1S3FA

Purine 2'-deoxyribosyltransferase + selenoinosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
165
Chain Sequence
b'MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine trans deoxyribosylase
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
total genus 50
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s3fA00
3PFKA 1KZHA 4JELA 4I7EA 1WEKA 3OPYA 1MTOA 4FYKA 3O8NA 2KLHA 1ZXXA 4KXNA 2F62A 4I36A 2F64A 4HX9A 4RH3A 3O8OB 1S3FA 4LJKA 6PFKA 3UQZA 4KXLA 1RCUA 2PMBA 2Q4DA 4JENA 2NX2A 4MCJA 4FYHA 3QUAA 2A0KA 5ITSA 4LJRA 2F2TA 4I4IA 1F8YA 2PFKA 5AJTA 3MAJA 1S2DA 2F48A 3O8OA 3OPYB 3SBXA 4LJLA 1S2GA 4PFKA 2KHZA 3HNOA 2IZ7A 1F8XA 1S2LA 2IZ6A 4A3SA 1PFKA 4FYIA 4JEMA 2A33A 1S2IA 4KXMA 2F67A 1T35A 3GH1A 2HIGA 3U39A 2IZ5A 4MEJA 4P5DA 4OHBA 4U1RA 3EHDA 3K2QA 5AJUA 4P5EA 3O8LA 1YDHA 3IMKA 4WL0A 4OHRA 4NPAA 3BQ9A 1WEHA 2Q4OA 3F5MA
chains in the Genus database with same CATH superfamily
1MXFA 3ELYA 3OLYA 3ZWKA 4LBZA 1K86A 2FWRA 1WP4A 3QBDA 2IUFA 1X38A 1GAXA 1JAXA 1E3QA 1V8DA 4QPCA 2ICAA 2AW3A 3VYUB 4DCUA 1CE8B 1ADFA 2MSWA 1SJ9A 4BTVA 5TARA 2XVZA 2RD2A 1KMHB 2F9MA 5DP2A 5F35A 2BYTA 3SIXA 4EGSA 3PFGA 3G5TA 4B3FX 3H5AA 4BQFA 4CM9D 2OORA 1USUA 3KJHA 4IOJA 1Z37A 5LQRA 3W6PA 3NX4A 1VE1A 2CDCA 1R8QA 2ZT6A 4CTNA 2GBFA 3IUEA 1RABA 3NATA 4BTLA 1WDMA 3NV7A 2WKWA 1B26A 3F96A 3M4YA 4FN5A 4CM9A 3ICVA 4LISA 4LX0A 2IEBA 3JQAD 4W9NC 4HLDA 2HUNA 5JALA 1NQTA 1ZCBA 5KYYA 2VXOA 3V1LA 3TAXA 2DR2A 1VRWA 1QRRA 3HSYA 4EHNA 1NI5A 1UP7A 2VSQA 4G37A 2DKOA 2ECQA 2QUKA 4HAYA 3EULA 5E7MA 2WJZB 5FWXB 1QF6A 5JJIA 4B3GA 3PNKA 3GXBA 2VZ0A 5A5VA 1V5EA 3DTNA 1HH4A 5C5IA 5FTJA 821PA 1EVKA 3SXPA 1G8GA 1DXHA 1Y34E 3D1VA 4LZZA 4L50A 4V03A 3OZIA 2ONCA 5IWAB 1XCBA 3EIWA 3WISA 1NVDA 3ZDFA 3GH3A 4BNGA 3N2LA 1V8OA 2FSHA 4RZHA 1VXOA 3V34A 1G6KA 3ZQKA 1RXUA 1XDSA 3P0FA 4PEVA 1HEIA 2Y1OA 5JXGA 3ZV6A 3A04A 1X3LA 3GRZA 2BUAA 3LCVB 3AP3A 1EBBA 2O5EA 1E5VA 2QXUA 1D2GA 5CT4A 1H94A 2ISSD 4BNHA 2OV4A 1GTJ1 1V8PA 2NAPA 3T4UA 4YDHB 3O4JA 4CMAA 2H54A 4WNAA 3G49A 2C97A 2FPIA 2WT9A 4Q37A 5H80A 3UHOA 1P9WA 4NYMQ 4I5DA 1C4WA 1C1DA 1JRLA 1IU9A 1RYZA 2JGKA 4NOKA 3F3YA 5IJAA 3BS4A 4IXDA 3KIPA 4XVHA 1XELA 2FETA 4L8FA 2Q1SA 3UGTA 4BMPB 3KVOA 4G0YA 2C5HA 1IMJA 3G2OA 4D8UA 4DLSA 3C6ZA 4R9UC 4ZTUB 2EHDA 4YCAA 3R5TA 1OFUA 3IAFA 4MDFA 4MQEB 1KQPA 2WF8A 2L17A 1H2YA 3O4VA 4HC4A 1DCMA 2FJPA 2QZZA 3DOJA 3O93A 1NLFA 3ZCXA 5EP4A 3WAGA 5I7HA 4MUHA 4AVYA 1GUAA 4XUGB 4ZK2A 2Z4SA 1EMDA 3U60B 5I8WA 1BAPA 1LDMA 2VIIA 4AG6A 3WDMA 4CKCB 4QRHA 5LXTB 4GDFA 1G2IA 1JU9A 1MT0A 3KV3O 3OKPA 3HFJA 4UAJA 1XKXA 2WYHA 4H1WA 1VL6A 2ZBUA 3KYJB 1GUDA 3RBVA 2B4QA 1PYGA 4AJIA 5IP5A 5B3JC 2L69A 2GXUA 5BN1A 2UXCB 1CR6A 5TSDA 3HXQA 1CUDA 4IHAA 4RH0A 5JOQA 3SZLA 1DBIA 1T9GS 5H4GA 1NVMB 3B5JA 4D4IA 1IVNA 2HLDA 3UUGA 4TV9A 2FX3A 3BIJA 4RX1A 2B92A 2WTNA 3QOYA 1MZPA 4RORA 5HZHA 1RQRA 2CVZA 3NP7A 3IIJA 4OLJA 5DBHX 4AQYB 2QLJA 4ISBA 4D43A 1M2KA 3K6KA 2CFSA 2OO7A 3D1LA 5A3RA 4N47A 4MA4A 5AOAA 2X2OA 3IO3A 2ZB7A 5D8DA 4YRZA 4P35A 5LB4A 3CUTA 1U4NA 4A73A 3LIPA 4I08A 4J0IA 5DXJA 4C0JA 2J3MA 3H4IA 4KJXA 4CTMA 1P62B 1G9XA 1Q1EA 4Q39A 2ZIVB 3F1LA 3LXUX 3EVGA 1ZHFA 3I0MA 2C2WA 5EP1A 4CMHA 1O77A 2GYWA 1LLFA 2XNCA 4L15A 5A3JA 1BH2A 3DO8A 2QRGA 4MLCA 4Z2AA 1E4VA 4OX9B 1ST2A 3CWCA 3B52X 3WMRA 4URFA 1BE8A 2DF8A 3HUFA 4LJKA 1JXQA 1THMA 1JHMA 4U3JB 3DC2A 4BV2A 4IDGA 2QD2A 1XDBA 3MOSA 4TQ9A 5IKXA 4ZA2A 4ARCA 2AMLA 4UKDA 3IVAA 2NSLA 2QTAA 3A10A 3GB9A 3PT5A 1OZGA 3FFXA 3K8ZA 2BONA 3W8NA 4E46A 5JD6A 4B6EA 2WJAA 1NC3A 1XZKA 4H3SA 2A0KA 2NLOA 1Z13A 2HQOA 4BQPA 4EF4A 1KYTA 3ORHA 5JASA 2L18A 1E4EB 1QP8A 1RLTA 3A1WA 1HT1E 1EP1B 5JH7A 5CLFA 1T36A 5LMNB 4P6VF 1BXZA 2NQTA 1J9GA 1B4DA 1QGDA 3E4CA 1KFJB 3DHWC 2C0QA 4HQNA 4RMGA 4KXYA 4EY6A 4KQFA 1JWLA 2J9YB 3V8BA 1YCHA 4II3A 1EIZA 1T3GA 3ZXYA 2C1XA 3NHJA 3GDOA 1PV1A 2NU6A 1G98A 4PFJA 3TD9A 3PUZA 4G0VA 4DYDA 1M8JA 3P9IA 1CYEA 1XN4A 4O4HF 1K75A 2O8EA 1JIVA 2QI9F 1PG2A 4OM8A 1U2RA 2LWIA 3GW8A 2B3TA 3HB9A 1TDJA 1ISIA 1EG7A 4KIFA 4DRXA 4F3TA 5BQPA 2PR2A 3F6SA 4KWHA 4EKEA 5L4SA 4FN4A 1KS2A 1W34A 3JR3A 4QBGB 2J59A 4UPDA 4FUQA 2HRBA 4YS6A 4RA9A 4C07A 4C0QC 1QIMA 5CR9A 3O4FA 3QXSA 4UTVA 1AKEA 2ZB8A 2IPAB 4U9HS 4PG4A 1GPJA 1VG0B 4BKMA 2FPOA 3B7WA 1PGJA 2BGKA 2JKZA 2OZPA 2FSIA 4RGBA 4H60A 2Z6AA 1J8VA 1G66A 1Y3DE 2B4RO 4FXPA 1QAQA 4G9BA 3ZJ4A 5JNTA 3G8YA 3H2JA 2YS7A 4H9GA 5P21A 1XVTA 4MVJD 1CU1A 3COJA 5EAIA 3A6JA 5FNVF 3RS9A 3KAJA 1C0KA 1SOVA 3CUEF 3TRFA 5TVGA 3SKVA 1NE7A 3SKXA 3QI2A 4FMCB 2HPZA 4I2NA 1X87A 2GWHA 2H85A 3E1SA 4OAPA 2PY6A 2CDRA 1H0HA 3LNCA 3PE4A 2JW5A 1V7PC 4IDOA 2IWRA 4D9MA 2FDXA 3KFLA 4YBRA 3TIGA 3R4CA 5KKCA 1RXSA 2XB9A 2RHBA 5ALLA 1D3AA 1RPAA 1BS2A 1FRZA 3OKCA 2FH5B 4I81A 4BMYA 1DG1G 1TT7A 1E6CA 3AEXA 1ADGA 2DZDA 4C03A 5K99A 3BXPA 4LNAA 3TZHA 3S40A 1M8GA 1OTYA 1TRHA 3IALA 4MXDA 4PXSA 4Y18A 2ZIUB 5LZ2A 3AJDA 4C4ZA 3ESQA 4OH7A 5IX8A 3GUZA 2IUYA 3UQYS 4HRYA 3ZZTA 1N2IA 3ZHRA 3S55A 4US2R 2IS4A 1ORTA 4ESVA 4BJ1A 1DC3A 1T8YA 3OVMA 1MCZA 2H4YA 2WD8A 4D5GA 1I3LA 2MSKA 3G1TA 3FSGA 3LA8A 3DULA 3PBKA 3CRVA 5J40A 3QYJA 1SRQA 1WSDA 1K6XA 1N0WA 3DMTC 3ABIA 5L8VA 5JFGA 3H8SA 5JDIC 3C3MA 4K5QA 1Y63A 1DXQA 1LI7A 2MSEB 2OO5C 3GDHA 3LSTA 4MS4A 4BFYA 5C31A 2QY6A 2R7KA 4UE6A 4R3WA 5BMVF 5C1DA 4L7VA 2K6GA 2XQJA 3F7MA 4GMDA 4RPKA 3OI7A 2POCA 4ERNA 3T5GA 1XCLA 4Y7CA 3WYAA 2FW0A 4IIBA 1GTRA 1DKMA 1LX7A 2BHRA 2WY2D 1C7EA 2IYVA 2WG2A 3SSAA 3EFHA 1Y3FE 2DR3A 2XSZD 3M6IA 4E70A 2AUMA 1J90A 5AK3A 1O57A 1KU6A 1K7YA 5BN4B 3P9QA 3QHAA 3UUWA 4BU0A 4UNRA 5B5SA 5FH9A 4JA0A 4HLUC 4RPLA 2UV8A 4G41A 1V9CA 3VU1A 3BC1A 4CQNA 4C0AC 2JJ1A 3E22B 2O8VA 3H5VA 3OJEA 1LLQA 5T3UA 4GYKA 4FQ5A 1SGWA 8ADHA 1RWWA 3BD8A 4TWIA 1Y8QB 4HH4A 1Y7PA 1YS2X 3CJTA 1N2CA 3GROA 4JT9A 3I04A 3UG7A 2P90A 3PR1A 2WSMA 3BVPA 3KEMA 4UBKA 2AZXA 4JN6B 1EWQA 2QP3A 3UICA 3WS7A 1ZJZA 3OMXA 3P2KA 5HK8A 1XNRB 2BSQA 5E3IA 2FJUA 3MTAA 4MV5A 1XKTA 3QY9A 4PLCA 2FP3A 3KJZA 3G2NA 2GLTA 1EG2A 2A33A 1J5XA 1GZUA 2PJDA 3GRKA 3I9NA 1X1BA 4OBEA 3TSZA 5C7OO 3MGKA 3WHLA 2VCEA 1X2BA 1UC5B 3TTXA 4DDUA 2H0AA 2XKKA 1E7SA 1XD2A 4RZ2A 4V1CI 1C8LA 1F2TB 3ULKA 2O5CA 3BWCA 3H4TA 5EWJA 3H5OA 5DYTA 1OZFA 4K9NA 5LBIA 2XMBA 1VJRA 2WKPA 1EGQA 2Q6LA 4HQKA 1HM5A 1RXEA 2JGIA 2EQAA 4UEQA 4X94A 3TUJC 4RTOA 4P5DA 5FPSA 1G5QA 1FNDA 3PQ2A 3PGA1 4NESA 4OHFA 4ZYLA 3A2MA 1SCKA 6GPBA 4CTKA 4HAXA 4H1VA 3IEIA 2X5KO 3WWZA 4BX9A 3KG2A 3AG5A 3BJMA 1AJEA 4I0WB 1XZPA 4UUQA 3RS4A 4DPKA 2BDEA 2D1YA 3GX1A 1QGUA 3O9ZA 5AJUA 1JU4A 2XD9A 5SYAA 4B7CA 1JTEA 3C16C 3AVPA 1Y5NA 3OAAD 4J0EA 1XEWX 2REOA 1JG7A 1KMQA 1FSFA 3IPCA 1RZVA 2MU1A 1HTWA 1X8LA 2YY7A 2ZR0A 3AVOA 3QKWA 3BSSA 1R66A 4HQLA 3B20A 5DEIA 1JVBA 4ABTA 5GWXA 3RT1A 3NEJA 2DGDA 4NU8X 4F4HA 3WV5A 3SLRA 1CQXA 1GNVA 2I29A 1CJUC 3MBKA 4LDZA 2Q3JA 1UBGA 4GAEA 2VP3A 2I22A 1SUIA 5CK5A 3NBXX 1XDWA 2DR0A 2GLXA 3UT5B 5K20A 4H3KB 2R751 2W7TA 3M4NA 1EZ1A 3RT9A 2J33A 4IIGA 1TA0A 1ZUIA 3I2HA 4JGBA 3VBEA 4CL2A 4GC5A 2IXTA 4L8LA 1KGDA 1E0DA 4RPJA 2WWVD 2V9ZA 1UFOA 1RADA 3EF3A 3NEAA 3R3UA 4UBJA 4MYSA 4KPYA 5LD2B 2G06A 2CSUA 2D5BA 3NJ4A 4HCJA 4LNUA 1JG6A 2QU7A 4S35A 4JUFA 4PTYA 5ALMA 1EFPB 3L7OA 4BUZA 3QVMA 2NZYA 1BXGA 1FVFA 1J0AA 2UDPA 3QXHA 5BORA 4I8DA 1JR2A 2ES4A 4AJ4A 1E99A 1U2TA 2B5VA 5JI2E 1YE5A 4PR3A 4YT8A 2NNLD 5I01A 3LUDA 3PI7A 3EXHB 5G1PA 3S1SA 2X5NA 3PGMA 4Q9JA 1B14A 1GY8A 1O3YA 1IJBA 2B25A 2HA4A 4GLFA 1JS1X 4LJRA 4Y6SA 4LOIA 3OT1B 3OE4A 3WB0A 5CEFA 5TPZA 1Y1LA 2KM1A 1HRKA 2RB4A 3NYRA 4WFQA 2ZJ2A 3ZX4A 5LQCA 3CUYA 3O31A 4JOSA 1SM4A 2WQ7A 2GNAA 3KE8A 3VNSA 2GJ4A 3LS2A 4BQOA 4GKVA 2PFSA 1Y9JA 4D99A 5IXJA 1H2AS 1Q7RA 3U56A 2X76A 4QULA 4CKBA 4B82A 2VK4A 4CLOB 1ENYA 3MCAA 3FDJA 4OFBA 1RWBA 4JJ8A 5JNRA 4FE4A 1SELA 2I7VA 2E87A 4QGBA 3UMBA 1II0A 1K6JA 1KNQA 1VCHA 4GL2A 1TA9A 4GSKA 3MIZA 1K08A 2DMRA 1CUXA 3WZLA 5A3QA 4KV9A 4DXAA 4LCJA 3IBYA 5IVDA 4BFSA 5CEJA 4S24A 2ECOA 5JNUA 5EJAA 4GWGA 2BH9A 4BMVA 4RULA 3L6OO 4LK3A 3IAS6 1QNLA 5COQA 2GJSA 4RABA 3N8NA 4E5UA 3D43A 1YR7A 4IUDS 5FOUA 5J2UA 3FNHA 2VJMB 2X6RA 3DV9A 3OTWA 3P94A 5FA5A 1ICIA 1V4VA 1J70A 3VAZA 2CVHA 1PFQA 1B43A 1R4MA 5B7QA 1FJ2A 3NAMA 1LPMA 4QQ8A 2Z8XA 3DXFA 2I1VB 4G2TA 2JFZA 4M0LA 1BU5A 3AV0B 2R97A 4OB6A 4AJOA 3NDBB 5E38A 1OQAA 3DTTA 3T7RA 1A4IA 3VU9A 2XITA 4I6EA 5JCJA 1E3MA 4F4CA 1PR1A 2VAWA 4Z1OA 4CW7A 3TPFA 4QU0A 3K1AB 1ADJA 3HCPA 3FSEA 3UW1A 4WL0A 1OVMA 5I7WA 3NDIA 1T5BA 5F1OA 4RJTA 4CEJA 1P3DA 4FDTA 1N2CE 4PAOA 3IPLA 2Q8NA 5LNK6 1R0WA 1UWCA 4TXMA 2O5VA 4IDBA 1L7NA 2HK9A 1W5SA 2JF0A 4EDHA 1G21B 2I2XB 2XWQA 3HPRA 2E55A 5F4ZA 5WRFA 1YRHA 5FEMA 1Z4OA 1U0EA 2AVNA 3WIDA 4R83A 1JAIA 2D1TA 521PA 4JJZA 4AWXA 3A36A 1V7ZA 1ZMBA 1NBWB 5GZ1A 5DLEA 1MB0A 4I3FA 3FN4A 1V48A 4MWGA 1TCCA 2QTCA 4QBFA 3EYAA 4YGYA 1U8YA 1PX2A 2ONYA 1I3OA 1U6IA 3L7YA 4B3TB 3C6BA 3HLYA 1C4KA 3SBDA 4YMHA 2O50A 3CTMA 2KLHA 2WE7A 3DV0B 3VTFA 3C45A 3JYLA 3OLXA 3K92A 4NBNA 2VHXA 1Z8HA 1ZI6A 2FUG6 1TAHA 2YHIB 2WTUA 1NLMA 1NJFA 3DL4A 4D8XA 4WLUA 1U7TA 1X92A 2RHMA 1VPWA 5BXYA 1NBMA 3IAS1 2OM6A 4INZA 4WOPA 3VSAA 5BRJA 3GFQA 4RVGA 1FZQA 1L4BA 3IHWA 4I1VA 4OHOA 5HHTA 5HQTA 1V1MB 3MB8A 2HHJA 4BNWA 2QDKA 1EGVB 5CVVA 4OSPA 3W2IA 3EQ8A 1X1RA 2XYHA 2J9FA 4OLHA 4M83A 4RBNA 5AVQA 3W6OA 4G0WA 1AUOA 3L8YA 3HR7A 5C1OA 3HXOA 1HTBA 3PA6A 1CQJB 2V3CC 3UW3A 5F51A 2V4MA 4JLJA 1E6LA 1UPCA 4R3NA 5FUWA 5EE3A 4C2TA 2I55A 1WXXA 4Y2GA 3SDSA 4KX5A 3M6UA 1YOBA 3Q98A 4F6RA 3DZDA 1CYDA 2XLCA 4HNGA 2HZ7A 4MGHA 4CHGA 3CNEA 2C3OA 2QRKA 3AHFA 1CF2O 1BWSA 1TKCA 1B8PA 1JIIA 2GPTA 2J3LA 4YC7A 5IEBA 2XXAA 3G79A 4DNXA 1JQAA 1WY5A 4KMRA 3SJZA 5LNK1 2X13A 4LHZA 1O0BA 3C8MA 1ZBQA 1SN7A 1OFUX 3H1AA 5DIZA 1S2MA 1IBLB 4L51A 2Z1DA 3PD0A 2V7VA 1ACJA 5GONB 2VVTA 3ZWNA 1NHGA 2MSLA 5IJ9A 3IIMA 4QHSA 1TQ6A 3GEMA 3J7AC 1XTKA 3DW3X 4Y30A 4BU1A 3C43A 3OY2A 4PYLA 3L5OA 3HU1A 3M4JA 1Q1QA 2VDKB 2WZCA 1P9LA 5K8UA 4DKJA 4PSUA 3TAHA 1PR5A 3WGQA 1T9CA 3GQVA 4HEJA 2NZ8A 3VSBA 2PSFA 3BMQA 4MW2A 1WCIA 1ODCA 2PVSA 1XAGA 2VATA 3GPBA 1SWVA 3OQVA 4ZVSA 1SG0A 1S3GA 4DY4A 1VQ1A 4K9LA 2ZIAA 1IATA 2G0NA 2FWAA 2HFKA 3G8AA 3JZFA 3N3AC 4A23A 4EAAA 5DTMA 5EOVA 3VNUA 1CUEA 1JPVA 1Z5ZA 1F2UB 2ACEA 1FXSA 2B1RA 2SBTA 3IJ5A 4LJ4A 3UIEA 3WTBA 3U09A 2PL3A 2O14A 1RXVA 3R9XB 3GRVA 1VL5A 2DT8A 3UTCA 2P78A 2ID4A 3GJ0A 3SEZA 1P5ZB 5DM60 1SK9A 2X0NA 3Q3JB 4WA7A 3RF7A 5BQ3A 4OJNA 4OL0A 4OUKX 4JBYA 3NWOA 3GEEA 2Q5OA 1Z38A 3SEQA 4DVJA 2XMRA 2Q9AA 4A0FA 5BNFA 2Y0CA 5LQJA 5LJIA 1QFYA 4CG1A 1RKQA 2O3JA 1QRUA 4QODA 3KHUA 1YR3A 1QBGA 4L5AA 4HQFA 4MINA 4XIGS 4XYGA 2JLRA 4V0LA 4X7RA 5DOVA 4INJA 3KOZA 5ALNA 3WJ7A 1SPXA 4BFXA 2V6MA 4QD3A 5BQXA 1YRBA 3PNSA 4FYXA 4S2UA 3H5TA 4DPMA 1NXVA 5K6AA 1I7SB 2XGJA 1D5CA 1S3IA 4HN2A 3I73A 1A95A 2E82A 3UK7A 5M2QA 2NUPA 2WF9A 3C4VA 1TIKA 1X7HA 1SHTX 5H3CA 3GRRA 4BXOB 4CIAA 2XUZA 2ZPUA 3B1WA 1W46A 5FBZA 1SUWA 1U1FA 1V37A 1QHXA 3K9FC 1UPBA 3LPDA 3QU9A 1IHDA 4O4HA 1ZYUA 4ETIA 4DR2B 4PLGA 2FMIA 1NBIA 3OECA 2DHQA 3M6VA 1KY4A 3JASA 4X8MA 3COZA 4PSAA 1Z6PA 4WKCA 4OREX 3TYXA 1MVNA 4G36A 5EI5A 1RP7A 4POOA 2FVYA 1VSQA 3AU8A 2N0SA 2OCIA 3CS3A 3H1TA 3NRBA 4LVCA 5D7NA 2PMDA 1D1QA 1C41A 2G6BA 3KUDA 4IJQA 5TE9A 4JBGA 1PJLA 4KSCA 4JR2A 2G9NA 2OM2A 3M5PA 1YTUA 2GPAA 1N2OA 4IM7A 3K71B 1DCFA 2CZCA 4X6YA 2O5RA 4V02A 1DXYA 1OU4A 1N5KA 1PS0A 2GZSA 1GU7A 4MRAA 4DV3B 3JALA 3QIAA 3PGJA 3C7CB 4U7FA 4J9UE 5FNVA 1FMJA 3UOGA 2VDLB 4C5AA 5HXAA 3BFVA 3OLZA 1SZPA 2BGRA 1O94A 2XKAA 3HVHA 3ORYA 1LA2A 4GDMA 2QN8A 5HJ2A 5HUHA 4U7JA 5JRDS 5FTKA 3CLUC 2EWMA 4XPZA 3UTDA 2J41A 3SEFA 1T9DA 3PEWA 4UHKA 2XOXA 3VOSA 4U9UA 3BQNB 4C6SA 5IC4A 4JIMA 2ZITA 4MIKA 1LD3A 1ZA1A 7MDHA 4J0CA 5BT8A 5FWYB 1NBME 2UYYA 4PG5A 4E30A 1RD4A 3E15A 4A0SA 3OUTA 5EJ5A 1AKRA 2G1UA 1Q83A 1J99A 3P5SA 4PPNA 4UASA 5DXFA 3RUDA 3CYFA 1FYVA 4DUPA 3FOFC 4RTMA 2YZKA 3D6MA 1XQ6A 4K1XA 1YZHA 2O0MA 1QF7A 1DIOB 1P80A 4KE6A 4Y2QA 3AW9A 5E7QA 1NF9A 1R0BA 4PGFA 5FPTA 4CLXA 4CBVA 3ZQ4A 3FUWA 4YJGB 1RWQA 5KHLB 3A1DA 3S2EA 3B60A 1M6HA 2JLAA 1O95D 2X7XA 3ASUA 3HXTA 1ZGHA 4MPDA 3P0IA 3ZY2A 2QJRA 4M86A 3U1VA 4BLPA 1ECFA 2JFXA 1QZXA 1YIOA 2R1TA 4NMWA 2CD7A 2H4FA 4BHTA 1EHYA 3K5WA 1CQIA 4TN1A 1OWOA 3NG1A 4NG4A 3RC2A 1E58A 1Y6FA 1WOYA 2C94A 4PQYA 5AKGA 3LZCA 2QMHA 4AK9A 4G24A 5ALXA 1GUBA 5FLKA 1K7CA 5MF6A 2I4IA 1T3SA 1JU3A 1Y6RA 3D6JA 3THYB 5BMVA 2V97A 3WLMA 1NMXA 2GKSA 1GGNA 3C6QA 1L8XA 2WNHA 4TVBA 2ZCJA 1GDDA 3WGOA 1QWSA 1KY3A 3K15A 4PU0A 4UVIA 4BYGA 4CQLB 4W8HA 2J31A 2O4UX 3AUJB 1JDBC 3DZFA 2COKA 3K6SB 5HF5A 2RGRA 3GU3A 4JVSB 1V25A 1OA0A 1SCNE 1LZKA 2Q6IA 3NM5A 4N3GA 4H7IA 4Q3DA 1TMYA 2Q45A 4YP6A 1E2JA 5HG0A 1EX6A 3D81A 4G85A 4GQAA 1AZSC 2OE2A 1KI8A 3NANA 2ZBFA 3SX2A 4A5OA 4D56A 1UQTA 2I80A 1TCAA 1SHLA 5EMNA 1RJDA 3WX0A 1WM1A 3ZWAA 2C58A 1UOQA 4DC1A 1M6EX 1U0SY 1DBSA 1IXRC 2VDOB 3AQIA 4X20A 5H59A 4YASA 1F3OA 3A31A 3MZ0A 4EUKA 3LO5A 3IQIX 1ZN2A 4H0CA 3X0DA 4BVHA 4J90A 4C20A 3SQOA 1MIOA 4QYIA 2I9KA 1ML4A 2PZKA 4L78A 1UMCA 1I33A 1ZD5A 3BDAA 2G3YA 2PD3A 3GMDA 4JL8A 3EXEA 4MIOA 3AR2A 1SB8A 4I5IA 4WPGA 2OXIA 3E61A 4YP5A 2R60A 2AXEA 4Y9UA 1XMQB 1ULUA 3C3WA 1OBHA 4YT5A 4B2PA 1N9GA 2I6XA 2KBEA 1BW9B 3NAZA 3S81A 2QB5A 1H42A 1EP3B 3G2LA 3DCJA 2IQ5A 1TJYA 3EZ7A 2Q9UA 4N01A 4YAFA 3HKEA 3V33A 3CB4A 3ZWMA 4BNDA 2IWHA 2DVMA 1W1IA 3E9EA 4LZAA 4DW8A 1M1ZA 4XRGA 2LP4Y 1GGJA 3H9GA 5KTRA 1OTHA 1PGPA 3HJCA 1XMSA 2BIFA 2EBHX 1SCQA 3HEBA 1FPQA 1PFWA 1VB3A 1XR3A 2HCRA 3T6KA 4B3MB 1ZH8A 2AJ8A 2O7SA 3ZV5A 5JSHA 5BOSB 1PD0A 3VPGA 4HZUB 2WU8A 1PL8A 2JVIA 2VH2A 3UXYA 4W9MC 2DLCX 5KQSA 5E6SB 3LH5A 5AI9A 3TBFA 1BMFD 1KF0A 3FGPA 3WL8A 4UNNA 3ZLUA 4D4MA 3T3EA 4NHOA 1ITZA 4QBIA 2JLYA 3JYQA 1Q21A 1W73A 3C3YA 4QU5A 1BVRA 3HDHA 2CJWB 2QBYB 1RYMA 1T2NA 2RC6A 3CONA 3ESCA 2P3SA 2C9CA 3L8HA 3TN7A 3MC1A 1A2OA 1T34A 4LYYA 4XGIA 4CM3A 4JXZA 2X1LA 4ZAZA 2W98A 3CB2A 1FTNA 4X1IB 2L0XA 2RHWA 3ND8A 1BHQ1 4IR7A 3TCXB 1V1RB 3DTVA 4B85A 1LBTA 8ATCA 1HYBA 5L95A 2P67A 3LDFA 1EGMB 4FZVA 4IXWA 5U9CA 1NOJA 4BMZA 2XDYA 2IYFA 2YW2A 4ZI7B 1NP3A 1DZ3A 1EQ2A 1M2OA 3B53X 4WZ6A 7REQB 4Y0NA 2R7NA 3A58B 5EUBA 2J07A 2A1TR 4KXQA 1A9XA 2JFHA 2FY8A 2O3SA 3ROQA 3GP8A 1TU3A 4CPDA 4JUDX 2ORIA 4QEZA 1DADA 3CNHA 1ML3A 2H5IA 1K06A 3I6ZA 3BB4A 3EIOA 2CK3D 3ICWA 3R6TA 4ZU3A 4WY8A 4TKVA 5EJ9A 3RASA 2ONKA 3J80A 2YWRA 1W9HA 3B13B 4K9RA 2YYYA 2AYYA 4B31A 5JSYA 3MAAC 4LF9B 3JQEA 3G0DA 3OX4A 4MQFB 3H6GA 2I7DA 5EHQA 1YUNA 5E2AA 1P0CA 4PO9A 4WESB 3LUJA 1X7ZA 2UU9B 1TK2A 3AOEC 4GPEA 3A25A 1FFAA 1DC6A 5IG2A 3QW4B 1QGAA 3IAXA 4FEYA 1QV9A 2WBLC 4Q48A 1KNXA 1PK9A 1N2HA 1U4SA 1Z0SA 2YRWA 3OBIA 1YQGA 3PQFA 1AX9A 3ITKA 2APJA 2FN7A 1JQLB 3LX8A 4J1TC 2A9KA 4OQLA 1YD7A 1Z4JA 3RFFA 3LC2O 3I6YA 3B3FA 1SCUA 4IV5A 4J7AA 1A1SA 4G63A 1BDHA 4Z4GA 5K0TA 3BGOS 1HE2A 3LQQA 4NRDA 3K0EA 3TOVA 2A67A 4F0JA 3VKHA 4BWYA 4QNMA 4HJRA 1DHRA 2D4AA 3D9QX 4MGEA 5AJWA 4B5LA 4Z5XA 1ZNWA 1EE2A 4MULA 4HSEA 4IGFA 4FHCA 5LOVB 2Y3IA 2RGAA 1KQFA 1M1UA 1SVMA 2IYPA 3NOXA 1HX7A 2HA7A 5FO1A 5KQLA 2FKAA 2C4NA 1B3RA 2EKBA 3M9WA 2JAHA 2JB9A 3Q7RA 1B1CA 1PV2A 1W4BA 1KMIY 2OLEA 1NU6A 2W2TA 2YC2C 4Q4JA 1RBMA 4R1UA 1KSJA 3MXTA 3BMOA 2YXEA 1LW7A 3GBPA 1KI6A 4RIFA 4CV3A 4AKHA 3F7TA 2V3VA 1BRTA 1HV8A 2IZOA 3DHEA 4JMLA 4QBTA 1YS4A 3FRHA 5JCOA 1VMDA 2BFNA 2CNKA 4EF5A 4TT3D 3HO6A 1R4NB 4LDAA 1JEQA 3ZDBA 3MWDB 3A37A 4UHFA 4AYWA 4J9VA 4EG8A 4QE3A 3C0KA 1Z3CA 4TT3A 1Q2UA 4AMZA 1EFUA 5EPEA 2G40A 4AF6A 2OECA 5KNCH 5K0EA 3QA9A 3V8EA 3QXJA 4PCAA 1JJBA 5JNSA 1Q0SA 3AZPA 2B4KA 2DG2A 2FLKA 2H65A 2ZIEA 3OPYB 5LZ5A 4EGFA 1EHCA 3RAFC 3HJFA 2VHUA 3I6BA 4BDTA 4ZV9A 1Y3IA 1ZM3A 2PU5A 5P8WA 4BNTA 3BBLA 4DGQA 1AA6A 1H3EA 2B34A 2D3WA 4MCIA 1RBQA 2L42A 4HNQA 4R8MA 2R7LA 3ORQA 3HB1A 4LQDA 4Y6LA 5CFQA 1TEVA 3GGPA 3UCXA 2QTMA 2E37A 2OHVA 3G5AA 3FHTA 2X3YA 2E4VA 4LMPA 1T3LA 3BGWA 2WU1A 2AFHA 1EPUA 5H02A 3VQTA 4C21A 4ID3A 3ZGOA 2WHPB 4LG1A 2CCKA 5HIAA 3LUFA 2GNPA 1RE0A 1P4GA 1NJ8A 2AQKA 3FMFA 2NYVA 3PGXA 4X8OA 3GA5A 1JIUA 3KSUA 3RJZA 2C07A 3GARA 2HU8A 1I7NA 2YFHA 1T6NA 2CLOB 2ZKIA 2R8BA 1JX6A 3STUA 1VTKA 1GZHB 2ZUSA 3FZGA 1AF7A 1I2BA 2BFEA 3LUCA 3T1OA 3ZCSA 4XJVA 4AN4A 5KX5F 5BWNA 2EOAA 1UOOA 2I7TA 4KGXA 1ZUD1 3NIGB 2Z6QA 1TF5A 5EJGA 3NHKA 2R00A 1Z5GA 4EABA 3O8LA 4M1KA 1P0QA 3NHRA 4PHTA 4DCMA 2OXEA 1PS9A 2E1PA 4GU5A 2O0HA 5EZYB 3VPHA 4QUGA 4V0MA 4FXOA 5E1MA 1L5LA 3SN6A 4NBWA 4NTZA 5K3BA 4M37A 4MV4A 2JGJA 1OXUA 3E58A 3LX6A 2VRCD 3EB9A 3WP0A 2QMUA 2ZKLA 4XJXA 4ZC1A 4GKKB 1ZRHA 4FFOA 2OY0A 3T5CA 1DO8A 2Q3EA 2WP8J 1DAEA 1KZYC 1IXZA 3KVNA 3RO7A 5L4LA 1KZ1A 1E2DA 2I1WA 4GXNA 3CVXA 4JLNA 1L1QA 3FAKA 1NVGA 3F74A 3K09A 4EG4A 3NEYA 3UV3A 4KP7A 5EZQA 1R0LA 1OYVA 2O3UA 1PTKA 3V4OA 3W6ZA 5DTQA 2C2KA 1TNDA 3D5TA 4IWNA 2QVXX 2V7QD 1QH9A 1N77A 1W7AA 1JA0A 3DPSA 1DV1A 2OMKA 2QV0A 3UENA 4BATA 2GK6A 1LF0A 1N3LA 3MLBA 1R3UA 4FFLA 4IIEA 4RS4A 4AICA 2WA1A 3FUUA 4EYSA 5ERYA 4NOJA 2FEPA 4FW8A 4CKWB 5I4IA 2PUAA 1JA9A 2G83A 5H1YA 2VFAA 4C1NA 3IYLW 4XD7A 5DM70 1R6DA 1KVSA 3CH5A 2J1LA 2QN1A 4IMPA 2YZNA 2H1RA 3JSAA 5H3HA 1N5LA 3HP1A 4E08A 3PUKA 5IHPA 2XJ9A 2RFLA 2QSZA 5CX1B 4RD0A 3NKFA 3KKZA 3LC0A 3SU8A 4RK7A 5C8DA 2PTGA 4PQEA 1M2WA 4DMRA 1NQOA 2C5AA 1VJGA 1XFDA 1XAJA 1XWWA 2JEYA 2LKDA 2I2CA 1OZ0A 2WWHA 3H2SA 3ZGXA 3AYXB 2X0DA 3IUPA 3OEHA 1E2GA 2VF2A 2QAIA 3FUCA 5A0VA 1U5CA 2JD1A 1C7JA 1OGIA 1V8FA 1ZH2A 2AGVA 2GDJA 3ESYA 1NMEA 3L77A 4CG0A 5CBPB 2UUCB 2TS1A 3B70A 3B78A 4C4RA 1IN5A 2H2IA 2D54A 4L16A 3KJXA 4E2WA 1B6RA 1TKRA 4IJMA 4TZTA 2H5LA 3MCZA 1KOLA 3RFVA 3ASVA 2XJ4A 3KALA 1Z75A 4H1UA 4XR9A 3K0FA 2Y1GA 4N6GA 3KRTA 2ZM6B 4KO4S 5DWVA 4M1SA 4KR9A 1U2ZA 3NETA 3OUZA 3ZU4A 5K0GA 3SC6A 1ZVJA 2GVNA 1WUIS 3FE2A 3M3HA 5B12A 3O90A 4MQLA 2D59A 2AYZA 5SY9A 2HJSA 4Z51A 3IOCA 3MJCA 3KUXA 2DE0X 4YPVA 2Z2KA 4ZQEA 2D7DA 1Q3KA 1UM8A 1U02A 2G77B 3HGTA 2QM7A 2YJ5A 4GOXA 3W05A 2C2ZA 2AZMA 1E6WA 5IM5A 3DZJA 1NLZA 3OTOB 4NARA 2H7CA 4CM4B 5EMHA 3K5HA 1M75A 3OOEA 1XRJA 1TCBA 3MCVA 4JASB 4DLBA 1IN6A 3B6EA 4DSNA 1U8AA 4L8WB 3T4EA 4YDRA 5HIIA 4DJ5X 4L27A 2RGUA 4Q3OA 2I34A 1TQ8A 2EEZA 2YOFA 5DISB 3RYCB 1PAUA 4XJTA 1OXTA 3Q12A 4HN9A 4Q18A 5HF6A 4YRFA 1JVSA 3N2EA 3QV2A 2ID9A 1T6ZA 2BWJA 2JPDA 3ET4A 3U81A 3A11A 5ULLA 3UOAB 1OH8A 1SQ6A 4KU4A 4NC9A 1CB0A 3CRQA 2ZJYA 2VNIA 3EBOA 2W2KB 3CTPA 1WTAA 3CU5A 5C4GB 4JUIA 3MWEA 3DLHA 2W2XA 3ZCQA 1ULZA 3HYRA 5L3QB 5DH9A 4Z7QB 1JBKA 1UOPA 3G6WA 3V1TC 1VMEA 4X7BA 5LIPA 3KQSA 2EW8A 2ZWMA 4IJVA 1U3WA 5BO5A 1E3IA 4B6SA 3DDCA 3JQ7A 1VL0A 4ENUA 4FDLA 4G4IA 4IOKA 4DC0A 3IE0A 1KJWA 1ZN9A 4RK0A 5D84A 2H2DA 5H7XA 1XTTA 2GN2A 3UC5A 1KI4A 2PGJA 5EWMA 4D74A 5DSZA 3WFZA 1TJ5A 2F3PA 1OZHA 3LPNA 4HBZA 3H5IA 5J1TB 4CHTA 5EIEA 2ZE8A 2YHBA 3H9CA 1DIAA 4JJKA 4QQFA 4BWFB 2GA9A 4BE7B 1HYQA 3ESBA 1A4UA 1I7LA 1LKZA 3IHTA 1AKTA 1E3JA 1RLMA 1UANA 3IAEA 3JW8A 3ORSA 4UNSA 4LZLA 3RADC 1P5RA 1YR9A 2FW7A 4U7HA 3D7RA 1U7WA 2R4UA 4A16A 4EHDA 3W2TA 3JQQA 1CRPA 3RVKA 1C7FA 1J2YA 4L9AA 1EJBA 2BBSA 3F8WA 3IAUA 2I9PA 2P5YA 3STHA 5IARA 4OB8A 3I5YA 3FFBA 2BFDA 1OI4A 2BBOA 5FI1B 4XFJA 5DM4A 1FP6A 1Z9BA 4GM4A 4ZVLA 1GA1A 3KJNA 2BKAA 4F3KA 2CLCX 2VSFA 3LG2A 4JLOA 4LMAA 5F7XA 3IV6A 4QTTB 1GQOA 4DLVA 1Z34A 1XEAA 4UVDA 2NP6A 3F5SA 5E4TA 3H2IA 1SUPA 1DEXA 1ANKA 3FKSD 5ESDA 3TR5A 5TQ2B 2GB4A 2AG6A 2NYUA 3ONDA 3TL2A 1L5NA 4JS0A 3W3AH 1UBHS 2ZU6A 1YMQA 4N8DA 3GLVA 4JZKA 1KDZA 4R2LA 3V8MA 4O4JF 3A4TA 4BLWA 4P7JA 1ZQ9A 1SBYA 2YHUA 1E3TA 2QUAA 2ZCUA 2GAAA 5GGYA 2JD0A 4CTOA 4X1YA 2H4WA 1U0OC 5M5BA 3GCWA 4I55B 5A1JA 1JFSA 4JXJA 4G89A 1B8NA 3K0HA 5I9IA 1TTQB 4TM7A 4ZMBA 1LC0A 2QTVB 3SZUA 2X4IA 3OHMA 2OV1A 3EUWA 4DIBA 3A7DA 4CE6A 1PNTA 2BP7B 3CE6A 3E48A 3OWHA 4IIXA 3UXEA 3N8GA 5B36A 3B8EA 2BFMA 4TL6A 2CXHA 5HTOA 1D2CA 2CL0X 3U4IA 3K5IA 1TRKA 4E0BA 4P33A 1R4AA 2FSVA 4D82A 2AQ8A 4RDXA 4ZD6A 2QPOA 1N2JA 1FYWA 1D6SA 1HURA 1VSBA 2H00A 3DP7A 4HUQA 4YMWA 4RNCA 5ITVA 4M9RA 1GD1O 5I3ZA 1J21A 1DBQA 1EX1A 4M1OA 2FUCA 2BSAA 2PMFA 3MINB 5EE1A 5D00A 4EOGA 2H63A 1B15A 2AI2A 5IUNC 3OFJA 4P0TA 2XGMA 2REQA 2Z98A 1CDZA 4PX9A 2RG1A 2FNAA 2VCHA 3IXMA 5HCNA 2PXHA 1K6MA 1AMUA 2XVMA 1BVYF 5F1PA 3VTAA 2EF0A 3GPCA 3RKSA 1XTBA 4KVGA 3UH1A 3LOUA 5CAEB 3QBEA 1NVVR 4MW7A 1BA3A 4URHA 1X8JA 5HRAA 2PGOA 4RDHA 2F8SA 3L49A 3G23A 4IQFA 3KSRA 4O2BB 3R9WA 4GM1A 3RFXA 5I9LA 5DK6A 3OFND 4FCWA 4TQGA 3QWFA 3GLFB 3S8YA 2PNFA 1D6MA 3RVSA 2I2DA 3QE3A 1M83A 1AA9A 1SOAA 4B3CA 1PFGA 1PNQA 1P0MA 3PTZA 4AY3A 4BMDA 4D3XA 2GDZA 4ASUA 3LF1A 4DLYA 2GK3A 1GNQA 3D4LA 1JBQA 1JKIA 4R68A 2NVUB 2YY5A 2Z2XA 2H1VA 1W52X 2B83A 1D1SA 1QNFA 1UT8A 2VDWA 4XR4A 3IBCA 3PA8A 3K0BA 1XLWA 1W4RA 5LBTA 3K4QA 2HSGA 4PC3A 1XVAA 5LUAA 2XCSB 2QRLA 1F6DA 1NVTA 2X1HA 1YDGA 3CKKA 5EXEA 4LC9A 5EMLA 1L9XA 1TJPB 1SCAA 1E79A 1HG0A 1F2VA 4EPYA 1HFKA 2A78A 4FK8A 4K9MA 3PG5A 2A9RA 4WXHA 4BBAA 2AZDA 1JHPA 4HS9A 1D9ZA 1VKNA 2HAEA 4KI7A 4RZIA 2GNOA 4ZOLB 2ZYDA 1EDZA 3R1IA 5C8YF 4Z9AA 3EMKA 2HPVA 1NZDA 5JNVA 3AESB 3OC0A 4QFCA 2GO7A 5IAGA 2DSTA 1IPHA 4G5XA 1Z4IA 4X60A 4BPBA 2RIRA 1L7QA 3W5CA 4MA0A 2QJWA 2REBA 4PRYA 1Y98A 2ENUA 2IU4A 4WEQA 3EXIB 4IGAA 1Y6QA 2F2TA 3QX7A 2H07A 3AL0C 2XMPA 2C2MA 4MVJM 4H6VA 4A2PA 1AQUA 4NXMB 4KKXB 1SR8A 4AFNA 1CY6A 3V8RA 3RK4A 4OK6A 5TEWA 3VHXB 3FZQA 3RKUA 5AW3A 1OJ7A 4AG5A 1SAYA 4Z9BA 4Q00A 1EK1A 1RQXA 2C4WA 3OCJA 4H7DA 5IUJC 2QYOA 4DA4A 1I0ZA 3F5QA 2CY0A 2UZAA 3T9AA 3VPCA 1YWGO 3WYBA 2PKXA 1KRWA 3TD2A 3CMMA 1ZU4A 4LX8A 4PNZA 1B16A 4X1KA 2Q6VA 3RYFA 1E7QA 2XUPA 3IH5A 3MTDA 2GZ3A 4A5SA 1F8UA 4OJYA 1BX1A 1K8XB 3ZGYA 5EZ6B 3I6QA 1WQ1R 3RAEC 5LP6F 1ESNA 2P2LA 4DPLA 1RRKA 3K05A 4HAWA 2FPWA 1D6NA 4BASA 4DM7A 1JDZA 4RK4A 3KL2A 1BEUB 3A70A 3PYMA 2HRRA 3BFKA 3DM9B 4H0NA 4MOWA 3SZOA 1C29B 3SNKA 2PD6A 1TEZA 1OGJA 4G23A 4RSGA 3N74A 1FTYA 1X1CA 2EGHA 3DL0A 3HNRA 3QVXA 4C0XA 4IUBS 1KA9H 2H31A 5F7JA 5FUBA 1SC4A 5G41A 3K9WA 3AGQA 1QK4A 1SU8A 3FCOA 3NNSA 5AVJA 3SCZA 4E32A 5JAMA 3R75A 1Y8ZA 2BTQA 2CHGA 3KYBA 1YQUA 4CFYA 3M6LA 3W7BA 1G19A 2F1KA 3U3OA 2G1PA 2QGZA 3KTFA 3TL3A 3V1NA 3HJUA 4O3MA 4I6JA 3HRKA 3B1KA 3OU2A 1XDGA 1M1YB 1IXSB 5C35A 1NLUA 2R65A 4ZARA 3JZIA 4IEEA 3K9HA 1TUEA 4J3FA 2IHBA 4WLVA 4X0EA 5BPFA 2QQEA 2P9BA 1H2ZA 4JVNA 1STOA 3SDBA 3TWOA 3RRFA 2GCGA 2VH1A 4UAGA 3UAVA 1RC1A 4I4TF 3NGLA 1CUAA 2IPLA 4X62B 3CZQA 2ORWA 3ZD8A 3KSDO 1F7UA 1PR3A 4K86A 2NO6A 4P4LA 4CFZA 1Z7GA 1DI0A 1Q0LA 2EQBA 2OZLA 4TMKA 4CI0B 4JELA 4DJAA 2EZ9A 1WHSA 5D3ZA 3DAYA 1RPTA 3NXKA 1JLLA 4WZBB 1K1EA 2AEFA 3I61A 4PAMA 2A5JA 1KOGA 2CXTA 3T54A 3L6EA 1P5HA 2FV8A 2PT6A 2RHCA 2RH4A 2WUVA 5AM4A 1VBKA 4O8ZA 5EGSA 4RVCA 1S8FA 2LRHA 1SCIA 2F17A 1CIPA 4R0NA 4PINA 3I2YX 4I6GA 1UMDB 2RGDA 1HNXB 1BYUA 4YROA 5JD3A 3STVA 1CY8A 4DA9A 4BO6A 3KELA 4TVSA 1J4AA 2IELA 4WZBE 3EISA 5REQB 4Y6OA 2P3LA 4BMXA 3GXOA 3TG2A 1E62A 2IY9A 2CJXA 4MYRA 4F72A 1L4MA 1SO8A 2GFQA 4N3NA 4Q4HB 4XUDA 3RUIA 3MQFA 3A6DA 4YMTA 1Q19A 1RCUA 1QC5A 3LECA 2ZJ6A 4PZUA 1CUHA 1WPRA 4YRKA 1OI3A 4F86A 2VQDA 3A4MA 2RCYA 5J1SB 1ODSA 1MABB 3INGA 3PF8A 4X85A 5HOQA 1UBJS 1P1KA 2CVQA 1CQPA 4H18A 1E94E 3FZNA 4KO3S 4KX3A 2BL4A 3BHNA 3Q87B 2Z5VA 4FBMA 4JKIA 2IUTA 3NDJA 5CB4F 3L92A 2YS6A 1IK6A 2PT9A 5HDBB 3SD7A 3M34A 1T2UA 1J25A 2PUJA 4KN9S 5TS2A 4JX8A 3HA5A 3RTEA 3HMKA 1PSWA 2IEYA 5DNAA 3PCRB 1UBUS 4G1BA 4NKRA 4BEBA 3C24A 4YIHA 2RARA 2IRWA 3C8UA 4WGGA 4XTCS 1OAOA 1VJ0A 4BP8A 1Y3BE 5C18A 1BKSB 3N0VA 2OL4A 2IF2A 5L51A 3DMYA 2CLFB 5KX5A 1FW6A 3KBBA 3X3HA 1TCUA 1YI0A 5HKLA 2W2MA 1UDBA 1OSNA 5FTNA 2LZ0A 4P08A 4WBNF 4NE9A 4CL8A 5EWLA 3K09C 5GJVC 1A8SA 1QS0A 3I4LA 1NASA 1U7DA 1T1EA 2BOVA 2XT9A 1HDXA 1T4BA 2AHOA 4R40A 1XXLA 5F2NA 3PP8A 1MN6A 4Q47A 2HF8A 4KQEA 5A06A 4F84A 4UM9D 1B0UA 1ZOLA 1YBAA 3F6EX 4HDKA 4Y2JA 1DLJA 2AOTB 1WU8A 3V80A 1E18A 4B5KA 1VYUA 4ZK6A 3WMEA 2PTHA 1HC7A 4CIDA 3FGNA 2QTWB 3D6FA 1MUUA 3A9CA 5DNVA 4HYTA 2PCJA 4E6EA 2IS1A 3QPCA 3PB3A 4IVPA 2YFQA 1VPTA 1GL6A 3D8NA 4LYHA 4Q4CA 1E3LA 5IC5A 1ZKMA 2RGNA 3KTAB 2MYUA 3K35A 1B41A 4N3BA 1T2EA 4I4LA 1FRQA 1DAKA 2EX0A 2YMPA 2DBQA 2IJGX 2Z4TA 4DSUA 4F6CA 5AW7A 2FR0A 2QTZA 3K31A 4K3UA 2OCDA 4FX2A 1ULBA 1JALA 2JI8A 4YCDA 1OX6A 2OVFA 3TUIC 1CUSA 1WV0A 3L7BA 4CLHA 3NVDA 4TL9A 3ZTWA 5DV9A 1PT9A 1E5XA 2OILA 3L0DA 4C5BA 3EVBA 2ZJ5A 5D2CA 3EGDA 2JG3A 1YR2A 5LYYA 2FB9A 4WH0A 1M73E 1TM3E 2CFOA 2W8BA 1VM6A 2HH9A 4PX2A 2VWQA 2PKYX 3G0IA 1EUDA 3EVAA 3ENQA 4MWSA 4TKZA 4Q24A 3PC7A 4AF7A 5K8JB 3JAMA 1ZR2A 4UEKA 3H75A 2XRZA 4L4YA 4B34A 1KVUA 1JSXA 3N2KA 1E2PA 2B82A 2BFBA 2QTFA 5K8CA 3GRPA 5FL3A 1D03A 1NMQA 4HGOA 4MQ4A 4Q66C 1DCTA 2IU0A 1CEXA 2Q46A 1S1MA 1CT9A 1UJNA 2ZIXA 4G1MB 4P36A 2M6LA 3TPZA 4IDHA 5J3JA 1S7GA 1ZR4A 4IJUA 3ZXIA 1SRRA 3ZU3A 2C9BA 4URYR 2RSLA 1K8ZB 2HMTA 1YK1A 2ZWOA 3S5JA 3VKUA 5JISA 5A4AA 1EFDN 3DD1A 4FKZA 4G4SP 3V4PB 3W8DA 4B71A 1HSZA 4DQ0A 4ARAA 2V0CA 4JSRA 1WPXA 1EK5A 2H5JA 3A4YA 1UDRA 3B8HA 2CXOA 3EQ7A 4QPDA 3DLAA 4LDPA 1PIWA 1IYZA 3NC1C 4ZU6X 5CDHA 5FUQA 1CF9A 1LLUA 1SY7A 2J5KA 2R6HA 4UUBA 4FGLA 2GAIA 3WGMA 3HACA 2Q4DA 4OH1A 4YQEA 2YHSA 2LUOA 2PJUA 2NU8A 4JP1A 1QZZA 1ZC4A 4NCXA 2GF0A 2QMZA 4KAJA 2AQIA 2RGYA 3G8DA 3ROXA 3RV4A 2VTKA 3GZNA 2JEOA 5TC4A 4NCHA 1GAEO 1GRVA 3HY4A 3O94A 5CXSA 1EVZA 3IUYA 3RU3A 3GLSA 4CL0A 1OGYA 1FYXA 3DKRA 4L0QA 4YCMA 5HKBA 1VBNA 1TYCA 3BOSA 5DXAA 3RWOA 1DMSA 4AMVA 3BIWA 1O6CA 1GU1A 3X1KA 3VOAA 1SBIA 2RI0A 4M46A 4C2UA 721PA 1JWBB 4ZO7A 1G5FA 1M0SA 3LLUA 4RNDB 5FF9A 4Y1EA 3REFA 3TK1A 1V45E 4B81A 5HKKD 2E1RA 5G4LA 3EZGA 1M1NA 3A26A 5K09A 2X9VA 2EFDB 3I9JA 4IKPA 4C7XA 2F3SA 1OT5A 4F2DA 2B2NA 1P5JA 2HA6A 4EELA 2XLBA 4Q1EA 3VPFA 3QEOA 2PRKA 5AO9A 4YJ2B 4YT2A 1A3CA 1IHOA 3WY9A 2MT9A 2XYGA 4BE4A 2EX1A 1UBCA 3PPVA 1DOHA 3UGJA 3QW2A 4BECA 2WSLA 1RM0A 3ZHTA 5GJBA 1A0OA 2P9FA 3IDSA 3K9LA 3M1AA 3NTVA 5K8LA 1JDNA 3FXAA 3CLRD 1FU7A 3H42B 2G07A 1AS3A 3ZNPA 2G17A 1FFSA 2WIFA 3T3IA 4NPHA 1LBIA 2ZR7A 5IFLA 1M34E 3A9RA 4F9GA 5E9QA 5FV4A 1MXHA 1N57A 2O2CA 1QWOA 5JFTA 4ZREA 5M7EA 1GRNA 1WHTB 3AUUA 3WAJA 4PF1A 1FA9A 1I3KA 1R6UA 1ZSYA 4GLLA 4R9RA 3VPAA 1ONBA 1T8RA 3FCSB 1A5BB 2GJKA 3HCFA 3IT2A 2Q6TA 3P19A 4JODA 4Y2HA 5DI3A 3T5AA 4J3NA 2IXAA 3ZVNA 1RYHA 1Z82A 4QEKA 1L4YA 2IDKA 2ZAGA 3QLUA 5G0VA 4AZ3B 1JYFA 4DV6B 3LLSA 1ZY2A 4MROA 5ANRB 4ZEOA 3RS3A 1TW2A 3NHWA 1I14A 4W7HA 2JJ2D 2J3IA 4EY3A 2PV7A 1BDBA 3WWYA 4FZ3A 3ZW8A 1Z6XA 3HEMA 3BXGA 4J29A 1KI9A 1MO5A 2QUHA 4JUBA 4KPFC 2O0KA 2OBYA 4HDOB 3N9IA 3HLKA 3UN1A 4CJXA 5AKLA 1N6NA 1Y8RA 5CA1F 2J9ZB 3B51X 1XCGB 3COVA 5TMBA 4U6NA 3GYGA 4NU0A 1Z2EA 3PL1A 5FBQB 1IEWA 2VLIA 1L4UA 1I1QB 4O4JA 5SYMA 4ZRMA 2XWJI 2Y1LA 3ISTA 1IPFA 3S7TA 4GR5A 1KYIA 1P2UA 3AUXA 3VZBA 4EGAA 3K53A 4MR7A 2A3RA 2WM9B 3BRCA 1PJTA 3MCUA 4JLWA 1YS6A 1BFDA 5E2IA 4YP7A 3RB8A 4HGPA 1DUIA 1N1EA 1VL8A 2PKQP 3VFDA 2BM8A 2CF5A 2NU6B 2L19A 1JIKA 1EQAA 1KWKA 3NGMA 4PLVA 1A8QA 3DAOA 1I1NA 2EW1A 3R3VA 3RROA 3BYZA 3W7VA 2QVCA 5D6OA 3VC7A 2WOOA 2O2YA 2SHKA 4TYYA 2FQXA 1P72A 3NT2A 4BNJA 2O8FA 2GJ9A 2IYTA 2YWXA 3D8TA 4KYVA 4FM9A 4HLCA 1DWQA 2VUSA 3EEYA 1SIOA 2JZCA 4INPA 5AYVA 3RE1A 3RHSA 3ADCA 2PRZA 3FWNA 2AVDA 4EP1A 3BL8A 4WJLA 1JF8A 1BN7A 2DT5A 3E5NA 3QKIA 4C0KA 3G8CA 4OJKA 3WL5A 2ZM5A 1GCAA 1E7RA 1UWLA 4CIBA 2WA2A 2OYSA 2E49A 2C2HA 3E9QA 2DECA 2N1MA 3AHHA 4O2RA 2R9VA 1D1TA 2XE7A 4R9VA 1H9BA 1QOQB 1FTWA 2OENG 1YR6A 1WE2A 1Z35A 2GHRA 5EE0A 3Q85A 4DYVA 3DBHA 4KQJA 5MFPA 3OE7A 1YULA 2Z0MA 5JD5A 1L7RA 1IULA 3ECCA 2OV8A 5K3AA 5IVIA 4QM7A 2XUIA 3IFSA 4DV7B 3BUSA 4ZO8A 3UK0A 2XNDD 5BV8A 5ICGA 3WL7A 4PHCA 4R1SA 3I2FA 3CEAA 5CITA 1PDWA 3EVDA 5KJFA 1HE3A 4QYWA 2MR6A 1QCCA 3N6RA 4LOHA 5KNCA 2XNDA 3LGSA 2CXNA 1WD7A 2POQX 3FDZA 3WLQA 4C3VA 1H1LB 1LQ2A 3V4LA 4YYZA 2G04A 3DYBA 3ZGZA 1XJ0A 4COOA 2YV2A 3MXOA 4GPD1 5CHYA 2AT1A 4UHCA 5FWAA 2OGSA 1NF2A 3DB2A 3WDKA 5EJ6A 1R0CA 5K0FA 2VQ6A 1Q22A 3LKDA 3CIOA 4FGKA 1C9EA 3DKVA 4TKLA 5EKSA 4B46A 1CQWA 4NABA 2PX0A 3IBFA 8LDHA 2R25B 3W4JA 3UPUA 2Y99A 1KEEB 3H8VA 4UM5A 3RJMA 5K3CA 1NX9A 2WICA 3A1FA 3G59A 2ZRBA 1MP0A 3M0EA 4Y2RA 4F9TA 3PIIA 2PYIA 1T10A 3HB5X 2XEXA 3V46A 4P4GA 4ADSG 3ZJVA 2AOTA 4CI9A 3QELA 3D2AA 3G2MA 4DSOA 2FZVA 4QDUA 4MNTA 5DRTA 2XWSA 1QORA 3QEMB 2GEBA 2IW1A 4MS4B 4PFQA 1WXDA 1I13A 4RY9A 3SBOA 4HRAA 3JPYA 5C8YA 5KTTA 2YWFA 1NI4A 3IDZA 3PX7A 2QRZA 4UD2A 2BZSA 3ZEIA 3DAHA 3ANMA 5ALUA 5I9SA 3WLLA 2J0VA 3K8YA 3N7TA 1E1YA 4F6LA 5JJCA 3IDOA 5K03A 1CB7A 3R8CA 4IH1A 2WMDA 1UH5A 1XP8A 2GH1A 3PXAA 3I76A 4X93A 1XG5A 4GZ6A 1FYEA 4EI2A 4Y2TA 3IQWA 3KFXA 1JIJA 1P1IA 2FHPA 4M1QA 2C83A 4PQGA 4OXIA 3S70A 4BCDA 4F8EA 5CA0F 3A1EA 2N42A 4QLBA 4H3HB 5KYGA 3TZEA 3SR0A 3U3ZA 1Y4DE 2K87A 1KMMA 1TADA 1U5BA 2DPXA 3RVOA 3CXUA 5KNBD 5B6PA 3HVRA 3ZDDA 1XZMA 3DWEX 3GD5A 4G5FA 4BZXA 1DRJA 5LL6P 1IRXA 1KZ9A 2PL5A 3DO5A 5KVCA 1SKMA 4TUYB 2V3WA 5KYWA 3AK4A 3TB4A 5ESXA 3NP9A 2BKUA 4X92A 3VO8A 4U9IS 4WQMA 4CMBA 1ABFA 1W5TA 2PUFA 2VWGA 3BDIA 3G7NA 1JR6A 1OROA 3KB8A 2VHQA 1UEJA 3GCGA 2ADFA 2FZEA 3Q4GA 5LP6A 1UAGA 2JJYA 4WOJA 1YDFA 2EZ4A 1ZZGA 2YV1A 1GWNA 1NSFA 3B89A 2RDMA 5AHRA 1YSCA 1HE4A 1JJFA 3MJRA 3LTNC 4FEAA 2V7GA 1I4WA 2ATEA 3BGSA 3O4GA 3RU9A 2PJRA 1YFZA 1NQVA 1SC9A 4GXQA 3U4HA 4BAZA 3HXMA 3IIIA 1XAIA 1N7GA 3I39X 3GWGA 1ODIA 4EGQA 3K30A 2WM3A 3EXAA 4M4SA 2M9MA 2QD3A 3QOXA 3PNMA 4ON9A 4YUZA 5AUPB 5KU1A 4DR5B 3IMEA 1NHWA 3KAQA 2CSXA 3DNPA 2ZE7A 2GZDA 3CVUA 2B99A 2B6NA 3MMXA 5LA6B 1MRZA 4UVEA 3P5BA 1PV4A 3MMSA 3W5HA 3PWSA 4MLDA 3T5MA 4B6FA 4JITA 1FFWA 4YCBA 2GOYA 2HJWA 5EPUA 3W5IA 2A14A 1T0BA 3K2EA 3BD6A 3QLVC 3OZTA 5IN5A 1P77A 4I4TA 3L4SO 3PPWA 5ALOA 3EC7A 4V0OA 3RTBA 2C9MA 5CRIA 3VVCA 4JB8A 1FNNA 3UKOA 3K7EA 1BXRA 1G20A 2ZUFA 4CN8A 3AFOA 3K9GA 2Q3MA 3PQDA 1VLLA 3MT7A 4BAGA 2XUDA 4J49A 3GP3A 3WFJA 2WWFA 4PHFA 3B3JA 3HU2A 5AJXA 4G25A 5CNIA 4LXGA 6AT1A 1SC6A 1G7CA 1NYRA 4KIGA 3BTUA 3ECAA 2XYQA 4H7HA 4N18A 5CNKA 3U3MA 1KYZA 5GTDA 5K0ZA 1K7EB 4LXHA 1JDPA 3VX4A 4KQGA 5B53A 1P33A 1V41E 1RVV1 4CQMA 4DTIA 5I8PA 1WUKS 4NZZA 3EIEA 3PLRA 4AO6A 1U65A 4EY4A 3WWCA 1O6BA 4L76A 1Z0DA 4OHRA 3TTTA 1E98A 1SZCA 4C3ZA 1NONA 4Q9IA 2A5FA 1A9PA 1N78A 1O0SA 2I3GA 3V1YA 1FZTA 2H2FA 3QQ5A 1BXGB 1E1RD 5GV7A 2XTJA 1OI2A 2P77A 3P4UA 2MDTA 5I5GA 5ALIA 3U7JA 5CDYA 1QH8B 5HIJA 5UKDA 1C80A 1DC4A 2ZJFA 4QX6A 3UJDA 1DTEA 5A05A 2XOKD 1OPXA 3GUUA 4COKA 1XPOA 3E3AA 3NBYC 3DAGA 2K5UA 2HDWA 4OATA 4L8GA 1OAOC 3VGJA 3OZUA 1G59A 4EG5A 3V42A 4RKEA 1VJTA 1VJ5A 3OQHA 3OX2A 5LN1A 5ALJA 3WRVA 3CNBA 1DINA 3L04A 4ZEVA 3MJDA 3MCWA 2HIMA 3O8DA 4F5EA 3Q2KA 2B7BA 1G8JA 5CB4A 1TAQA 4YB8A 1CY7A 1W5FA 3ZH9B 4G9EA 4MUKA 3U0BA 3ECSA 4B3RB 2EYQA 4O0MA 3KZCA 1SEPA 3LM8A 2IV2X 1VCIA 3TRDA 6LDHA 3QMMA 3WBKA 1JPJA 2PS1A 1T2CA 3MUEA 1HDCA 1PRYA 3VYSB 4NENB 5HM8A 3L0BA 4KXWA 3DE0X 3CEPB 3KOUA 4IS3A 1GNSA 4P3XA 3B82A 4YI3A 4EAQA 5C80A 5JS1A 4EYOA 2ZJZA 4Q5IA 5DGIA 1OASA 1ZISA 3OA2A 5K51A 3OPXA 3O95A 4WBNA 2NX2A 4TLEA 1EK0A 3TW4A 3MD0A 3PHHA 3TLMA 1YKGA 4N54A 3MS2A 5B4TA 4DVGA 3PNQA 3Q0EA 3QENA 1RZRD 2VHEA 3PVCA 1NR7A 4M53A 4DG9A 5C81A 1UBFA 4GI2A 3ZWPA 2QLMA 4H4EA 3ND5A 3FOBA 4B84A 3D2LA 5J2UB 1O9BA 5AR1A 3GFRA 4MQ5A 1GSHA 1H2HA 3VM6A 1AUQA 3ZD7A 1WCV1 3ICPA 2Y1CA 1W93A 3KHKA 2HKIA 3SC2B 3K72B 1PJ8A 1RWMA 5AM5A 5E8JA 1SXJA 9GPBA 3SS8A 3KXPA 5L3RA 3ITDA 1NRIA 1UCFA 4A8JC 3N07A 1JR4A 2YN2A 1BDJA 3ORFA 1BJTA 1R5NA 2MINA 3LBAA 3ROMA 2R8YA 1GU0A 3ND9A 2GFHA 3ROEA 4F11A 4IKOA 5EYPB 1RDFA 3VNVA 4MW1A 1I5OA 3W3AA 4KHZA 4LI0A 3ETJA 5KMGA 1YT5A 2M1ZA 4XQEA 1R3DA 3WNVA 4LW8A 5LWHA 1RKBA 2XOEA 3ESXA 4NBTA 3R0ZA 4REMA 3QE2A 1QDEA 2OQ2A 5I47A 1V16A 1FNSA 2Q9CA 4AU1A 5F3RA 1LJUA 4B7XA 3W4IA 2QRPA 4MV0A 2PANA 1USGA 1Z5VA 2W2LA 4RJ2A 3DDUA 6CHYA 2GAJA 3C3JA 5BUSA 1I7DA 4WFJA 2O3TA 3FBWA 2AR7A 2FPMA 1UOEA 2ZANA 1XDUA 4HGNA 4B2YA 4KCGA 3HCAA 4D2IA 4EG7A 5F7OA 2CLLB 4AZ0A 3VJMA 4U1RA 3LOQA 3LY8A 4AZSA 3A6GA 4HYYA 3IDFA 3PQ6A 3I9MA 4LRWA 1TJNA 3OF3A 2B35A 4B43A 4B4DA 2GHTA 3GFTA 4E5DA 4YV2A 2RGWA 3WHKA 3ZK8A 3DB1A 4TN5A 3V8NA 1SVNA 2CLDX 2AD5A 2HNKA 5I7EA 3KDAA 1PL6A 2NPIA 2VAVA 2Z57A 2VAMA 5L3SA 2KB0A 4WY5A 4GPZA 2JAUA 5JO9A 3U3RA 3EXG1 1XMIA 3FMIA 2G25A 2P9CA 3AL3A 3K96A 3NTUA 3QZUA 1SIWA 1VIYA 2QLTA 5AJVB 1WDTA 5K1ZA 5EZ5A 2XTNA 3ZE1B 3TIFA 3C8ZA 4H7JA 4L9WA 4UCXA 3WNDA 3G0GA 2VAPA 2ZJ1A 4LEIA 4TRNA 5J43A 3N6XA 2P5SA 4AS1A 4KREA 4UXHA 2FMXA 4QXRA 4DREA 1MX5A 3R77A 3UJAA 2A0FA 1ZI8A 3OMWA 2AN5A 2NTYC 3F3MA 2J9FB 1G20E 1ZI9A 3D8BA 3DAPA 1L0BA 3MTJA 1JR3A 4ME6A 1N92A 4MW0A 4ZT5A 2BGUA 4QRIA 5FYQA 3ZVMA 2E4YA 4LOAA 3FHCB 4ZCPA 4BRWA 3P8ZA 1HSOA 2R66A 1GA6A 4TKMA 4LV5B 4XQ0A 2B30A 1U1CA 3FPGA 2PMEA 5K0BA 1G60A 1XXHB 1W581 2V98A 1N5IA 4KRYA 3PRJA 1UBLS 2XXAB 1UKCA 4Q3EA 3HFSA 1IXYA 3OUUA 3RYIA 5LQNA 4RD1A 2UAGA 4QA9A 4MMZB 1I0LA 5DM2A 5M29A 3GLHA 1TQ2A 3L2OB 2GTHA 1J06A 2JRLA 4AJPA 4E5SA 4NECA 3UJ7A 1Q6YA 3ST7A 5IZCC 5CD1A 4B3IA 3FHOA 1XXHE 4EI9A 3EXFB 1KAEA 1WUJS 1CD5A 3GEPA 1ZH4A 1OR8A 4L5IA 3QX3A 2DBZA 3EDYA 2G09A 4OP3A 1JBEA 3IP8A 1GQYA 2YX1A 2BC9A 2Q7XA 4MPTA 3SHTA 1Z6ZA 1T43A 2ZRQA 4MGIR 4D9FA 4INOA 2VYCA 2Q1TA 3MJEA 3IGFA 4I5FA 4N5MA 2I6QA 1QYDA 1UL1X 1YZQA 3A4VA 3EIQA 2WVAA 4XYBA 1FQKA 2QD1A 3KT0A 1WCIB 3DD5A 3GFVA 3MQ2A 1XDDA 3QLUC 5FOQA 5KSZA 1GT6A 4TYNA 2GD0A 1MR3F 4UZEA 5AM3A 2BMDA 3WQQA 4BO4A 3KPJA 4K3VA 3IPXA 1MORA 1UJMA 1EU1A 2RJ3A 3BE5A 3WP1B 3M81A 2OGTA 2QPTA 2CNWA 1BKDR 1XP5A 3WNQA 1QHGA 1XSEA 1KRXA 4MR8A 2NZVG 1Q7BA 1U1EA 2GHIA 3SKYA 4D8YA 2YQ5A 4G09A 4YEDA 1JT2A 2OP1A 3NALA 2LGJA 3TLJA 2DQZA 1KFBB 2QQ5A 1V2HE 3H2GA 4H7PA 3SOZA 1XL0A 4YXWD 2BMWA 1G3QA 2DKNA 2R6ZA 5AQEA 1SZDA 4GW3A 1ECGA 4TYQA 3I62A 1IY8A 1X13A 2GVZC 4YXWA 3H3FA 2P8JA 4CUJA 4PM4A 2IDZA 1ZOPA 4DIFA 1CV2A 3EARA 6YASA 5LQAA 3R3ZA 4OBXA 5CA1A 2EZTA 3H3XA 4DSTA 2IYYA 1UKVY 3SLGA 3JAWA 2DUNA 4J7XA 4AP9A 2V7BA 4EX6A 1XHEA 3KTOA 4UC0A 3DWGA 3LBFA 4J0FA 1NRWA 1SUSA 4P5EA 2IE8A 3A1NA 1NZFA 1BE0A 3KXLA 3A9TA 4LF4B 1CY4A 4OGWA 5L7YA 2HO5A 2FJ0A 2V1XA 4G0QA 4WK4B 4P0PB 1J9ZA 1W87A 2NUPB 3C41J 3UKJA 1GXSA 2G7ZA 4DAEA 4AY6A 4MGZR 2FEAA 1DAGA 2Z3WA 1NV8A 1E2NA 4KR0A 4PS1A 4PZDA 5BOVA 2C4MA 2WJVA 2CB9A 2F3QA 2FGJA 1RHQA 2IGTA 3L0CA 4FSXA 5CDUA 1W4LA 2ON6A 3U26A 1MOSA 5I4CA 3AI3A 1Y1RA 1FPMA 4UDOA 1QLJA 1ELOA 3NTLA 2PX5A 1MEOA 4X97A 1BWRA 2OPHA 1U9JA 2O7NA 4ROSA 5A3SA 1RAIA 4ARUA 3A4NA 3FPAA 5IW8A 5FO0A 4H15A 1H6DA 1M0WA 3EFOB 5CM2Z 3LXRA 3NCTA 3MJSA 1IH8A 3QU5A 4OHXA 4RHCA 3ZR4B 4RFLA 2A84A 2X8BA 1FF9A 2MYPA 5L7WA 3ZXXA 3U7QB 1L7EA 3FIUA 3UJHA 2WJ6A 2RK3A 1TMKA 2AV6A 3JQFA 2VJNA 5DYGA 1IQRA 1Y4SA 1YRYE 3KJGA 3NLLA 5T64A 5LPNA 1YDEA 2GN9A 4LXXA 4TMVA 4O5OA 1D04A 5DT9A 2BLNA 4J8PA 1DTWA 5KDOA 3RUFA 3KXDA 3G5MA 2W58A 4P3NA 1MAHA 2YJZA 1G5PA 3ILVA 3PUVA 4KNVA 5BVGA 2D2VA 3SXUB 2HFJA 2PZLA 1RPNA 2ZRFA 3MUOA 2PMWB 5BR4A 4LOJA 4CQJA 4I5GA 2WAAA 5FJJA 3DF9A 4JLBA 4EHBA 5KQPA 3D7NA 5KEIA 3H83A 1JAZA 4LHVA 4F2HA 2YBEA 1RHKA 3RUCA 3BDVA 4BKUA 3RAPR 5HQ3B 3SK0A 3X1ZA 1KP3A 3TLGB 1BE6A 4ZC8A 1FX1A 4HXYA 5SZHB 3SBXA 2PM8A 2IU3A 1WPQA 1O1YA 5ADHA 3UB2A 3F6BX 1QG6A 5K3DA 2GEJA 5A2QA 3Q9NA 1EFRD 1TL7C 2ONZA 1R2QA 4LGMA 2CLIB 2R1TB 4JP5A 4N6OA 4OK3A 4LF8B 4D9JA 3QLEA 4D46A 3S0JA 1NV9A 1M7GA 1QGED 4GP9A 4HDAA 1O4VA 3TDMA 2G9QA 1GL9B 1Q92A 1U7XA 3TQFA 3WLAA 1DJOA 3LGXA 4Q9AA 2UZ0A 3EASA 3GLHE 4PYMA 3T3PB 4BUCA 1MGPA 3DLPX 2C2XA 2G8LA 4GG1A 1Z47A 4XYMA 5E9WA 4ZAFA 1FC0A 4AY4A 4RMJA 4CUZA 4CCYA 5E8RA 2I54A 1GNRA 3IBSA 4EVSA 2X5OA 5BV1A 3NDRA 2G7MC 4A6PA 5HIKA 2P91A 2JFNA 4ZAXA 3KJQA 4DN6A 4CF4A 2WHEA 5AFSA 3NOQA 1H69A 4RGQA 4O2AF 1SQ5A 2J7PA 2R5FA 4O5AA 4N49A 3U4DA 2WHXA 2HL6A 3H1FA 4LSWA 4RSMA 1TVCA 4YAKA 1QHFA 4JVOA 5DFAA 5CA0A 2NADA 2BTOA 2WF6A 1U8EA 3BORA 3EQZA 4JHXA 4L5CA 4KQ6A 3JR7A 1LFAA 3SR4A 1YB1A 5DW3A 3UJ8A 4PNHA 4MRRA 2R44A 4FJ1A 1C1YA 1HORA 2BMAA 2PKCA 3LL7A 1Q3HA 4X20B 3LWDA 3DE5X 3JWEA 3HUTA 2VP6A 3W1WA 2EKQA 3I9LA 1GCUA 3BSYA 2H2WA 4Y6RA 5B30A 1USIA 5IT0A 1MIOB 4B35A 1GGFA 2RAVA 3VSEA 2IT1A 2EWWA 2VPYA 3R5SA 1W0JA 1FE8A 3QGMA 3A0UA 3HYCA 3ZDYB 4D0RA 2XMCA 1H0SA 3QI7A 4HDMA 1UJCA 4TYPA 1PJSA 2XCUA 3EQ6A 1LF5A 4UU0A 4OLBA 3QM1A 3R6WA 4OHVA 2X0FA 5DX8A 2NNWB 2J67A 2FOXA 3GV0A 1F0KA 3UAGA 1O96B 1M7HA 3ILSA 4GOMD 1W47A 1LDEA 1MO4A 1X39A 3IURA 3I9OA 4RY2A 3TCKA 5C32A 1P2FA 4KQHA 1JMYA 1WJGA 2RH8A 3PFHA 3UMYA 2XBLA 4RK5A 1M6WA 1P7YA 3DVAA 4NOMA 4TVKA 4RVFA 1NW6A 5ICFA 3DE4X 4GHWA 4BVKA 2F43A 5DHQA 1PW5A 3TTSA 1T5DX 4BAUA 2R84A 2W6JD 3CPSA 3J7TA 4XCQA 3T3HA 4LV6A 4UTZA 4DF3A 1I2MA 1A9RA 5AKIA 2OK7A 5CH5A 4MB0A 2DY1A 1G55A 2HSZA 1E89A 2VPWA 4LSGA 2QVGA 2O2JA 2X8AA 3IV9A 1QCYA 4ALNA 1AKYA 3AVQA 3LL4A 2ZI6A 4N4AA 2YASA 5EHGA 1U2DC 4YUVA 5A5FA 3IR7A 1FX0A 5IF3A 1Y9AA 4WXMA 1Z5UA 4LWOA 4B33A 3DTVB 3O0TA 4KIJA 5HKOA 2P6NA 4OB7A 3SY8A 2HT6A 1Z25A 1N75A 4ZO6A 1E5DA 3NKVA 2ANBA 2PHZA 1QYRA 3ZBUA 3F46A 2JIBA 4PLYA 1FQOA 2KSQA 5BNIA 3RBZA 4HB2A 2M1XA 3CNQS 4KRFA 5EE9A 2QTNA 2Q9BA 1U6KA 4BZZA 4JFRA 4WX2B 1L8QA 4R71A 4KQWA 4OA8A 2ZE6A 3AMVA 2IOFK 4DDKA 1I4EB 2B6HA 3KJFA 3W3ZB 4EHAA 4AUKA 4TMYA 1MVOA 3EMBA 4TKVB 3F47A 1COZA 3LYLA 4I4CA 5IBQA 2NZUG 3H3JA 4LHXA 1E92A 2GBIA 1U8XX 3EVNA 2QAGA 5JAIA 1Y7HA 1SK8A 2WQZA 2I91A 1MRNA 2JGDA 2JHPA 2PZEA 3ZE2B 4DG8A 2B0CA 5HJ5A 1TCVA 2PLNA 2XIQA 3VVMA 3FVVA 4B32A 4AAYA 2G6TA 4RJJA 1DL5A 1KU0A 3P0EA 1NVKA 3V6LA 4J4TA 4QDOA 4ARZB 2YCLA 1IHPA 2PIAA 1K97A 1NYTA 5GM2A 2G71A 1EFVA 2D3TA 3W2HA 4RLSA 4B73A 5JZMA 4O4IF 2IOFA 3KKNA 2JGEA 2Z9CA 3PNPA 1FDSA 5SZKB 4LUCA 5IABA 3UCEA 4QDJA 3TR0A 3NHYA 4B44A 5T6MA 4BO2A 3AF1A 4BJ5A 3FYUB 4E2ZA 5AIBA 3UFXA 4EECA 4CM8A 4NPAA 3MB5A 2YZMA 1JKJA 1KPHA 4BL5A 2QS9A 3LUPA 3UV7A 4NDNE 1UADA 1OX4B 4JEHA 1IWPB 3F5MA 1ZA2A 1DCKA 3PEFA 2GM3A 2JCXA 3OZ7A 3HBFA 2VHWA 1WF6A 1KI1A 1EWYA 2KI5A 3L1KA 1SKUA 3WYEA 2DQSA 3LDUA 3HJNA 4MW4A 1WEKA 2ZS8A 3KCNA 3OY7A 3EVCA 1SC1A 3R7LA 3I3OA 1KPIA 2YWBA 3DPIA 5EN4A 2ZJ4A 4EJSA 1WXIA 2B4AA 3TLAA 2YY6A 4MI6A 1EXNA 2QY9A 3HJAA 4N9WA 3EZYA 4URWR 3C7KA 4KH0A 1EGAA 2AE2A 2G4VA 2AIRA 5DNWA 1ZXXA 2XWBF 3PUWA 2PUWA 1UKEA 3K0AA 4LV8B 4WKNA 5A6VA 5J4VA 1ORIA 3MS4A 1KI3A 3G02A 1DJPA 5K8VA 3HI6A 3WLPA 4HX5A 3HV2A 2B78A 3H8JA 3SG0A 1G0OA 3WLHA 3C3AA 2GN0A 3BCUA 1JHQA 4G1VA 1EA7A 1LWNA 2ZUWA 4P38A 1A9QA 4KMOA 4NYJR 4YT4A 4ZI5A 2OCYC 3VA7A 4WKBA 4ZOQI 2IHNA 3BH6A 5L9AA 1JDUA 2ID7A 2Q41A 2QVYX 3OESA 1W6UA 2QW8A 2E18A 2QW1A 3Q88A 4MVJI 1E0JA 1ZJJA 5C34B 1ZRNA 2FVXA 4WLFA 2P9TA 3AR3A 2GN8A 5HW0A 5B7NA 3U3DA 4Z3DA 2AFHB 4W5QA 2QZPA 2B7LA 3B38A 4RD3A 4YR9A 4RTQA 2LIVA 1PP4A 4I9NA 1JN0A 5H3LA 2WK1A 1NGSA 2CUNA 4X3PA 3RTAA 1HBJA 4C88A 3SSMA 1ZLXA 2Q0HA 2IZ1A 3RSGA 2DU8A 3L7DA 4H6PA 1U0LA 2BMFA 2HSWA 4R5HA 4W6ZA 2N75A 1A5SB 3RWBA 5TGDA 2UUBB 1G1MA 4LGYA 1L8AA 3AF6A 5KKNB 3P0JA 3B1VA 3GG9A 3KLMX 1R4ZA 2D7CA 3L0ZA 3P9XA 3PTLA 3SYKA 1G5HA 1X14A 3DE7X 4RSRA 1DDGA 4UCFA 3T61A 1S2LA 2HLHA 3Q9SA 1BU8A 1O9HA 2HHLA 2VYND 5CIQA 4YXFA 4ZHQF 3AR7A 1DJMA 3X2SA 1E32A 1TTHA 4JEMA 4YYEA 5JNLA 1CR1A 3UOWA 5B2EA 4G81A 5ILQA 3FYSA 3IQZA 3UAYA 4F56A 1AC5A 1COWA 1O0CA 3HCWA 1VLVA 1B74A 1G4AE 3G7UA 4BGUA 3NH6A 2BI4A 4EFLA 2C1ZA 4EYEA 4TTRA 3RTDA 2DHEA 2I5PO 4XW2A 1ZCJA 1G3UA 4LHWA 2BUBA 4NPCA 2QN2A 1OLXA 4J0GA 4C0HA 1JMVA 1SD1A 4FCCA 5DCUA 3N8IA 3I3SR 3O1IC 4XIJA 2JH8A 4ZYTA 2FWMX 3D5QA 4Y3UA 5CDSA 1GQSA 3JYHA 2DLNA 4PLZA 3TOSA 1SQSA 2X0JA 3HBNA 3O6VA 4QOJA 3ML1A 2CWDA 1AKVA 2YFKA 3CT6A 3IMKA 3VR6H 2M6KA 4G0ZA 2WJGA 3IL2A 3JQ8A 2JC3A 4GBGA 4LDQA 1SKYE 3RC7A 4MDHA 4ZVTA 1DWOA 2E5FA 4HDRA 3GAAA 5BSKA 3DEJA 2A9FA 3GAMA 4MS1A 2X41A 2H3EA 2VK1A 3HYLA 5ALZA 4UNIA 3DFUA 1Q91A 2FPRA 3TLXA 3P1JA 3U7EB 3ZC3A 1DZIA 3WOVA 4CMEC 1KZHA 2B2CA 2IOHA 3D4PA 2OXFA 4LRQA 3WQBA 5BYAA 4H1HA 1UBMS 1NW3A 4EKYA 1WL8A 3TGLA 3CE9A 4JYMA 3BIXA 3ZHBA 2O6LA 3EY9A 1KSHA 1EDDA 4UXJA 3D2CA 5IK2D 2GZRA 3ZX5A 3BJEA 3HCNA 4ALLA 2UXDB 2LBPA 9MHTA 1GO2A 4QDKA 4F5ZA 3ZVKA 1VC2A 2KS6A 1NATA 3WK9A 1O2DA 3VGPA 5IK2A 4K2AA 3RDPA 1P81A 2IHUA 5AM1A 5GAJA 4EIWA 1P19A 1Y3HA 2OAGA 1TKBA 3E7WA 4DDHA 4IIUA 1XQWA 1VE6A 1BCRA 2A1UB 1DEKA 4G5QA 1K5DA 4DCSA 1ZM9A 3O92A 1I30A 1TE2A 2YIVX 3DE3X 2A1IA 3B1YA 4NR0A 3TXYA 4ZYYA 1G0NA 3K0FB 1AUVA 1E2QA 4KR2A 1S2NA 2AX4A 1E6MA 3OETA 4NVRA 2IEIA 3NNDA 2GJ8A 4QOSA 3VNRA 1WG8A 2FEWB 4PIVA 1I4TD 2IPMA 4C1BA 5EHXA 2OCXA 2PU7A 3LDHA 4GX1A 4QQKA 1JLMA 3MOGA 2QRUA 2QE6A 3B6ZA 3E7XA 2BD0A 3Q7SA 3ZKAA 3BA1A 1R8SA 3VTKA 1Z26A 2AWNA 1RMYA 2UVPB 3MW8A 3PNYA 5G0UA 2XI4A 3DR5A 3ONNA 2WYOA 1WDWB 1Z39A 4WXRA 4HP8A 5JSFA 2DB3A 2H0RA 4D41A 2QAJA 2WB4A 3C6XA 3E7PA 1U28A 4F3NA 5K0SA 1HL3A 1Y0BA 3K5PA 4N03A 1KEUA 3ZUGA 1N6OA 1YHNA 4JT2A 4MUNA 4BNLA 2OAEA 4DLKA 1N25A 2AJDA 3ZGVA 2Z8YM 4I9FA 2Y0BA 2BJVA 3VBCA 3K9NA 1VHDA 2JGAA 1PX0A 4R8VA 2QF7A 4R7GA 9LDBA 3L93A 3BHMA 5FPHA 3NKLA 1YHZA 1HUQA 1FIUA 2PKRA 1H5QA 5KWSA 4DUYB 3FLMA 3HJHA 3IX7A 1HMYA 4TQUS 1SBTA 1JSLA 1XLVA 3F6CA 3GGGA 2BHNA 4HNSA 4C0BA 3A1UA 1IM2A 1M5RA 4X5OA 2CNNA 4MUAA 3ABRB 4F3YA 2ASEA 2YMQA 4QUJA 3Q10A 3RIMA 4YP1A 2ZSKA 4H0FA 3V3TA 4DV2B 2Z83A 1REQA 4AYTA 5AUNB 1VKOA 2V7PA 4GGOA 1L7VC 4K1LA 1ES9A 1Z0UA 3PENA 2WWYA 4AJLA 3ETGA 4X91A 1F17A 4DA8A 1ZD8A 3DR3A 4EUFA 1WBDA 3AF2A 3EPPA 1E1QA 3VPXA 1PEKE 2SECE