1S3IA

Crystal structure of the n terminal hydrolase domain of 10-formyltetrahydrofolate dehydrogenase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
b'MKIAVIGQSLFGQEVYCQLRKEGHEVVGVFTIPDKDGKADPDGLEAEKDGVPVFKFPRWRARGQALPEVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGTAPRCPQSEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTSGLSTQGEALPIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQLEDGKMMPASQFFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title The crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase: mechanism of hydrolysis and its interplay with the dehydrogenase domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase, oxidoreductase
total genus 92
structure length 307
sequence length 307
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 1s3iA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1s3iA01
4QPDA 3DCJA 2BLNA 5CJJA 3KCQA 4NV1A 3DA8A 4Q12A 1YRWA 1FMTA 4ZZ1A 4EW1A 5J63A 4ZZ0A 1RBZA 4QPCA 1GRCA 1CDDA 3TQRA 4ZYZA 1RBYA 4ZZ3A 1RBMA 5J9FA 1ZLXA 1C3EA 1GARA 4DS3A 3R8XA 4TT8A 2YWRA 3TQQA 1S3IA 4YFYA 1ZLYA 4EW3A 2BW0A 4TS4A 4ZYVA 4TTSA 1RBQA 1C2TA 3AV3A 3O1LA 3LOUA 3N0VA 4S1NA 1MENA 4ZYUA 4EW2A 1RC1A 1JKXA 4ZZ2A 3Q0IA 4ZYTA 4IQFA 4ZYWA 1NJSA 1MEJA 3W7BA 4YFVA 3P9XA 3AUFA 2FMTA 3NRBA 1CDEA 2CFIA 4PZUA 2GARA 3OBIA 1MEOA 4ZYXA 4ZYYA 1RC0A 4R8VA 1ZGHA 3GARA
chains in the Genus database with same CATH superfamily
5KX5B 4B7AA 2Z56A 5L3VA 3F7NA 1NXPA 4MGKR 3K1AB 2Z6AA 1E2NA 1E2BA 1QWOA 2J0EA 4L8FA 5KYWA 4L0QA 1H0RA 3LC0A 5BWBA 4AL4A 5EE9A 2HCJB 4PNHA 3R0QA 2IF2A 1RPAA 3W1WA 4COOA 4RXUA 5FNVA 1N9ZA 3OU2A 3BDIA 1WXHA 4UDNA 4IBOA 3AF1A 1W44A 4MDYA 2QSZA 2WJIA 421PA 1MD9A 3PT9A 5FWNA 2AZTA 3QEAZ 3KYIB 3U5TA 5AVTA 2CNWD 3QPWA 3M1YA 2WKWA 4OM8A 1U1EA 1YHYA 4IZOA 3QVGB 2B8EA 3MD9A 4LXIA 4M0UA 1IJKA 2W2LA 3UFXA 4Q05A 5KJ6A 5FIUA 5J47A 721PA 2QT1A 2YINC 4DBLC 1MA3A 2FR8A 3DL0A 3NAMA 5FWDA 3MWEB 1U7HA 5FAKA 1DKLA 4G84A 4QOGA 3VVCA 1NMQA 1RWWA 4FBMA 4MVJP 3O8RA 4LA4A 2HM7A 3GU3A 5LQAA 1R64A 1NBEA 3NQ41 1EDOA 1PJQA 3INYA 4DLKA 1QH9A 4NENA 4LZNA 3DE4X 3NONA 1SCDA 3LUJA 5EJ9A 1PZMA 5K2MA 3F67A 5A1TA 1U31A 1KFEB 3OE4A 3PYXA 1L3BA 2R44A 1DIBA 2FEMA 2CDBA 3IBSA 3ANTA 3KSUA 3EVTA 4L0CA 3IV9A 5LDGA 4BVBA 3QX3A 3OCWA 4F1WA 2F9LA 3BD7A 1OI2A 2IODA 2WJ6A 4OP2A 5SZKB 2FPUA 1E5VA 1ZD9A 3DTNA 1VJ0A 3OF2A 4CCWA 4D3FA 5DEIA 5FLYA 4YT8A 1VBNA 2FX5A 4MQ6A 4MINA 4NJMA 3OVMA 4CR8A 3IHTA 5BSTA 1F8XA 5AI5A 1FP4A 4F72A 2HPZA 3NM4A 5LSAA 5B3KA 3CLKA 1HETA 1GGNA 1TJ3A 1VE6A 3Q3EA 4K03A 1SA0B 3AUKA 3M1AA 4H0FA 5C37A 1TKAA 1JPVA 3A7DA 4YJ2B 5F52A 1M0TA 4S2EA 4CLXA 5IJ9B 3TF5A 4O5OA 1KYIA 4CMBA 5C8DA 2JEOA 3Q7EA 3RT7A 2F8SA 3C85A 3EGIA 5G0TA 2YXEA 5DSTA 1RMTA 1WXWA 1HL3A 2VRCD 4O6VA 4F2PA 3RUDA 4X41A 3L0SA 4QLBA 3AVTA 2MMCA 1NN1A 2B30A 3MJDA 3NRJA 1NN3A 2JD2A 2PEZA 2IRWA 4XGQA 3NFYA 3S1SA 2PIDA 3K1AA 4BATA 3KB8A 4ZZ2A 1WZUA 2C59A 3HXPA 3S4YA 1XMOB 4RL4A 2ORYA 1IZ0A 2OZEA 4F4CA 3A6FA 2Z8YM 1OXXK 4MDHA 2VZEA 2VYNA 3RRNA 3JTMA 5T64A 3V5NA 1RXCA 1ZD1A 4CTOA 1SR8A 2Y1DA 3GRRA 4L22A 4R1UA 5HIIA 2JBAA 3HA3A 1IY9A 2HJGA 1YQQA 4IGAA 2CMDA 3WTBA 4YRKA 3JRNA 1OV6A 1XRLA 1M2NA 3BXEA 5FKJA 1Q0RA 2O1XA 1F7VA 4HSGA 3EY4A 4DCUA 3KZVA 3TIFA 1XXLA 4IJWA 1HORA 3UXMA 4CCYA 2YTZA 1DV1A 4S1OA 4ZGBA 3MWEA 1N6LA 1PQWA 3FH0A 3NORA 4LRSB 4YCDA 2GO7A 2Q6IA 5J58A 2BF7A 2PPVA 4FBLA 3U49A 5HE9A 3AVWA 3T54A 5K0FA 1V6CA 1VM6A 2E55A 1TT7A 3M49A 1QF7A 1PI3A 1N5OX 4DZZA 4QJBA 1X1AA 3EGVA 3FFAA 4U7WA 4X94A 3TOSA 7ABPA 2K2WA 3T7EA 4KIFA 1CU1A 3CKLA 4RKRA 1ZG3A 5AK6A 2Q3MA 5G40A 1L4MA 4DPMA 2ZVQX 1PFUA 4R51A 2VJAA 1ADCA 5TNXA 1E3IA 3SHWA 4BO2A 1Q15A 1Z8NA 4AY3A 3RVBA 4HQRA 4CMHA 4F6CA 2YC4C 3WK6A 1HXHA 4DYDA 2WYVA 2PU7A 3PUHA 4DILA 4FWIB 3I6ZA 2IPLA 4GUDA 3B9PA 3VBCA 1EX1A 4U7JA 4WACA 4I4CA 5JWOA 1EI9A 5THXA 1DRUA 4DXHA 2ACKA 5G3YA 1ULBA 2YOHA 3ZHRA 1GCOA 5E4TA 5HVNA 4YJ2A 5IJ9A 2HWYA 5I9IA 2QL6A 3FSGD 2JHAA 4PSCA 3SZ3A 5F9FA 3LOQA 3RYCB 1ENZA 1NBIA 4QQKA 1E0AA 4UU7A 3S2SA 4FI3C 2C2OA 4F9EA 2QUZA 3IBYA 3N0TA 2XE6A 3NTRA 3PC2A 3T7DA 3OQOA 3FMIA 3PIIA 4NCAA 4K0RA 4P4LA 2JW5A 3PHHA 4UNIA 1D2GA 2NMVA 3E05A 4A0FA 1ZIOA 1E5TA 3JSAA 1CUUA 2MMGA 3TNDA 3T7KA 3D0OA 1ECCA 3ADKA 1J8DA 4EW3A 4S04A 1W5BA 5KCZA 2O4UX 5B7PA 4BLQA 1P80A 4L2IB 1CUYA 3L0CA 1YOVB 4PGFA 4Q16A 3N5CA 4MVJH 4OL0A 2JFHA 3NGXA 3O9VA 4XUEA 1D2RA 3A25A 5CG2A 3HVJA 4HAVA 1WBDA 1DBPA 4KQXA 2FGJA 1OLUB 1JQDA 3DDWA 3E27A 4B0OA 1W29A 5JMOA 1WCIB 3L43A 3WRYA 3RHFA 1KO7A 4HH1A 4IKEA 2VDUE 4WJZA 3VNRA 3EG9B 3P32A 1H22A 5DMHA 1FLAA 4O8ZA 1CR4A 2PCLA 4HEJA 1FFCA 3SF0A 1KJNA 4MRPA 2D6FA 1N6NA 1SVSA 2DR0A 2GT1A 4PO9A 4OYHA 1A88A 4R8KA 2XNDA 1W52X 2XQKA 2QN8A 3K0FB 3O4VA 3OP1A 4FU0A 3SDBA 1H93A 1P9RA 2H7XA 2GJSA 2VZLA 3BWXA 3FKSA 4YBRA 3B36A 3RVPA 2ZATA 3IODA 1ACLA 3IOYA 1IVNA 4E07A 5KWEA 4O3MA 3ZVNA 2X5NA 4G89A 5LMZA 4P08A 1FTYA 1YCDA 4H4DA 4RWZA 1J24A 4Q4LA 3A8TA 3NT5A 2JLXA 2J3QA 1C5KA 3GGCA 3WIDA 3VKWA 3ZIAA 2YWHA 1FUYB 3LDFA 2QJOA 1HNWB 221PA 1J5EB 5BORA 4CGZA 2J9GA 2V97A 3G6KA 1W0CA 5I4KA 3NIDB 1AY0A 1Q7EA 4J9UE 4DG5A 4KWCA 2G1AA 2SKDA 4IP0A 1GU7A 3H4IA 5FOWA 1AKWA 1E1CA 3VDNB 3RYCA 3C14C 1JA0A 1U1CA 2PTGA 2VI5A 2C77A 2ZSFA 3SEQA 3ZUPA 4U3JB 3VKGA 1ISMA 3U6KA 1M67A 4Q4DA 3QV2A 1TZMA 2DX7A 1YZVA 1R3UA 1LK0A 4ENTA 3BN3A 1L4LA 2AN9A 4L78A 4IOMA 2RJ3A 2R9VA 2QQFA 3EOAI 3CCCA 3OTWA 4IL5A 4M8NE 1TEZA 1M8FA 3A9WA 1GGHA 3FXAA 1Y8QB 4W8OA 5G02A 1T0HB 5ALMA 4MWTA 3SEFA 1N34B 1MOPA 1E96A 4IDDA 1B4DA 2BEVB 4L2IA 5DI9A 1NBAA 1UOPA 1YOVA 4B85A 4G0YA 3MA0A 1WZEA 4RABA 2N42A 3WIVA 3IQEA 3WKEA 1TZBA 2PS1A 4TMKA 3NV7A 1Z4PX 2EL7A 3AVYA 4TLDA 5BN4B 3V4FA 3WQBA 4MK4A 1BMFA 4GPTA 3V9PA 4UBMA 1NXQA 1WCIA 1MO6A 3VPCA 4YT5A 3VFDA 2AFRA 4L7QA 2RK3A 3CJRA 4ZMBA 4M1YA 5C46F 3UVEA 4GL4A 4ND2A 3U37A 1LV7A 2JFOA 3RSZA 5B55A 3KG2A 4PPGA 3M6WA 3CR8A 3WHLA 3UNXA 5CB0A 4LNHA 4O4JF 2J4DA 1LS1A 3FNIA 3JVEA 3P5BA 2ZWAA 2VUUA 5GVSA 3ZU5A 3OO1A 1IVYA 1J25A 1NJ5A 3ESAA 2WOJA 3K0FA 4QDOA 4UBNA 3C3AA 1NW9B 3KJQA 3WAJA 1V8PA 5C5IA 3AJ8A 3X1JA 3BGSA 3NPMA 3EPKA 5DGHA 4Q9JA 2CXUA 3TMAA 2NUAB 3GUHA 3MS4A 4IRMA 3H65A 4R8SA 2HIGA 4A03A 4LTDA 5EJMA 1XA0A 4Q3KA 3UW3A 2FOXA 3T0IA 3SY8A 2SICE 3C15C 4BMPB 2KSQA 3D7SA 4YJFB 2EJTA 1FLDA 4ZDIA 1BU8A 4MUIA 3IUPA 4QBGB 3RHSA 4BL5A 1QLHA 2GZ1A 2YYYA 2IU3A 3KQYA 3K30A 3LX6A 3OC0A 4KMSA 3VYUB 4J0CA 1PYOA 4RAOA 3WBFA 1OHHD 3WV5A 2IHJA 3M1IA 4P5EA 2GDJA 1UZLA 4U3JA 1SZJG 2HYDA 3JCZA 3BRCA 4WRRA 1NRJB 5CVEA 3RVJA 4BMOB 5JS8A 3A4IA 1G8MA 1EDBA 1FS6A 1VLVA 1ZA1A 3GCWA 1IZ8A 4R2IA 5AYVA 5LJLA 2EFEB 2BDEA 4DMKA 4WZZA 2ZYHA 5E0KB 4D92A 3DOFA 4H7KA 1ENYA 1NJSA 3JYQA 4C3VA 2GKOA 2IOFK 2EX1A 3OQPA 4KQWA 1XQ6A 3EA5A 1IN6A 3EEBA 2FPXA 2BEVA 1SAYA 4HWSA 4KG7A 3QF4B 5A5DA 3Q3JB 4FOOA 4M1EA 1ZH6A 3EA0A 2JI4A 4ODIA 4YWHA 1U99A 3U4MA 2GN9A 1X7HA 1KPHA 5BN4A 2HSDA 1S2DA 4G25A 4JEMA 5J2UF 2BDUA 3ZI0A 3SX0A 3HM2A 4KK4A 4B87A 3V8QA 2PWBA 3OPYI 4MPJA 3I30X 1RYEA 1RP1A 3H84A 4UMVA 3WQHA 2HBZA 1ISJA 1Y8RA 3EPLA 4BC0A 1PSZA 4OQFA 3U3OA 1Q0LA 1ZW6A 3D54D 1FYWA 3AZOA 4WCVA 2PGLA 2QN9A 1JR6A 2WILA 3EMDA 3I76A 4RWEA 3EXAA 3U7FB 1DUSA 3MCAA 4ZVTA 1SRRA 5BRAA 1PL6A 1OX5A 2IYVA 2ZTUA 1RZ3A 4HGPA 2LIPA 3G2PA 4IIJA 5JY6A 1FTSA 3MJHA 1JNYA 3UUFA 5LPNA 1YR7A 2V6MA 5KIAA 1WDLA 4NYIR 5LL6P 2VRBA 1J1UA 2QP3A 3E3LA 1PFKA 2BCEA 2QN7A 4L9WA 4OI0A 3VV3A 1CF9A 4U8GA 3KKOA 3R8CA 3KYCA 3KCQA 2ZE6A 2HNAA 2QAGC 4M6WB 5JS7A 1E7WA 2BT4A 4ZREA 3SFZA 2W58A 3E22A 4BCCA 5CMLA 2ZSEA 3NM5A 3F3SA 4ATNA 1IHXA 2FFJA 1VE5A 1NATA 1ZIXA 2GXSA 2IU4A 4YJFA 5J1TB 3VJMA 3MQ2A 3WFJA 5AVVA 1YB1A 3GFOA 2OCYC 1JKIA 3R3JA 2H4HA 3BD8A 2CLFB 1Z2PX 2OKCA 2WG1A 4XB6B 3WL7A 1RVV1 2GPNA 3VOTA 2XMGA 3CE6A 1F2TB 2IU0A 2DETA 5DNVA 3ZVMA 3SNKA 4AKSA 5KJCA 1YSCA 1MJGA 4OXRA 5U9CA 3ZJVA 2C8JA 2FSUA 2AV6A 2ZUDA 2XRFA 3AR9A 4OB6A 5TY0A 1M7HA 2ZRHA 1N1MA 2EW1A 3STXA 5BSVA 4IZ6A 4EHDA 1BDHA 1I5RA 4HH4A 2FN8A 5K0TA 2E18A 3KAQA 1RP7A 4F9FA 3JV7A 2IYRA 2O6HA 3HKCB 4CR7A 4O2AF 2ZM5A 3H7AA 3GWZA 5IM4A 1CQJB 2V6IA 2JJ2D 4DA7A 3Q11A 3N2KA 1JDTA 3LXRA 3I5YA 4NE7A 5L4NA 1EVYA 4X0EA 4Z3DA 1H1TA 5SZIA 5J4LA 2ZUTA 4CM3A 1A5ZA 4OF4A 3RUIA 5H9WA 1QP0A 1G8JA 4FMDB 5HKAA 3DTVB 2DWUA 4MRSA 4OO3A 3UJ6A 4CLEA 1CT9A 2ASVA 2VAWA 3F5FA 5JSFA 1T5HX 5KYTA 3ZD8A 4PG4A 1GYQA 4M7WA 3W6NA 1EXVA 2Q41A 5HNKA 3X2SA 5FFFA 4JB0A 5K6RA 1BXZA 1XTJA 3R3UA 2I2AA 3D3KA 1TU4A 2DFLA 1WZCA 4LI0A 1RM0A 3RHZA 3QI2A 2DBRA 3RS4A 1PZNA 4HX2A 4Q21A 2P4SA 1UL1X 5JJKA 3OM1A 4FQ7A 1RYDA 3PTZA 2XNJA 4EVSA 1CY2A 3SM9A 2LPMA 1Y42X 2IEGA 1BWSA 5LBIA 2DE0X 2H1HA 1EE2A 2OZPA 3P7MA 5LU8A 2B7CA 3A3NA 2GLXA 3NT4A 3HRHA 4JODA 3LQ1A 4NBUA 4M6WA 2CL5A 3HFJA 2WWRA 2PMWB 3M9XA 3TVYA 3H1AA 5T4FA 2R7LA 2BRUC 5JBIA 2I3AA 3BH6A 2A1TS 1U0GA 1SIUA 2OAGA 3JQ9C 5JSKA 4A2PA 4CODB 2WAOA 1EVKA 1VKOA 5IN5A 3O91A 4DUGD 5JDCC 1JXOA 4OYLA 3JQ8B 4NJEB 2VP3A 3AKYA 4EB8A 1I7NA 1U2SA 1TK9A 2ZBFA 1LSUA 3SVTA 4ZCSA 3JZFA 2EW8A 3HCPA 1V11B 2CDAA 2EF0A 1WMEA 2XX3A 4MI3A 3UT6A 4B6FA 5IHXA 4JY7A 1EUQA 4IJQA 1NKTA 3GDGA 4ZOLB 4PCUA 2P2CA 4N5IX 2ECQA 2YRWA 1EK0A 1T15A 3KSRA 3QWAA 2XJ9A 4YK7A 1SKQA 2CJWA 4R7TA 2QTCA 4C76A 3LV8A 4OJYA 1QUFA 2P41A 2XA9A 4PTZA 7YASA 2IDKA 2ZRAA 4Q1CA 3TECE 2W8ZA 1CQJA 2QMQA 1Z5PA 3DW1X 5DT2A 1CS0A 3AVOA 3UEOA 3VDQA 1JJBA 1KVTA 3H87A 1MXFA 3FNFA 4BP1A 4HVCA 3DLBA 4ABYA 3NHMA 2AJTA 5ALUA 1A77A 4CKBB 3KTDA 2L42A 3MMXA 3NBZC 1W75A 1P4RA 3MK31 1V5EA 1NMXA 3OY2A 2M6SA 4K9NA 1TFRA 1W1IA 3DTVA 4JT2A 2RKBA 4Q9DA 4CMKA 2MSEB 2HEGA 2XXBA 1EVZA 2N3ZA 6LDHA 4BFUA 1HA3A 4TYYA 3OQVA 4H6WA 1E6UA 3EFEA 3BF8A 1RBZA 3IR5A 4IWYA 1A8QA 3S68A 3OLCX 3DEIA 1BE8A 1EQUA 4D02A 2ZAOA 5DN6A 1NP7A 3L8CA 4UHJA 1DX9A 3OLYA 1X1RA 2VF7A 3PKZA 3LK7A 3K9LA 1OFVA 4DBVO 5SYAA 5EJIA 5E3HA 1R4MB 1GCGA 2JFPA 3WSTA 4CN9A 2YIMA 2QAGB 1V7CA 2D5IA 1TMOA 1B8NA 4UNRA 1A5BB 1AXEA 2HNBA 3UOWA 1K63A 3DMFA 3KVRA 2F2TA 4B6OA 2YW9A 3LAWA 1QIMA 4BO3A 2Q6KA 3N9IA 4HLDA 1XD2B 1GXSB 3HBJA 3TAHA 4PG5A 1P91A 3COYA 3EQ8A 3L4EA 4GI5A 2OG2A 4JU9A 5DN9A 2ZM6B 3JVIA 3ESQA 3FDJA 4G1CA 5BXQC 4IGFA 2ZS7A 1YBMA 1TEVA 2O2XA 1XEWX 3E81A 2X4IA 3IRVA 3JQ8A 3KUDA 3N2NA 4YN3A 1JIVA 4PZ9A 5AOBA 3M3DA 1BQ3A 3WY9A 3ZGLA 4DSZA 3F78A 1V11A 1ECFA 3OOEA 3QW2A 3F8SA 2QVGA 1RRFA 5DTRA 5LBTA 1VTKA 1IHPA 2FVXA 2O8NA 1KZ6A 1UKAA 2UYCA 2J31A 3AETB 3H4VA 3OF5A 1OFHA 2NT4A 2OOSA 5FLEX 1SHZA 4X3CA 2VA9A 4ND1A 1TLFA 1ZJJA 4IFTA 2BLLA 1KSGA 1TCBA 3CNLA 4JBYA 3IUJA 3DOJA 4M83A 3W7BA 1QHNA 2XTZA 1JVSA 1TA4A 1JB1A 3TR6A 5BR7A 4CKBA 3CUVA 1EQAA 1W46A 1YMUA 2P69A 3EXEB 1Q3HA 3JZMA 3W9BA 4BVGA 2WJYA 2JIBA 4HVAA 2CD9A 4GKKB 1WHTB 1H2ZA 2C0PA 2ZUCA 2RGAA 4LTNA 4C01A 4NCBA 3C39A 2AKEA 1R9JA 3U4HA 4AZSA 4XCQA 1W85A 4DV6B 1BO6A 2ZDGA 2GTPA 4K81B 2P8JA 4OEHA 2I1QA 1RAGA 3UUWA 4JLPA 1R0XA 3VPXA 1D0SA 3QWIA 3T4PA 1JHQA 1RC0A 1THGA 1C14A 2VWQA 3Q9NA 4QAQA 3R7BA 1F48A 1N3YA 1IY8A 4M38A 4RADA 1ECJA 3O94A 4ZQFA 5AVUA 1R4MA 3H9GA 5CCEA 3D5TA 3O82A 1RI1A 4C1NA 5K4HA 5JY1A 5F2KA 3WGGA 1NPDA 2QAGA 2VYFA 5KYXB 2OVBA 1A69A 3OCYA 3TGWA 2D8MA 3NV9A 4AZWA 2UUOA 3N28A 4PANA 2F67A 4CDNA 3DW3X 2FPMA 2OP0A 5K8IA 2H07A 4LHWA 1P9OA 3WG9A 4BZQA 5JISA 4ER5A 1KI6B 2FF7A 4C4XA 1XD2A 1GXSA 2ZBRA 5AW6A 4FOPA 5HXAA 3BEDA 5EIFA 4BP8A 3Q7PA 4GR9A 4DCGA 1UKYA 3IBGA 3CVUA 4V03A 2WMDA 4NNJA 1H9AA 4WSOA 1Y1LA 2PX3A 4BN5A 1I5EA 3NWOA 2FPGB 1K6EA 2O3SA 4UTRA 1X80B 3GC6A 2OBMA 2OAEA 1JR3A 3QU9A 3GHHA 4Q19A 4XSVA 521PA 3U4DA 2QUIA 4YCNA 1KY5A 3ZTWA 3CPSA 1E5LA 4URUR 4FDLA 2I4LA 3HU2A 1Z2OX 4AROA 5A03A 1NNLA 1SQ6A 1Z8FA 3TUJC 3AETA 2B1JA 2ZBVA 4OHBA 5SICE 4EO9A 1YQUA 1KI3A 4GG1A 4MP6A 5LZ9A 1Q1ZA 1ITZA 1X3LA 4K5QA 2GPTA 4FE7A 4M60A 3NWJA 1HLDA 5E1DA 3BHNA 3H0KA 3W3AA 1ZD4A 4N39A 2VSNA 4ZI7B 2Q3LA 2H1SA 2R6ZA 5JC8A 5LM3A 3T5PA 4JI6B 1Y6FA 1MP0A 3KFVA 2PQ6A 3U7IA 4M9RA 1IAQA 5CU7A 5LA6A 2LP4Y 4ASUA 1IN5A 3KUCA 1PWZA 3AQ4A 4NCXA 1B16A 1E1LA 1YL5A 2C9MA 4TRMA 1Q7TA 4DQDA 3GRPA 1WHTA 4NHOA 2W42A 2YBDA 3BWMA 4IINA 1CRWG 2JI8A 4PLYA 1E2LA 2PL5A 1KYWA 4PNZA 1T43A 3G9XA 4RY0A 4YPFA 1TJYA 2ONYA 1Y6RA 2BELA 3TRKA 1ULAA 3TGPA 5LKRA 3J81A 3PICA 1SKBA 1WO8A 2R11A 2WSBA 1ZSYA 1MB2A 5CIQA 1AGRA 1OWNA 1U0EA 4XSHA 4DGQA 3KVOA 2RCYA 1GPYA 4UOZA 1F4LA 2PZKA 2B99A 2G1JA 2QUAA 3D4PA 4LE0A 1U3UA 2J3KA 2QP9X 5ALWA 3ZVLA 2VP9A 5EMHA 3A31A 3IAM6 5IFLA 4JP1A 4CEIB 1E4OA 1TB4A 4U5QA 1XEWY 2RI1A 3DEYX 3ENZA 3SFTA 2QD2A 1TLLA 1EFHA 3G5UA 5D7NA 4FN4A 1ZU4A 4AF8A 4DJFC 2BH9A 2GSDA 1KK2A 3JQ9A 1E66A 3AG6A 5ADUS 4RKQA 1T36B 4BLVA 3NHFA 3RBZA 4CF7A 1UBMS 2BFAA 3JYLA 1Z06A 3ANNA 2JKVA 2C5SA 3FYSA 5CGQB 5JDCA 5KSOA 2EV9A 1AK1A 2D59A 3ZCUA 5IKEA 4PO1A 1NBWB 3SVZA 2FX3A 5DIFA 1BYIA 3I45A 3PEVA 2FOLA 2Z30A 2Q3CA 4JOCA 3LY7A 2JGRA 1CR2A 3UHOA 4URXR 2CVQA 3A6KA 2FPGA 3PGKA 3ZTYA 1UKVY 4YAIA 1X80A 4Y6SA 1MQ9A 2G0TA 2PLRA 3KJXA 3EXFB 3JYOA 1KF0A 2JA1A 4NFLA 1PFWA 3ECAA 4U2DA 4JC5A 5CYGA 3QVLA 1EEHA 2AR0A 1C9DB 3KUUA 4IRXA 2JAWA 2MJLA 2I7XA 1WXFA 5JWRA 1MNQA 2YCBA 4GVPA 2OCXA 1AKQA 4LMRA 2WY2D 4ZI7A 4UXIA 3NXKA 1NF8A 4FDMA 2NWQA 2ODWA 3C6ZA 4DRXA 1I9GA 4NLLA 4TWJA 7GPBA 2J32A 3PD7A 4OHUA 3VAZA 5IDVA 2GBPA 1XL0A 2G67A 2VCYA 2WTMA 1Z35A 3BSSA 5DM2A 4MQ5A 4O4HF 4DW8A 1WWKA 2HI0A 2H2FA 2R97A 4CFYA 3LZDA 1FDSA 2Q2OA 2V5AA 3MTAA 2JI6A 2VSQA 1BE1A 1RI5A 3IP5A 1JI0A 2GAJA 4FHEA 3VZDA 4DV0B 3O5AA 1GAWA 5FI1B 4CGYA 1GTZA 4A0HA 4PHFA 3H3XA 2QP4A 1OXVA 1ULTA 3O95A 4KVAA 3TB4A 3DNFA 4CMIB 3WWCA 1GQFA 2ZBPA 3OX4A 1GTL1 5EKTA 3DD5A 4N41A 5HKOA 1ZLXA 4Z8XA 4EA6A 1MQSA 3PS9A 3DEKA 5EFZA 1P2UA 3A2NA 2JBWA 4BO0A 1U1GA 2FPKA 4MVJD 1H6BA 1DWPA 3TQTA 2OK8A 3M5WA 2YZGA 3NT2A 4KE9A 1ZK4A 1T6ZA 1RRCA 3U3MA 2X0FA 4LZWA 4PLWA 2QX8A 4W63A 1QYWA 1T36A 3SIWA 5IT5A 2YHAA 4TS4A 2REOA 1QG0A 4X00A 1P4AA 1UC5B 3OQNA 1GAJA 3ZE9A 4FGUA 1H1DA 3SHQA 4UCFA 3UHJA 1JWBB 8ABPA 4GZMA 1XZNA 3FNQA 4QYWA 4ZO4A 4R8MA 2YV4A 5BSFA 4ARZA 2Q5IA 3DZBA 1UQRA 3LYLA 4IHJF 4GYJA 3SHVA 5BN3B 4XSGA 4OOEA 4CQMD 2IW1A 4BNKA 3EXFA 5CDFE 3FCCA 3TO5A 5ADHA 1DQYA 1E9SA 2XB8A 2IDJA 4DN6A 4LRQA 2GK4A 2NTJA 5EWMB 1PNRA 1ZQ1A 3B9QA 3L6RA 4II2A 4J2HA 3QH4A 4DLLA 4BO5A 2VQDA 3I9LA 4MO9A 1Q19A 1AHNA 1LD3A 1A4XA 3BTOA 4JZYA 5GGXA 4BLOA 1Y4DE 3G8DA 3UXYA 3OECA 4G5SA 3LXXA 3TDNA 1ZBDA 3EC1A 2PMBA 4BIIA 4D3XA 2TYSB 5CXSA 3NBFA 3VR4D 2WZQA 1P17A 2J3HA 2O3QA 2QG9A 3P9XA 3R5TA 3GLFE 2FMFA 1QO0A 2GAIA 1G41A 1IM2A 1U0NA 3AJ9A 4G0MA 4EB3A 1UDAA 1Q22A 1GPMA 4ZVUA 2IYQA 3PJFA 4JK3A 4FINA 4QTTB 3E5HA 4BRSA 4RW0A 1QANA 1Q77A 4AO8A 4DHWA 4E2FA 4D9KA 4ITRC 3OFNA 4PQGA 4RH3A 1XTBA 3L92A 4ILKA 5C34B 1QQ6A 3HA2A 3BGWA 5ALJA 3NOVA 1HQKA 3WO1A 3JQBA 4BGEA 5KC9A 1FCJA 3A9CA 1RFGE 2X0NA 3Q3GE 2F3QA 4JVNA 2V3CC 1QTQA 3MB8A 2GUWA 1E4VA 1QGZA 2DECA 3LPMA 4RIIA 4CMIA 1EM8B 3CZQA 4QYTA 1XVIA 4OLAA 3IV6A 2IPOA 2ZKIA 1C7IA 2ZRJA 4HGNA 1T8PA 3IR7A 4DNOA 1HYQA 2ZSIA 4GSKA 2YASA 1AD2A 4XRGA 3STHA 1Z38A 1XJ5A 3INRA 2OSVA 4LDJA 5BYKA 2RKOA 1CZKA 1EWKA 4I1RA 4NU8X 3DXXA 3FPSA 4JLBA 2I1LA 4YDHB 1YQ9A 3KWLA 3B85A 1QBGA 2C5FA 4FT2A 4J03A 3UJHA 4EATA 3GEDA 3C0KA 4TQUS 2O59A 4MJ7A 4EEKA 2HQRA 3NDBB 3RVDA 1ORDA 3EGOA 1FYEA 3VSDA 4KO1S 2JHCA 3QUSA 3NB0A 3FD8A 1XO1A 5GVRA 3V8EA 1XAJA 3G7SA 3X2EA 5CDGA 4JUDX 1K66A 4K26A 4ABTA 3HJFA 1X9GA 1R8YA 2NPIA 2QG4A 1Z4IA 5TEVA 1JJ7A 3IPLA 4V1CB 1C3OB 3HDTA 3QE0A 4F3CA 2TECE 1BDJA 2XHZA 3IMEA 3VV2A 5BQXA 1K8QA 1E59A 3LDUA 4FILA 2IYWA 1XWIA 3LPAA 5EWMA 2KM1A 2IUYA 3H6GA 5EJ8A 2RK4A 3GLIB 5HS4A 1E6CA 1KR2A 3BRWA 4HLNA 2CV2A 5ALRA 1GNSA 3P2IA 4L28A 1V8OA 5JR3A 4KFCA 4WKNA 4ESHA 5LC1A 5ALKA 4C4AA 3W8DA 1FNDA 3VJKA 1Z6GA 3WLFA 2DUUA 2G09A 4L8WB 5FOXA 2YDYA 3AVQA 1C2YA 2DWPA 4X64B 4ERNA 1TKRA 1Q6ZA 1MOSA 2H4WA 2OT3B 2ZSAA 3CHYA 5IYZF 3HUTA 3IQDB 3FUVA 4PS0A 3WHPA 3TRJA 1G3MA 3RU2A 3I01A 3KQMA 4Z9YA 3M81A 3NUZA 4EUNA 2BGGA 2UV8A 1TYDE 5EIBC 1BDBA 1L5SA 2P2LA 4POOA 4CLHA 4IM7A 1TJPB 2WA1A 5CPFA 2Y93A 3NR2A 1UQTA 1TCVA 1H66A 1IHDA 3IEKA 1M73E 4MIOA 3UBMA 4KYVA 4EF4A 4JIGA 3ZHZA 1W87A 4TRNA 1QYIA 4UDYX 1EM8A 3S8MA 3CF2A 1QG6A 4GX2A 4L15A 2Y1LA 2XUIA 1OASA 2B2XA 1SZPA 3C45A 5K2OA 1E1NA 1EUDA 3N6VA 4JXXA 2QR3A 3CT6A 2X0JA 3QP9A 4OHFA 3BC1A 5IMSA 2OFPA 3DE3X 4CL3A 1GUBA 1TQ4A 3EASA 1RLOA 5TGZA 3T9CA 1FDWA 1E0DA 1PV1A 1C3LA 1S2LA 2JJ1D 3OJ0A 3DHWC 1BEUB 4MH0R 3WL3A 2VP2A 5AIBA 1RPJA 1G38A 3HK2A 4Q9LA 4DC0A 3RU3A 3CPJB 1JR4A 1T1JA 3CH4B 4W6QA 4EG6A 1HSOA 3INNA 3CVWA 1W9MA 3QYAA 5FNVF 1VJGA 3E9RA 1YO6A 2XNCA 4LSWA 4LFCB 1WKVA 3F90A 3VZRA 1EQ2A 1RW4A 4OGFA 2AWNA 5SY9A 4FZJA 3ZCQA 3ZW8A 4J3FA 4G97A 1C3OA 1HFWA 5DM1A 4V1CA 3Q6IA 4TKUA 3R7SA 3GGDA 3ZC3A 1VHWA 4EB6B 1T5TA 3HB1A 1Y9JA 4RUKA 3WLMA 2R5WA 2FLWA 1CB0A 3ROMA 4Q3BA 3O84A 2ASEA 1XWWA 3GLIA 2FPLA 3E4DA 1UZUA 2ZEJA 3AXSA 4EARA 2NU6A 1JILA 1TL7C 2ZJYA 1VFPA 3BREA 4JFAA 3STTA 2GLTA 3RW9A 1PR3A 5BWMA 3WX0A 2HWXA 2XWPA 4J7UA 3C74A 1G7CA 1YS9A 1PV2A 1YVUA 3A70A 1A9YA 4NWIA 3OLWA 1YV9A 2Q3JA 3U26A 5ITZB 4ZT7A 2O1WA 4X95A 3NHUA 1UJ6A 3R23A 1U8EA 2C2GA 4O2RA 3Q3HA 4JKIA 1EAMA 4ZOEA 4ZTBA 1Y37A 5J59A 1BCRB 3UH0A 5AP9A 5EIXA 2H0RA 5FWAA 4GQIA 1PNVA 1W6RA 3FPJA 1LBQA 1T8SA 5B64A 4K9OA 2REXB 3MJVA 4GHWA 4KU4A 3RUHA 4XGNA 3B5IA 1I4OA 1FFAA 1X9IA 3ZD7A 2AI2A 3THRA 3E5NA 4ZC8A 1K3FA 1GV1A 1PEKE 1J07A 1WXXA 1QSGA 2WWIA 3L1VA 3VC2A 3VKUA 2RHLA 1PT7A 4DKXA 1W581 4GI1A 3FUUA 4ND8B 3HBAA 3EWAA 3EFOB 1KY3A 1XQXA 2WIDA 3BL8A 3O7WA 2MSLA 4JYCA 3ZV4A 4CV0A 2BEKA 4KMRA 3RSFA 1IPFA 5HP4A 4RMNA 2BUBA 3H2JA 1FXUA 5EYPB 2IVFA 3O83A 4R69A 1VXOA 4UHDA 3B82A 1NF3A 3GGGA 3NOOA 3PQCA 4G0UA 2Q9AA 3IFSA 3R09A 1X8KA 4XCVA 2NYVA 3H05A 3TSWA 1OXKB 2WMNB 5H80A 3I6QA 2RK6A 4LKRA 2BGIA 1Q0PA 1OZFA 3ZHOA 5DXAA 2J7PA 2X77A 4US1R 5KX5F 1Q17A 1RLIA 5FUXA 4XWTA 1OB5A 2JCSA 2E4WA 1JA1A 5T4HA 3SKYA 5CFRA 4CG2A 4WJLA 1OA1A 1B43A 3ORSA 3H9QA 1FBTA 4IG4A 2FJ0A 4UVDA 4CE6A 4ZV4A 1GQOA 2AMJA 4I6JA 1CKEA 2B5WA 2IPAB 2UZ1B 3H2IA 2JD0A 2ZRIA 4HZIA 4MP3A 5HBRA 4GL2A 3AESB 3E1KA 2YN4A 1KYVA 3KS9A 1NQUA 3E9MA 1KY4A 1CUWA 2HMYB 3KOOA 4H7FA 3W5CA 4BN4A 3SGLA 3P2OA 1ATZA 4EB6A 4I55B 3CBQA 2F90A 3WAKA 1H4SA 1E58A 1XU7A 3SQLA 2ECOA 3O4GA 2FRDC 3TSOA 1SXJE 1YBAA 2WWTA 2YBEA 3B53X 4UUQA 5DW0A 4G5XA 1WB5A 5B1DA 2RARA 1PWXA 2Y9PB 2D5LA 4ZU6X 5ITZA 1RYHA 1TD9A 4PIMA 1Z2NX 3NW9A 4O5AA 2G0NA 4B4WA 3HDJA 1DHTA 4KYUA 1BCRA 5KBYA 3D7NA 1DJNA 4KKVA 4OSEA 1FRQA 2GYUA 4JSTA 3ZW9A 4H3HB 4W6ZA 2P67A 3BTSA 4ZEXA 3AR4A 3MJSA 5I7SA 3G2IA 3ZS9A 1POXA 1XAIA 2CLIB 1I32A 4MP8A 4P81A 5ILGA 2J45A 4YBZA 5G0SA 3X2FA 1CLEA 1EM6A 3SS7X 4ND8A 3IQXA 3D1JA 5KYVA 2QI9C 3EFOA 3F5QA 1JAZA 3HL0A 3O8QB 4LJ6A 3I9FA 4P4UA 3CLTC 1ULZA 5DRYA 4M76B 5I6DA 3JTEA 3UPUA 3UCFA 2XB9A 5ARCA 3WZLA 1XRNA 3CO0S 1YRYE 3CW9A 1TX4B 2CK3A 1Y3AA 4YJ2F 4ZOCA 1GQSA 5EYPA 5CPBA 4BO9A 3FUWA 2WUDA 1PZFA 1GYRA 5HUHA 5IZCC 4ZVKA 1B0PA 4I9GA 1KPIA 1ZC3A 2Q4DA 4DLRA 5JNSA 2IHZA 3A2KA 4N49A 1S4QA 3N0RA 3W77A 2GX6A 3I9V1 2PAFA 3LUFA 1DKQA 1FW8A 4DF3A 3FMPB 5IWAB 3GZ4A 2MYTA 1Q1EA 3OCVA 4I5IA 1FSFA 4LF5B 2IYUA 3KJHA 3IQIX 4NBVA 3DXYA 3RS7A 3BFXA 4UUNA 4RE5A 4KLCA 1A0OA 2PZFA 2X0KA 3G23A 4LOIA 2FTKE 3NNSA 3NOXA 4RZ2A 3NYQA 4WWHA 3RFTA 2G6TA 4XKJA 2HO4A 2UZ1A 5AI4A 2WWXA 2YMPA 1RQ7A 4KYIB 1X1TA 3AESA 2CVZA 3NETA 3WL6A 4Q1FA 3RREA 2XCOA 5ARBA 4OMFG 3K92A 2WICA 2OFOA 3BERA 3CINA 1YZGA 4P1ZA 4R8LA 4UXHA 4OUDB 3KEGA 3PWZA 2LDXA 1O8CA 1QU3A 3CGWA 1LZLA 5JE8A 1XQVA 3FIJA 2W70A 3W2IA 1P1KA 1XTTA 2VHEA 3I34X 4RV5A 3SBEA 4BQOA 1WQ4A 2PX8A 2CLSA 3G8BA 3QNWA 4Q5IA 1U8YA 4OFBA 2RHMA 3TGLA 5KWVA 3H11A 3RKSA 3ZNNA 1VLQA 3U9LA 3ABRB 4YYEA 4CM8A 2CMHA 1N6RA 1B0AA 3GZTB 4QT0A 5ESXA 3GIDA 2XR1A 1E8NA 4NI5A 3BHIA 4JJKA 3KT6A 2NACA 3NH9A 4I8IA 3CVVA 3A0UA 4S1VA 1GUDA 1P6XA 2M9MA 2P0EA 5IXYA 1RRPA 3VR3A 3QWBA 2EP7A 5FPKA 3TRHA 1EX9A 2Y0PA 2V6JA 4W7HA 3P0FA 4I6EA 1QHSA 1LPOA 2VPPA 5I7FA 3G3EA 2FCAA 2W4QA 2QDKA 4M21A 4AO6A 4ZKDA 3L46A 3AHIA 1WUIS 1KQGA 1WDWB 2AG5A 3O8QA 2P75A 4JKYA 2YJGA 3KSZO 3PNPA 1UWLA 2BHRA 4A91A 2HA4A 2B3TA 3SLKA 4QYSA 4QUAA 3TG8A 2IHTA 8ATCA 1IBKB 2ZAIA 3AHEA 2AEMA 4GGPA 3SU8A 1H2YA 4DUYB 3OZWA 5GY7A 4E3WA 5EHQA 4M1OA 3H19A 3I3SR 3O31A 4GPIB 4RY2A 3RUEA 2H3HA 3HYCA 1BGWA 3VHQA 2PKXA 1PX2A 3CRZA 4M1QA 2FPRA 2D3TA 4B6GA 3M4NA 2C5HA 4WINA 2QM0A 2R84A 1LLFA 4OP1A 5F4BA 4B81A 4NONA 3M6AA 2RHCA 2Q3BA 3IRUA 4EUHA 1P3DA 2J41A 3RIMA 2YQ5A 4KMOA 4BKUA 4B8ZA 3GFSA 1T34A 1X13A 1ORVA 3LX8A 1STOA 5FADA 2X8BA 4CCSA 1N3LA 2J6HA 2FK7A 3IULA 1DAMA 1XZQA 3IT2A 2HH9A 1B2LA 5DBEX 1V1RB 1EA7A 5H3LA 2BHLA 5U4QA 3GLTA 1IDOA 3LXUX 2QNRA 4E5SA 4P0TA 4ZYYA 3M0EA 2C7QA 3DXFA 1N5IA 1XCMA 4OG2A 1BH6A 3CURA 4UMFA 5ERYA 5EQTA 2GJ4A 1JZSA 1MC4A 3ND6A 3RTDA 2V5VA 4HGOA 1IUKA 3AY3A 1KMIY 5GZ1A 5JPCA 3FPAA 2QRUA 2WFZA 4YASA 4GSLA 3A4TA 2LVBA 1VKHA 3NEJA 4FEAA 1CEEA 1ZONA 2ZJ1A 4BFYA 1M2GA 2ZK7A 4M0DA 4D4GA 3JVDA 4B44A 4YR7A 4K6FA 3FETA 5B2ZA 1N57A 3R7DA 2BEUB 4PRYA 2GETA 1XAHA 3AKCA 3H1GA 3LSTA 3TLJA 3U7JA 3ZWKA 3PHGA 1WTAA 4NP6A 2PN1A 3IQGX 3WJAA 3GVXA 3EYWA 1Q2XA 3PNYA 4MLDA 3VZBA 1HDZA 4FCWA 4NMHA 2E4XA 4BB5A 1N2HA 3EPHA 3ZE1B 1DJQA 3QE4A 2Y77A 3HXTA 1PGOA 1Z0JA 3QVSA 4LRUA 3OZGA 1Q1AA 1XZFA 3EWNA 4JKOA 4ZCTA 4LDQA 1J2RA 3NVDA 2YV1A 3L6DA 2RC6A 1CP2A 3RVNA 5DGTA 2R66A 1RYMA 1A71A 1YQEA 4L8YA 4PZYA 1XV5A 1RNLA 2VZ9A 1I2DA 1HC7A 1NJ8A 1TU0A 3E70C 3G6WA 3CJTA 3F47A 3K96A 1JN0A 1VMIA 3DKRA 1DDOA 3AU9A 5FT9A 2IV3A 1QRDA 1S3IA 2C5AA 2GFIA 2W2KB 2GXUA 2ZR7A 3H6HA 2EQBA 4AJ2A 6REQB 3QHAA 4RVOA 5CFOA 2V7QA 3QBJA 1JDUA 2H92A 1SBNE 2ABWA 1KVUA 1WCWA 2VBCA 3QI7A 5E1OA 5CCXA 3GLGB 4W8GA 2HOQA 4JVMA 2JL1A 3MJ4A 3LWDA 3FYHA 2D00A 4HQ6A 3DMHA 4Q48A 8MHTA 3K5WA 4LJRA 2YFYA 3HYNA 2GHIA 1F1JA 1ZMBA 5T4EA 1D7AA 3H2GA 1F5NA 1KOLA 1V1RA 2X8LA 2R48A 2FRDA 4HI0E 4XARA 4QBIA 4X62B 4W5QA 5JNLA 1E4EB 2OESA 2PXXA 3HWSA 2ONJA 3TL2A 1OY1A 1AZTA 3OZBA 5EESA 4TKVB 5DYWA 4CM6A 5AUOB 1QOPB 2GZ3A 5FP0A 1ZKDA 1IRXA 3TM4A 1V48A 1ZXBA 2P8SA 5IXJA 4QDUA 3Q72A 5T8KC 4F6RB 1TPYA 2J9RA 4O2LA 2YV3A 4FHDA 5IUJC 3TLGB 2BR4A 3UWOA 4QDKA 3LCUA 4ZYWA 1YJAA 4G0PA 5T6MA 1DELA 1EIZA 3SQDA 3GLSA 4BFVA 3C4VA 1TZKA 2IEAA 4E5UA 1N5MA 3EZ6A 3ZXXA 1GGVA 1SIOA 2IFTA 3RASA 4RHEA 3B6IA 1U6KA 4IIJF 2PX5A 3ZDQA 2R8YA 3EEIA 2PX0A 2JGJA 4XIJA 3H1PA 5DMXA 3NAGA 2EVWX 1ZRSA 2CXXA 3KD2A 1FQWA 5AQ1A 1T5OA 5CX1B 5ITVA 4DDKA 4QKQA 3ZGZA 1C1XB 1JSLA 1Y8CA 4L4UA 1AUPA 1N2CE 1SC6A 2EFCB 1YS2X 2W6JD 3BCSA 3IP3A 4RTKA 4BCBA 1KIFA 2QVLA 3LHDA 3U1TA 5IZCA 1GTRA 1JQJC 1QO9A 1V9CA 3A4LA 3V1NA 5KZMB 1I1OA 2XUZA 4L0DA 3V55A 4FX5A 4R40A 1W48A 4TVKA 4CMGA 3GRUA 4FI3F 2WIGA 4HYQA 4ZVSA 1YTUA 4AQ7A 3N2ZB 2PUHA 5C5CA 1H5UA 1JKJB 5GONB 4Z4CA 3UTDA 2IITA 3ZIDA 1Z6XA 4EAQA 4EI8A 2W2KA 1XDZA 3E7WA 4HVLA 4ZCMA 4L02A 3S2ZA 3LYUA 1YDMA 4KVGA 1BVRA 4BV9A 2EFHB 1PT5A 2XUDA 1LX6A 2XQIA 1M2EA 4MPRA 4JBXA 4EG7A 5JXJA 1GAXA 4KSBA 4J0JA 4L5YA 1ACMA 4RCYA 1MT0A 3GLGA 4QULA 1N8NA 3DBRB 2V4ZA 2JI7A 1KSJA 5SZJA 3BM5A 3C16C 1RDFA 2G5CA 3ZY2A 2ZTMA 3JR7A 4LSMA 2PSFA 4YAWA 3W4KA 5IM4F 1T1RA 3GGPA 2PMEA 2D5CA 2C7PA 5HQ3B 4IFIA 3PQEA 3NAQA 1UH5A 2RH9B 3FVVA 1P2FA 3MJTA 1E4EA 1J39A 3PE4A 4YY3B 3GVIA 2HSZA 4KCGA 2W6ID 3ILYA 4TKVA 1N33B 3C24A 2HU8A 2CE2X 3HVUA 1KJWA 4L5JA 4DCJA 2CNLA 3IKLA 4F6RA 5AVKA 3ZVKA 1ZJ6A 2JFFA 2WZCA 1RWQA 5LB4A 1NUUA 4OX9Y 3RVRA 3JQAB 5REQB 3WAGA 1PT9A 3AUUA 1KBZA 4U2EA 1UBRS 5HHTA 1KTIA 1E18A 1JHXA 5DWDA 3B6EA 1KDVA 4PXSA 4IY1A 4KQ1A 1S89A 1TTTA 2FSIA 4P0QB 3RWOA 1AS0A 3FPCA 3W6PA 4WCFC 3JQ7B 2O3JA 4WVLA 3RFFA 4FYWA 3N7UA 3I04M 2XCIA 4GU5A 4ITUA 4IIDA 3NC4A 4RGVA 3P0HA 4U8HA 1GG8A 1KZ9A 1DOZA 1SHTX 4EY5A 1VCIA 4GM4A 2DR2A 1SHJA 5HEKA 1Z6ZA 2VNSA 3LYHA 4Q93A 4CDRA 1C1XA 4S05A 1JDPA 5CM8B 4BU1A 3I1FA 4N82A 3TRFA 3AR5A 3WBBA 1T9ZA 3GNQA 3ZK7A 2FWJA 1AURA 2RGXA 4TMXA 5GP1A 3KXIA 1C8KA 3I4FA 1SY7A 4E21A 4G65A 4PGAA 1FRZA 4HK4A 3W1EA 4U0KA 4RD1A 5KNCD 3R76A 4RMJA 1SU4A 3VKVA 3W5AA 2B4QA 5K3CA 4QGSA 3HO8A 4CKWA 4M0EA 1JKXA 1QH1A 3FMVA 3WNQA 1JKJA 5GONA 3WE7A 1YI1A 3HVIA 4ZEMA 3SZRA 1K7CA 4NYMR 1NC3A 4A6PA 2VHZA 1K7SN 2R87A 5IEJA 1JNXX 3GO4A 1PD0A 2B1RA 3DP9A 4X63A 3OZTA 2WWVD 2C31A 2VLIA 2QL9A 4WASA 4CU5A 2QKYA 1LDNA 2W2NA 5DEOA 1MVOA 1OYWA 2NNWB 4GR5A 4KV7A 4L9RA 4DSUA 3EF1A 3BICA 4IIHA 4FB5A 3ZQ4A 1JWLA 3L8YA 4QXAA 4RDCA 4A2CA 2NZXA 2QX9A 1O9HA 3T9DA 2QX6A 3R1IA 4OYRA 2M6KA 3TQSA 2C7VA 3UK2A 3KO8A 4IHKA 4UAJA 1A4RA 2Z9BA 5H9VA 3WMFA 3FN4A 5HQ3A 1WVMA 3V1TC 5D8DA 3T95A 5B4UA 5KTYA 4P3PA 2RB4A 1B41A 1N7HA 3OEEA 4FMDF 2A57A 4LEIA 1KYZA 3FAKA 1NMEA 2QPTA 5EUQB 2HDNB 4MCAA 3MAGA 1DLIA 3FWZA 3MFQA 3DAHA 2YNMC 2R7KA 3V4SA 2C4HA 3A04A 1M83A 3OT5A 4LE1A 3JQAA 5EEHA 2GSWA 3ONVA 3V33A 5CT4A 2A14A 2YJ6A 2FW8A 3E7FA 4EMBA 1K3TA 2X3YA 1KMCA 4QGFA 2BH2A 5EMLA 2DPGA 2H48A 2ZJ0A 1OWLA 1PR4A 4N8DA 3JQ7A 5JV5A 5G1PA 3PZRA 1L5HA 4MV5A 4MUJA 1XP8A 4MPTA 3ILXA 3JARB 3PIDA 4JDUA 1NZDA 1PQPA 1RIFA 1YF3A 1PR5A 1ANKA 1HT0A 2A4MA 1RQGA 4ZALA 4M1MA 3RCBA 2R8BA 1V9SA 4B6JA 4BFTA 3ICCA 3DAOA 4NV0A 3GDFA 2FW7A 4CLOB 2PMDA 1XDGA 3L0ZA 3VBEA 3FPFA 3FLBA 3DFUA 1OFGA 3QHPA 1RBYA 4QXQA 5DFAA 2NV0A 4XB2A 4FFLA 2XYVA 1E2QA 2DUMA 2WHQA 2I2CA 3FWNA 1JDNA 3A9TA 2BL4A 3GIWA 3LT2A 3L77A 1NVEA 3LP5A 3TZBA 1R6BX 4ENUA 2YIJA 1JZTA 3RM3A 3CG0A 5IK2A 2QOEA 1NGSA 5JYCA 3AZPA 4KUHA 4WTOA 4JS0A 3DHYA 3T9EA 2IXEA 4ZOLF 3BFVA 2WAAA 2DT5A 1Y3IA 3AJEA 3GPBA 2G6BA 4O02B 3R5JA 4I5EA 5ENVA 4BKOA 1TM3E 3E5MA 3IIIA 3V1LA 5I45A 2ZIEA 3LI2A 4PCVA 4XIFA 1B15A 2ZRPA 2W98A 2QROA 1J09A 3LNCA 3GDWA 2OCBA 4PZLA 2XWBF 4HGRA 4PZPA 4ZXFA 1ES9A 2BFFB 5C3UA 1ENPA 2QVXX 2V55B 3KZMA 2Y76A 5JZOA 4UM7A 2VTDA 5I9TA 4YJGB 4B4DA 4RMIA 1C1HA 2PKCA 1UXOA 3A58B 2ZVDA 5ECYA 5T8KA 4CNQA 2NO5A 3RC9A 3RK0A 3OSZA 3V6LA 1OOEA 4AW9A 4DOMA 2C9CA 3E9YA 4RAQA 5G0WA 5LYJB 3QFHA 1DKPA 2XCSB 2SKEA 3PITA 5EVJA 2OGWA 1M1NA 1M1YB 4PYJA 2VK8A 3AL2A 4WY2A 1ONPA 4ZHQB 5JMPA 3MRSA 2AZXA 4TMZA 4F4UA 2YKGA 2ZG6A 5THKA 5C1BA 4MYRA 3O8NA 1OI7A 4WCFB 3TLBA 3PQ5A 4Z7QB 5BV8A 3LW8A 3A6ZA 1VHQA 2H7YA 2XAAA 4CG0A 1XMPA 3GBVA 2I91A 1D3AA 2HU5A 1DAOA 2VZ0A 3DJYA 4K0KB 1GILA 4HWGA 2I9PA 4N8EA 2WDZA 4TLLB 4CF6A 4M1WA 1PO7A 2GR9A 2QJRA 4HAIA 1XG5A 4P53A 5HZGA 3T34A 4UFPA 1BS2A 2OGSA 1YA4A 1PQUA 5BUCA 1H2FA 1YIOA 2UKDA 2X9LA 5EG5A 1DFHA 5ADWA 2AZMA 4F60A 1BX0A 4CLOA 4ZAZA 1VGVA 1AO3A 2V98A 3MELA 1FNSA 5AOCA 3EXG2 3TD2A 3X1YA 4BEBA 4G0WA 2NSHA 3I2HA 3S5UA 3KSAC 2OE2A 4E5KA 3MWLA 4URFA 4WI1A 1O89A 1VL2A 1M34B 2FETA 1NW8A 1H8HA 121PA 2VTVA 4QHSA 4WECA 2MCFA 3ZCXA 2OMKA 1SCAA 5P8WA 5AVQA 1LH0A 1M7GA 1EWYA 1T9HA 1B8VA 2WHYA 1Z16A 1FFXB 4K2AA 2G36A 4HFJA 4DL9A 5EIOA 4G5YA 3AV0B 1CUSA 3LDAA 1EVEA 5IT9A 3ZLUA 2OXTA 1QCCA 1Q91A 2IQIA 2QGZA 2CHGA 2X9QA 3CX3A 4AUNA 4C22A 3ZD9A 4UE3S 4EKGA 3KPWA 5K5EA 3U6BA 4P92A 1IB0A 1P1HA 2BI7A 3WA7A 2HT1A 3ZXYA 3FLAA 2NAFA 4ZN6A 3AR7A 1RWKA 2R85A 3DL4A 4ES6A 2AJDA 4P31A 1K4YA 1Z2AA 3C6MA 1Y3DE 3DBLB 1TYCA 3ZLJA 4XM1A 1D4OA 2Z3ZA 2PGAA 3GPCA 3O47A 3ORRA 4LHEA 4QNMA 2I22A 4HO1X 3AF0A 4G1FA 4YJGA 5GJCA 3LC7O 5LA6F 4BIMA 1N0IA 1AA9A 2HV8A 1T3ZA 5J1SB 5ED4A 2AJBA 1RLJA 3DVSX 3I5UA 5A4MS 2AOWA 3K9HA 3EIWA 3FPBA 3Q85A 5LYJA 1OI3A 2DHEA 3RS3A 1GU1A 3FYTA 2JFZA 1M1YA 2E6KA 1GARA 1IQRA 2O2GA 3MJEA 3AKDA 4ZHQA 3QPVA 1ZOPA 1LI5A 1NNI1 3EAFA 3TJMA 3FOFC 3GL9A 5IC6A 3GF4A 1HZJA 2J33A 1UINA 3FNBA 1IQ0A 4UAGA 4AJLA 5A3RA 5CG1A 1PW5A 3K20A 4QL3A 4WCFA 4DB2A 3KHTA 1LV8A 4ZVMA 4U1RA 1MJHA 1QAQA 1J7KA 4KXQA 4MWSA 2Q4EA 4BNGA 2HW8A 1A5AB 2ZQYA 1MAWA 2VQSA 1NV8A 1T4CA 2EC5A 4G2NA 2C9BA 2WIKA 4E31A 1H3NA 5BT8A 5CDHA 4HG2A 1BAPA 1J0XO 1NUHA 1P0IA 4LJ9A 1V8FA 1Y5RA 4D8UA 3S27A 1A9OA 2FPOA 3R3VA 3VRHA 3MGCA 3A27A 3UMVA 1F8FA 4BQEA 5KVSA 5E95A 1JLHA 4GPAA 1DRJA 3ZW7A 1SK8A 3UV7A 4AY5A 1SZDA 4DTCA 2NN3C 4MVCA 3CWCA 4YP0A 1SC1A 4P3XA 4C87A 3FOBA 2UAGA 3FNRA 3AF3A 2N46A 2WTEA 3CMCO 4XGIA 2DC1A 2Q99A 3T9AA 3WGZA 1AQNA 4UTNA 2EEPA 1GTG1 3QXCA 5I5EA 3SDSA 2V4UA 4AX8A 5FV4A 1NXXA 3LCJA 3ACBA 3QWFA 4NX2A 2D7DA 4OHYA 1NDHA 1T1IA 2BMAA 4MV3A 3IDZA 2IWRA 1PDOA 1BVYF 5A7HA 3G13A 2NP7A 2LUOA 2R8XA 3WKAA 5ESRA 5B12A 2F59A 4JI3B 4WW0A 2HPVA 4I4IA 2NSYA 2OXIA 1RRKA 4AZ3B 4KREA 2W71A 4D6YA 3LUGA 2P30A 3NWEA 5JCZA 2V45A 5E4JA 5M5BA 1Y5MA 4CTNA 1QOQB 1P4GA 3G88A 3R6WA 4ZI7F 2VP5A 2COUA 5B7GA 4LPKA 3ZQKA 1GJRA 3DBLA 3HNPA 5LMNB 1TGYA 3M89A 2GZSA 2QTAA 3OWHA 3R40A 3Q5EA 4AIIA 3L41A 2P27A 2YNMA 4Y0AA 3HSSA 1LPAB 1XNJA 3P9KA 1H0KA 1CYEA 1G6KA 5HOEA 1NL3A 4PRKA 1P45A 1IFXA 5KEIA 1AQIA 1OLOA 5DTEA 4AJEA 4RIGA 2FFHA 1O4WA 3K6SB 4N5HX 2CGEA 2O5EA 1SU8A 1AF7A 2QLTA 3QMPA 4FCCA 2X9NA 4E4YA 3QYPA 3I2FA 4EGSA 1VZ2A 4XJTA 1SVUA 4L0MA 13PKA 1AF4A 4H31A 1KKLA 4CL0A 2YZNA 4MEAA 4PF1A 1GPH1 1KAOA 4Q1DA 3K0CC 5COAA 2AHOA 4CEJB 2QUBA 2RIPA 1UDBA 3V7FA 2PBZA 2FZKA 1QIKA 4MQEB 4LFBB 3KKKA 5K0LA 3NYWA 2FA9A 4C06A 1IU9A 3ANYB 4B46A 1V2HE 2RGWA 4Q9NA 1NQAO 3GWGA 2RHWA 4RK6A 2JDIA 4RFVA 4FOTA 4YHBA 3F1KA 4KXYA 4M7OA 2D2XA 1KK0A 2IYYA 3NBMA 3R3ZA 4Y8VA 4WK4B 5KMGB 1R4NB 4GWKA 4AS2A 1KSHA 1ZM3A 3EGXA 5JXGA 3KQPA 1XVUA 4P54A 4Y2RA 1L7VC 1N4AA 1OD6A 3IAAA 2BMVA 1PJTA 3CB2A 3QA3E 5JANA 1XEXB 2GZ2A 1E3MA 2B78A 4Z4HA 3V2GA 2R68A 3VH4A 2GZDA 2YWCA 4C78A 2EU8A 1OXBB 2NYRA 3IB6A 3HPQA 4WLNA 1XPRA 3E2PA 1E79D 3DKIA 3K2QA 2VTEA 2WAMA 4GOJA 4LHXA 2OFXA 4J3JA 3UPDA 1QTNA 2O7NA 4ZICA 3LK6A 4G41A 3D1VA 3TQOA 3ECCA 3MCUA 5KVQA 1Q6YA 3AB7A 5E4YA 4PYRA 3WMXA 3PLAE 1DG1G 5LVAA 4CIYA 1DU4A 4IQ0A 4AZ3A 2NXCA 2WM2A 4TLEA 4KPGA 5LIPA 5D5PA 1CETA 2MYPA 1CE8B 2CMFA 2YFKA 3JRWA 1WSWA 4QQRA 3LKZA 2YZKA 4UNSA 5FO1A 2HRCA 4OP3A 4LX0A 4OMDA 2VCHA 3NGLA 2EFJA 1XCBA 5H5JA 2ZKLA 5C5DA 2E1PA 4M9UA 3MGKA 4ZMSA 2E1RA 5IBCA 1HKHA 4GIBA 1IHUA 1OU4A 1VSBA 3B9RA 2FWPA 1G3RA 1Z4KA 3FYCA 4LJYA 4QJIA 5TR9A 1WUKS 2R6CA 4HKTA 1T3HA 4ED9A 1FUEA 3VR2D 1Q3TA 1FF9A 1GR1A 4XFDA 3K6SA 3PPIA 3F5MA 4Q7LA 5FQOA 2J3DA 3WYCA 2W2XA 1UKZA 3EJWA 4YAEA 1FQKA 3INTA 3QELB 5C2JB 4UHFA 2NUTB 2JJMA 2ZS9A 4DYVA 3FWPA 4EUKA 2CV1A 4EQZA 4IDBA 3OE7D 3VSEA 4JOBA 2CV0A 4G86A 3D9QX 3WB9A 2B36A 1N2OA 2P1RA 3AHJA 4MQEA 4N3AA 3PCTA 2OUIA 3VU9B 5IC5A 1H85A 1E7QA 4PFJA 3UTCA 4RA9B 4XVRA 1RPZA 2XXAB 1WXQA 3TOVA 1ADGA 2DH5A 2JKYA 1P2BA 4EX6A 1DUVG 4FUQA 4BAZA 3S8YA 3KETA 5KMGA 1IMOA 2DWQA 3QBDA 3H9EO 2WINI 2XRYA 1XAGA 3W2FA 5HFAA 3IGFA 1XEXA 3GEIA 2Q2VA 3IQWA 2A33A 4FGWA 2CJYA 3K9WA 4PLFA 3RF6A 3EBOA 1SOWA 3I2GA 3Q87B 1JTFA 5K4GA 1AGNA 4RZXA 2IS6A 3FFWA 4BZPA 2CHQA 3FUCA 2C42A 1X42A 2I4IA 1FFSA 3KWFA 2VRNA 1YCFA 5ESDA 2YVQA 3RIGA 2AIRA 4R9VA 1B6GA 2GF0A 4LFAB 4MAMA 3EEOA 1SOUA 4Y1GA 1E2KA 3DA8A 4IG9A 4IVNA 4MV8A 4GPZA 3B8EA 4NARA 3NOQA 4YROA 1OH7A 1HT1E 2X0RA 1MN6A 2B3DA 2WPNA 1IY1A 3AUYA 3GMDA 3NEYA 1CE8A 1NVAA 4RKYA 1NBMD 1QH0A 2B69A 2HA7A 4RIFA 3W2EA 3ZX4A 2QQEA 1GQYA 3ZWMA 4YMVA 4XYLA 1J00A 4D2IA 3CX4A 4Z6KA 2M32A 2RDMA 3FJ1A 2I4RA 3TAUA 4YLYA 3JASA 1QQBA 3N07A 5AJVB 2G5PA 4EG8A 5KWJA 4I66A 4IUYA 1WNTA 2MINB 3O21A 1TYZA 3K53A 1ZOIA 1M74A 3EPPA 1PZXA 1Y34E 1KI4A 1PGJA 1EX7A 2O0MA 3OQ1A 4LW8A 5ER6A 1K6XA 2F00A 3Q7TA 3WRXC 4X45A 1A76A 5LZ5A 5C7OO 1GGKA 1H2EA 4C4ZA 3QELA 4BQPA 4DA0A 4DREA 1RCTE 1UF9A 1I4TD 3R8XA 2Z4TA 4TT8A 1NYRA 2NUTA 4L8GA 3W5DA 5DF1A 1G2QA 4J6FA 4JLKA 3EUAA 3U4AA 2QPLA 2GVDC 3VR5A 1EJ0A 2BUCA 4IFEA 4TOIA 3IQHX 3VU9A 2J4FA 3HYLA 3V1UA 4B6EA 3LA6A 4EG5A 3CLSD 5L4SA 1I2AA 4FFBB 2PO7A 1AE1A 4INOA 1IAVA 1ULUA 4BVLA 4DMCA 4RA9A 3M5CA 5F4ZA 1XVLA 2QQ0A 4RM2A 5TS2A 4R0VA 4KPYA 3AB3A 3ACCA 4EF6A 3NHSA 2AGVA 2HMAA 1WDMA 2CL6X 4W9MC 5FBKA 4EM6A 5EWLB 1ZXLA 1R7RA 4F0JA 2HF9A 3AEXA 4K05A 4J0IA 3VMMA 5TQ2B 1ZINA 1HOTA 4LHYA 5EHIA 3OPNA 3FRJA 3C7TA 3WYFA 4Q4HA 1ID1A 3VYTB 5BMVA 4REQB 3DULA 4LAFA 2VF5X 5BOSB 3VU3A 2ECKA 1ONSA 2WLSA 1SUFA 4J94A 4OQXA 1N3IA 3CW2A 3KPJA 4RF2A 1F2UB 1Q1QA 3G7NA 3TMYA 2CXQA 4KE8A 5D86A 1FFEA 4YI5A 4DEYA 5EJ7A 1NASA 1PGPA 5FPTA 2W6CX 4LI3X 1MB4A 4D6PA 3ZE0B 4PLHA 1JU4A 1E9FA 3KIPA 4TMYA 1FX0B 1GZDA 4F3NA 1WUHS 4MS4B 1R6XA 3FHCB 1KNXA 4JSRA 1UP7A 3D6TB 3NIFB 4J4HA 3BS4A 3RVLA 4K6HA 1GDHA 1DTWB 5A02A 4JI2B 1TTPB 5DYGA 1LQ2A 5E2IA 2DH6A 1VLMA 2XWJI 4J3NA 4ZO6A 2F3UA 5FUWA 1B0UA 3L18A 3VTAA 2MINA 1S01A 3HEMA 3IOMA 2GERA 4N5DA 1AK9A 1C7ZA 2O5RA 4TTQA 3H17A 3TFOA 2HA3A 2IA5A 3RANA 4LJ4A 4RYDA 1A7JA 1JG4A 4PINA 2QVZX 3EVAA 1QR6A 1X7WA 5JECA 1CS4C 1SB8A 2I29A 3D4NA 4BN0A 3KTOA 3LPDA 2CHFA 4KAJA 1CNEA 1XHLA 3ODPA 1XMQB 3K0CA 2CLCX 5A9RA 4L51A 5JUWA 3T41A 1I3LA 2Q9UA 4U0JA 2BE7A 4DEXA 1WLSA 1QH8B 3WGTA 4RD3A 5ALOA 1V1MB 3W5JA 5F1OA 4YECA 4ZO8A 3VPAA 1Z33A 3GX1A 4KZPA 4MPDA 5I9SA 4MULA 3EQZA 4FFBA 1UT5A 3JQPA 4ZPJA 1MAVA 2RGEA 1LTQA 4KE6A 5GAJA 1U7TA 3ZV6A 1Q12A 2A5JA 2RMKA 1P4HA 4RZUA 4FGSA 1QVVA 5ALNA 4BX8A 3PQ7A 4KR6A 1KRXA 1P5JA 4UBLA 5TQ2A 2FK8A 2QMYA 1AHHA 3BHMA 4DCVA 3E48A 3D5QA 1XCJA 3O1IC 3U3JA 2BC9A 2ZI7A 3BGDA 3LDGA 5A5EA 4GLFA 3LC2O 4NBWA 1DLJA 5BOSA 4Z4QA 3HFRA 1N75A 1UBNA 2EBFX 4GPEA 3DMDA 2A30A 3OQIB 2HJRA 1KFCB 2J5BA 1F2UA 3KOWA 4KGVA 4ND5A 4AMYA 2YHBA 1MU0A 1YWGO 1LLQA 4LJLA 4C3OB 4BO7A 3THOA 4CQMB 5CLJA 4DDTA 3PE3A 4YFYA 3DMPA 3GNTA 3RFVA 5JU6A 3EGEA 2NYUA 2FW1A 4D99A 1OFUX 5LYYA 2B6NA 3ZU3A 2ZR9A 3SE0A 4GXQA 3WWOA 3ZOZA 5HTOA 2A9JA 1A9QA 4PV7A 5ALSA 4F38A 1GVNB 1KXZA 2KE5A 4GYWA 5EZQA 1W9HA 5G0VA 2AE1A 4RVFA 5A05A 3L7IA 1DTWA 2GM5A 3G0DA 3ZHYA 4W99A 3VC7A 4EELA 2R47A 3DZIA 1G9SA 1HLGA 2ZJFA 4M3NA 3T7CA 3HCDA 2F62A 1PG5A 2G04A 2EAUA 4OB7A 4OLFA 2AFIB 4BJ5A 5C8YB 4BV8A 1G2PA 2HBQA 4OATA 4YQFA 3ETGA 4JA2A 2BY4A 3OKCA 2Q9BA 4ISCA 4AM8A 5FDFA 4OREX 1MRNA 1I0IA 4OQLA 4QOIA 4HDAA 3F9CA 4AJHA 4R01A 4UNQA 5BSHA 4ZYTA 3AHCA 4V0RA 4B3RB 4Y2YA 4FZ3A 4ZFNA 1DKUA 1QH8A 1XLTC 1DUIA 1GPNA 1G8FA 1GEGA 4BKQA 1V1MA 2P35A 3GJ8A 4QBTA 2WWHA 1R0RE 5DX0A 5KYYB 4EEXA 3F4BA 1XLWA 1LQTA 2DCMA 2X4LA 5HIKA 1GSIA 3MBIA 2GEKA 1N0UA 2OL4A 2GS9A 4BO6A 3B6MA 1ZJWA 4UBOA 3EBPA 1XNQB 1ZOSA 4K3UA 1TQDA 2OYRA 2Z6VA 1N9GB 3F7MA 3KBOA 3NRBA 3F3YA 1F4VA 2F1KA 1KOJA 4YXFA 5JS2A 4HY3A 3VC1A 3H4TA 4RK1A 3WB1A 3USES 4O3FA 4YJHA 4DLXA 2R0QC 3NHAA 4Y2XA 1T2EA 4MQLA 2GARA 5BYAA 2I7VA 1X1BA 2CNDA 4FWBA 4RHFA 1DOHA 1JE1A 1JYEA 2YHSA 4I36A 1NVXQ 2MIIA 4QUGA 4TSFD 1JP7A 2PLWA 3ICOA 3Q9SA 3HV0A 2Q6OA 1SBZA 2QWXA 3OQIA 1UOOA 3DEHA 2VQ3A 4FJ0A 4NK4A 3TFWA 5LQCA 1U5CA 3P9ZA 2G3YA 3W7AA 1O96A 2G88A 2K2QB 5KINB 2W6PA 3IHLA 4I55F 4M0PA 2W2OA 2HLHA 1F20A 1FRVA 2RGCA 2Y1CA 2WABA 4XIYA 1TK3A 2XE7A 4H1HA 3N8NA 4ZO7A 1Z6AA 2BTEA 2EEZA 2YZ7A 2Z4SA 2H2AA 4AF7A 3P0RA 1PDVA 3RAJA 1SUDA 2VF8A 4JBNA 1YFLA 1FA9A 2K7ZA 4CMEC 5JNWA 4BE7B 1IOZA 3N87A 2XDWA 1CIPA 2EWVA 2EZTA 1GLNA 3EF3A 3PNQA 4L6CA 2MR6A 4L5IA 3M9LA 4CETA 4RF3A 5FOSA 1CSEE 3QF7A 1SCKA 4M86A 5IRCD 3MWFA 2CNKA 3GN2A 1HX7A 2CFCA 2AFIA 2PQ2A 2LBPA 2WDPA 3A1SA 3BDAA 4M8SA 1KP3A 4RX1A 5C8YA 1UDRA 1UP4A 4H1UA 4RTPA 1FXWA 4FYPA 4UOEA 2OGUA 2L18A 2XVYA 3HVKA 2OO3A 1CB7A 1DB3A 1RE0A 4NPHA 4OXYA 1ADJA 5CTJA 1NHGA 1UAYA 3GFFA 2ZBGA 4L76A 2C3PA 2ZYTX 4NE2A 3IT1A 3HXMA 3H5OA 3L6UA 3AC0A 4OX9B 2ATXA 5ILQA 2G8NA 1K5PA 2VHYA 4FNMA 4ZC1A 3U3RA 1MOZA 1M8JA 1ZW1A 3V8MA 1MO3A 2WZDA 3FKQA 2YYAA 5KYYA 3A0RB 1ZL0A 1E2UA 4M0MA 3E35A 4IDOA 1ZI9A 1QVRA 3DCYA 1QIJA 1UBSB 3PE6A 5GPBA 1BNCA 1EGVB 4TT3A 4DR2B 2B8WA 3CV3A 4DM4A 3DUWA 1N9GA 3C43A 4JUBA 2QT0A 4X1OA 4TQ9A 4HPXB 4BX2A 1JEDA 2W6NA 3QVVA 5GIOE 5DOZA 3ETCA 3ASVA 5EJ6A 3F98A 1GRVA 4Y6RA 4JV5B 4BDTA 1DEXA 3CSUA 3EQ6A 4JLVA 4ER7A 5JSZB 2FDCA 3LVBA 1UMCA 1E9VA 3B3FA 3JATB 3REOA 4Y2VA 1NX9A 3FLEA 2GEJA 3HV2A 1PQYA 4H15A 4S12A 1K89A 5K99A 5FBZA 3U4QB 2C2KA 3QIVA 3SF8A 2CZCA 1HNNA 1EFLA 3KQQA 3N58A 4NU0A 4CUJA 1Q21A 2VLBA 2ZRBA 3RGGA 3PEYA 2DLDA 1G20E 2FN4A 3WFZA 1AGYA 2QAJA 1NYQA 2QB5A 4WEOA 1EK2A 3L05A 3WIBA 5CDFA 2YXDA 4LQLA 4NRDA 4Z1MD 3I9OA 2YQZA 4YFVA 4LOKA 3S81A 1JJAA 2G71A 2P4QA 2Y68A 3BD6A 3M4XA 1NUAA 2ZYAA 3ZJUA 2X6QA 4JVOA 2OM2A 4ZCQA 3UWKA 5EMNA 4MPPA 1I4WA 4DYHA 1XELA 4V0KA 3T15A 5DNAA 3OX2A 3X1KA 4AXBA 5JEDA 1V95A 3TQFA 3B52X 5J40A 4E1VA 2PH1A 1JSCA 1CUIA 3HY4A 3IIMA 1SXJC 3JYNA 4FLFA 4TTAA 1DEOA 3QXSA 3VPHA 2PJDA 1JQAA 1X0XA 4UC0A 4XQ9A 4LVNA 2CXNA 3GJZA 1L8LA 3AH8A 4IYRA 4PSAA 3FTCA 3L7LA 5CH5A 3WYBA 4KJZA 1G8SA 2DWCA 4G2TA 4UZSA 4OFXA 4B0PA 4EKNB 3GFPA 1DJOA 2WPDD 4YALA 3TI9A 4EITA 3PXCX 4Y6LA 1G291 1VL0A 4P7BA 4Z99A 2PD6A 2P11A 2PGNA 4D9BA 1RWMA 3QU4A 3EFHA 3PNBA 5K3OA 1CCWA 1FNCA 3IPRA 4AJOA 1L5RA 3MG9A 3HN2A 4V39A 5EP2A 3OT1B 1Z6PA 3C3XA 4QICA 3PK0A 3RO7A 3BTVA 1CXZA 5CNIA 1DMRA 1I4DD 3ZZTA 4DGSA 3T4UA 3CUKA 4FUTA 3DL2A 1M6HA 2P9ZA 4PO8A 4WGFA 4DA8A 1F7UA 2X7XA 4B7UA 1IBCA 2GK6A 2Z5LA 1RI3A 1XCGB 1K2WA 4YCBA 4G0OA 3M3PA 3EIXA 3PC4A 4J29A 3TBHA 1O97C 1ZI6A 1HTBA 4B8WA 1VYHA 1AS2A 3ENQA 5K4AA 5G41A 1JALA 1QFXA 4EFMA 3L1IA 3EIEA 4FN5A 1NC1A 1SPBS 1VIYA 5KSYA 4C0KA 3FHJA 1F38A 3JATA 1VMDA 2HFJA 1IIRA 1OYOA 2CUNA 2D7CA 1P5ZB 3H8JA 1C7RA 3OKFA 1A8SA 4LZPA 1RHMA 2FXIA 4F6LA 3U4QA 1YHNA 1SM4A 3M6VA 4Q1BA 2B8NA 5TXGA 4BU0A 3S7TA 1U9CA 5ALTA 4JYAB 2DVMA 2O8EB 3ID6C 3K0SA 1Z5ZA 3JD1A 3R44A 5LNK6 1LXCA 1JAYA 1V96A 2RONA 4MKRA 1SUAA 5FI0B 4ND6A 3AFMA 1PT8A 3OEHD 1QHXA 1B00A 5DLQC 1DRKA 4QUDA 2XSZD 4O59O 3MM4A 4PBTA 1W35A 2C07A 1QFMA 2R5NA 4J7CA 4IMIB 1E5DA 3GUYA 1X14A 4JZKA 4RQTA 4W8HA 3U3XA 2B0JA 4GZ5A 4LE2A 3LM8A 3RJ5A 4C20A 1MHTA 1T25A 3WKDA 1H4VB 1ISIA 2HSWA 4H6XA 4N8SA 3UB3A 5CB6A 5A7FA 5BN5A 4BNHA 3CQ9A 1YGYA 4K9LA 1S3GA 1D9XA 4BFLA 4LMPA 1MENA 2XUGA 4UHCA 1ABEA 2PH5A 2HF7A 3JWIA 4CDMA 5LLDA 4RVGA 3VI3B 5G3ZA 4ZMRA 2X41A 5JNVA 3AEKB 2WQZA 3BDVA 3E7XA 1BCSA 5EUCA 4PYIA 2PA0A 1H69A 3FDIA 2FV8A 1NPYA 3IE2A 3OT1A 4HAYA 2XKBA 4LYFA 2AG0A 2EX4A 3UT5A 3LDHA 3ICWA 2ZAGA 2O50A 1DS6A 3QLVC 1LNQA 5H0IA 4W1PA 2C2YA 1PEDA 1DAPA 1PYDA 4DG8A 5EXTA 3D6VA 2BGTA 4NH4A 3PQ3A 2AW5A 1P7PA 1UFKA 2VS1A 2W4IA 2ZJ4A 3DFZA 4C04A 2IZOA 2BBTA 3IHWA 1WQ1R 3Q8WA 1Z4QA 2JS7A 3LUHA 4B71A 4XDGA 2FWMX 2VA8A 4RULA 2WKRA 4O2BB 3ED5A 1ZOOA 3IEMA 3GAAA 1CK4A 5A4IS 3U0BA 4R2HA 2MSKA 4Y98A 1K4KA 4LQ4A 2F4NA 5K0JA 2O9JA 1QYXA 3R0VA 3ZWAA 3LCVB 5KSZA 5KQMA 3U3KA 3S29A 4P4TA 1RJ9B 4BJ6A 2O8EA 4V0ME 5KTNA 1PNTA 1MIOA 1CZOA 3CW8X 3QXHA 1NFQA 1ONBA 1I3MA 3D3NA 3ZWDA 4CUZA 7MDHA 4N76A 2CL7X 1PR1A 3PA6A 3HB9A 4PBSA 4CMEA 3OP4A 3ZCSA 4DV2B 2PZLA 2IEDA 3RQIA 1J2UA 3U19A 1X8XA 1SXJB 4PWZA 1NPTO 3CNBA 1T9GS 3GOHA 3QM1A 3UAWA 1WVGA 3ADCA 1E20A 1KYTA 2J5XA 4X20B 5ES3A 3VI4B 3WWYA 4QECA 2ILVA 3GQBB 1XTUA 4N47A 4JAVC 1W59A 3ORQA 5CAEB 2QTMA 3ZQUA 1EG2A 1T9DA 1BKSB 2XCQA 2I62A 4K46A 4N65A 4D44A 2C9YA 3ABQB 4NQZA 4J2OA 5AQEA 3VDRA 2H2HA 4PW0A 3MT8A 2Q07A 3RNLA 2RHRA 1I80A 1LPSA 5IVDA 1SU7A 1TIPA 2IY9A 3CEMA 5HGJA 3JQQA 4EMSA 5K45A 4ICIA 4GAEA 2O7SA 2G77B 5JWHA 5NLLA 4WKCA 2J67A 4JI4B 2EJUA 3AEKA 3MTDA 1J1ZA 3AIKA 5CLHA 5CD1A 1I8TA 3PLNA 5EJGA 1E77A 1GUAA 2RBGA 3EDOA 3LIPA 3OIWA 5EINA 4GOOD 3EZ9A 3PRJA 3U62A 2EIHA 3LHSA 4R4JA 4KIJA 5TPWB 2PO5A 2QLBA 1X86B 2DYKA 4KN6A 3ET5A 3UAZA 4AJPA 1Y82A 3WHIA 1LBSA 1RZRD 2VOEA 1IUPA 1QFYA 5K3BA 1BW9B 2DLNA 1UK9A 1GLGA 3P71T 1YU9A 2QRZA 2F3PA 4Y1RB 5GONF 1O6ZA 3NHPA 1SBQA 2PG3A 4UW9A 1YS4A 3CKYA 3RSQA 2KHZA 3ER6A 1DJPA 4W9NC 3J7TA 1M8KA 1MTZA 3VYVA 1MNAA 3AJRA 1S1CA 2IZ0A 4O2BA 3T5DA 4NU6A 4QIHA 2WW8A 4NAVA 3R75A 3A1FA 4F5WA 1BQ4A 4IVQA 1N0VC 2CFOA 1D8TA 2EG5A 2VJCA 2VYQA 4QG7A 1FK8A 4TLCA 3CRRA 1TMKA 4D4IA 4DJEC 2BM8A 4GD3Q 3WZMA 1RJ9A 1VCMA 3K2IA 2ZLBA 1KDZA 1QCDA 2W90A 4MJLA 2LCQA 4IQFA 5ALVA 4Y3UA 4MARA 3W4JA 1YIDA 1LW6E 3K70D 2FXVA 1NSFA 2QYSA 3EVBA 3MS7A 5E3IA 4G5QA 2M6LA 2HMWA 4GICA 4KBYA 4DA4A 1EB9A 2DAPA 2G07A 3U7QA 1X74A 1QB7A 1SXJA 1RC8A 4KQEA 4L1KA 1RACA 2TS1A 4AZ0B 3MWJA 5DM60 2BGNA 3L7CA 3REGA 2QA5A 4X20A 4ESOA 4D26A 4FHCA 2MWMA 3L8ZA 4KNWA 1KQ3A 3CZ9A 4KAFA 4JJ7A 4C7KA 5ANRB 1EE9A 1YVPA 1T0JB 2E49A 2GYWA 2QD1A 3R6GA 1CDEA 3WLTA 1YR9A 3R9IA 1RWPA 4G5RA 4QXOA 2LR0A 4S1WA 1Q7CA 3ROGA 3V8NA 4LBVA 1CY1A 2OHXA 1O2DA 1MVLA 3QSGA 3H5NA 2I6TA 1E63A 4H59A 2AR7A 2G63A 1UEXC 3F71A 1P18A 4LHZA 4D56A 5GMOA 1WPRA 2EJCA 2Q2QA 4S0ZA 3WJ7A 5DASA 2EKZA 5LCXA 4EUEA 4JBIA 2ZIZA 4BRZA 4XOIA 1G5TA 4QVKA 3PF9A 2FDXA 1D2CA 2DFPA 1A2OA 1B26A 2ZQ5A 3DLPX 3EULA 1EINA 1EK1A 2PCJA 4I81A 1Y3HA 3NHBA 4RJ2A 5TPWA 1BHJA 3T61A 2MDTA 2QQ5A 4PC2A 4QYXA 5BR4A 3VTFA 3TG2A 4BFXA 2FWRA 1ND6A 4PCLA 4Y1RA 4ZGGA 4PAGA 1AKMA 5NULA 1FDRA 3OAAA 1E3QA 2ZI4A 4GBED 4IXTA 5AI6A 4X93A 1FTNA 3SYNA 1H2AS 5KI6A 2IHUA 3U80A 4BTVA 4ZZ0A 1KY2A 3KVVA 4HAUA 2JJYA 4KQHA 3C5HA 3BXXA 3ULKA 1R5NA 3ZWBA 3KVNA 4AN4A 4DIDA 5GJBA 4ZANA 3ZHCA 1S0UA 3P9RA 3UWSA 5FH9A 4W7SA 1J0EA 1DC5A 1QP4A 3HU1A 1UK8A 5AD1A 2GBCA 2VCEA 3GVHA 3PXAA 2OHFA 3U9SA 1XXHE 2BSAA 1R6TA 2RJOA 5C7YA 3H5VA 4I5FA 5IBPA 2JLUA 1V1JA 3HCCA 3FFXA 1NVKA 3A7EA 3D3WB 3FI0A 4MJ3A 1YUBA 1WU8A 2NQ8A 2W7TA 3MUEA 4Y9SA 2E5FA 2A59A 2ZE7A 4EI2A 2JIQA 5DHQA 4B82A 4EF5A 2HAEA 1DMSA 5T7BA 3KAPA 4FCVA 1DC7A 3MD0A 1LI7A 3BGVA 5MFPA 4UEKA 2NVBA 3MHPA 3OLQA 4ZT6A 2O8FB 5FJJA 4YRNA 1Z25A 3KKEA 2EKQA 3PQDA 3JD3A 3BWYA 4GFDA 1CQIA 3SSNA 1S8OA 1CUGA 1ONNA 4LCJA 2CCJA 3IV7A 4LV6A 4RMHA 4UNPA 3I2JA 4EVIA 5BPFA 2VHXA 3PEEA 1RJDA 1YOBA 4ZCLA 4LWOA 3DLCA 4EUSA 3N6RA 4MI1A 1AKVA 3NXSA 3KFLA 1D6NA 3PJEA 1JHAA 1T0IA 1PFGA 3EIHA 1GFZA 1MX1A 2PMKA 4PQYA 4EX7A 3AFGA 3I64A 1UC9A 1A1SA 2JIOA 4J1NA 5C9ZA 4QREA 2ZIGA 2O19A 2FMXA 3QLVA 4TLMB 2EZ8A 4EHJA 4JELA 2FZVA 1Y81A 2PKRA 3CU5A 3QUCA 3V48A 2P6OA 1NQ5A 4MIKA 5AXBA 4US2R 1PP4A 3A11A 3O3OB 1JQLB 3ZDDA 3WLJA 1C81A 4W1RA 2V58A 3QW4B 3TTSA 4W9RA 1BDMA 1CFZA 4DR4B 2E21A 1XFAA 3RUAA 1G5FA 1IPEA 4YDRA 4BYMA 3KM0A 4RVUA 4X90A 1QRTA 4CV2A 5BV7A 4R1LA 2XITA 3M4JA 4KQMA 4PY2A 2AUMA 5EXXA 5EP1A 1ZOLA 4IMRA 4DLPA 3FZEA 4H77A 4YRRA 3GAMA 1RQLA 3DE6X 3B78A