA 3D8BA 3SXUA 4ZZ1A 5JZ9A 2EJTA 3IODA 4KXVA 4I4NA 4MWTA 4NH0A 4FTWA 5D87A 1PR1A 2G5TA 1D2GA 3L4BA 1BA2A 3GJRA 1RMTA 1R9MA 4OH1A 4W4TA 2XTZA 4BQNA 4WNYA 1DIOB 4W5NA 2IITA 4MMXB 5C31A 3TBHA 4ED9A 3T4XA 3JVIA 1EG2A 3BD6A 3NYWA 1U2GA 4B2PA 1C4KA 1QOPB 1EP9A 4I50B 2DSNA 3MCTA 2OMKA 4OYHA 2YBEA 4W1RA 4L2IB 4LF9B 3BRQA 4AM8A 3BD8A 1ODSA 2PS3A 2A5LA 2HW8A 1J39A 2AXEA 1XCLA 4KVZA 4L72A 1J5PA 4A8HA 2CYCA 1G60A 1IN4A 1A8HA 3GG2A 2NQ2C 5J2TF 2NO6A 3USZA 5ADHA 2UVDA 1PZXA 1W5AA 5P21A 2GXAA 2F4NA 3ASZA 1TYAE 3FTDA 5F3DA 4MR9B 2VA9A 1M6VA 3E82A 1CY4A 1K75A 1A4XA 4JLJA 1IZ0A 2BJWA 4BXOB 1E8NA 3VOTA 1IXRC 2JC3A 2Q3EA 1NUHA 4BLPA 2VEOA 3CEHA 3TH5A 1QE0A 2GUWA 4L85A 1N4AA 2QQ0A 2CMGA 2JPDA 1PT8A 2IS6A 2ZI3A 5BOSB 4YDQA 5FPYA 1G21E 1VRVA 3PC8C 5EE0A 3QJYA 1IAVA 4ZO4A 4J0EA 5CCEA 3ZW9A 5J2UF 5L7TA 3PL5A 4IRUB 1AXRA 2IF0A 4L0DA 3RTEA 4D7AA 2XZDA 3OQVA 5IKMA 1MJNA 4G0NA 1PLKA 3KTOA 4K6HA 5EZYB 1GTG1 4A82A 5KYUB 1MP0A 1DWQA 1LC3A 2RAPA 1M0TA 4N41A 3STVA 4M54A 2Q21A 3TS1A 1KS9A 2PXHA 1IBCA 1GGMA 2WHPB 3CEPB 3NHKA 1BHQ1 1BOOA 3H1BA 4FHFA 3SEZA 4PXAA 3IULA 2ZJBA 4JL5A 3GLTA 4IGKA 5BWCA 2ICAA 4RTJA 3WGNA 1G2OA 1M83A 1D2CA 4QZVA 3VR6H 3OMXA 1T3HA 1ITZA 1C14A 4JVOA 1JG1A 2P40A 1L7OA 1JKJA 3ANSA 5DYTA 3STUA 2HFKA 2YYZA 5DGCA 4L75A 1QIGA 3DCNA <