1S3IA

Crystal structure of the n terminal hydrolase domain of 10-formyltetrahydrofolate dehydrogenase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
MKIAVIGQSLFGQEVYCQLRKEGHEVVGVFTIPDKDGKADPDGLEAEKDGVPVFKFPRWRARGQALPEVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGTAPRCPQSEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTSGLSTQGEALPIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQLEDGKMMPASQFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title The crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase: mechanism of hydrolysis and its interplay with the dehydrogenase domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase, oxidoreductase
total genus 92
structure length 307
sequence length 307
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 1s3iA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1s3iA01
3Q0IA 1FMTA 3P9XA 3GARA 1RC0A 4PZUA 3DA8A 4ZYXA 5J9FA 4ZZ0A 2YWRA 1ZLXA 1RBQA 2FMTA 1S3IA 4QPCA 1RBZA 5CJJA 4ZYZA 4TTSA 4TT8A 4ZZ2A 1ZGHA 2BLNA 4EW2A 3LOUA 3R8XA 4YFVA 3O1LA 2GARA 4ZYWA 3NRBA 4ZYYA 4S1NA 1CDDA 1RBYA 2CFIA 1JKXA 4R8VA 3AUFA 1RC1A 4ZZ1A 4TS4A 1C2TA 1NJSA 3DCJA 4QPDA 3AV3A 4Q12A 3KCQA 4NV1A 4EW1A 1GRCA 1MEOA 1YRWA 4ZYVA 4ZZ3A 5J63A 1CDEA 4ZYTA 3TQRA 2BW0A 1MEJA 3TQQA 1MENA 4YFYA 1RBMA 3W7BA 1ZLYA 4DS3A 4ZYUA 3OBIA 3N0VA 1C3EA 4EW3A 4IQFA 1GARA
chains in the Genus database with same CATH superfamily
2AG1A 4FYKA 3M5DA 3FAZA 4RS4A 2RIRA 4B32A 2FMKA 3H9EO 1LF0A 2X0RA 1AKWA 1E2UA 4FD3A 4CPDA 4ESEA 4OX9B 3VM6A 1SR8A 2GZAA 4DG8A 1ZYUA 2A0YA 2QZPA 2ZJ4A 1R00A 2BHSA 3Q7QA 4RD3A 1WVIA 2BEKA 2C94A 4O2BA 3OPNA 5J4LA 3BJRA 5KYKA 4DR4B 3ZHYA 3UGJA 4CFSA 2MSKA 2QG4A 2QUBA 3SKYA 1O5OA 3G7UA 4YQFA 5EP4A 2WJJA 4TV8A 1E79D 2Y1XA 4XCXA 4MI6A 5EL0A 1K5GA 3LX8A 1RXCA 1N2OA 4D4MA 3OZBA 4OL0A 4OA5A 2BUAA 4J1QA 4PBRA 3ANSA 4ZQBA 1WSDA 4BLTA 3OQIB 5CB0A 2RHTA 3EIFA 2IYVA 3HCDA 3OJWA 5LBIA 3AW9A 2V7QD 5ELMA 4BE7B 4G5OA 1RRPA 2JVJA 1CUFA 3L3BA 5FPPA 1B0ZA 2APJA 1HSOA 1Q12A 4BMXA 4ZJPA 4MQEB 7MDHA 3UT6A 1P8AA 1REQA 3M1LA 3TRJA 3PRYA 5GIOE 2V1UA 2BLNA 1YSCA 4IAOA 1YWGO 1UFQA 4RE6A 5TF0A 4M87A 1FX1A 1Q0UA 4BUJA 1TW3A 4OHZA 4Q03A 3DHWC 5A3VA 5C8YB 3EZGA 3WYAA 3SQNA 3ZI7A 7REQB 1JDSA 4YBZA 5DXJA 5FWXA 3LUCA 1JNXX 3E3AA 4R1QA 3N9IA 1GLNA 4Q9LA 5F4ZA 1Q3TA 3WZ2A 4RTOA 2VNJA 3BRWD 1YZNA 3AI3A 5C2JB 2H4FA 4JJ7A 2GK4A 4HLCA 5DDIP 5EWLA 5HZHA 4YRDA 5EMLA 1NMZA 1A0OA 1ZZEA 3E5RA 5MFZA 5ESXA 4Z4FA 1E5VA 1XN1A 3GA0A 4MS4B 3UWDA 1A98A 1U8XX 4A15A 3MUEA 3TNDA 1E0KA 3IMGA 5FA5A 1M7HA 2D59A 5BW5A 1TTQB 4MUMA 1FFWA 3ND9A 3SBEA 3ZK7A 3L0ZA 2L17A 4MW2A 5AKLA 5CURA 3SZOA 4RF2A 2YWCA 3GB9A 4OQDA 4BPRA 1XCOA 2C3YA 1DINA 1E20A 4LE1A 1YDMA 4CTKA 2XWSA 1KAMA 1ISSA 2JJQA 2GERA 4DSOA 4I3GA 4IJKA 4IIFA 4HH0A 5TVGA 3DFFA 2O2GA 4RVNA 2BBOA 2WINI 2X4IA 2XWQA 4X9XA 2PD4A 1KNXA 1P0FA 2FJ0A 2YN0A 5KWEA 1E9BA 1L1QA 3EXHB 4X8MA 5FEMA 1OU4A 2Q6OA 3EULA 3AR9A 4YT5A 3WGTA 4QUJA 2PEYA 1FXUA 3IT3A 1G7TA 3RHFA 1RYNA 3KOWA 3ZGZA 3TLZA 4B5KA 4RJJA 4URHA 4YRNA 5AYVA 4M6WA 1BQ4A 2P6OA 3AEQB 2DM6A 4PZLA 1T6XA 5K8LA 3EEYA 2C1EA 3ENZA 1BGWA 4V0OA 3NTLA 1RAHA 3BJMA 4DE5A 1DWPA 4G1EB 2OOSA 1Y3IA 2A78A 4F60A 3A1SA 3G6KA 1MGPA 1T9BA 2P1ZA 3AETA 2VQSA 2WKPA 1OXVA 3FRIA 3KDSE 1Z17A 4FHEA 4TYMA 1Z8FA 3OWOA 4E6EA 4DV1B 3P9XA 2GM5A 2B34A 3AJAA 1IUNA 1VMEA 4DDKA 3SN6A 4BTLA 1GTMA 4RFSA 1XRLA 1Z36A 2AKAB 4MP6A 5AVWA 1NY6A 4MJ3A 1N1DA 4NH4A 4JENA 1W8IA 3ZWPA 4FQ8A 5DX1A 2GZRA 5F23A 4ENQA 5IDYA 1A4RA 1NHWA 4QIHA 4M1OA 3K20A 4UPEA 3FCXA 4IMIB 1MC4A 2BFCA 4W4TA 4XGRA 4NOJA 3L02A 3MJTA 4MR8B 1K97A 1HXHA 3OA0A 4QPCA 1USUA 4C0QC 1NKSA 3TVYA 1NYRA 5JH7A 1L8QA 3KQTA 4MR9A 4O4HA 4U7TB 1NNUA 4DWVA 1N6PA 4XFDA 3QHAA 3MWJA 2H54A 4IVNA 4D3YA 4D5GA 2HRZA 1NR1A 3A36A 3BF8A 1XWFA 3X43A 4LHEA 1FYEA 4JAVC 4FI3C 3PU6A 4OFWA 3UJ7A 4C4OA 3AMVA 3NGXA 2WG1A 1BMQA 1EFCA 4XR9A 2YXBA 5LXTB 5DLQC 1J33A 5DW0A 3ZIAA 3U4QB 2E7ZA 3RKUA 1Y1PA 2VSNA 3GVPA 1P4GA 3BJIC 4YAFA 1HNWB 1ZW6A 4AF8A 4PHGA 2VZLA 4I4TA 2PFSA 1IEVA 4MRNA 4R51A 2I7CA 1JJIA 2X8WA 3C1AA 3URKA 1UC5B 3X44A 2XPCA 4IIEA 1F2VA 4HDAA 5BVHA 2IDJA 3OA2A 1TLLA 5INTA 3VNQA 3T1NA 1IOZA 3LECA 4L2IA 1GAEO 1V8DA 4P98A 1BX1A 3MWFA 2YN2A 3LVQE 3GU3A 1AHIA 1IB6A 1TRKA 1C30A 1T4CA 2Q6LA 3M4YA 3P32A 4BFVA 5FULA 1KJQA 4I4CA 1XP5A 2QI9C 3DTYA 4TS4A 2OV4A 3TL2A 4DTIA 1D5CA 3UOAB 3E9DA 4Q1AA 1EM6A 1RNLA 2YV2A 2K6GA 3KWLA 3ND7A 4LRXA 3RK0A 5KO2A 3FX2A 3TCXB 3S29A 2JD1A 4UUAA 2JHPA 1E61A 1VDMA 4L8GA 5CT5A 5BQ3A 3D4PA 2GDZA 2JCVA 2JH3A 4OREX 2HH9A 4GLJA 2VHTA 3JWHA 2ONJA 4YYZA 3QPVA 4R68A 4IJMA 4A23A 4YLYA 3ZX4A 1W2GA 1W4BA 2CXRA 3TLMA 1SKYE 3M6VA 4L4XA 3F97A 4X7PA 3H87A 1E7RA 3LCMA 1T5DX 4OBEA 4ZAZA 4MZXA 3ZD9A 2ADFA 2OGSA 2XUDA 1IJFA 1DMRA 1UDBA 2OM6A 3ADOA 3DSRA 3OZCA 2AC2A 1F06A 3QTLA 4LIPD 1E9DA 1SCDA 2GJ9A 3PHBE 4JB2A 3HN7A 4XIFA 3NTXA 3SZLA 1NXXA 1O9BA 1EWRA 4Q9KA 4HT3B 1K1EA 1NT2A 1QS0B 2HJRA 4B0PA 4JI2B 1WPXA 1W1UA 1CUIA 2VAXA 3WZLA 1OWMA 3TEFA 1P7WA 4D9GA 3RGGA 4PSCA 3OHSX 6YASA 4N76A 2QMZA 4KHZA 1VC2A 2DEUA 1RACA 3EN0A 2GFQA 3CN9A 5B1IA 3LXXA 5JMOA 2FRVA 3BHNA 4PIPA 4FDMA 3LY7A 1EHYA 4KQ1A 4LMAA 4URFA 4YREA 1JHRA 3DEHA 2ID8A 3JQAD 3K5HA 5IKEA 1UK8A 4JUCA 3HYLA 1ULHA 2VDPB 4IDPA 1ZY2A 1TD9A 3HBFA 4GC5A 4AW9A 1P7CA 5IXSA 3RKSA 4KODA 2VHVA 1QPGA 1KQFA 3QE4A 1AM4D 4RELA 2BFOA 5JSUA 3QV1A 2I3GA 1Y5MA 1WUYA 5B12A 5LR6A 1QNLA 3MD9A 4K6HA 1FLNA 1VG0B 4KXLA 4LZJA 2QY9A 4RPJA 3S2EA 1ZUNA 3D8TA 3KQYA 1UXJA 4JC5A 1Q50A 2O20A 2GBLA 1JR2A 3DVAA 3KUCA 3QBVA 3Q2IA 1SUFA 4W7HA 1Z4NA 4Y9SA 4A8HA 4ZO8A 5BYJA 1PQ4A 4F04A 4D79A 1RWNA 1XMQB 1R6XA 3VUEA 2A0XA 2H2GA 1GV0A 4ALNA 4YJGA 3U9SA 2ZYDA 3O83A 1PCXA 4AKSA 3V46A 5KQPA 3DLBA 3FF4A 4BEBA 3BQNB 4M7RA 3KWJA 1XLUA 4WCFA 4XX0B 4C30A 4BFXA 4C5CA 4YMHA 4YQZA 4S1WA 3KJGA 4WKCA 4U8GA 4KQJA 1OTYA 4RHYA 3SS7X 3PFFA 4C3ZA 1JQLB 4AMVA 1BYUA 3RE1A 1M73E 1R0LA 3LS2A 5GPBA 1M5TA 3ZY3A 2X76A 4Z6KA 2ORWA 1J1IA 1P7ZA 4OM8A 1LDMA 2VK2A 3KOUA 3QWHA 2G4CA 2AOVA 1LPSA 3V2GA 4FKMA 1UFRA 3JSAA 4YCDA 1PFWA 1GGEA 1G3QA 1M8KA 1ST3A 5K99A 2YASA 3AC0A 1G8AA 3IULA 2J45A 3OZRA 1PFYA 1I5EA 2JFXA 3R2JA 4G2TA 4AIRA 1IYZA 1A8IA 3P2JA 1XJCA 2PHZA 2ZIZA 3BMQB 4QLAA 3V1TC 3WFIA 1BXRB 3A2NA 1V7QA 1B6RA 3PPWA 4DN6A 1E5LA 4RXMA 1J9EA 3S0JA 1XU4A 2PXXA 5TQ0B 2OBYA 4PG5A 3STVA 4BKMA 2CLIB 3AP2A 5HJ5A 2FR8A 1R9NA 4GLOA 5K8IA 3EGXA 3ZCSA 4NS1A 1IE3A 1DAIA 3L6OO 3X2SA 5CYPA 5AVQA 1EEHA 2XCOA 1JQAA 1RWWA 2AI3A 4AYWA 1ORDA 1C81A 1S9DA 2J6BA 3BS4A 4JLSA 5B3JA 1GVNB 3VNVA 1OGIA 1F2TB 3DYBA 3DUFB 3I3OA 3T7CA 2WNHA 4XW2A 1G3IA 5K9ZA 3EVEA 2JGDA 1CG6A 3QXJA 4I4LA 1ECBA 4JP3A 4BX8A 1W0KD 4RACA 1A9SA 2XQGA 1A4XA 4K7JA 2ZROA 3RM3A 3ZE8A 3T6KA 1XKXA 3IHWA 121PA 2OHJA 3LHFA 3QI2A 2EF0A 3QKRB 3IDAA 4GWLA 3STWA 2P3SA 4CKBB 2B0JA 2IXDA 4MIYA 1ESDA 5KDLA 2PUDA 1A7AA 3SYMA 2QJFA 2R1ZA 1AMUA 5ENVA 1RAAA 2ZU0C 2QL7A 3U1BA 1T9AA 2JLRA 3GUVA 2E55A 1S3SA 5HKKD 2LNDA 2HCBA 4KKVA 1C5KA 2QJWA 3OAAA 2WDZA 4QJ3A 3SX2A 1P2VA 2ZRJA 4UHFA 2ZRCA 1T9KA 3I30X 2Z4TA 4NFLA 3V8VA 5BT9A 1FQWA 4M0MA 4TSFA 5CX1A 3S3TA 4E1VA 1X1RA 3A6EA 4FFMA 1OXXK 2QWXA 1CJMA 1S9HA 3OG9A 5JPDA 2HA7A 4M4SA 1IIBA 4GHWA 5EJIA 3LYLA 5LUBA 3TW8A 1Y8ZA 4IRMA 2WJIA 3UWSA 5DTRA 2BP7A 2QG6A 4EHNA 4LF9B 1J0DA 2IDMA 3K0CC 3AF0A 3FCOA 1IHDA 1KJNA 2AYXA 1G42A 4FMBB 1K2WA 2IYUA 3DEIA 4BWGA 2PT5A 4ZCMA 4DUYB 1FVFA 2G70A 2TECE 1NQTA 1P33A 4LS3A 4WY5A 3UZUA 5F7JA 4XWKA 1LW7A 1ZITA 4RMIA 5JJLA 1WD5A 3A06A 4CETA 3ZXIA 3H1EA 1NQWA 2NGRA 2B3DA 2AEFA 4MHTA 1CX9B 5F4BA 2ZUVA 5JZ9A 4L07A 1X9GA 3HKDA 3VYRB 2P2YA 3KQVA 2VQEB 1N0HA 1AA6A 3IBGA 4UTXA 4DLWA 1RJ9B 3BFJA 3HCEA 3JZDA 4KXVA 1Y3HA 1NOJA 2JJ1D 2OXEA 5DXAA 2XDQB 4BMZA 4FQ7A 2K87A 2CHVA 1QCYA 2M2IA 1YMUA 4KC0A 2WOJA 4KV9A 1HKUA 1TVEA 2XXBA 3EGEA 1R6TA 3GPBA 4DWJA 1JAYA 4EFNA 2NTEA 4P3PA 1FIUA 3T1TA 1E5XA 1PUJA 2R8ZA 3ZD6A 1SB9A 1IRIA 1V96A 3G88A 4G63A 1EGHA 4AKHA 1KDOA 2OXCA 3MTJA 1ZMRA 5K1ZA 2ZB7A 5E95A 1K2VN 2YQ4A 3EQ6A 3MGBA 2C7QA 3AR4A 2EQBA 3QVWA 2PZ8A 5IK2A 4XVCA 2XVAA 4TN5A 1CQWA 3EPRA 5FI3A 2GCOA 4G81A 4KW7A 2WWRA 4N3CA 1MABB 1NBME 3O84A 4JEIA 4OJKA 3G8CA 2HQOA 2ATIA 2FK8A 3PEFA 5ALTA 3I3SR 4Q1BA 5ELXA 1BX3A 3HS3A 2QX4A 3KDAA 3TLXA 1OXTA 3FDZB 4HNGA 5KOHB 3FLAA 4D45A 1NF9A 5J5AA 3QNUA 4C7OB 4Q48A 1GKUB 4ARAA 1P75A 1ZW1A 1P45A 2A5JA 4UBNA 1SXIA 5DW3A 2Q3BA 2O3JA 2VXBA 1SIUA 3RVOA 4E5NA 4KGVA 2IYNA 1JQEA 4EUEA 4AJHA 4ESVA 1ZD9A 3NKVA 3O9MA 4AVYA 4FR2A 3FTCA 2WUGA 5A9SB 3QXHA 1MA0A 1KAOA 2QOEA 3B5JA 1TAUA 2H2FA 3AHJA 3P0JA 3F3MA 1PNVA 2HJ9A 4AZ0B 1H6DA 3WDSA 5LP1A 1T6YA 1CS0B 1I7DA 4QYIA 2HEIA 2X9VA 1Q1ZA 2CVQA 4JLWA 3H1FA 4ARUA 4CQMA 4BQFA 3AKDA 4PO1A 1ZUHA 2FPIA 4NATA 3RV3A 2FLWA 4QNMA 2XAAA 4OJYA 1LRJA 1KEEB 5CK5A 5EQDA 5EVJA 1XTBA 2B2NA 5JRJA 2AC7A 3LF1A 1XQYA 2UYYA 4FFBA 5DASA 1RKUA 5E1OA 5FWAA 4IP0A 2BMJA 1PW7A 1WQ4A 1DFIA 1AOXA 2RDMA 2ZGVA 1RKVA 3CTPA 3D31A 2G80A 4LCJA 4Q34A 2RGDA 4QPJC 4EO4A 4FHCA 2G6TA 2CGEA 3AKEA 5FA8A 3OZIA 3MW8A 4GT1A 4B3SB 5C53B 2V6JA 3U7QB 4LF5B 4Y3UA 2P5UA 1Z0FA 4NULA 2XF8A 2XOXA 1P4HA 4Q47A 5HS6A 2D62A 3BRQA 4G85A 3H5VA 5HK8A 5CFLA 3KLNA 1N5KA 3FROA 2YVAA 3PPVA 3P2EA 3HYTA 1J2UA 1XRRA 2ZB2A 1QIMA 4HWKA 1SUBA 3WRWA 5BR4A 1X7DA 4DT1A 2QP3A 1E9EA 5KVVA 1FDTA 2GJSA 5BSTA 1OOEA 3JQ7B 4AJ2A 2OAGA 3QVSA 4MWBA 3A3NA 2C95A 4UNQA 2G9NA 2WJ3A 3JALA 3NDJA 4I1UA 1WG8A 1DUIA 3F3YA 4MMXB 3PGXA 3A0RB 5AW1A 1E0JA 2P62A 1Y1SA 2HA5A 3DDSA 3EGDB 4UCXA 3COYA 3RRBA 4EHBA 1K7EB 4MW4A 3NT5A 3UT0A 1SXPA 1DJOA 4RWZA 3FPKA 4GDFA 2R8BA 3L8GA 1U11A 4V2UA 1N5OX 4LMBA 3OTIA 2X1LA 1GLGA 2WU4A 3GFOA 2L0XA 3IUBA 4MS1A 4LJLA 3SQLA 1X70A 4Z2AA 4RTNA 4YK7A 3A05A 3A1TA 2QSUA 3VDRA 1FDIA 3MLAA 1NBOA 1SK9A 1OLXB 1OYWA 2N42A 2XX3A 1MRZA 4KIUA 3NT2A 4WXEA 4EZIA 1QH0A 3RG2A 3ZWAA 1YUMA 1H1LB 1P2TA 1DADA 4H7PA 5JJCA 1DMSA 1PKXA 4US2R 4GVLA 3QFSA 4W82A 5ALZA 3GPLA 3HVRA 2JGIA 4ZYWA 4TT3D 3DMHA 4WZBB 1YJBA 2HWYA 5CFOA 1PWHA 3AZPA 3HWSA 3KYCA 3AHFA 3OCJA 1JFFB 4XARA 1D3AA 2ZFUA 4NG5A 1D2AA 5KHAA 2H16A 4HB0A 4C6HA 2X5XA 2R1UA 1KZ7B 2OZLB 2ZJ6A 3LWNA 2ZUFA 3KLBA 1UPFA 4L1KA 1PUXA 1V0JA 2BHNA 3AJEA 4YUXA 3CRRA 4NYMR 1EJ2A 4IGFA 4PPFA 4IJUA 4R81A 1KORA 1CP3A 1KY4A 2HAEA 3B6MA 4GI1A 3U3MA 3JRNA 3HVIA 5C46F 4Z8XA 1KMHA 5EMKA 4B3TB 5LA6F 4A6XA 3RI3A 1IB0A 2MT9A 2F64A 2CZCA 1FYDA 1UEXC 3QOYA 4LJ9A 4XVRA 3SZUA 1EB9A 1XYYA 3RHTA 2NUAA 5IKOA 4HS4A 4QVGA 3LU1A 4RMHA 2QZ9A 4ISBA 2FB9A 2OHXA 5AT1A 2XZPA 2CD7A 2JBAA 3HCRA 3K5IA 5FI1B 1K6XA 1ELOA 1YCGA 1VJTA 1BWQA 2AVNA 3AU8A 2D2IA 1ZESA 2K2WA 1VKNA 1JRLA 1J0AA 2I2AA 5AI5A 3GBSA 3DLPX 1PL7A 1TF5A 3FPEA 4KLZA 2HF9A 3VR5D 3IBSA 3PD0A 4MZDA 1K5PA 3JPWA 3HKCA 5L4SA 3K1ZA 5TS3A 3KXIA 2IC5A 2Q6KA 2XBUA 2GN8A 3ABZA 3FYHA 2XYGA 4C6TB 3NFRA 1V48A 1XMSA 4OXQA 1L5NA 4V02A 3WLNA 4EPYA 1MB2A 2ZXEA 5EJEA 5EHZA 1SD1A 1C1XB 1JJAA 4QBHA 2UVQA 2PJUA 1SXJB 2RJOA 4FYWA 4XIYA 4DV5B 2RGAA 3KE8A 4JBXA 4HAVA 4M99A 4UMEA 1CWUA 2IPLA 1O89A 1NE2A 3HB7A 5HEKA 2XGSA 1RTTA 3PRKE 1N2CE 4IWNA 1XA3A 2MYNA 1DWUA 4H59A 1NIJA 3LGXA 3SR0A 2QDKA 2BGGA 1C50A 3V2IA 1TQ8A 1WW2A 1AHPA 3OJLA 1W1WA 2SNIE 1WLYA 3N76A 1GGMA 4NJMB 5KNLA 2GUGA 3ABRB 1I5RA 4QDKA 2C82A 2IY8A 3RTBA 2IOFA 2V03A 2PMCA 1KIMA 3RYHA 3MELA 2IPXA 4YS6A 1G5IA 1ZEJA 1BJRE 1CY1A 3CONA 1E6MA 2EARA 1ZZGA 1JPVA 4UMVA 2GHTA 3M2PA 4D3DA 4QTYA 2TMGA 2Y1FA 3CPHA 4IXDA 1ZBDA 2ODBA 3WYGA 1JG7A 1VFNA 1CXZA 2Y9PB 5IT9A 5BN1A 1JQ5A 1SH7A 4GLLA 4QODA 2H4JA 1QM5A 1O94C 4KN5A 5WRFA 2EBUA 2J7PA 3SEZA 3TL3A 1VL8A 5SY4A 3ZWWA 5AQ1A 4FGJA 3DE0X 4R1TA 5AOBA 2DLCX 4D81A 5C7YA 1PQYA 5FV7A 3LTEA 4F3TA 2P11A 3H86A 2BC9A 1X8XA 4UUMA 1C7FA 2BFFB 2D5CA 2QD5A 5K3OA 2Y3IA 4IGIA 1Z5GA 2IYYA 2JHFA 4BQSA 3ZGLA 3LPDA 1Q0HA 1WLSA 2QYOA 4CRWB 1WHSB 4TQAA 3WJAA 4XVQA 2EL7A 1X7ZA 3O38A 3WL7A 1KXJA 1DEAA 3ZY2A 2JIDA 3G6WA 4FX2A 1QH9A 4M0FA 5IYZF 3GLIA 1M7BA 1O6BA 5CX4A 1A8QA 2GNOA 4NZNA 2J32A 1NUQA 4Q3DA 1JEQA 5EUCA 1WWKA 2XOEA 2P5YA 4J7AA 4FOLA 5JPIA 3SHFA 2HGZA 1QU3A 5DJ5A 5IABA 1AURA 2FQ1A 4XQEA 3S5JA 1J70A 3P2OA 4B6FA 5EESA 5GGYA 3AW8A 3IUNA 2XR1A 4EFLA 1QANA 3ZTYA 4E7PA 1CUHA 1JJVA 4CEHB 3QEOA 2JGEA 3ETDA 3NJ8A 4ZCIA 3HDVA 3AX6A 4RADA 1M0EA 3IVXA 4MQLA 5A6SB 1R10A 5LZ2A 2I03A 2FZGA 3WYCA 3WKEA 5DCWA 2QSJA 1XRQA 3NHAA 1G66A 5K6RA 4ITRC 4LC1A 1E6EA 2HW8A 4RF5A 3WGNA 5DN6D 2RH4A 4MR7B 1QGZA 4S1PA 3A8TA 2V6BA 5DGXA 5HSGA 4AZTA 1DKMA 4GX0A 5AKEA 1AS3A 1JB9A 4BO8A 1QV6A 4NYJR 1FRZA 3BM5A 4Z9FA 3NEYA 4TUYB 5HS4A 1BMFD 1XMIA 4RLQA 5LL6P 1VLVA 3HGMA 1YDFA 4XPIB 1M34E 4H3HB 4INOA 4RETA 1LLDA 1VHJA 1Z73A 2Z5FA 3S81A 5JOQA 4MS3A 3ASVA 1BGVA 3HLYA 2K7FA 3HVHA 1COZA 3F8WA 3OLZA 3IQDB 1EFPB 3B82A 3N2KB 1XCJA 2C5FA 3EEQA 4D9KA 1G20E 4E1AA 3CPSA 2V4ZA 1EVEA 5KOIA 4JEUA 2IS1A 1JTEA 5CMLA 3T06B 1U1CA 5FI5A 3PL1A 4TYWA 1MQSA 4DMKA 4ESOA 2VUIB 4KIWA 1UMBB 5DPMA 4H7IA 4QBKA 4RF3A 1PR6A 2FOLA 4P32A 1MIOB 2YVLA 4TMZA 4DR6B 4PG7A 1FSSA 3VJRA 1XI2A 3L5KA 1LCIA 1I10A 2QKYA 2HRBA 4ZOEA 1TFRA 3CW8X 4WDRA 4H1VA 1FNMA 5J59A 1KMCA 2AX3A 1T1RA 2C5EA 3AHHA 3F6EX 1CY8A 1XXLA 3H11A 3KXLA 4HG2A 3K92A 1UM8A 3NS7A 4GX2A 4J90A 2OAEA 2YBDA 4ZCTA 6PFKA 4EPWA 3RDPA 1NVDA 1JG4A 3AF1A 4K9RA 4M8NE 4AJNA 4C0WA 4LOKA 4BE9A 3V4SA 3CINA 4HN9A 1KFEB 3FKSD 3V5NA 3VNAA 4JLPA 5IASA 1NL3A 3Q3CA 2BZ1A 5EIBC 3MFYA 1UZAA 1PV2A 2RGUA 1TECE 2JC3A 5JC8A 2P9CA 1JWLA 1J0XO 1JDTA 2CDNA 4HJXA 5AW7A 4Y6GB 1YTUA 1UBTS 1WB6A 2E3JA 1AU9A 3R75A 1QH1A 4F4DA 4FFDA 5KWSA 1MDFA 6CHYA 4L8VA 5K0JA 2IY9A 5TDHA 3TWOA 1Q0QA 1Z82A 1OTXA 3BQMB 2CHUA 3GAZA 3JQCA 4KN8A 5AVSA 2DTXA 3FUUA 3IEVA 4RAOA 5G40A 1XHEA 3K05A 2BZGA 3QPUA 4EKIA 2XITA 2E49A 4MRMA 3IL2A 3I9LA 1K7CA 1U7TA 2WMNB 3BWCA 5JQGF 1SCUA 4XWYA 1CD5A 2XKBA 1OWPA 3U2QA 1X8JA 1HGXA 1V25A 4IV5A 5KYYB 4GBED 4NS4A 1X9HA 1A77A 3CB4A 2HFJA 4YDRA 2A5GA 3QWIA 1U0EA 2RI1A 1V1RA 4M9CA 3K0CA 2HQ1A 4QTTB 5A3SA 4F38A 3O8CA 4RY2A 2IHKA 5J2UB 4NV0A 5DO9A 3BL5A 5AK0A 4I3HA 5EP3A 3QOXA 1CT9A 1JHDA 2PL5A 1C41A 5HKBA 3D8SA 2QMOA 3PR3A 1C3LA 1FMCA 3BB3A 4MYSA 4Z1MD 1R0SA 4FMPA 3TAUA 4X8OA 1F8FA 1GCUA 3CE6A 4BUCA 2R85A 3IIMA 2OAQ1 4EX7A 1BMTA 4D3XA 3R0VA 2WWFA 4AUNA 1C80A 4C2BA 3PJDA 3GH1A 5EJ9A 4TZ0A 2YXDA 1FPMA 1C7JA 3M1AA 4PG6A 5K4AA 4CMHA 5FLXA 3Q3JB 4CU2A 1SVWA 4PYIA 5LSAA 1SZCA 1HEYA 3DE1X 1FLVA 3K0FA 2YTZA 4QGGA 4ZTBA 1X1TA 2BUCA 4RABA 1JDBB 3ZJ4A 2BW0A 4BAZA 2AFRA 2QSYA 4CE6A 3KKEA 3WO1A 1LQTA 4K6GA 1HT0A 1TXGA 3H8VA 1GTVA 2XHEA 4EK9A 2CKMA 4MLZA 4RY8A 4FWBA 3AINA 5L7WA 3RYCB 5DHPA 4EEKA 1VJRA 1CUDA 5IAEA 1FS5A 1YE5A 1DIGA 1RABA 3UJBA 1JLRA 1OV4A 3D5QA 1KDTA 3F47A 2GCNA 3TW0A 4U7JA 1AV7A 5NLLA 3QE9Y 5EINA 1MLDA 1Z4OA 3EXAA 5ALJA 1WEHA 4F3RA 1NPTO 2XIJA 1XK7A 5IVIA 4HGQA 3GEPA 4QJ5A 2Q2WA 4KTVE 3A9WA 1I7SB 4GC9A 5ER9A 4WVFA 4C7JA 2HWKA 4GKBA 3TCNA 1ADBA 1Q0PA 3I9FA 1FUYB 1HA3A 1UJMA 3LXUX 4L08A 4YJDA 4XX1A 3UF0A 3U9TA 3K6JA 4LKOA 4MV1A 2BMVA 3CLUD 1ZGJA 1M74A 4QATA 4DQXA 1R4NA 2PEZA 1YB7A 1QZUA 2OQ2A 4P4UA 2A9RA 3SMQA 3FWKA 4UEQA 3ZIUA 4Z0HO 3AUYA 4HNTA 2VT7A 1THTA 3L7AA 4JJIA 4RJIA 2D1SA 2ZUSA 5IBPA 3VH1A 2BEUA 2H2HA 1R8JA 1OTHA 2Q99A 2O9JA 1T6ZA 5KINB 4K9QA 2VOEA 1M6YA 4WIAA 4QOFA 1OR8A 3OUZA 2PGAA 2IT1A 1AY0A 4F56A 1IN1A 3GRZA 4OB6A 5LP6B 3OQOA 1X6VA 1RHRA 5I9IA 1SGWA 2N0SA 2QX9A 1C9DB 4NCIA 3EH2A 4B4KA 4I9UA 3EOZA 1VL2A 1LSSA 4LYJA 4PYMA 2F43B 1A2QA 1Z7GA 2EGHA 2J0SA 3LSTA 4C0LA 4P86A 4ZMSA 2EKQA 3AY0A 1XTQA 3I12A 3MINB 5E2IA 4QOSA 3B1KA 4TS1A 4D56A 2YJ6A 1OAAA 2ORVA 4UU8A 5K3FB 1V43A 2WNSA 2PZKA 4KO1S 4OLJA 5MHTA 1N7JA 2D0PB 3AR8A 3H6HA 2X6QA 3FHOA 1ATZA 4MULA 3KC2A 3G8DA 4OQPA 2BTEA 1D9XA 1RBYA 3HDGA 1WNTA 1AGYA 1VJGA 3PUYA 3RS4A 5A2GA 3LUJA 1X86B 5BOVA 3VHXB 3GIWA 1OX6A 3HCCA 3IMKA 2D0IA 4MLDA 1YD7A 3CBQA 1H0RA 5TGTA 5D5QA 1P7YA 1VMIA 2VDKB 5F2EA 1NN3A 3MBIA 4X20B 2VAWA 5TR9A 2G0AA 2W70A 4BO0A 4IKPA 4ZTUB 1GA4A 2Q41A 3QJ5A 4OB7A 3D8NA 4LY0A 4S05A 2NV2B 3GDOA 4YRTA 4CG0A 4IQ8A 5A04A 5IS2A 3EZ2A 4B2PA 3C2QA 1IOLA 5JQGB 5I9SA 2X8BA 3VX4A 3W6PA 3E8SA 1UXIA 3OLXA 1KGDA 2CHQA 3PQDA 3G0BA 3ITDA 2F17A 1SVKA 3Q5EA 3FSJX 3ZC3A 5LZ7A 4TLDA 1ONNA 3FMGA 2PWPA 3LKBA 3PKZA 2FSSA 2AOWA 3QVXA 4R8LA 5KQGA 2P7HA 4FOPA 2XQKA 5EZSA 3TIIA 3V34A 3UJDA 1LJ8A 1XRMA 3U7HB 1KFKB 4YONB 1O9HA 3VH3A 3PGLA 1NRJB 2EERA 1RWKA 2CXHA 3VAAA 1IVYA 1QONA 2ONYA 1QGDA 2JS7A 3MT0A 4RUKA 3FB1A 1Y80A 4M46A 5JI3E 1AQLA 1P77A 3GAFA 1MUUA 2R87A 2H85A 1W88B 2CVPA 4OQ4A 2JBWA 3QG1A 1JSRA 2V7TA 2II6A 4EW3A 2WOOA 1E3MA 2INGX 4L72A 2G0TA 1ZVQA 3GH3A 3J80A 3K9NA 1EK1A 1HETA 3PCRB 3CJQA 4HDNA 1G8KA 4D74A 4LRUA 3ID6C 1FU8A 3LSYA 4MLPA 1BKDR 3A6LA 3BIWA 4GVPA 1PV4A 2VK1A 2NO6A 3QLTA 2V4MA 3IAM6 4N65A 4MIOA 5JJ5A 4C7MA 2JG3A 3IQGX 4RSMA 4XTRA 5EKXA 3I5YA 1P91A 1CF4A 4NECA 3VDQA 4FYIA 1HRKA 4IXMA 3DL0A 4WNAA 2PBRA 2YJZA 3T9CA 3E4DA 3WLSA 5G1NA 3G7NA 1TTHA 1GL9B 2IYXA 3AKZA 1CU1A 2OV1A 2QAGC 2YRFA 3OIVA 2FPUA 2QNRA 4M8KA 4TSKA 1J5EB 2P69A 4IV8A 1O2DA 3W5IA 4E5VA 5JYBA 4RL4A 2VPIA 5FB3A 4CUZA 1Z34A 4HQRA 3EHDA 5B2ZA 2CF5A 2EEZA 3OWXA 5HF9A 5AJWA 1LFDB 3DF9A 3K9WA 4J0QA 5AKHA 3JAMA 3N74A 2JZNA 1IWOA 2XQJA 5AI0A 1U63A 2VDWB 3Q0EA 1YRYE 2P67A 1N3LA 4QUDA 3TBFA 4BLQA 3JD2A 1YRHA 2GZ3A 4OQLA 2AJBA 3FUTA 1I0IA 1SB8A 3FTPA 3H9JA 3R5FA 4C29A 1Q1AA 2B2XA 1CNMA 4FHZA 1JUDA 4KK4A 1XLWA 2W2OA 5IW8A 3OKPA 3OMXA 2FJPA 3ISJA 2EHJA 3GVXA 4JWKA 2XZOA 1VHDA 4JZYA 4BEJA 3TZKA 5BV2P 4NBLA 5BWOA 1PWZA 2GBCA 2QT9A 2I7VA 3H4TA 4UREA 4ZVQA 5T4BA 1ZD8A 3HA5A 3ZOKA 2QN1A 4OBBA 4BN4A 5CB8A 1QC5B 1QV7A 4C21A 4MITA 3SHQA 3EDMA 1CZLA 2H1OA 5TV2A 4F93B 1F14A 2ECPA 3PR2B 3HZHA 2GPTA 1JJBA 2HSJA 4M9RA 1Z0AA 3U19A 4CLRA 5BXQC 1BHJA 3A1WA 3CZ4A 5F52A 6REQA 1LZLA 1V6CA 1M9NA 2Z30A 1NSYA 4L8FA 2FZEA 2DPXA 3A3OA 3W8NA 4H1HA 3WLOA 5IXYA 4I0WB 4DMLA 1TC1A 2X19A 3MJEA 4OQMA 5AXCA 5ICFA 3WGZA 2RGRA 1O94A 2C9BA 3M5WA 4OHYA 3GDWA 4QJIA 3WWPA 3WA7A 4PYQA 5C4GB 3DW1X 4Y6RA 1KP2A 1WHTA 3T5DA 3KTAA 3RSLA 2W6JA 1D0VA 1JA0A 2MR5A 3Q41A 5DTIA 1V11B 2EYUA 2BFWA 2Q3CA 3OM9A 4KYUA 1EUZA 2JFNA 4LJAA 3PHJA 3QWBA 3DE7X 4IHQA 2AN5A 2MU1A 2W4MA 3QLUC 4E2YA 4PLZA 2I4RA 3FVRA 2E82A 3IUMA 4UAVA 4N3NA 1O97C 3QENA 1W5EA 2G08A 2ZG6A 5ITWA 1XNRB 1O57A 2ALJA 1NMQA 2MMGA 3G0DA 3GLVA 3ZE1B 1D2NA 2CVOA 2I6SA 3PRHA 3RJTA 4NEQA 1PR9A 2Y1OA 3SIPA 1IQUA 4XSVA 3ZHRA 2Q50A 2WJYA 4YMTA 4B7ZA 2VF7A 4DEVA 2NUPB 2FEWB 2VTVA 1HE4A 1XQVA 2XB9A 1PS8A 4JGGA 4Q9AA 2JGKA 1SKYB 1ECGA 1U98A 1W5TA 4RV4A 4WZ6A 2C2ZA 2C2YA 4M55A 4HBGA 4Y2RA 2WB4A 1QO0D 5KC9A 2JI7A 2GHIA 3BFPA 3GCDA 3HYRA 4WJZA 2PH3A 4WBNB 2IH5A 2QQEA 1OLSB 3DLCA 2WKQA 4MGIR 2W42A 4FFLA 1C7EA 5JALA 3AIOA 4OMFG 4YCJA 1CUBA 3QV2A 4XXHA 4YEDA 2I3DA 1L2TA 3FMFA 2BMEA 1RI3A 3M3HA 2DHCA 3K1AB 3KEMA 3C3DA 5TQJA 4KWEA 1A7KA 2CNNA 2D06A 2PLWA 1VPTA 4E4TA 1ODLA 2QRUA 3H3FA 3EIQA 5JC1A 3B1XA 1Y9JA 1RZRD 1IH8A 2PMKA 2PPVA 3V8NA 4HUTA 2XD4A 3KOZA 4J1TC 4EP1A 3FNEA 2EBWA 3KQKA 2P2SA 3DV0B 1FJXA 2ZBGA 3ESDA 1E9VA 4IR7A 4MIEA 3EQ7A 3CR3C 1ICIA 2YOGA 4MOWA 2RGNA 2CEAA 3L82B 4BNXA 1QO9A 5BNZA 1IRXA 2W93A 1CUWA 1DDIA 2H8GA 2X5KO 3LVFO 3OF5A 3OOHA 1XZHA 4Z9BA 4DA0A 1N5RA 1X7XB 4HNAA 1EVQA 4EYEA 2NO4A 3EXHC 4GZ5A 3NAGA 3LQ1A 2O1XA 1KI1A 2BEVB 4WHMA 1UJ5A 2BSQA 4C7XA 3KSAC 1ZOOA 1SC3A 4XFKA 3E2IA 2BMWA 1U8YA 2AF3C 4GMXA 3ONEA 1RJDA 4PAGA 5AK6A 4RYDA 1GQ2A 4UBOA 4W8OA 5HQ3A 1MG0A 3T1HB 2IW1A 4OUKX 4DLPA 2DFNA 2O52A 3M6MD 3HJBA 1QU2A 2QEQA 2E1RA 5BUSA 3P9SA 1SOWA 3OO0A 3HXPA 4CKYA 3N8KA 1B15A 1GPNA 2OG1A 3R3ZA 5JY1A 1I30A 1MP0A 1PD0A 2KX7A 1DBVO 3K4PA 2JANA 1ZJJA 4KQGA 4BNDA 3WQHA 4WJLA 2MYPA 4NBWA 3WIEA 3QFCA 1N78A 1YU6A 3UKDA 4ZQEA 2NUBA 2G1KA 4KOEC 3DV2A 3LX6A 5LLSA 3T7SA 1TAHA 3HY4A 2SBTA 4UVHA 3TTYA 4GL4A 4H6VA 4WVLA 2FI1A 1U2TA 2RK4A 5L3SA 5KYWB 2JAPA 1PF7E 2WUDA 1QP0A 3FAKA 2HRRA 1RADA 4E13A 4XDHA 1Q6ZA 4TL8A 4H6PA 1I4LD 3VX3A 1PQWA 4A1FA 3NTUA 4KO8A 4EI7A 1YAJA 4XVHA 3W7VA 5T7BA 4CMIB 1QB8A 1YJCA 1MO5A 2IRWA 4RKQA 4MV4A 4YP1A 4F4JA 5K09A 3AM3A 1T25A 2B1GA 2OBXA 1N2GA 3D6MA 4LZWA 1I01A 4ZXPA 1T24A 5AHXA 3QKSA 1AIPA 3C39A 3SHVA 5DTJA 2NT3A 4DCPA 1K6EA 4KFSA 1N77A 1H4QA 5AM5A 1X3SA 5GTDA 5DTEA 5JIBA 2LIPA 5HRCA 2D7JA 4WAUA 4KFCA 1SKAA 3OQ6A 3M82A 4RPHA 4KXUA 2Z1DA 2FLVA 1WV1A 1LF5A 2LE0A 3ZNPA 5KOYA 4EMTA 4F1JA 3TECE 2CYCA 3T15A 1GA1A 1HC7A 2DSNA 2B20A 3QXXA 1JQDA 1U90A 5F1PA 2RGBA 4ODIA 4Y7CA 4XYGA 3LQQA 3Q0TA 4ACBA 1V5GA 4Z9AA 4GDMA 5FIUA 4B46A 2C58A 4HH1A 5C8XA 2V55B 3M9XA 4IJVA 4OI2A 2EL9A 2NNLD 5CVJA 1TM3E 5JYEA 1QZXA 1Z75A 2RC5A 2UZ0A 2ZDQA 4Y6PA 4LQDA 1VKJA 5E6SA 3EZLA 5IF3A 2WFAA 2NU8A 3P71T 4TKUB 2FZVA 3O9ZA 5CYFA 5FRDA 4OHBA 5KAPA 1Z68A 4LNUA 1KK2A 2IWRA 4EG0A 5JNSA 3EGCA 3NHSA 1Y3DE 3V2HA 5JXJA 3U62A 2IUFA 2DECA 1SKQA 2X9LA 3ASYA 3EZ7A 1W19A 3FF1A 3DBVO 1NR5A 4FBLA 3VR5H 1J22A 2EX0A 4KXFB 3HYCA 4BLOA 4BMDA 4JU9A 4QO8A 4BRSA 3G9UA 3K0EA 1GSHA 5LD2B 2JI9A 1QAQA 1VMAA 4HX2A 3V4LA 4HY3A 5JJKA 2Q0SA 3JTMA 1YRQA 2RHHA 1VSVA 4MPRA 4NMHA 5EXTA 2C00A 1EYZA 3W1EA 4II3A 3IDFA 5FA6A 1ZL2A 4FLMA 1NF8A 5JCOC 4I50A 2GLXA 2ZE6A 1ZHHA 4P4SA 2VHEA 5E8RA 1PEKE 2IXFA 4BLSA 1CR4A 2IFTA 3NX4A 1KOJA 2D2VA 4WUTA 5CDTA 1DGQA 4I5GA 3I72A 1S1MA 1T9CA 2XOKD 1QIFA 3BK2A 1V71A 5T4FA 4Y67A 3GJRA 5HUQA 3A25A 5FUMA 3B53X 1XBTA 5ARCA 3ZK8A 1P81A 2XE7A 1Y6RA 1N4DA 1TOAA 3SY8A 2QRHA 5DIFA 1MXFA 1L5LA 3UMVA 1W47A 2I1QA 2IEAA 4O4LA 1PG2A 3EWNA 2QXYA 3DOJA 4NZOA 5B6IA 5KWJA 4OUDA 2J5RA 1WUKS 1GUZA 3I53A 1EFRD 1RXUA 2FW1A 4UCFA 1IAQA 1WY5A 2BBWA 3WK4A 3ZCTA 4EVIA 5L9AA 3REOA 4LTDA 3SCZA 2HKIA 2CNLA 4LPKA 3TFWA 1GPH1 4R1MA 4MHOA 3WWCA 4B3BA 1KOGA 1JHAA 2W83A 3AERA 3LIPA 2IHVA 2J9YB 2E4UA 4WESA 3SJ7A 1BFKA 4P83A 4RSRA 5F2OA 5JSHA 1FVXA 4MKIA 4AMGA 3ZHTA 2AD1A 4R0NA 4DHEA 5EE1A 3UK1A 2PN1A 1M1UA 2OFWA 5C7IO 1EXMA 1CY6A 2WYUA 2V7EA 4B4DA 4JI0B 1Z6PA 1H8HA 4R31A 1FCJA 4KO2S 4M3NA 4MI1A 4MWZA 3IT2A 4GXNA 3SWWA 3VNUA 1D7AA 4EG3A 1MQ9A 2AXPA 2JHGA 4EB0A 3KVNA 4G0XA 4R2JA 5EXEA 5ED0A 3ELUA 3UXEA 3VMMA 5E3JA 2Q3EA 2Q2QA 4EF4A 3TB4A 1G17A 2JVKA 2X14A 3LD9A 4POAA 3WYBA 4L78A 1XKLA 3CT6A 5ES4B 2HSZA 1ZQ1A 1KYYA 3ABQB 1IQRA 2GEUA 3W2EA 2XNCA 1PLJA 2JLQA 1I4OA 1D2MA 3JVDA 1CYDA 2GA8A 4O4IF 2QVXX 3BK1A 3T9BA 3N59A 4ZHQF 1K6JA 1XXHA 4B3HA 4DPMA 4ZDKA 1CQIA 2Y4OA 4AYXA 3WHPA 2BGMA 5IANA 1EK2A 1P2BA 2X5JO 2Q3LA 4JX8A 2KM1A 4B87A 1O6FA 1Y1TA 2B7LA 3I58A 4PSDA 1YQGA 4DYVA 1L9XA 3PSAA 3AEKB 4FMCB 1J2EA 4AG3A 2O3QA 2FFBA 2Q1XA 4H0CA 3KSBC 1EUDB 2GKOA 3ORRA 3CWQA 4NBSA 4ZJZA 4MPTA 3STXA 1IJKA 4I6GA 1H0KA 3BJEA 3C85A 3VPBA 1EINA 4BKUA 1VLJA 5A5GA 2AEJA 3A9TA 4LXUA 2Z2XA 1SHZA 3HKBB 3OPMA 3D9QX 1H3NA 3IKJA 3VU9B 3MJFA 4Q7MB 2GRAA 1HFWA 4GKVA 2BSAA 1MX5A 1JXOA 1PWXA 2HPVA 3WK5A 3UC5A 4CMBA 1I51A 2QXUA 5ALNA 3U4MA 2BFDA 2PDAA 4HDSB 4X44A 4O8CA 2G9ZA 4DEXA 4ATNA 3GY0A 3D6FA 3ZPXA 1PSWA 3RHZA 2PD6A 2QTAA 3Q87B 4B6EA 3I2GA 2FEAA 4DREA 2P9BA 3PA6A 3NJRA 5CB4F 3EVZA 3B9PA 1NOKA 1ZM3A 3AF2A 1KO1A 3L5OA 1J8DA 2XVMA 3OUTA 3QFHA 4UUBA 3C24A 2QRQA 1Y81A 1R74A 3AEUA 4MP3A 1B6GA 4ZCRA 1JFLA 3DDCA 2B8EA 4BNJA 2VXOA 3N0XA 4OAQA 3N28A 3IEKA 4F0JA 4EUHA 4HKTA 2QAIA 3CNLA 5I9LA 1LPOA 3KFLA 3JD3A 1P1CA 4R54A 1RLIA 2EQ5A 4MO9A 3HB4X 1NJSA 3BJZA 3KEOA 4FINA 4G0VA 4HWRA 2AG6A 3EC1A 3HPRA 4ZOCA 5FHQA 2C0CA 1WMDA 1Q7CA 3QE3A 3VPDA 1WTAA 4PAQA 5BXYA 1AMOA 2X4GA 4L4YA 1SM4A 5FR2A 1C9NA 4E32A 2JVIA 4IYRA 2C7PA 4CGYA 1C9EA 2P0EA 3OT1B 3TSCA 2TSYB 4ALJA 1V3QE 1Y7LA 1T35A 3L7NA 4G4JA 1A72A 4PLYA 5SZIA 4D9JA 1U3UA 4JT2A 2AQ8A 2ZZMA 5K8UA 2RHLA 1V8BA 3GL9A 2O7NA 1YT5A 5M04A 3GLUA 4YBRA 3AUJB 4JC0A 2VG8A 4YT8A 3I9NA 5DNEA 4QOIA 4HL6A 5EJ4A 1FYFA 2VATA 1X74A 4EYSA 1JVSA 2QRLA 3RUHA 4RA9A 3L7DA 3LQKA 5I5EA 4EL5A 3GFBA 3X1JA 3NDRA 2XMQA 3UAYA 1D6NA 1N6LA 1PFVA 3BEDA 4NBTA 2WYWA 4CI9A 4A91A 1B73A 2Q6IA 1TCCA 2AFHA 1LS1A 5GV8A 1PUIA 2AD5A 1TYDE 2CXOA 3B6IA 5H02A 1JR3A 4PYNA 1KI3A 2WJGA 2G07A 3FZQA 4MHSA 3TK1A 2ESRA 3V9PA 1AS0A 1U02A 4HQKA 3L0BA 2OZVA 4HVCA 4I4NA 4RW0A 4XEHA 5EI5A 1U0BB 4E15A 1NKVA 3D4NA 4RH3A 3SJCA 2IXEA 3MCAA 2LBPA 2JHAA 3KD2A 2KW5A 1Y9AA 3E61A 3K53A 3EIOA 4TVKA 2YVUA 1B6TA 1C7QA 1KZ9A 1ILEA 3IAS1 1UJCA 4X84A 5DSXA 2QRVB 1ISGA 2FUCA 4ZV9A 2P9EA 1XKQA 3MB5A 1Q92A 1KEZA 2FZCA 2UZIR 3C16C 1GY8A 3DO5A 3MAGA 4EFKA 1CJUC 5F73A 2FUNB 3H1AA 4DR7B 2OAP1 4HGPA 4OYYA 1A9QA 3NPAA 3IRUA 4EG8A 5DYIA 4IIVA 2CY0A 4O4IB 4EARA 2PKCA 4CF7A 1K8ZB 1FQOA 5CJJA 4F2WA 3FCUB 3AJRA 4P82A 2YL2A 2RAVA 4Z0NA 4UHEA 3INNA 1VLZA 5DT9A 5E7JA 2A1TR 3NXSA 1UEIA 3OQIA 4EITA 5H4HA 3WGLA 4G0OA 4PAOA 3WA6A 3VV2A 1A1VA 4B3MB 3T38A 2FG5A 4KQWA 1N2CB 4PNZA 1TYCA 3UAWA 2NZ2A 3I5XA 4KVZA 2DH5A 5J5CA 1I4DD 3D8HA 4PGGA 4MQEA 3VU8A 2OG2A 1H5UA 3KYIB 3IKTA 1PDOA 4FCVA 1WDWB 1YTLA 3F5MA 3ESQA 3EEFA 2JPDA 2HWWA 4PRYA 1TO2E 2VXCA 3FNRA 9GPBA 3QVJA 2IHJA 2OVBA 5D6OA 5FHRA 4DMFA 5CVVA 3B9RA 1NP6A 2GRUA 2HV8A 1UODA 3SIWA 3VISA 1HYQA 3UN1A 1BS1A 2PO7A 3G5UA 5FYQA 4YJ3A 3ADCA 2V4UA 2VT2A 1VECA 5HIJA 3C8DA 4NZ9A 1KE2A 3ESXA 4A6DA 1JEAA 1JLSA 1TQDA 4KI0A 4WOCA 2RGCA 3MYRA 5F3DA 1FB5A 3U16A 4MS4A 2R6R1 3BRSA 4RPGA 1KK1A 4F9TA 4TOIA 1E3JA 5AJYA 3RKRA 4ZAWA 1B16A 1MNQA 1KKMA 4Y6SA 1F2UB 3PE4A 4INPA 3KJFA 3RF6A 3UB3A 2XCTB 1QWOA 3EODA 4WW0A 1N9KA 1Q0RA 1SVIA 4CM5A 1Z6QA 4HLUC 4XB1A 4J1TA 3VR3D 3JQBC 4BO5A 1B0AA 1NUUA 4FGZA 1HPLA 1ZU5A 1VGRA 2HMAA 3BGOS 4DBLE 4ZVRA 1Z0ZA 1W59A 2BRUC 5JNWA 5LQJA 5SYAA 1PAUA 3D54D 4JJGA 1CYEA 1CJVC 1BOOA 2X42A 1H6AA 1WSBA 1GYPA 1Y6QA 2FP4B 4CLXA 3IVAA 3AZOA 3MQ2A 3GZ4A 5FT9A 2P4UA 2BR5A 3SFZA 3ZHXA 4X1IB 2R751 3B7WA 4UTOA 4C1BA 4BBJA 1A9XB 2YYAA 1NVMB 3DKPA 4HSGA 5CA0F 1QK4A 4ACAA 1N5IA 4XR4A 2WKSA 1P62B 3CX6A 3E22B 1A9PA 3VVBA 2Q5LA 3IFSA 6NULA 3L0YA 3W1VA 1JKMA 5C51B 4AL4A 5DHRA 3SF8B 4ARSA 4CL8A 4GEKA 1D03A 2EHDA 5AVYA 4B6RA 3CNHA 2VPPA 2HHHB 1A5TA 1CZKA 3AVVA 2RKBA 1ZIXA 4IJQA 4B34A 1BEUB 2Y1CA 3SQMA 4UQLA 3OZSA 3HDQA 2NX2A 4KEAA 5JWHA 5KC8A 3HEBA 4ISCA 2WFLB 4JBNA 3VNBA 4U0KA 2XSZA 2YC4C 4E4YA 1KVSA 1OZ0A 1YA4A 3ACDA 5IBRA 3ZHCA 4FK8A 4JI6B 2EV9A 1CKEA 2WTXA 4G56A 2ONKA 4OAOA 2F1OA 3JAKA 4JD5A 2NP6A 1QUFA 2HA6A 5D1NA 4MAMA 1ZI8A 2P7IA 2ZSIA 3B48A 1YI8A 2EGUA 2B9EA 1B6SA 1R12A 1ZKMA 4UBKA 2FW0A 1NXOA 1ZUIA 5HDQA 1DCKA 1I4EB 2PXHA 3ZG6A 2B83A 3GA5A 1CQPA 5DIZA 4UHCA 1DQNA 3DBRB 4FE7A 4KR0A 1X38A 2MIIA 2PR7A 3KQQA 1AN9A 3DMYA 2CHGA 4B4WA 3UOWA 4K03A 5JXHA 2OSVA 5KVSA 3QIVA 2FETA 4EYQA 1T1IA 4N7JA 1KRWA 1Q19A 1UAYA 3MWEA 2VKQA 1HTTA 1Z4QA 4IDHA 1R66A 4NI5A 4KXNA 1P7PA 2IPAB 1E3LA 1P1IA 3DNMA 4U3JB 2ZJYA 3OJFA 2DC1A 2GCPA 5ULLA 5A06A 4PLVA 4D57A 5BVGA 1MJ5A 2I78A 3NHMA 4YRCA 3DE5X 4BFWA 4X6LA 2GLUA 3HY3A 4QDZA 4QEZA 3SXUB 2CLLB 2QZZA 2L82A 2SHKA 3IPYA 1EWVA 1HE1C 2PKEA 1CB0A 3ED1A 1AH2A 1ZS9A 4GD3Q 4L4ZA 3VR6A 3WC4A 3JQEA 4AQDA 4YWHA 5E0KB 2XRYA 4WKOA 4RCYA 1SXJC 4E94A 3LW8A 4DA6A 1G41A 4NPAA 4BMYA 1G9XA 2X2PA 4TV8F 1MB4A 1YONA 3B7PA 4TKMA 2JCBA 3PNKA 3DLAA 1T2DA 2IUEA 3MILA 2B21A 4JQZA 4K86A 5DWQA 1KA9H 2ACEA 2O2JA 2DFLA 2ZYWX 1FUUA 1NUTA 2WUEA 3GCGA 4L6CA 3FLMA 3R5JA 2H0QA 3BCHA 2L19A 1T3GA 3EWIA 3JCZA 4UDYX 1M33A 2W2VA 3L43A 1RHQA 3N2LA 4D8YA 3TLYA 5AVUA 3RH0A 4E03A 1UMCB 2RBEA 1JT9A 4KPGA 4R5MA 4NENB 3GGCA 4EJFA 3MMXA 3NATA 2CLEB 2WYIA 5AJXA 1X7YB 2WLSA 3DHEA 1I6MA 1IHOA 1RJGA 2Q5EA 3MUNA 3OPXA 3RANA 3MS2A 1IY9A 2E5LB 1V7ZA 4I1OA 1RBMA 4G0YA 1A8UA 1TA9A 4N0MA 3SX0A 3UAVA 2BZ0A 5JCOA 2QTRA 3C7KA 5F3RA 3AUSA 3R5TA 4MJXA 1V8FA 3L7BA 3NWOA 4N82A 2BFBB 2CB0A 3IOEA 1QS0A 2C5GA 3H1GA 3UJ3X 3WTCA 4TWRA 1E9SA 4UW9A 4ZALA 5BQFA 2RH8A 1LK0A 3OPYB 4N49A 2AJ8A 2L42A 1RLMA 3OTHA 1D8AA 3RYIB 2UVPB 4UNSA 3RUAA 2P2NA 4RJ2A 2OEPA 4Z4GA 5J4KA 4M9QA 5FOSA 3ZIAD 4AS3A 4G65A 4D8UA 4GIBA 4I9FA 4KNYA 4RF4A 3G0IA 1M83A 2CXXA 4Q4HA 2H0AA 4RXUA 4BO9A 3OMWA 5CTJA 1KEKA 4G86A 5C52B 2VK8A 3FGPA 3GUCA 3EGWA 1FYVA 1LBSA 1YJ8A 4OD0A 2ODPA 1DAFA 2XA2A 4LWQA 1Z38A 4XH9B 1YCFA 3OQMA 1MB9A 1NSTA 2X6RA 3GUZA 3IJ5A 4KRXA 1NBIA 4UAJA 1Y7HA 2VI5A 4MRRA 3FBGA 3VTZA 4KGXA 3UFXB 2OKGA 3DDNA 5AM3A 3VDMA 3IOMA 1Y4UA 3N3AC 5IC5A 4YRPA 3ZGOA 1MHPA 2X6TA 4ZOQI 3Q9NA 5I3CA 3PE3A 1LDGA 3DM9B 3AM5A 1FFGA 2P3QA 4LBWA 5CXSA 4DDHA 4JU8A 3BTOA 2HQBA 5BSWA 2QK4A 5JVDB 5K0GA 4JDUA 1PN3A 2I7TA 5KX5F 3HXMA 2ZCJA 4CCWA 1T5LA 5JXIA 3D81A 5KQLA 2VZ9A 1ORVA 2OCDA 4NSNA 4JXZA 4II2A 5TRTA 1FUIA 4XX0A 4Z3KA 3CEJA 5JXGA 3VA7A 4DLSA 3UWOA 5AUOB 2ZANA 3CVWA 2AT1A 3ZQUA 4ZEVA 2V7QA 3HEMA 3GQBB 2I1WA 4PN7A 2X86A 1PJSA 4O29A 5TC4A 4HCJA 2FKAA 1Z0UA 5IFKA 3ZVKA 1CUGA 3B13B 4LECA 5ECGC 5CNIA 1UQUA 1L7QA 3KT0A 1L7VC 1EUCB 2O3TA 2QXTA 4Z4IA 1F38A 3KHUA 4LK2A 1ZISA 2DTEA 3CR8A 4NE2A 4XSGA 5DRYA 3WLEA 1RRMA 2E1PA 3HXLA 4BDTA 2AMFA 1Z0KA 5J58A 1ZIOA 3ETLA 5IKXA 1OLUA 3ESAA 3AUFA 2SICE 5L3VA 5BSVA 2HO4A 4LHWA 2FQWA 5DRTA 5A03A 3QW4B 3SE0A 2JGRA 4QUGA 4ZVPA 3I6QA 1TZKA 3BMQA 3E3OA 3NHWA 1BXRA 1RRFA 1X7HA 2O0HA 1J24A 2O2EA 3AUAA 3BRWA 3NNSA 3UMYA 2F1JA 3DZHA 5BUQA 2V5AA 1YOBA 2JAOA 3DDWA 1UBJS 2PRJA 4RLHA 5JH7F 1QHIA 2ISCA 1Z5UA 2GZMA 1ECPA 3KR1A 5TQ0A 1UK6A 2C5AA 3AJDA 5CLLA 1ZMTA 3C43A 2I3ZA 3E82A 1WV0A 2IXGA 2BEWB 4DY6A 1G98A 2OENG 2X7XA 1MNAA 3RUEA 3RTDA 1ML4A 5CGZA 2GEBA 2QRMA 1G21E 1G8YA 4JLKA 1K88A 2BM8A 2O7VA 2P0YA 3D4OA 3DYIA 3E58A 1X1DA 3PXAA 5L7TA 3C3AA 4JLAA 4D0RA 1F2TA 4HB3A 3DUFA 3R74A 3SLGA 2Q5CA 1B26A 1KARA 3JTEA 3I6ZA 4YIKA 3HV0A 4YH1A 4F84A 1FUEA 4G8CA 3ACBA 4KRGA 4MXDA 3X1ZA 3L6UA 2QAJA 3U3XA 3PI6A 3WYEA 1F6BA 1WCIB 2FF5A 3QX7A 4QGFA 1F48A 3B70A 3QKRA 2GEJA 2GVNA 3G02A 4JLDA 2GS9A 1LRKA 4GF5A 5EP1A 3V1LA 3CEMA 4CKBA 3N0VA 4DPLA 1HDOA 4CIYA 1Y6JA 4PCVA 2EP5A 5A0FA 1W36D 1NQ5A 5B53A 1STOA 2O8FB 2BKVA 4HDRB 4HH3C 5AKGA 8MHTA 1X19A 1CZOA 3JWPA 5FD8A 4I8IA 1KVRA 2B8WA 2JIZA 1LEHA 1VOTA 3GP5A 2VJKA 3M8KA 5DNAA 5DHQA 3UK2A 1IG3A 1I0LA 1P61B 3KZNA 4LOJA 4YJHB 5LQNA 2GI4A 1JQBA 4Z4HA 3PGKA 1VI5A 3AKCA 3QELB 4LY3A 3R0IA 3N2NA 4G07A 5LWHA 1UP6A 1V37A 4P5PA 2PKQO 1CNFA 3KZ1E 1YA6A 1TW2A 5CHYA 2Z57A 1JFSA 4B84A 4IV0A 1U8ZA 5FO1A 1HV8A 1NVUQ 2PLNA 5K0LA 3U4DA 5CVTA 3WFJA 4OY3A 1HRDA 5F2NA 4E2XA 1RR6A 3CLSD 4M1MA 3FPCA 3OD1A 3IT1A 1F7UA 4JBIA 1U9CA 3EG5A 3QBJA 1PP4A 3AUUA 3U7JA 2D4HA 5DM0A 4KUGA 4KE7A 3IOCA 4HMQA 1LI5A 1RJ9A 2HU7A 3PRJA 2ISQA 4KB5A 3BXEA 3H2IA 2XDQA 3DXFA 1XX6A 1IK4A 2O0KA 2B36A 3TEJA 2K7ZA 1N5DA 5BQ5A 5A2QA 1FSFA 2JCSA 2QPOA 4MW5A 4OP2A 1X94A 4EM6A 4F3NA 4BMCA 4DRXA 4Q18A 3AFIA 4WLEA 1UIMA 1MEEA 1QUEA 3HCFA 4U1RA 5BQXA 3K32A 3D3JA 4TMTA 2DMRA 1W85B 1KZ6A 5BW8A 3NV9A 1N6RA 3KBBA 1DLIA 1XD2A 4UBLA 1XMPA 4E22A 4UE3S 4JQCA 4LX8A 1R2QA 1X2EA 2YS6A 3RFFA 3TI9A 5A0VA 3DTTA 1MABA 1X1QA 3RRFA 3KK0A 1CNEA 2YVQA 5EYPA 5FOTA 1I2BA 3OAAD 3MXTA 1EB8A 4H1UA 2D13A 1T13A 2YUIA 1RQ7A 2M9MA 3ILVA 1G9TA 1NE7A 2HF8A 4LHSA 2PUEA 1QGUA 3NVKI 4ND8B 4C7OA 5DNUA 1HLFA 3BD7A 4TSFD 4G24A 2L18A 4IMPA 1O1YA 1S2MA 2FFQA 4MVJE 4X6XA 2C3PA 2O23A 3PNPA 1PJRA 1WBJB 3GV0A 3JWEA 4YYEA 4RCZA 4UVDA 4XUDA 4WN3A 5C35A 2X1MA 4Y30A 3P9RA 1LV7A 1Y8RA 4HVAA 4NV1A 3ROGA 3TQTA 2FU5C 5FPYA 4IWXA 5DX8A 1L7PA 2JH9A 4NQZA 4LF8B 4II7A 4O5OA 4HLDA 3MM4A 4AZ0A 4DBVO 4MQ5A 1UWLA 3TKAA 3JZIA 3UV7A 2H52A 4AZWA 5IF9A 2ECOA 2DLDA 2J3LA 3K6RA 2YDXA 4XAQA 3ETNA 4CMJA 4DG5A 2P35A 1XTPA 3IILA 4RNDB 1UWCA 1P17A 1TM2A 3C8ZA 3MD0A 1N5JA 3BIOA 3P0RA 1KFJB 3X1WA 4UBIA 2QMHA 3G17A 4D41A 1R9JA 2Q8NA 1C4WA 3BGIA 1KEEA 2WP0A 1UBFA 5LP6C 4ZMBA 3GAMA 4AT1A 3K6SA 5AJTA 3L8EA 1IFXA 1T3LA 2IPMA 3ESCA 4Q7LA 5CFMA 5I6DA 2J6HA 3P27A 2Q5QA 1W75A 2QYSA 5BSRA 2WWVD 4X63A 1C9MA 5CFNA 2ZIGA 4EI2A 1V35A 2I2BA 5TMBA 1ZK1A 2FPGB 3CO5A 2AYYA 3P2MA 3TUZC 1AG9A 2IZOA 4J2TA 3OJEA 5JECA 3U7QA 2WZBA 4NJOA 3UMJA 3FSGD 4WMLA 3BQ9A 3CLKA 4AX4A 2O8VA 2Q2OA 4L8YA 3K15A 4B9EA 3C3CA 4MYUA 1N2BA 1DXHA 4ZARA 3BN3A 4QYMA 1XZLA 2IE8A 3MK31 3DULA 4ZU1X 3UK6A 1H3EA 3FH0A 2IV7A 3S8EA 4NLLA 4H3SA 1E7WA 1MZVA 2XRMA 3AY3A 3DT9A 4FJ0A 4MKXA 3GOQA 3S1LA 3WHKA 1XUOA 4QU9A 1ENPA 2RKOA 4NNPA 4P3OA 3ME5A 4FILA 4A0GA 3U09A 1KBQA 4AB1A 1C0PA 3ADPA 5DP2A 1RP7A 3U0BA 3E05A 1WMAA 3IAUA 1GJRA 3WO0A 4HLUA 1JG3A 3EGDA 3JQBA 2BLLA 2F6RA 4KUHA 4ZT7A 4MW1A 3ICOA 4A1OA 5C4MA 1ZM9A 2IYRA 2WIJA 2AUNA 1PVVA 2BRUA 4RVDA 3WB0A 1NX9A 3ZJTA 3UKOA 3A2KA 2WILA 1Z15A 4R7ZA 3QOFA 4PHCA 3WV4A 2C2HA 3EXEB 4WBXC 4YP7A 4OHPA 1GNSA 3T12A 3ETEA 3V1NA 5LZ4A 1KJIA 3NM4A 1ZSYA 2IW3A 4NDZA 3BD8A 3WHLA 4EW2A 3MLBA 1OLXA 1I13A 2PS0A 1NVGA 2C3MA 4CQMD 4XQ9A 3UA3A 3E9MA 1JPUA 1Y7PA 3ZY6A 1QYWA 3D8RA 4QXAA 4RZQA 1MJFA 3HH8A 1FFCA 4YUWA 1H1LA 2W00A 5GJCA 1JQ3A 1SAYA 2REOA 1U0TA 4R8SA 5LU9A 2IU4A 3PG5A 4IDCA 4O2LA 2LIVA 3S1AA 4Y2TA 4O02B 4Y0VA 1P1BA 1WUTA 3I73A 2GBPA 4WZBA 4YAOA 5HDBB 4EGAA 4FDVA 1EUYA 4ZVKA 3CX8A 1JFFA 1ZXBA 3OPQA 4ANFA 4I1PA 2CVFA 3BTUA 4GPZA 4LYFA 3IEUA 5DSTA 4LA4A 3ANMA 4U7HA 3CZMA 1ZA1A 1MX9A 1VB5A 3G79A 4A9AA 3LBIA 1FDSA 1YQDA 1C0KA 3KQOA 3V8PA 1UUFA 2OZLA 4N3GA 3SYLA 4GPTA 3KQPA 1JECA 4TL7A 5LNK1 3VPGA 3NDBB 1LXCA 5DM70 2ZB8A 2IPOA 1GGNA 1L7OA 1NI4B 3MWDB 4GKKB 5F9FA 4MYHA 1NV8A 2Z4SA 4WX2B 2CF6A 4EW1A 2FQXA 3A1CA 1WB4A 3PYXA 4ZI5A 1U0OC 5J4VA 3A6KA 1WZCA 3WGKA 4YRSA 2HCFA 4RQUA 1K86A 2XCUA 3DMDA 4BV9A 3U6BA 2WIAA 4YJ2F 2VA8A 4B47A 2YKGA 3GG2A 1ZINA 3AVWA 3ZLUA 1P5FA 3BTSA 1ECJA 5TPWB 3AESA 2CLMB 3O74A 4Y2JA 3IAXA 4EQ6A 2ZKLA 3IDQA 4JS0A 2YDYA 1VPWA 3LRXA 1AQ6A 4QLOA 4P0PB 4UARA 5CCXA 3WMGA 3JAWB 3A9RA 5TXGA 2VWPA 2ZRFA 1ILWA 1KSHA 5CA1B 2IH2A 1N0UA 2VP4A 3PQCA 3V9AA 3IE0A 1SD2A 3A6GA 3ZYZA 2HCJB 5IH7A 1BZYA 4F46A 5CLGA 4DPKA 3A9CA 5JYCA 4DF3A 3CN7A 4MUFA 4ZDJA 3HLTA 1JZQA 5I48A 4NZYA 5DCLA 3LC2O 1R8SA 4TXLA 5JMTA 1Z4PX 1ZAKA 3SSOA 3ZQJA 4QX6A 1RQGA 2COEA 1CR2A 1RDFA 1V6AA 3DMFA 4GNRA 1YXMA 2BE7A 2KI5A 1SXJA 2CXPA 3ND8A 4ZI7B 2FSIA 2RIPA 4P2BA 4L50A 3AYXB 3EEIA 3W5SA 1UC9A 2PUJA 5BUCA 3SIXA 2BBTA 2RHDA 2RH5A 5D3MB 1XYGA 2QL6A 2GGSA 3ZYCA 2DG2A 1T5BA 3ZE2B 2ZQZA 1CVLA 1JHPA 2QZ4A 4HXYA 3RB8A 4HQ6A 3VSCA 4CR6A 4HEJA 4LXQA 4LYGA 3UM9A 3NALA 4DFDA 4RY9A 3BK7A 3KV3O 3G2MA 7YASA 2WT4A 1AKQA 3OMLA 4HNQA 5C5CA 1IN8A 5DK4A 1GFZA 2VYCA 1KK0A 3L6BA 4WD3A 3UMBA 4NHEA 3G2LA 1R1DA 5A4AA 5D1HA 3VO8A 5TQ2B 1GKYA 4JFRA 3I76A 4IUYA 4WZZA 1Z8HA 4RA6A 5IHPA 1GSIA 3LZCA 1AO3A 5DYYA 1T15A 4QQRA 5B30A 3LZDA 3FTEA 1GG9A 4M0CA 4YJFB 3RAGA 1CSEE 5CG2A 3I9OA 3HCPA 1EM8A 3R5HA 4X71A 3E7XA 5K8VA 3WSVA 4DWOA 1JMKC 4J3FA 2Z2YA 2Y1EA 1GQRA 5EHNA 4RMGA 3TOSA 4EWLA 1E92A 5GMOA 1S1CA 1T43A 1DAPA 1H23A 1O4WA 3M4JA 3IBYA 5DLPA 2JCGA 2DETA 5EJMA 2BFFA 1XRJA 3A4YA 3I04M 1TD1A 4TROA 5FH9A 3PFKA 4WJKB 1A96A 5CVDA 1AN0A 2OHIA 2W6ZA 1NXWA 3GRAA 3G2JA 5DULA 3UXMA 4KMMA 4RIEA 1ESCA 3EIEA 4NU8X 1WHSA 3EVCA 4CVNA 4KACA 4RS3A 2B8NA 2WJVA 4DSUA 2W22A 1YHYA 3Q8LA 3QX3A 2X77A 4RD6A 5EPOA 4S12A 3ZCXA 2VDUE 2FV8A 4GP7A 1UKAA 1XD8A 3L84A 3LCCA 3KVVA 3F6CA 3ZBTA 2Z98A 2YZKA 5KYGA 2I4NA 2JAHA 1IXYA 2X0DA 1JFVA 1HYBA 1U7UA 3IVMA 2YX1A 2HN9A 3R3YA 1OKKA 1E6KA 2PX0A 3SP1A 3RAPR 1Q2XA 5T64A 3TTVA 1YJXA 3P94A 1YQUA 1ZRNA 3MIZA 2P30A 4NR0A 4YRLA 3HWRA 1L4LA 3DJYA 5KHLB 3DO6A 1PR5A 5A6SA 1C3XA 3WNZA 4QQKA 4DJFC 2O2DA 2XNSA 1EGMB 1KI6B 3LDAA 3FOFC 1J5XA 4FFWA 4G97A 1PG0A 4UCWA 5GOTA 1CUVA 1EFTA 1MENA 1GR1A 2WM9B 4MR7A 2FDCA 4M0UA 5IZCC 1FW6A 2M6LA 3OTGA 1JHQA 1QGOA 4RM3A 1H2ZA 1IBSA 2HIMA 2QSZA 1ZLYA 3GZTB 2FZ4A 1SMKA 3DD5A 2IA5A 4FDTA 1RAEA 1RJEA 1YK0A 2ILTA 3PDJA 4XQ0A 3ZE7A 2ADOA 1H42A 4C4ZA 5JZVA 1OXMA 1XHLA 3IE2A 2B35A 3GLTA 4I19A 3LLSA 4OQEA 3WGYA 4XPIA 5DN9A 1RXYA 3BD6A 3EZ9A 1OZFA 2BGLA 3IQZA 1PT9A 1VCIA 2J1LA 4GR4A 4COOA 3SOZA 1OY1A 1IM8A 3NP9A 3TINA 4EPRA 2RMKA 4MTLA 4WBSA 4UTNA 4ONEA 5LA6A 2ZI5A 4IDEA 5AOVA 5KKAA 4CEJB 3WQSB 4YDHB 4QBTA 2KJQA 4YJ2B 5LOVF 2A9KA 2FWIA 2X2FA 1GA6A 5BYAA 5JD5A 3O8NA 1UBUS 4EUSA 3I9MA 4P93A 5K3EA 5BY2A 2BL4A 4EHIA 4TKVA 2VJPA 1UMBA 2J0EA 2WAXA 4IQ4A 2F9MA 1Y3AA 2CL6X 4KQEA 3DNFA 4R2HA 4AU1A 3U4GA 4DQLA 1E2KA 1MIOA 2CK3A 2GJ4A 4K6FA 1XT6A 3P96A 4TXJA 5KTKA 4JVOA 2P4EA 3C7CB 3OZTA 3GN2A 3OY2A 4J4TA 3Q10A 4WFIA 2H2DA 1WOMA 2G25A 3DKVA 4RORA 4FI3F 1M6WA 1TVCA 2J9FB 1P5JA 2D8MA 4POOA 1KO8A 1K66A 3GNLA 5A4JA 4DDUA 4A92A 2GXQA 4ZI2A 1R15A 3U44B 3HJFA 1TIPA 1KEWA 3PFHA 5THKA 3N53A 3C41J 4C7VA 3QX8A 3D4LA 3VKFA 4M49A 4I1VA 2ZAIA 4PQFA 3GYGA 4YGXB 3WB1A 3NVMB 3R8XA 4F85A 3SC6A 2YV3A 3IQHX 5IARA 1OIWA 3CKYA 4BWVA 3DBIA 2ZSBA 3DG9A 4EYKA 3DW3X 2FW6A 1MOSA 1ONPA 1BNCA 4KUEA 4PIMA 5BO5A 1X80B 3NQ41 2R1VA 3VHQA 5JAMA 1THGA 4O4JB 2IOQA 5D01A 3K0HA 3KLPX 1LK5A 2ZTMA 4FHDA 3LDGA 3NB0A 3QTBA 4K6MA 1O5IA 3P5BA 3DMRA 3AIIA 1SY7A 3UV3A 4EY5A 4CIAA 3OQHA 2O1SA 3DZJA 2X9GA 4EELA 3AUXA 3I42A 5KDDA 1H93A 1R0CA 1TF2A 2IHUA 1T36B 4ZQGA 4EUKA 5LQAA 2ODEA 1YS2X 1FZTA 5FR1A 3I6YA 4J29A 1XR3A 4XWGA 5JO0A 4XM1A 1GGVA 1U7PA 4HWGA 3OP4A 1KH1A 3WL8A 4UUOA 2EZ8A 1Q0LA 4N3AA 3X3HA 3HI4A 1HUQA 4YAIA 5C34B 1TQ2A 5ITSA 4PLTA 1GPLA 2QGNA 4EI9A 1YF3A 2FPMA 2H9YA 2ZTHA 2HEGA 2WT9A 3ZJ5A 5JD3A 3JZFA 2R6AA 1U80A 2Q3MA 3BSFA 3BWVA 3L1HA 3P2KA 3TH5A 4IHKA 3WNQA 4LGMA 4EHLA 1J2TA 1HT1E 1UPTA 3NASA 1DWQA 4C43A 4YROA 1TDJA 2XE4A 4KFTA 3G68A 2IYEA 4JJEA 5ESRA 3N86A 5JADA 1EPUA 3W8DA 3OECA 4I14A 4N0QA 4AY2A 1NGSA 2XZLA 2QN2A 1ISMA 5LD2C 5A3RA 2PMBA 4L85A 1LK7A 4X97A 3ZY5A 2XECA 4ZAYA 2BAGA 2D0OB 3RYCA 3DEZA 1KYIA 3B2NA 3IEPA 3VR5A 1R9GA 4A8PA 1U8CB 2Z8ZA 1Q7EA 2C2OA 2COUA 5DXFA 4D0LB 3QVGA 4LBVA 3TMYA 3GMTA 2JA2A 2Q6VA 5HTKA 2IQIA 3RJ5A 3GHHA 5GGXA 3ORSA 1NJFA 1L4GA 2EOAA 5FPSA 1CB7A 1YIAA 1VJ1A 2D4AA 3EASA 4JOSA 5JT1A 3SVTA 5LCXA 3HP1A 7ABPA 1C9JA 4EF6A 2JJ8A 2ZJFA 1QDEA 4OXXA 1A88A 1FXWF 4ZJUA 4Q4JB 3OIUA 1YDEA 4KMSA 4FNAA 5BNWA 4EH1A 4BGEA 1VG9B 2PXCA 1P6UA 4JMPA 2ERYA 2O0JA 2OT3B 5JNLA 2IVZA 3REFA 3WWDA 1ANKA 2D1RA 3FB4A 2WVJA 2P2DA 1RXIA 1MT3A 1NXPA 2ZVDA 4M1ZA 3STTA 3DFMA 4DNPA 4RDXA 3RJ9A 2B30A 4MEBA 5L3SB 1PFKA 3F5FA 5T6MA 4XA8A 5JFOA 1YQEA 3SMVA 1EGVB 2IP4A 3PFCA 3L4BC 4E5DA 5AW0A 2UYQA 1A2KC 5LQKA 5LP6A 5DFAA 4MUEA 1FTYA 1ZGAA 3THSA 1DX4A 5GM1A 3U3RA 1YBHA 2FXIA 3VZPA 5EERA 3PI7A 5DGCA 4LV6A 5AVZA 3L05A 2QM0A 3TRFA 1SUPA 1RXEA 1BJTA 1ESNA 2F43A 3H5TA 1RXWA 5EA2A 3ZZMA 1H65A 3RG8A 1HYHA 3MINA 3RHSA 4PLCA 5AHRA 2FPRA 4M22A 1EK6A 5K3FA 1JZSA 2DX7A 3C3YA 1Q7RA 2PLRA 3IIEA 3KV1A 3PDHA 2DBVO 2DFKB 1SVNA 1I3LA 4NPCA 2JLZA 5IM4F 4H4CA 3U4CA 5JARA 1M1NA 2R7KA 2O5VA 4GZ6A 1UM9B 3T0GA 4CKEB 1N7HA 3EE6A 4FYPA 4C4SA 4R0VA 1Q17A 4D8WA 4XKJA 2CLHB 5BWCA 2GN4A 3DAFA 1JHVA 4KLCA 4PQYA 4CYMA 4ZHSA 4REQB 4W9NC 5BNIA 1TA4A 4BWFB 4TMWA 3A28A 1Z0DA 3DOEA 3EFHA 2A84A 1XAJA 2X1VA 3ZU6A 5KPDA 1M72A 5FBWB 2H00A 3GP8A 3WL3A 1QFSA 4NX2A 4TQGA 3QEBZ 1KI4A 1W25A 2ET6A 2V98A 3FOEC 1QIEA 1LI7A 2ERXA 2HIHA 3O7WA 4Q5IA 5JQGA 2GPJA 4EUFA 1WAMA 2NT4A 2H5EA 2F4VB 4FVTA 4DLZA 3P52A 2CCKA 4QUAA 3PQ3A 4P7KA 1E3WA 4BQOA 3OX2A 1ONOA 1Y82A 4S3MA 1CY0A 4LHZA 4L7VA 2YW9A 4Y9UA 4BS9A 4PQEA 5I7WA 4NJEB 1E8NA 1OI2A 3JVEA 3PQ7A 2ZSEA 2QE6A 5DN6A 2QN8A 5B6JA 2E0IA 5TE9A 2UUPA 4E3WA 1CBUA 1WZ2A 2NXEA 1VYTA 4QC2A 1TPYA 5EIOA 1DB3A 4LXIA 3H42B 2IEIA 1J42A 1M2JA 1GUYA 2RARA 2DUNA 3E5HA 3KKKA 4N18A 2PMEA 3TOVA 3ZVRA 4OHUA 4F5EA 1JJ7A 3U7FB 5JXWA 1E5TA 2CWWA 3CTMA 2LD4A 2NSDA 3R7NA 821PA 2W9XA 2XB8A 2SCUA 1A5ZA 2RI6A 1TIKA 3G23A 4WK6A 2ZJ3A 3KHKA 1BX0A 1NVTA 4Y1RA 2AW5A 4PRLA 4TWIA 2J7KA 3K0AB 3T7TA 5HGJA 2V0NA 3OIDA 3AFNA 1RYFA 2AXNA 2CV2A 4NKRA 3OIGA 2PL9A 4EW6A 1DC5A 2V97A 3H2SA 2XRFA 5EKDA 2JAXA 3WQBA 1JG2A 4J9VA 2NTJA 1E2MA 3KFXA 4N7RA 1CQJA 1GQFA 3A31A 1DIRA 3BE8A 3MCVA 2GHRA 1E8MA 4F12A 2IYOA 4LHXA 5CNKA 1KETA 2O3UA 4PGHA 1RWPA 3TE6A 1JGTA 3V33A 4B75A 3ZXSA 4FC6A 10MHA 3GGOA 5E1MA 3EF3A 5CDFA 3THYB 1HG0A 3EHEA 5ICEA 5KU1A 3JARB 4R3UC 5CU7A 1SBNE 3DP9A 1XC7A 3NBAA 1O8CA 4JR2A 1JU4A 2W4IA 4V0MA 4GE0A 5A3JA 2ZP1A 4C1NA 5EEGA 1YZ3A 3H65A 5CRIA 2FSUA 2GYUA 5JZSA 3HJAA 4JJ8A 3DMPA 2P41A 3QBEA 5K7SA 3CUUA 3CG0A 1WMFA 3DTVB 4EBFA 3EEBA 4IYJA 4MDHA 2NP7A 2BD0A 5FNVF 4HUQB 1MZPA 2ZSAA 3QU2A 1JHZA 1B0PA 1G8FA 2KPOA 3CIFA 2OD9A 5KKNB 8AT1A 1JR6A 3DEKA 2HT6A 3W9UA 1EAMA 3E8MA 1OE0A 2VDWA 4MUHA 1ZD4A 4XGIA 3GNQA 4KN9S 1HE8B 2WPDA 3I9JA 3MYYA 3QYPA 4R3WA 1H85A 2NTNA 3KJHA 3DZBA 4MWOA 3QP9A 1RI2A 4QECA 3RGWS 4LVOA 5ALGA 2UXCB 1NN1A 1SBIA 1XZJA 1Q11A 1GZ6A 4R8VA 3N2GB 2V8OA 4YAKA 3RC7A 4J0DA 1JFTA 5JR3A 2HJSA 2IBSA 2P3OA 3TDKA 3CVVA 1OYYA 1E69A 3M3DA 5KJ6A 1AXGA 4DLKA 3HZRA 2G5GX 1USKA 3MJDA 2XY4A 4NFHA 3U81A 4YV7A 4MDYA 1QC5A 1PBNA 2C4WA 3FNFA 4FLEA 3D2LA 3TD2A 1G4HA 2BR4A 2CBZA 1Y8QA 5FBHA 4KFUA 1DCFA 1ESZA 1NLYA 3ZWXA 3KQNA 1R8QA 4Y1GA 3W5CA 1EVZA 4TTAA 1WCV1 2EKBA 4EA6A 2ZBFA 2ZUBA 5P21A 3ZU3A 3W6UA 1F0KA 1NY5A 1LVUA 2BDTA 1N9GB 3GPDG 1FP1D 1WKCA 4H08A 4MEAA 2QQGA 1PSDA 2V5UA 3VFDA 3JATA 1KR2A 5E6UB 3EIUA 1ZD2P 4G5HA 4QGSA 1X1EA 2GM9A 3TQSA 1DKLA 3URMA 1RYHA 5LZ8A 1BXKA 4CV2A 3W5HA 1OC4A 5JNVA 4DV7B 3L1KA 5TGZA 2ZR8A 4N6OA 1H2BA 2J9ZB 3EVAA 4KMRA 1C9KA 2ES4A 3FMOB 1V11A 2J33A 5J2TF 3FOZA 3CWZA 1P2UA 4D82A 1Y1KE 2DQZA 1KAEA 3AJ8A 3EYWA 3R6WA 4TQ9A 2IV3A 3PUKA 2NU9B 3WJ7A 1XTRA 1Y5NA 3TR5A 4BJ3A 1BRMA 2NYUA 2ZIAA 3HJNA 1PGPA 1OBHA 2X9QA 2Y77A 3CUKA 3CNQS 5C1OA 1EXDA 3AGPA 3BT7A 2FPPB 2WA1A 3I8SA 3HRIA 5CGQB 1VHLA 5FUVA 1ZR4A 3R3JA 2AC4A 3MTGA 2WMYA 1VPEA 4W6QA 2WABA 4HVLA 3BPSA 4MKFA 2R2GA 2NUPA 1J7KA 4HNSA 3WOHA 1MC5A 4CR7A 1CFZA 2WM2A 3PJEA 3KPYA 1Y6ZA 2GPWA 5B36A 1OWOA 2OFPA 3WGIA 1C8BA 4X60A 4GOKA 2KSQA 3L4JA 2RHOA 5BYBA 5J23A 2PQ2A 3CBGA 5KCMA 1WXXA 3ZNQA 3U5ZB 1WTCA 4V24A 4JXXA 2R6JA 1PKEA 3QTTA 4FCTA 4LMPA 1OLSA 4DLBA 4OI4A 1VSUA 2WFZA 2YVKA 3E70C 3H5OA 3PDIA 4IIHA 2EG9A 4NH0A 2SECE 4P4LA 1LDEA 1NBEA 1J8FA 1MOZA 1RWXA 2QLLA 2REBA 4AK9A 4BMVA 3K1AA 2C8LA 3C6BA 2AUTA 2YXLA 5F12A 4UNNA 1Q1BA 2HK8A 4LXXA 5IZCA 5KYTA 1SBHA 3FE2A 2PU7A 2XUGA 3O1I