1S3IA

Crystal structure of the n terminal hydrolase domain of 10-formyltetrahydrofolate dehydrogenase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
MKIAVIGQSLFGQEVYCQLRKEGHEVVGVFTIPDKDGKADPDGLEAEKDGVPVFKFPRWRARGQALPEVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGTAPRCPQSEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTSGLSTQGEALPIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQLEDGKMMPASQFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase: mechanism of hydrolysis and its interplay with the dehydrogenase domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase, oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
total genus 92
structure length 307
sequence length 307
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 1s3iA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1s3iA01
1ZLYA 3AV3A 3O1LA 5J9FA 4ZYZA 4ZYUA 3LOUA 4ZYWA 1C3EA 1GRCA 4ZZ1A 4YFVA 1ZGHA 4ZZ3A 1RBYA 4NV1A 4ZZ0A 1JKXA 4TT8A 4DS3A 4EW2A 4EW3A 4EW1A 3DCJA 1MEOA 2GARA 4QPDA 1MEJA 3NRBA 4PZUA 1GARA 3W7BA 1RBQA 3TQQA 3Q0IA 3KCQA 2YWRA 4YFYA 1CDDA 2BLNA 1S3IA 3AUFA 3OBIA 3P9XA 2FMTA 4IQFA 2BW0A 5CJJA 4ZYXA 4ZYYA 1CDEA 3DA8A 3N0VA 5J63A 1RBMA 4Q12A 4ZZ2A 1YRWA 3TQRA 3GARA 2CFIA 4S1NA 1FMTA 1MENA 1RC0A 1RBZA 4QPCA 1NJSA 4ZYVA 4TS4A 4TTSA 3R8XA 4ZYTA 1C2TA 1ZLXA 1RC1A 4R8VA
chains in the Genus database with same CATH superfamily
1DJPA 4FGJA 1PZMA 3IUJA 3EG9A 4AT1A 5IVKA 1XK7A 2JJ1D 2OZPA 3G7SA 3TLKA 1KF0A 1VSTA 2VWHA 1UBCA 4FYIA 4OFWA 1RM5A 2WD7B 4WT7A 2HRCA 4TVBA 4MLCA 3RSLA 1YBVA 2AUNA 4ZJZA 3MB5A 5J4LA 3FYCA 2VJAA 4OFXA 5K4GA 3GRPA 3QE2A 1VE3A 2ZPAA 1T6BY 4JLNA 4HGOA 1E2BA 2LR0A 1IWBB 3HJCA 3H9BA 3CKMA 4MV4A 5EOVA 5LDGA 3DONA 3DFKA 4RTPA 1KXZA 3C41J 3ID6C 3E53A 2F1KA 3GMIA 3K1YA 3R74A 1GGNA 1K2WA 3I2GA 3QWIA 4O08A 1M6NA 4C6HA 2XCTB 4PR0A 4TTSA 1YI8A 3OZXA 3PRKE 1XA3A 3ETJA 5KOYA 2JVKA 1OXUA 3M5PA 3KQPA 2HYDA 5JISA 2WA2A 3FBTA 4H1TA 1I1QB 4B5LA 5AQEA 3TD9A 3V7WA 1VLJA 4B17A 3KHKA 4EFNA 2GZRA 2VJLA 5EESA 4EQ6A 3WRWA 4FFPA 2QLNA 3HBAA 1SHLA 4O2BA 4UAVA 3ZQ4A 3ETLA 4AIRA 4W4TA 5LB4A 4XUGB 1ACLA 4XVHA 4YUAA 2QQ5A 3W05A 1E1QA 3L4BC 4RZSA 1EMDA 5FV4A 2IYPA 1UBGA 3JQ9A 2D0OB 2IPNA 3DTYA 2B6HA 1JJBA 1CF2O 2VHYA 2NLOA 1GFWA 1EWQA 1JHRA 2ORVA 2HSGA 3E5HA 3MUEA 5CGQB 3N8HA 4NYIR 1VJ1A 3P20A 4E07A 4JP1A 2AJBA 1P9LA 2PS0A 2AL7A 3IAUA 1FSFA 3KAPA 4QG7A 3SQNA 5DEIA 2AGVA 3RYIA 5JRJA 2VPWA 3ZY6A 1A7AA 5E6UA 5B3JC 1DIBA 1G3MA 1VECA 4JP8A 4M6WA 4BBPA 3FZQA 1QQ6A 4FCTA 5AM1A 1HE5A 1P33A 1N1MA 1C1DA 1TM3E 1UMCB 4JT2A 4FNAA 4Q9KA 2XUAA 3ZNPA 4IM7A 4DSTA 1H8EA 2O7VA 2B9EA 3D02A 4BRWA 3FYUA 3LC1O 5DSXA 4JLOA 4BUZA 4C2TA 2Q3FA 3F4LA 1CVLA 1R4MB 3QV2A 1I7LA 3QELA 2QIOA 4OAPA 4FHFA 4UDNA 5DM60 3DEFA 4M7PA 4QSMA 5A3VA 3AF6A 4RVGA 3GLFA 1UDXA 4FC6A 4HWRA 1RCFA 3PQFA 1MOQA 4NEQA 3S1SA 3T7EA 4XARA 5EPOA 2AZ4A 1BIFA 4UHFA 4E15A 1ZHOA 1OTYA 4LA4A 3BWMA 1I01A 5HE9A 4PLTA 5EHZA 2PT9A 3M6IA 3CMMA 2QUAA 3LVQE 3DO8A 3ZEAA 4TVSA 1SVUA 1IULA 3DAFA 1NU6A 4DIDA 5IKXA 1HYHA 2WHQA 1M8FA 1Y4ZA 2BFFA 2PGNA 4G5YA 3OE7A 1AGPA 1Q6ZA 3AEQA 2YJ4A 3IAEA 1PJLA 4M38A 3ZWYA 3R8CA 1N7HA 3D2AA 3DE1X 1CJTC 1NXOA 4FS8A 4YVFA 5AVRA 5ITWA 1E2PA 4GM4A 5LZ7A 4JI5B 5DYWA 5LQCA 1CEEA 2WNHA 5DYTA 4L0CA 4MQ4A 3RROA 4ND8A 1SVSA 3D8SA 3LC2O 4R5MA 4ARAA 3WA7A 3B5JA 3CVVA 2JHPA 1K2VN 3AG6A 4URHA 3IUQA 1UT8A 2VLIA 1NF8A 3OD1A 1G66A 4E7OA 3EAQA 3VU1A 4RZXA 1IDOA 2RH4A 2HGSA 1DWQA 2NV2B 3OHMA 3QEAZ 3BZBA 1W85A 4HQNA 5BQ3A 4CDGA 3IURA 4RD0A 3DZKA 3RBAA 4GWKA 1H23A 1M2NA 1R1DA 1U80A 3BRSA 2W6NA 1C3OA 1JYEA 1H1LB 3QLUA 3T94A 3OTOB 1PBTA 4XWYA 1O95D 1E1NA 5ALIA 3WBFA 4H4CA 1SAYA 1H0KA 2FW6A 3P0HA 5IYZA 1NP7A 4PQYA 4ZQCB 4F91B 3FMIA 1D03A 1RWNA 3I9OA 3RV3A 2RHCA 2XB6A 2WU4A 3A6LA 4BFTA 1M8GA 4DCOA 1SNYA 1VCIA 2NPFA 5K0ZA 1EBBA 7ABPA 1CDOA 2AE1A 4G5QA 3ACBA 2A5LA 3DAOA 4M37A 4D4HA 2FZLA 2IHTA 2YQZA 3QBTA 4O0MA 1PG2A 1EM6A 1UWVA 1PFVA 3IIKA 3JAWA 4EG1A 3U5TA 1L8OA 1JH8A 5A3RA 3ED1A 3IVMA 5FLXA 2WU3A 2ZSBA 4DT1A 4BNVA 3SSNA 3QPWA 5L3VA 5CPFA 1E2HA 3I4FA 1V7PC 5F3WB 1F60A 3RKUA 2IYVA 3MF4A 5IVPA 5KVCA 1IXZA 1KOLA 2C5AA 3WLNA 4JI0B 2EG9A 3I9V1 1Q3TA 1MH1A 2J32A 4X3PA 1WV0A 1OVMA 1R6TA 1L7BA 2JLCA 2KMLA 1ACMA 1BGXT 3K9NA 1VHWA 3C5HA 4HATA 4MVJD 4GBJA 4UD6A 2GEVA 2CLIB 4BFSA 3B1WA 4ZO9A 2C3YA 4RJ2A 3DBHA 1KYWA 1LC3A 1DKUA 1JB9A 3I64A 3L6UA 4PIMA 3L49A 1UFOA 3SIXA 3O74A 3G7NA 3G13A 1AA6A 3G2QA 4MKHA 3GU3A 3JAKA 4Z1MD 1VPLA 4RHFA 3FMGA 3H2ZA 4MAFA 4BVBA 1F8FA 4JBWA 4GPAA 1GQSA 4E88A 1FFEA 3U4DA 5JZBA 2VUHB 1K7YA 1MOPA 3FGOA 4ZXPA 2WFMA 2R1VA 3HA7A 1KO5A 1OIWA 4KRYA 3VV3A 1OZHA 2HWXA 2P2GA 3FRHA 1HE8B 5JAMA 3AI2A 5C32A 4EPRA 1DEXA 3CURA 4OFZA 4GLOA 3GPIA 4MWCA 3QU2A 4M1YA 4NULA 2CCKA 4JUIA 1EKXA 1NXSA 2P9YA 4NECA 2OA0A 3TSAA 4K0KB 3T1VA 1XF1A 2DWPA 1HT0A 2RGYA 1AQUA 5CX1B 4GMHA 2V65A 1U5BB 2GTPA 4BXOA 2A1UA 3HFRA 3IPAA 5SICE 4RL4A 2IU0A 4NU8X 1KBOA 4Y6QA 4MS3B 2QAJA 1VBFA 1PZXA 2I33A 4ZP1A 3V1YA 2GJ9A 3WL7A 1AKWA 3D5TA 3U0BA 2W2KA 4MOWA 1NL3A 1G291 1WBJB 4UTNA 3SX2A 4A6XA 3PGKA 5K20A 2WM2A 4E2XA 4TQAA 2ZJ1A 4D5EA 4M9ZA 4H59A 1Z7GA 3DE3X 3LF1A 4IW3B 2OBYA 4WGGA 4MUKA 4C76A 1P6XA 1XRMA 1JA0A 2VH5R 1SXPA 2BE9A 4UPVA 4U7FA 5I6DA 4LRTB 2Z3ZA 4ER6A 1XYYA 3RVNA 1ULTA 5L8VA 2Q62A 4HP8A 5ES3A 5F7OA 2MSEB 4Q3LA 2PUVA 1WW8A 2RK6A 2G77B 4HQ0A 4WBNA 9ABPA 4LK2A 3JQ7B 4HXGA 2O5CA 1QZTA 4U6QA 3E9CA 1XEWX 3PEUA 4NLLA 5CT8A 3UYKA 4AG6A 4B3BA 2YYZA 5C35A 4Q4HB 3MERA 3BBPA 1KC1A 4U3JA 3T4XA 4G86A 3GZNA 4PGMA 2OHHA 3KQHA 1JQ3A 3AUFA 2X0RA 5GONF 2Q6KA 3ZV3A 1JZQA 4GI1A 5GM2A 2AV6A 3TIXB 1ODSA 1V26A 4B5KA 2F4NA 1EYZA 2XV1A 3KTOA 4R83A 5IT4A 1GCAA 2C95A 2YOHA 4MRVA 1QH0A 1IUKA 3TBFA 2HW8A 2JGNA 5DNVA 3WNZA 2W6MA 3L6BA 4CIVA 5DHRA 5JBIA 3N76A 3FBGA 2GEBA 2GS9A 4K88A 2Y77A 4XXHA 1L7VC 2PMWB 3GLVA 3HY4A 4NMXB 4NNJA 1OWPA 4RWZA 4XB1A 4CG2A 1GLGA 4ID3A 4I5IA 2M1ZA 3DW1X 1QTQA 3AQIA 5HGJA 2MOKA 4ES6A 1X7WA 3GXBA 2ID9A 3LX5A 3SE0A 1PEYA 4REOA 5IHPA 2Y99A 2Z1MA 3TNYA 1DV1A 1IOZA 1GY8A 3NYIA 2ZRDA 3CCCA 3GLFE 2J9YB 4OYRA 4IQ4A 1OXTA 4X6UA 4DA7A 3PNBA 4URYR 4E4RA 3CJTA 3L0DA 1KOGA 3LYLA 1WUKS 2FN7A 1IBMB 4LTDA 1TVCA 1ND5A 1S01A 3WVNA 3AUJB 5AYVA 1CY1A 5K0NA 5IKMA 4M88A 4KPYA 4G89A 2ZB3A 4FDVA 4ETNA 2KE5A 3UJAA 2R6GA 4IOLA 1GGEA 1PIWA 1FUUA 4A91A 3VYWA 4CMAA 1P8JA 1R0XA 5GGYA 5J4HA 3GZTB 2JLWA 4A36A 1CUUA 4YCDA 1SXJA 3FYUB 2ZT5A 1GQOA 4RHEA 1B00A 2XVAA 2B7LA 3QE0A 4IVQA 1HNZB 4BNHA 1HA3A 1SCQA 3UC5A 1WLSA 3IIMA 3U81A 1E2JA 2LGJA 2P0YA 4N48A 1IMOA 2C2ZA 5IAGA 3ESZA 5HG0A 1JR4A 2FXVA 5B1HA 4CNBA 3P9NA 1ZI8A 2VP4A 4CF4A 2JCBA 2JLYA 5CYOA 2ZITA 1KR2A 2BCEA 4M76B 1NFQA 3RKSA 4ER7A 1Z7BA 3O31A 2Q4OA 3PPVA 1X13A 4QQ8A 4WX2B 5CK5A 4BO4A 4BEJA 3MGGA 5CTJA 2ZR9A 4LYJA 2QGFA 5LA6B 2V45A 2IKSA 2X23A 3VPAA 3DOOA 5DXFA 2E4AA 5ALNA 5GOTA 3I2YX 3MCVA 1C9JA 1QK3A 3A1CA 2DKNA 4MVJF 3C5CA 4C4PA 2ZIXA 2Q3MA 2NX2A 2XMDA 3GEIA 4FN5A 1X9IA 3X1JA 2WSBA 1JP7A 3H4VA 5B30A 3R6TA 2FP4A 1USUA 1PWEA 1EWVA 2ATIA 2UZ1A 1G19A 2UZ0A 3FIJA 4ND5A 1UP7A 4D80A 2AI3A 2D3WA 5JJLA 2V54A 1J8QA 3G2MA 2WJHA 1FFCA 1UL1X 2BFNA 3D3KA 2V6FA 3PBKA 3EQ6A 2XW6A 3DTNA 5EKSA 3UMGA 2DFPA 4NOKA 3W3AH 2ZZNA 1JLLA 3HO8A 3IKLA 3P2KA 4F1KA 5SYNA 1FJGB 2W5UA 3DR5A 4CKBB 4H1UA 4FT2A 2XKBA 4X8LA 1PJCA 3AV3A 1BEZA 3GA0A 2WNIA 3GJ6A 3NTLA 4U7WA 1ZCJA 2DH6A 4MUXA 1UKBA 1VHDA 2QP4A 1M8JA 4FFNA 2Q9UA 5B58T 4C4TA 4Q4JB 1L7RA 1JQ5A 1C1XB 3ROKA 4WNYA 1UANA 2C3OA 3DUFB 2BTOA 4CL2A 1V7QA 1VIAA 1RJFA 5AO9A 1C1DB 2FPLA 2PQMA 1NNLA 3H1TA 4OLAA 2CXOA 2XE4A 4L8LA 3FR7A 3LPNA 1FRVA 4QUDA 3DCNA 3DV2A 3C6ZA 4UHJA 1QIMA 1UJNA 1U04A 3MCAA 3JVDA 4UCFA 5M7EA 4NXMB 4PGAA 2ZJ3A 1JHUA 4UU8A 4YUYA 3GRCA 5CB8A 2NQTA 4CN8A 3K6RA 4AXBA 3N53A 4TS4A 4PQRA 5EC8A 1GYQA 1ZX1A 3EFOA 1KK0A 5TPZD 2IW1A 2XWPA 3NASA 2JIZA 1FLNA 1HL7A 2BUBA 4DSUA 2C7OA 2AG0A 1WXIA 3OQBA 4H0FA 3FNEA 3LYHA 3LBHA 4II7A 3VHXB 3N6RA 2XECA 2XEXA 4B35A 3FDXA 3A6DA 4KO1S 4G2TA 3IPRA 4DXAA 1NXWA 2OGWA 3PHLA 2LTAA 2OO5A 1T5LA 3K4QA 1AKUA 1Z5VA 2X4GA 3I9V6 5D5QA 4YWJA 3VSBA 4KXNA 4DLXA 2O8CA 2FUNB 4ZAGA 1G1AA 1IONA 3EUFA 3C3AA 5JVDF 3KYDA 4HAZA 1DI0A 2K5UA 4NJEB 5JMWA 2H4FA 3T4UA 2WE7A 2UYHA 4DGQA 1RC0A 5FKJA 3ROFA 1IHDA 1FQOA 1SPXA 3B2EA 1XVIA 4MRPA 4NHOA 4ZVNA 5I7VA 3U48A 3EK2A 5L3SB 2XCRB 3X1KA 3N2LA 4JLJA 3QFHA 2NXWA 4O29A 1MNQA 2VF7A 4IVNA 3E9MA 3ET5A 3GFRA 1TLLA 1JHDA 5BWBA 3ELBA 2TECE 2QM0A 4Z3KA 1RHMA 2E37A 3H8VA 1PT9A 1SKYE 4Y2UA 3SS8A 3ZHQA 8AT1A 1GZ7A 2WJAA 3N8NA 2NG1A 2EKLA 1UKCA 3NP7A 4REMA 3DR3A 4JT9A 5LD2B 5BSRA 4OXNA 1P5JA 3H3FA 1DKLA 3B38A 4X91A 1HX7A 2EZ9A 2NACA 4V0NA 1F2TB 1PU2A 5CNMA 3R5HA 3TW4A 4XJTA 1ONNA 2QUJA 5LDHA 4JCOA 1KQNA 3AM1A 2PSFA 2BCGY 1CZUA 3EGEA 4BNMA 3G82C 2QTLA 1LDGA 2OL4A 4WECA 4ZALA 1T36B 3SBDA 1AVTA 2G70A 5KDOA 2H1OA 4LF9B 3T35A 2V6GA 4DILA 1MA3A 2VTDA 3NVKI 3PL1A 1QHFA 4OOEA 4HGZA 4RUKA 4CL8A 4UUNA 2V9ZA 4JNKA 3RW9A 1J9GA 4CHGA 3S2FA 1V1RB 2BFCB 1AQYA 3NDRA 1WY5A 1NW4A 3U7FB 3DEIA 4ER5A 1UKZA 3EDYA 3FVWA 3GRAA 5E1DA 4WE3A 4E94A 5CITA 4OQQA 3IDQA 3KUCA 5ELLA 3FTFA 3H19A 4MR7B 4B3MB 5FPPA 3SP1A 4HNUA 5KYYA 5BW4A 5H80A 3WICA 2ZIAA 3BPSA 3L4EA 3V4OA 1E1RA 2VZLA 4I3FA 4WK0B 3BWBA 2X2EA 4K3UA 1N5OX 2HRZA 1QZ3A 1Q14A 3F90A 1JTFA 2AZXA 4B75A 3WP1B 4A2PA 1DAEA 1RRFA 4GT1A 4XGNA 5JXGA 2GCEA 2ZWMA 4JMLA 2NVUB 5FAXA 4EI7A 5GINE 3BGVA 4Z54A 2WFZA 1ZGBA 2ZOSA 5IT5A 4OI2A 4I5GA 4WEOA 5J5VA 1U0JA 3RTGA 5BR7A 4MB2A 5FBWB 3EA5A 3L0IB 1QANA 1SHTX 4LX0A 1FA9A 1P1CA 3GGSA 2PGJA 4EGAA 5LQUA 1NVGA 1WB5A 4KPGA 2Z6AA 3AESB 4U4AA 3G0IA 1AIPA 4IIHA 2WYWA 2ZI3A 4WK4B 4DN6A 1XQ9A 1TM7E 4XR9A 4FB4A 5FCDA 1K0UA 4ADSG 4XH9B 1KYQA 4RA9B 4XYLA 3UHPA 3JQFA 1WDLA 2PLRA 5DRTA 5EJGA 2WUEA 2QJTA 3WRYA 5DM0A 1DCKA 1FDOA 1V6CA 2FSHA 1EDOA 1F0PA 3EQ2A 4JXKA 1EDEA 1S6YA 1ZH6A 2JI6A 1UBOS 4WLEA 4XLTA 5JE8A 1IAQA 3VU9A 3M33A 1BCRA 2XVZA 1T6NA 3K5PA 4L8VA 2PRJA 2OGTA 2RAPA 4HDKA 4RL6A 2I4IA 1YRYE 3HXTA 3U7IA 4DOMA 4HDRB 4ZI3A 2CXUA 2R8RA 1BCSB 2B4KA 2WWVD 5A02A 3CX7A 4S1NA 5HF5A 1C4OA 1P7PA 5JV5A 3QVWA 1UBNA 4Z4GA 4TTJA 2P3LA 1U3VA 3BAFA 4OD0A 2GEDA 3WLKX 2A0FA 2ZSFA 3GUVA 3NUZA 4QJ3A 4P31A 3W2IA 4ARSA 2CDRA 1WXEA 1XEWY 4PNZA 1JG1A 1R2QA 1N2CB 1QGED 1ZN8A 4JB8A 3K73O 2WV9A 1U6IA 3OCXA 5HIJA 4CQJA 2FRDC 5BYAA 1VRWA 3OTWA 1KOJA 3IRUA 3NHMA 4WK6A 2YR0A 3O8BA 5JCOA 1RAGA 4L72A 4MHOA 4R69A 3H1BA 4YBRA 4LI0A 2Z6UA 2FV8A 3OCCA 1D04A 2WSIA 5ERYA 5IC4A 1QIHA 1NF2A 2YWHA 2V97A 4R01A 4BEBA 3DQQA 4AP9A 3SF0A 1LLCA 4A23A 1KAGA 1LQTA 2QLFA 4M1MA 5K4AA 2IEBA 1K7CA 4P84A 4UHCA 4Y67A 1TW3A 4Z9YA 5EKXA 4FB5A 1KORA 4PYJA 2FE4A 1DELA 3OESA 3LRTA 5EA2A 1SG0A 2CJXA 3HI4A 1PAUA 2AE2A 2G4VA 4LQLA 1XVVA 1C14A 4RWEA 4UOQA 1M76A 3PCTA 1F8YA 2UU9B 1NIJA 5B7PA 3OJEA 5F77A 2J3LA 5BNTA 2H07A 3V1KA 4OHKA 3TTYA 5I7RA 4QJBA 5JRZA 1QBGA 1HFWA 2FFBA 2H4XA 3KCNA 5FNVA 4CEIB 4RK0A 2Q7XA 4EIWA 2AK2A 2V4UA 3IMGA 3EH2A 2IYLD 3RBVA 4BL5A 2QD1A 3ELYA 2L18A 2FP3A 4DIEA 4KQKA 3PEWA 3G0BA 2GEKA 2FSIA 1CRLA 1QHSA 1L6IA 4O4IA 2OV2A 3N0RA 4BNZA 1OSNA 1J2EA 3DOFA 3Q1LA 1L5HB 1VYHA 2XA9A 2YJ6A 3PQ4A 4FFWA 3UMCA 1MHPA 2GAIA 1ZGAA 4LRWA 3Q98A 3MRVA 1EK2A 1I4WA 3QUBA 4ND6A 4W5WA 5K8CA 1D7OA 1O08A 3B9QA 3HCPA 4C03A 3HDHA 4I0WB 4Y0NA 5FPTA 5A5EA 5CFLA 4CEHB 2WHRA 2Z4RA 5E8JA 2Q5LA 4I1UA 1BD4A 4MTLA 4CODB 1I6LA 2YVAA 3U3ZA 2CVFA 1SVOA 3R41A 3ZQ6A 1KE1A 3SC2B 4UU7A 4PVCA 2EFGA 5ALFA 4AX4A 4BMXA 3WNDA 1AV6A 2V3VA 2ZRCA 2X58A 3TFOA 2NPOA 4FU0A 1BE6A 5DCLA 3RRBA 3RJMA 1U7DA 3VH4A 4BIMA 2VDQB 2A5FA 721PA 4CUZA 5C5DA 3EVGA 5EMMA 1H8HD 1EG2A 1RQ7A 4JZKA 1GL3A 2P79A 3CLRD 3EWNA 3P2IA 4TKUA 2QYOA 4IDQA 2Z5VA 4DBVO 3P96A 3O8RA 1K4MA 3S8MA 1LPNA 2RGDA 2HY7A 1DSSG 3KJZA 3SEQA 4E6EA 3K8OE 2JEZA 4IH1A 1YQ9A 1RPJA 4N8SA 3RVOA 4QBHA 5IJAA 4NCIA 3O93A 1Q1EA 2HU8A 1B6GA 2X3YA 1NY6A 1XCOA 4L1KA 4B7UA 5AESA 5FD8A 1CK4A 2AUTA 2Z9BA 4NFYA 4N1AA 1QUEA 1OTXA 2XWQA 3IYLW 4L85A 5JCPA 2BGWA 1IY0A 1GPWB 2IXBA 4IH4A 4G65A 4M1QA 3R6GA 4R8SA 1IN7A 4YQFA 3LPLA 2XUFA 3TS1A 3WMFA 3VTKA 3Q8XB 4JJ7A 4WZBA 2W2PA 4BB5A 3KZMA 1DX6A 1PUJA 3D0KA 4N5HX 4RVDA 1QRTA 1R0CA 1N5RA 1DV2A 4FYWA 3WHIA 1TB4A 2SKDA 4HAUA 2DLDA 1IY1A 4CIDA 2C9MA 1DIRA 5I9MA 4JXXA 16PKA 5BQ5A 5SZJA 3NWBA 3G7UA 4TLEA 4YFYA 1M1YA 5FFMA 1JS1X 4CTMA 3IE1A 4GO1A 1F48A 2PSHA 4EITA 1DQNA 4FCCA 1X2BA 4J0GA 5CCBA 4UZFA 4UDOA 4GNRA 5DN6D 1O5TA 4RTOA 1ZFNA 2PYIA 4GSKA 2GPBA 4I9HA 2Q0XA 3T3HA 2GZ3A 2PZLA 5FHRA 2Y05A 4AZ3A 3RJZA 4RQBA 4DQUA 1A88A 1F2VA 4HFRA 4QOFA 1B8PA 2C4VA 2EXXA 4NG5A 4UFPA 4JXJA 2JFOA 4UTOA 4M8KA 1WX1A 4EUFA 1DQPA 3B3AA 1JAHA 2GZ1A 3NDBB 1CEXA 3T6KA 3CG4A 2BDEA 3IH5A 1E6LA 3MIZA 3ICQB 1UXGA 1CUJA 2BV3A 3F47A 1AXEA 5LLSA 4N49A 2X86A 3UZUA 1WUIS 3Q10A 2PKXA 5CFOA 1EAMA 3UWSA 2GX6A 2ZPTX 3TNJA 1JALA 3OM8A 1JFRA 4EKIA 3OLVA 1VJDA 3WRXC 3NWPA 4CLRA 5U1PA 3NMUF 4BMNA 2B2NA 4MDHA 1O5OA 3QLVA 3W5AA 1CUEA 1M3SA 2OCLA 2R87A 3CLHA 4ZYTA 3WOVA 1KU6A 4QNNA 3WAJA 3ZJ4A 5BPFA 5EQTA 3TDMA 2BKUA 4DJFC 2RIRA 3OQOA 1LDNA 4I50B 3CR3C 3DDUA 2XWJI 2MWMA 3OMWA 1JDVA 4GZ6A 3SHOA 4FX5A 2XMSA 2VVTA 4JJ4A 1QWOA 2FE1A 2OCGA 4IIGA 4DKXA 1E7RA 3T95A 4DRXA 3IAM1 1PR2A 1JBQA 3DKKA 1Y8QA 4JK3A 1RPTA 5G3ZA 3F5QA 5IC6A 1VLZA 4J8PA 3AINA 1WG8A 5KI6A 1SG9A 2IJGX 1HEYA 1CQJA 3M70A 4BLPA 4AJEA 1PX0A 1PR1A 1OROA 1Y6ZA 3H2BA 4NAVA 3KUXA 1PV2A 1JSLA 3A14A 4B3XA 1MLDA 3C3MA 1CJUC 1ZGGA 4G0OA 1R3DA 2O1EA 5A5FA 4DM7A 3NALA 1F4PA 2HXGA 2J9GA 2X8WA 3O1LA 3AIOA 3WWPA 5L3SA 1APBA 2CDAA 1H4VB 3Q15C 1YA8A 2VXOA 3L8ZA 5EXPA 2HLDA 1I6WA 4LTMA 4KRFA 1RQ2A 2Y4OA 4RA6B 3BJEA 4FEGA 1SUBA 3TZBA 1BX1A 5SZHB 5C8DA 3WLIA 5IZCA 4TOIA 3ZBTA 5F35A 3R7AA 2C31A 1OU0A 4Q18A 1HY3A 3TW6A 3OIFA 3MGAA 2QR5A 2WYIA 4TWBA 3T4PA 3DE4X 1MQ9A 5LCXA 2RI0A 1JECA 3IJ5A 4ZODA 2PVCA 4CKWA 2WJWA 4F3YA 2HIHA 1ZH2A 4YPFA 1DQYA 3I9KA 4FE3A 1AN9A 1F06A 3ISTA 2W2OA 3KVVA 5FWNA 1EVQA 1DIGA 3IHTA 1ZD9A 3P9XA 1M34B 4IUCS 2HXSA 2XMGA 5CVJA 3KRTA 3ZTYA 4EYSA 2NMVA 3W5IA 1YQXA 2NZ2A 2W00A 3A6GA 4PCLA 5IM5A 2V0GA 1GDDA 1QX3A 1AE1A 5AJUA 4OXIA 4G5XA 2QM7A 3HJHA 3M6AA 1WPRA 3Q3HA 1QP8A 5F23A 5KWIA 3UMYA 1R12A 3EYWA 3G2HA 1LLUA 4LSMA 4OHOA 4Q6BA 2H2HA 5LQDA 5HCNA 3F2VA 3RV4A 1V41E 1Z2OX 2I2BA 3T3EA 4DMFA 1R4MA 5HX7A 2VQEB 1SWWA 5F1OA 3O0TA 4DBLC 1QGOA 3AKCA 3GZ4A 1I0IA 3TLXA 4YUWA 4IDGA 2ZVJA 3ZOZA 3UAVA 2PIAA 3NBMA 4B6OA 3JYLA 4ZIRB 1H8HA 1VKNA 4NR0A 4YPVA 1E0SA 3A06A 4P53A 3W8NA 3T12A 2WSSA 1C8BA 4TROA 2KLBA 4MA5A 3MFYA 5E9AA 1H1LA 3HP1A 3SLGA 3ZXXA 2QD2A 3HNOA 2ZJAA 3KKPA 3CUUA 3N07A 2Q9AA 2GHQA 1VG9B 1KOFA 1Q2UA 1GZ4A 3NANA 3EXFB 4LYDA 3DM9B 1F7VA 3QLJA 4PSDA 1SQ5A 4DYHA 1GZHB 1GAQA 1R37A 3PUWA 3I72A 4I9UA 2VDMB 4PLHA 5KYVA 1DRJA 4C3OB 1Y3BE 3LC0A 2XYVA 3O0DA 4P81A 3D7KA 4XYBA 1JAXA 2BFBA 3LUAA 2Q2VA 1SQGA 1QHHB 3O8LA 2P6OA 5K3SA 2GYWA 2XBUA 2AF4C 4N65A 1VLQA 3OZCA 4AZSA 3KXLA 2FSFA 3G2PA 5AK6A 4F9TA 1HR0B 4RNCA 3PX2A 1P0FA 3R44A 3QYAA 2JBAB 1SUFA 4N01A 3TGLA 1PLKA 2PANA 3W2FA 1DIOB 1F6DA 2P9BA 4YP0A 4YREA 1RVV1 1G98A 3IHKA 4CF5A 1WTCA 2EBHX 3MT8A 1OE0A 4E2YA 3OVMA 3WBJA 4L9RA 2EDCA 3PP8A 3GMDA 4V1CI 1ODCA 3NHUA 4LF5B 2GCOB 1LQ2A 3ES9A 4RHTA 4B8WA 5JNWA 3A1SA 1T9DA 4WUVA 2ZTHA 4XA8A 4FHEA 4AQ7A 1VHQA 3HJTA 1VIYA 1OX5A 1GHTA 2A92A 2ROQA 1MX1A 4HXYA 3G5AA 4O25A 2JH9A 2D7CA 3K0FB 4ZYWA 1NRIA 1Z6GA 3WMEA 3GNSA 5FOUA 2ZKIA 3A3PA 3WTBA 3NBQA 5ER9A 3GJ3A 2GA8A 4YJGA 1RXSA 1ATIA 2VNIA 2YXPX 4UBNA 2ZI6A 3TQQA 5TY0A 4PG5A 5IAOA 3OT1A 3RIXA 3IOYA 1OLUB 3PUXA 1VRVA 1TVKB 4UCXA 3ZCPA 3GD5A 4O4LB 4ZYLA 2HMAA 2ZE7A 3WYAA 2D7JA 1TA9A 1JSXA 1U94A 1X80A 4LNHA 4D3YA 1KZHA 2ERYA 1YZQA 2VRCD 2JCXA 3F0TA 4ZVVA 5TARA 1G55A 4HZIA 4EGFA 1U3CA 1UJ5A 5D86A 4XJXA 1GCIA 2J6CA 1DTEA 3LUDA 4OXXA 4JI8B 1W47A 1F1BA 4G37A 2R47A 4NU0A 4U2GA 4KLCA 4QVKA 2IYWA 3OM1A 3AH8A 4RKYA 1AF7A 2XGMA 3QX9A 5TMEA 3W5CA 1XKXA 3KZVA 4HMOA 1B1AA 1E6EA 2OCPA 5GVRA 4AUNA 1JE1A 2IQIA 1HTTA 1ZJ4A 2VZEA 3T1HB 3GJ8A 3KUUA 4AYWA 4PLVA 1FLVA 3ER6A 2C4MA 3KJEA 4JA2A 3SXUA 3KEGA 1ZPDA 1FP4A 3AM3A 4KV7A 4ZO8A 3KDAA 5TQVA 3PTAA 3VH2A 1HRDA 2CLCX 2XUDA 1TE2A 2O7SA 3IVRA 4TQGA 4X7PA 5DN9A 2ZTMA 2LCIA 4DHEA 3SYTA 3CIFA 4D9BA 2PG3A 2JIOA 3IUMA 4MYSA 2NV6A 1TU4A 5DZSA 2XOKA 4DUGA 1CHDA 2P78A 3BXHA 3UC9A 3KTFA 1QV7A 3QENA 2VUUA 3H8JA 4IV0A 4JUBA 4LRQA 3RGGA 3V4ZA 1BDIA 3EJ6A 1MAWA 4H3KB 4Z51A 2QX8A 4RNDB 2A67A 2R6JA 5JD6A 4AMGA 4JUAA 5JY1A 4WLNA 2PZBA 3DXFA 3N28A 2OV1A 4OL9A 3B53X 1P6UA 5D2CA 2B20A 1YUMA 5C1DA 1H2RS 4MS4B 5LFAA 4XFDA 1XHLA 5JPDA 5WRFA 3N05A 1JZSA 2B4YA 1GPNA 3ONEA 4Z1MA 4PYRA 3VR6A 1ULHA 4YC7A 4YCMA 3VA7A 3F9IA 3H2HA 1NW9B 4QECA 2A94A 1OH8A 3KQQA 1XQ6A 3ZHYA 4AUKA 3OIVA 2G5TA 2JGMA 4AKSA 3AC0A 2EZTA 2PD3A 1E3WA 2HV9A 1H9BA 2OM6A 2ZR0A 4BZPA 3N5KA 1XZ8A 4UEWA 4NI5A 5C0OE 1G8MA 2YKGA 3FCAA 5FTLA 2RHBA 1MA0A 3ZBQA 1REQA 3A1DA 3MMPA 1FNBA 3UJ9A 1PTJA 3SFZA 1Q0RA 1G7SA 1A1SA 4WLFA 3L06A 5B6IA 1NAHA 1VCNA 4JJ8A 3MMZA 7MDHA 5FPSA 2BH2A 1G3QA 1XMJA 1WCIB 3WIDA 5JVDA 3TRKA 3AIIA 4OXYA 1BE1A 3OPVA 1II0A 5HK9A 4F5WA 3VSAA 2W8BB 4FFMA 3JD4A 3GRYA 3CLUC 1XJWA 2F3TA 1PT6A 3OEHD 4EZIA 1Y8QB 1JHVA 2VDNB 4FFRA 4WPGA 1P1HA 4Q1DA 4MYHA 2QR2A 4K9PA 4DCMA 5AJVB 3QVUA 5BV8A 1MIHA 2VEDA 1SCNE 1E9EA 2P4HX 5CLLA 4LF6B 2PH7A 4R1MA 4GE0A 4ZQHA 4MW7A 5C31A 4L0DA 2KBFA 4AU1A 4XPIB 2P7HA 3MHPA 4MRMB 2GPAA 2IOQA 3R0IA 5FWYA 1SCIA 3N70A 2JHGA 3S27A 5B1SA 3BGOS 4IZIA 1NP3A 4AWBA 1QPGA 2Z8YM 4F04A 3DFIA 3NV7A 3GJQA 4Z4FA 4B3GA 4YRQA 3MTIA 1IZZA 3C8HA 3LDHA 3DPSA 4N0DA 4Y2GA 5ELMA 3CVUA 3O3MB 5KTNA 5DLDA 1J2UA 4BASA 2NYRA 1EXNA 1U4SA 3CZ4A 3LY7A 5ALXA 3QYFA 4RQAA 3EIOA 2X1MA 3TZQA 1GLVA 1B0UA 3T5AA 1E6KA 1L2TA 2JA2A 3ETNA 3A2MA 4KKXB 4UARA 2IH4A 1Y5NA 1NYRA 2CWWA 1UBEA 1EX1A 2OCIA 2XMBA 4GOMD 5FUMA 3VYVA 1EVEA 2IPOA 2RGNC 4HTAA 1BA2A 2WIKA 2PGLA 4WOBA 2RG7A 2CMGA 1Z73A 3BRCA 2GN9A 2BBOA 2C83A 2F7SA 3LM8A 4GQAA 2QZZA 3R77A 4UQOA 2BVNA 4AKTA 3C7TA 2I22A 4GBGA 5AKKA 4DQ0A 4EQZA 3JRXA 3QPCA 4IS3A 5JAUA 1M66A 4KH0A 1L7MA 4PZUA 1D0IA 2QRLA 2G72A 2OORA 2J7PD 3CXUA 3M4ZA 4PFSA 2WF8A 2XYRA 2IOHA 5BSMA 4WL0A 2QL9A 2Q50A 3NC4A 1II9A 1S8NA 2YHIA 3O90A 4S2UA 2VYND 3NCHA 1UPCA 1PNQA 3IXQA 1QXSA 3DL7A 3QEJA 4PX3A 4EYEA 4MJ3A 1PG5A 5BOVA 1G20E 5EXXA 3QKSA 3QU9A 4QNMA 4LQ4A 2JD2A 4K2AA 2DBZA 4B84A 2VAPA 4RVOA 3SR0A 1UPBA 3IERA 1R8YA 1J21A 1GA4A 2FZEA 3IA7A 4R8LA 2D1SA 2XBLA 3CUKA 4YRRA 4EHIA 3TOZA 2CF5A 1P9NA 3KOXA 4ZQBA 3B48A 4F9EA 1R5JA 2A1UB 1O4WA 2VR1A 3TRHA 4M21A 4FW8A 2VQDA 3IMCA 4ZO6A 1J7KA 1EP1B 3MQ4A 5TS2A 4ND1A 4TKVB 3SQXA 1SMKA 4EY5A 1BSVA 1Z2AA 3H5RA 3HCCA 4EQ6B 3QGMA 3QX8A 4GX2A 3VX4A 2HWKA 4AQYB 4LVNA 4UM7A 4PLFA 4TS3A 3IEMA 3SE7A 4BP8A 3F9CA 1YVDA 2LKCA 4G24A 4RMIA 3DKVA 1EP9A 1US8B 3QNWA 1U0NA 4YLGA 1PWHA 5JS1A 1X1QA 2AJLI 2QUBA 3L7DA 1ZH8A 1KVSA 2G5CA 3AM5A 5HRCA 2VJNA 2Z1DA 4TVKA 1BN6A 4JQCA 2QKYA 1V8OA 4HDSA 4L76A 3NFYA 4RLHA 1NTRA 5IKEA 2Y2VA 1S1CA 5KQMA 2FG5A 4HS9A 1L5KA 4UNQA 1IK4A 1ATZA 5IASA 3PYLA 4PYLA 2ADFA 4HLDA 3UVEA 2WHPA 5E95A 1JDTA 5LMNB 1OHHD 4OO3A 3VDMA 5IJXA 5I4KA 3IUYA 1Q0UA 1Q74A 1XTTA 2XUOA 3L07A 1N25A 1KDPA 2WIGA 5IAKA 2VN8A 1M6WA 4WH0A 3BUSA 4TMKA 3N9IA 2ZTUA 3LV8A 3COJA 3U4HA 1SHJA 2CL6X 3AFGA 1IXRC 1KYZA 2YMMA 2OAP1 2R1TA 3EIEA 4QOIA 2M98A 3OO0A 2NO5A 1RYYA 4Q3NA 4RK5A 3VDXA 1I14A 4MKIA 4ZYVA 3L18A 2IKQA 3DUWA 3U3JA 3V7YA 1Y5MA 3ETEA 3AHDA 3K8ZA 1E7YA 2O2YA 4BTVA 2L0XA 2BM0A 1GM5A 1G21B 3LLCA 3H5WA 3K1ZA 4B74A 1DINA 3BE8A 1I2DA 4IGKA 3WMGA 3DCJA 2HHAA 1ULAA 5EIHA 3UENA 2DHEA 8LDHA 1U2EA 1NXQA 2CMHA 2I80A 4K9MA 1VLLA 3TLGA 1QFXA 1D0VA 1DQRA 1C4WA 3AU8A 3M81A 1Q84A 4FNMA 3WP0A 3MT0A 4ME6A 2P1ZA 1FYFA 2A9OA 4P80A 2AKEA 3CZ5A 4UDXX 2BP7A 1H8ED 3RIMA 2DSNA 4I50F 1XLTC 3W5VA 1DEOA 2VZ0A 3EZFA 2WJVA 1OXSC 1YIOA 3CZ9A 4YCAA 1E99A 3O83A 3U26A 4OF4A 1NVMB 3PDWA 5JHGB 4ARZB 3HADA 4UNPA 2NNWB 3AY7A 1M2OB 3MTJA 4QARA 4ECAA 5CFZA 5KJFA 1MB4A 1UP4A 1U1GA 4EMUA 1JIXA 3S29A 2XNJA 3G02A 1Z5UA 1IOWA 1TPZA 5E8RA 3SJUA 4EJ0A 2WQ6A 1WOMA 1ZN9A 5H4GA 4W9RA 3LCVB 3SFTA 1WF6A 3KT3A 3KM0A 3NTQA 2IOFK 4BNTA 4QKQA 5J2UF 5FADA 1XTSA 3C3KA 3HV0A 2J9RA 1TDJA 5AJXA 4XTCS 2HK9A 3LGSA 1KERA 1ZG3A 1NPDA 3H04A 4RIEA 1T2VA 1W76A 2JLZA 1NMYA 1E61A 3KJNA 3EC1A 3MD0A 3MXTA 4WN3A 5EP3A 2HUPA 4D26A 2LUOA 3L6RA 3D7NA 2QYTA 3EW9A 4EEXA 1GRNA 4R2HA 1ND6A 1JEEA 2ZUDA 2WM3A 3F5MA 4HWKA 4L16A 3NTRA 4LY9A 1KEPA 1EVIA 1I0ZA 4L73A 3VNSA 1IBKB 1ZN2A 1EQ2A 5F33A 1EUCB 1WPXA 3MS7A 3DMRA 2RGXA 1AZLA 4MEJA 2IY7A 2O2GA 1NDHA 2Y1FA 3L8MA 4FDUA 1E3MA 1VGVA 3P0FA 4OCZA 1UAAA 4PU0A 3BMNA 2GAAA 4GOXA 2SCUB 5H9WA 2NZXA 3JAMA 2C4NA 3G59A 3OM0A 3AUUA 1E0AA 2H1IA 2NVBA 3R3VA 3K1AB 4D3FA 2QT0A 1F14A 1EM8A 1XXHE 2G40A 4C88A 1ICIA 2F43A 2JLVA 3KQOA 1NV8A 4RCYA 4D25A 5ECDA 3BTOA 3JALB 4MR8A 3MRSA 1Z5WA 2WTXA 4P4NA 5H9VA 3WDMA 3ZGOA 2Y0CA 4D96A 5HJEA 1QCDA 2R1VB 5AVXA 4LSGA 3KPUA 3JWEA 2QXTA 3ND6A 1INLA 4PPYA 3UJ8A 3VMMA 1XXHA 3GAZA 3ZE1B 1JXMA 3KWJA 5HA5A 1V8PA 4R0MA 1IM5A 5BQOA 3F78A 2RHWA 3DDWA 4AI6A 4BPBA 1UMBB 1CY2A 1MIOA 1XRLA 4FLEA 4F4FA 2FOXA 5AVQA 1LBEA 4MGZR 2WF5A 2GDJA 5CDSA 1DE0A 1N5LA 1IIRA 1U0TA 4ARZA 2HHJA 1N9GA 3L6DA 1U9IA 3BOSA 3VR5D 4KIWA 4KQJA 4MQEB 4Z8YA 4BNLA 4DQDA 2XKJE 2B8EA 1SO8A 2ALJA 2FPUA 3F3SA 3NGXA 4WK2B 3JWPA 2EBFX 3TN7A 4DXDA 4CIWA 3B8HA 1JDBB 3TRIA 2PQ2A 3WYEA 3GVCA 5AM2A 5JARA 4DV0B 3GIDA 3LXXA 3ZLBA 1JEQA 3MN1A 1XF9A 1QRDA 4IPTA 2ANBA 4BZZA 4CE6A 4MVJP 1BX0A 1EGMB 3K92A 1AOXA 2CLSA 1T0UA 3KPJA 3ZZMA 2GFIA 1GUFA 1Y6JA 3VR2A 4KPEC 1PYOA 2J3EA 3I0ZA 2DQSA 1L4UA 3C1OA 4N5LA 2X0EA 3CGWA 4JYZA 2HLDD 5KDLA 2JI7A 5SYAA 1AG9A 2VSYA 4E70A 3UXHA 2VYVA 4RF5A 3OG9A 1N6OA 2XRFA 3UMFA 1B0PA 1UFQA 3RS3A 3SQMA 1H2AS 2GMWA 2P0EA 4WASA 2JLUA 3MCWA 4QU5A 5KYGA 3R76A 2XUZA 4QTTB 4AB1A 1EHCA 1RKQA 4BVHA 2AEJA 1M6HA 4FKZA 4HTFA 2NP7A 1GRVA 4F9GA 3AEKB 3WIOA 4F6CA 3NTXA 1SXGA 3OJOA 4X92A 1OGYA 2EQAA 1YFKA 4G0ZA 3LYUA 1U8ZA 3T41A 2B6NA 2AJTA 3O1IC 5JDIC 3E5RA 4PN3A 5LXTB 1A5ZA 1XIVA 1VL5A 2P1RA 2XLBA 4M6WB 4B1FA 1Q1AA 1XLVA 4U8GA 4EA8A 4DV6B 4S35A 5LKAA 3N7UA 3PHGA 2CYAA 4I1OA 3OECA 5EIEA 4K28A 4PRLA 5CFQA 4I1PA 1CQXA 1YS1X 3D4BA 3FROA 4M99A 2O7QA 3DFZA 1VKOA 5D5HA 3WK8A 2L19A 5BWOA 4HUJA 1JIQA 1SU7A 4P5DA 3IRVA 4ABYA 3REQA 4MIOA 1ABFA 4FVTA 4X3OA 5C1IA 1M72A 5AVWA 5A5DA 4PLPA 1IZ0A 1KKLA 1FDVA 3G8AA 2BD0A 3MTBA 4EFMA 5L6MB 3IV7A 2CDBA 1R4ZA 2FSGA 1GRQA 2J85A 3JTMA 4NK5A 3N6XA 1L1FA 5B6JA 4XASA 3LQRA 4G09A 5FR1A 5TMPA 1URPA 3NT5A 2Q3DA 1U1FA 1N6KA 5DXAA 4CCWA 2OMKA 2YWDA 3I8SA 4U5XA 3D8NA 4ZCPA 5HQTA 1QU3A 2LXNA 1R6XA 2R66A 2ZWVA 5DYIA 5K0FA 5LQNA 4FQ8A 4OBWA 3D3QA 3ESRA 1CR6A 2LDBA 3ABRB 3GLGE 2ORYA 5ICEA 3PUJA 3UYLA 4G2NA 1CRPA 1ZH0A 4PW0A 4HDOB 2DFDA 3Q9LA 3IODA 1GIAA 2VFAA 3LMKA 1T2FA 2OFXA 3WSWA 3RTEA 1AKNA 1EFLA 5JG7A 1GGMA 3BMNB 3EB9A 5J4YA 1NHWA 5IH3A 2NV0A 1QVVA 1YDGA 4UBMA 3B51X 1FYXA 1RADA 3DBRB 3MCUA 9LDBA 3UW1A 1P1JA 4I36A 1EM8B 1GG9A 2QVGA 3GQVA 5I5GA 1OFVA 2O8VA 3E3LA 3DZHA 3Q7TA 4FZ5A 4QDUA 5CDTA 1J8FA 2Q1SA 4F46A 5TRTA 4M1TA 1W4ZA 5JCJD 1U7ZA 5LQAA 4G84A 4BC1A 2DUNA 4FGKA 3H97A 1NASA 5EQDA 2ADOA 3QF7A 4LXIA 3DT6A 4F86A 3ETCA 5IBPA 3RANA 5JI3E 2EQ5A 3ANTA 2ZIFA 1P2BA 2ZBRA 1KC3A 3FPBA 3V8VA 2AKYA 3OMLA 2IYQA 2HI0A 2PBLA 2V7VA 4OYHA 4DEYA 3EXHB 3I05A 1L1RA 2YL2A 5DJ5A 1QIKA 2H5JA 2PXAA 4CMBA 4RDHA 4O2LA 4DMRA 4FW9A 2J8ZA 4FR5A 1NURA 2EG5A 1VL8A 2DLCX 4L4XA 3OSZA 5HKKD 2EGHA 2ZRQA 4OB6A 1C9NA 1SBQA 4NH0A 5TVGA 3NKVA 1T8TA 4NV0A 2D2IA 3EA0A 2FR1A 5E9WA 2IBTA 4KNYA 1BE8A 4XJSA 1T5OA 2CF6A 3IAS1 1X77A 2DRIA 2I7XA 4G4GA 4HADA 3ULKA 2ZAYA 2QGZA 2Z0MA 3I73A 4ENUA 5LIPA 4DUYB 4HLQB 2GK3A 5FRDA 1K86A 2VRBA 4EFKA 1OYVA 3B89A 4ZOCA 4ZMBA 4DV4B 1W1UA 3O1JC 4G1MB 1P62B 1OZGA 2NTEA 3AFMA 2C61A 3NHFA 3OZDA 1XCPA 4NBTA 3VSEA 1IRIA 3C3EA 3BWCA 1MTZA 3UA3A 1HURA 5HZKA 3NNSA 2K4MA 3T1QA 2GKGA 2O2DA 3IJRA 2IYAA 1EH5A 3WB9A 3ZGXA 5L95A 4V0MA 1TNDA 1ODFA 3IBFA 2QBYB 2AN1A 2WOJA 2CXNA 2AFHE 3H3XA 4MKFA 5CCDA 1KE2A 5KC9A 3PZBA 2ODAA 3LUBA 4NX2A 5JDIA 4V0LA 2HMYB 3GG9A 3L0PA 4F4JA 3IAFA 2V3CC 1ISPA 3R6WA 3R7WB 2QMUA 2Q49A 1UWLA 1ZJZA 2F90A 2W8BA 3BB4A 2A5GA 2B0CA 4DRXB 4LF4B 1TLFA 1Y5LA 2FF5A 5F4BA 1HE1C 1D1QA 3R8FA 2J08A 4FMDB 2NADA 4F93B 1YRHA 1V45E 1WLYA 3ORFA 1IM8A 3R7NA 1H6CA 2IYTA 3S1LA 4QBTA 1FFYA 1K6MA 1NTOA 4YAIA 1JQJC 1WW3A 3EA4A 1OVGA 4G8BA 5T3UA 3VR4H 5CDFE 5DHTA 3M4XA 4FN4A 2QORA 1LX6A 421PA 3Q8KA 5F9HA 1U2SA 1J1ZA 5J4VA 1HYQA 1EWRA 3Q88A 3GI1A 4HH4A 3VHRA 4EF5A 3S6JA 1GFIA 4LQCA 3E9EA 3PEYA 1PR3A 4FGLA 2GXUA 4ZWNA 4LIPD 2CKMA 1XKQA 3D8RA 1QGUA 4A6EA 1CERA 2AG5A 2NO4A 5AVYA 2QF7A 4WY8A 3A4MA 2N0SA 3B13B 2DFLA 1F0YA 2DE0X 1NA5A 3BSSA 3C4QA 2OV8A 4IGFA 3OA2A 1PX2A 2IP1A 2Z2XA 4QHTA 5KC8A 1MO3A 1NMSA 1PV1A 3ADKA 1T2DA 1UXHA 4MW4A 1NI5A 4HXFB 4DNXA 3IQHX 3E03A 3QHAA 3UQZA 4ZHSA 2HA4A 3AUAA 2EJTA 1OAOA 4M9RA 2GXAA 5KOIA 4WFKA 1TT5A 5D01A 3FDJA 4LE0A 1U9YA 5E0KB 3AJ8A 2CFOA 1E1CB 5HXAA 4JEUA 2AI2A 2YXEA 5L51A 3PXEA 1JFVA 3VAAA 1NYTA 5FH9A 1XDUA 5ERGB 4BJ3A 3UCEA 3FTPA 3SGLA 4N47A 1XEFA 2XGOA 3QBDA 1XZKA 5GP1A 1FS5A 4HNQA 4Q21A 2VDKB 3V42A 4F97A 4LFBB 3HJRA 2B1JA 2HZBA 4NHEA 4OAOA 3EXG1 3EIWA 1NF3A 4DAOA 2RHJA 1NN0A 1D1TA 4Y1EA 2O8NA 4Q03A 4DA6A 1CF9A 3DYVA 4WXMA 1LVGA 5KNDD 5K3AA 4AS2A 3T9BA 1ULSA 4A1FA 5JNVA 3OQIB 3EF0A 4L15A 4WXYB 6REQB 1ESMA 3ORSA 4G41A 2G71A 4BQRA 2A57A 5HTKA 4KEAA 1Z25A 4O4IF 1LS1A 5FOTA 2WK1A 1JKJA 2J67A 3VOTA 1QIDA 3BHIA 3V8MA 3UATA 7GPBA 3UMMA 5CT5A 3TF5A 4M0CA 5ICCA 4G9EA 1YIAA 4HX9A 4W7HA 3L1UA 3ZCXA 5CVTA 4MI6A 4YRCA 1QP4A 5TGZA 4X20A 1OBHA 4QBKA 1KETA 4DR6B 5IYZB 1UK9A 5CYGA 4Q1BA 5ALKA 5F12A 1T43A 3FKJA 1AS3A 1E5XA 1PT7A 3WDKA 3WIEA 3HBNA 1O77A 3TMKA 1PK9A 3NIFB 3ZWCA 4KJZA 4DJDC 4DSNA 1XNRB 1E1YA 1B2LA 5M3BA 4RACA 2FK7A 3K0BA 3NRJA 2IDZA 1W9HA 1F4VA 4DY4A 2G6TA 1E5DA 2HOQA 3VI4B 5JTUA 3SS7X 1JU9A 3VPCA 3QVTA 1U8YA 5J40A 1U6KA 4TTVA 1DTSA 1WVGA 5CW1A 3CJQA 3I2FA 4B6SA 5IMSA 1DCFA 2EFCB 3N75A 2IS1A 2ZR8A 3ND8A 3OFJA 2RGAA 2BFOA 4Y6OA 1CJSA 3OQ1A 5AW3A 2C5HA 2FXIA 3UF0A 1XFAA 2PBFA 3HLTA 3IQIX 2QA5A 4Z3DA 3B7PA 5E6SA 1CYDA 4UFNA 1SBTA 2H48A 2DT5A 3GHHA 5DHFA 3SBEA 3VM6A 2OO5C 4MO9A 4BVEA 2IXFA 2HREA 3I6QA 5E4JA 5EEGA 3M6XA 1N7GA 3DC2A 4COOA 2CLLB 1ZW1A 4MWTA 1BCSA 2AFVA 4PYIA 4B76A 5KPDA 4GEKA 1YFJA 4E11A 2PBRA 6PFKA 3DDOA 4MMYB 4J7AA 5ANRB 5BVHA 2Y1CA 5KIAA 3L7MA 2OB2A 2R96A 3PIRA 4J4TA 3PKJA 5IBCA 4HOYA 4PRYA 3N87A 2PUFA 1FXUA 5EWLB 1KDRA 4NYIQ 1XPUA 3HWX1 4D8YA 5H68A 2JLBA 3FOZA 3WTCA 4I9FA 5FIUA 1NI4B 1VQ1A 2ECOA 2C7BA 2X8LA 3NV9A 4RTMA 3N59A 4CKCA 2EV9A 1CR0A 1MTOA 1JEOA 2DZDA 3AEKA 1VMIA 4HNAB 4D0LB 1VSUA 2ZVDA 2CWDA 3B9RA 1P4SA 2QVXX 4HZGA 4WKOA 4EHHA 3DSRA 3TUIC 4CXMA 1EJ0A 2ONCA 1LK7A 2FPIA 1XTBA 3DL4A 4XVQA 3V48A 3ZWPA 2I2AA 2VJDA 3K4HA 3LOUA 4FXPA 3HY6A 4IILA 3IDAA 3UH0A 2C7PA 3MJ4A 2ZETA 3ENVA 3HKBA 2QMZA 1B6RA 4GGMX 1TMGE 5BUQA 1EP2B 5JFTA 3N2KA 5AUPB 2G1JA 3VKVA 1RHKA 2BMVA 2LZ0A 1GP2A 4I66A 3TD2A 4TZ0A 2B7BA 1SU6A 3TG2A 1CRWG 3AR8A 3I04M 4KPUB 3DE7X 1V1JA 1XAHA 2CVOA 2ISQA 4B2LA 4B80A 4HAYA 3MTDA 3BC1A 1U98A 5A4MS 3UXEA 4OUDA 2A7QA 1K4YA 3U44A 4UTRA 2CB9A 3DEKA 1B74A 2JFXA 3HB7A 3BDIA 3HHEA 5AHXA 1U9CA 2GT1A 4JFRA 4KE9A 2R6AA 2R6R1 1G8AA 4U7PB 2PZEA 1YDHA 2H59A 3LLVA 1KO1A 3ZE0B 2VT6A 4E1BA 5E1MA 2YZ2A 2I2XB 1NUQA 3FTDA 5AXBA 4TYWA 4AKEA 3H87A 1WEKA 4V39A 1SZDA 4M9QA 5D6NA 3V4PB 2YRXA 2AD5A 4XWWA 3BILA 3PWTA 3OTIA 4MS3A 1R9GA 3BWVA 1IATA 4XAQA 2BMJA 3EHEA 2W42A 5HDBB 4EB8A 2FPGB 4CM9D 1YBFA 3GDGA 4D0RA 5LVAA 1EXWA 5G1PA 3INRA 3K72B 2X41A 4L8GA 5DVZA 4FJ0A 4WJZA 3HYRA 2VBIA 1WVMA 2QR3A 4EVQA 1UBKS 4YT2A 2XE7A 4OHWA 2YOGA 5FBHA 2HA7A 1EGQA 2H63A 1U8CB 4KMOA 4AMUA 4KQCA 5ARDA 3OLYA 1FJHA 5CHYA 4A5SA 4BQIA 4NDNE 3KEOA 3EXEB 2IEYA 4JA0A 4MS1A 4AN1A 1RWKA 5ED4A 2FH5B 1IN6A 2R4QA 1BDJA 1GCGA 1YHYA 1TL7C 1TEXA 3B52X 1EGVB 2AFHB 3BF7A 1GPUA 1HQKA 2EFEB 3FX2A 3K5WA 1KARA 4IXMA 4UVHA 5E38A 4BY9E 4Q37A 2PR7A 2E0IA 1HLPA 1Z5OA 2ZJ8A 4KOEC 4CLOA 3O73A 1JT2A 2QZSA 3AU9A 4R2JA 4L4YA 3NXKA 1XSEA 2AN4A 3B3JA 4X1IA 3RT9A 2BKEA 4QJ4A 1TCAA 3KEMA 2D6FA 5REQB 2H8KA 2PPLA 4HKTA 5DYNA 4MEAA 3TXYA 5BUZA 5L53A 3AFNA 2EQBA 4GPIB 3DGEC 1T2AA 2DP4E 2ZIVB 2FNAA 3FTNA 4RK1A 3N3BC 5BYJA 3UAXA 1T29A 2UVDA 5HZHA 4FGSA 1NBOA 1AY0A 1IZ9A 1QFSA 4ZVUA 4MITA 5DM1A 3QEMB 4WW0A 3U4GA 2XA1A 3WQRA 1ARZA 4OHCA 3UWOA 2XEDA 1RXEA 4HMQA 3L8GA 3EYAA 4BQFA 2O8FB 3ZJVA 2V8OA 2BTQB 1I94B 5JH7F 4BN0A 3GJRA 3OWXA 3IP7A 2CHQA 1Q50A 4IIXA 1ZU5A 4B85A 1T8UA 2VF8A 2ZRJA 1GCOA 3FAKA 3LKDA 4XDHA 3LFUA 3TOXA 3CVXA 1WM1A 1HH4A 1Q3HA 2E6KA 3B85A 4OB7A 1SQFA 3OZUA 2C2XA 5BSGA 3K5IA 1Q95A 3CUTA 1QZZA 1XCLA 5LL6P 3BA6A 2FY8A 2CMDA 2GRUA 1LDEA 1SVIA 1E2GA 1TRHA 3NHKA 4JDPA 4MI1A 3ABIA 4WLOA 4P1ZA 4EBFA 3QF4A 2DR2A 1DGQA 2PL9A 3WLAA 5DHAA 2QD5A 2DJ5A 5HUHA 1OWOA 2PL3A 3DVQX 5IJ9A 1WIWA 4EI8A 1CEQA 3UMJA 1PHPA 1D4AA 3TPCA 1W581 4URUR 4BNWA 3LD9A 1QR6A 1QM5A 4KN9S 3HWRA 1AS0A 3GDFA 1GAWA 3Q85A 5A5GA 2LVBA 5CA1A 4JR0A 1HYBA 4TPKA 4GSYA 2ZYIA 3H5OA 2X4LA 2Q9BA 4HWPA 1JDJA 1F3OA 3ONDA 5BRNA 4DY6A 1KGSA 4HVTA 2EP7A 4A0SA 4PC6A 3L8EA 1JR3E 1EDDA 1YMUA 2H2WA 4XRRA 3KQWA 4KN5A 5JYEA 4AG5A 4AS3A 4E12A 3COVA 2OQ2A 1DBVO 2I6GA 2EHDA 2RG1A 3JARA 5AJWA 2BBTA 3JQCA 1U28C 5D3ZA 4DQXA 3LCCA 2IYUA 4CEJB 3AI7A 2JZCA 1A9XB 1LLQA 3PL5A 3ZHZA 3A9CA 2HNBA 3QUQA 4UMEA 3CEHA 4K1LA 1T5IA 3ENZA 1EESA 2M32A 4GS5A 2C4UA 3PNKA 4E22A 1R18A 2VQ6A 4WKNA 2WWWA 3NWEA 2W37A 3JWGA 3QBVA 1UC4B 4LWZA 3S55A 1W5SA 2NSLA 4B73A 3DE2X 3HGQA 1NMXA 2IEIA 3C43A 3CH5A 3LZCA 4Z2YA 1C8KA 1WABA 1MPXA 3EX7C 3H4TA 4XB2A 2V98A 1D6MA 4XEUA 5DU2A 2PJZA 5EJIA 3JASA 1TEHA 5HE8A 2RBGA 5C8YA 3BKXA 5J63A 3RIYA 1YAJA 1D5CA 2PFSA 2XMQA 1RYEA 3PEFA 4RF2A 4D3ZA 3OPXA 3FYUC 2H0AA 3ISJA 2J0EA 4MYTA 4OGGA 4Q9IA 4X1KA 3U60B 3IE0A 3EZXA 1JTEA 3L9WA 3CF6R 4IEFB 4IX1A 4HG2A 4V0ME 3HY3A 2FCAA 4WY2A 4DDUA 5ENZA 2POCA 5CXSA 1OFHA 2OYCA 3O4JA 3F1LA 1K0FA 2AQ8A 4IIJB 3AHIA 4RHXA 1I3NA 1HLGA 1AJEA 4ZZ3A 2WV7A 2TMGA 3ETGA 4B6GA 3SQLA 2UV8A 2H4YA 2HA2A 5D3QA 1ZWLA 2I7TA 3ZW7A 3DUFA 5BQFA 3R5SA 1G4UR 3QPUA 1DDIA 4N6NA 2PS1A 3ZWMA 4F5ZA 2FEMA 2XZOA 3ZOKA 5EE0A 1OXMA 2RSLA 1N8KA 3RUAA 1VMEA 1R0RE 1I51A 1G8YA 2BI4A 4QRHA 4QDOA 3G1WA 1RPZA 1L3CA 1QB7A 4MDFA 5BN3B 1CUCA 4MJ7A 1Z56C 3O8OA 2QTBA 3R3XA 1O9HA 3EXIB 4W63A 3KQVA 4U2BA 1HE3A 1Y7TA 3E22A 1NUAA 4J91A 2DOKA 1J25A 3U13A 1Y4UA 4O1MA 1KI6B 3HJGA 2QAGA 3OUUA 5IM4A 4BYMA 3OZRA 4YDRA 3RS4A 3WFIA 3O94A 4N4AA 2I7VA 2FMUA 4ROTA 4ZKDA 1GZ6A 4CRWB 4MR7A 2X5OA 3WO1A 7MHTA 4OU5A 3VH1A 2AW5A 5LYJA 5FAKA 2FSPA 4TN5A 2YWJA 1JG7A 5CB0A 4TGLA 4ZDWA 4C4SA 5IDQA 2BFEB 1BW9A 1GILA 3MUOA 1T10A 2WTBA 4A8HA 4ZV9A 4PHGA 2VTEA 2DSTA 2EERA 4Q5IA 2JGDB 3IUBA 4X5OA 4Q4DA 2OP0A 4Z7NB 1VYVA 5KNBD 4B4DA 2VJMA 3FDIA 4I9GA 3U7QB 1XBTA 1U1EA 3FCUB 1RBYA 4N3NA 3T3OA 3P2JA 2Q6TA 3ASYA 1CUBA 2Z2KA 1IVYA 4ZQFA 1N0HA 1JQDA 3EW7A 3T5GA 4WZZA 1QOPB 4WZAA 2P3OA 5GQSA 3L7KA 4OQEA 5C4IA 1T4CB 4NZNA 4QLBA 2B99A 4MA4A 1Z6PA 3IR7A 4UM9D 1HNXB 2ZRLA 3DQZA 2PS3A 4HLUA 1ILEA 5DMHA 4M7OA 1A98A 2X1LA 2W6ZA 1XPRA 3AR2A 4J0IA 2FEPA 3JAWB 3PU6A 1YU9A 4FMCB 1A9ZA 3I61A 1YCGA 2N3ZA 4RPKA 2VTVA 3VZQA 4DC9A 1AQJA 1OHHA 5FBRB 4U2EA 5DNUA 1X39A 1P6QA 1WUTA 2IP2A 5FLYA 2IDJA 3BJZA 1SUAA 2IEGA 3JWHA 2BT4A 3NHBA 4UFOA 2XUJA 1MX5A 1WMSA 4IHKA 1NRJB 1Q0QA 3DHYA 2YDYA 1LS6A 3V1MA 5C7YA 2JIQA 3RWBA 1CUGA 4QOGA 1JIKA 4G25A 2NOAA 1Z0AA 3NJ4A 2QX4A 4HB3A 2Q3EA 3KTDA 2OKCA 4H7IA 2OMEA 2QX9A 4G0YA 4FEAA 5LNK6 4F7WA 3ZPXA 1TQ4A 2PMFA 3O2JA 1XZGA 3K16A 4CKEA 3L84A 4MWGA 5CPBA 1GCUA 1GFZA 2BJWA 4P36A 4RTNA 1QS0B 5EIOA 1I7DA 1E9BA 121PA 3HO6A 5AI6A 3VVBA 4FFVA 1FL9A 1VMKA 3GRFA 2RHOA 2OV6A 4IINA 2HT1A 3D81A 1K92A 2DTEA 2O2HA 4IUYA 5JJBA 1E1QD 5BN5B 3BIXA 1OKKA 3SVZA 4XCXA 3WQHA 4RS4A 5MF6A 2P40A 4DLNA 1CLUA 1GPBA 2O06A 4QJ5A 2BFEA 4LMRA 4KBFA 3U4QB 4LEIA 1MP0A 2PZAA 3C14C 1AMNA 5DM4A 2F67A 4LJLA 4YRJA 2COKA 2WI8A 1IUNA 1PS8A 4M1SA 2Z1NA 4XIYA 5DW0A 1YS7A 2X9NA 1GKIA 3C1TA 3EARA 3OIYA 3FFXA 4QPPA 4BNGA 4A8PA 3HRIA 4JOSA 1A2QA 2VCHA 2G83A 3X1ZA 4YP1A 1F2UA 3L5OA 5D8DA 5FFNA 3EC2A 2C2KA 3WLMA 3BAZA 2P2DA 3I9MA 4HRAA 3WJ2A 3THWB 3SX4A 2WD8A 3HBMA 3VZDA 4AIIA 1KTIA 2YV1A 1EUYA 4Q15A 1BVUA 4LKRA 7YASA 1W19A 3D4PA 3HK2A 3KSBC 4O59O 2WQZA 3ZHUA 4A0QA 2I9KA 2OXIA 4CKYA 4AJ4A 5L3QA 4BJ5A 4QXPA 2WMDA 2VHQA 2WU8A 3LFTA 3L8YA 3FNHA 3P97A 5IARA 1ILWA 2SBTA 4G9BA 4WN9B 4AP6A 1TCBA 2XDYA 4UCQA 2GEJA 3FI9A 2IV3A 4TS9A 1L5WA 5IANA 2XUQA 1GSOA 3E05A 5JEEA 1L8QA 1Z4NA 4TWRA 7AT1A 2EZUA 3BIOA 3Q9SA 4MR9A 2V7GA 1H2HA 3H1FA 5CR9A 2Q5QA 5F9FA 4GPEA 2EFDB 2OYRA 2HPVA 1G8HA 3EVAA 3L7LA 3K2BA 3PENA 3DZBA 4J0EA 1ADBA 1UBLS 3TGWA 1FRNA 1PVDA 3WK9A 3LHFA 2KX7A 2DEUA 4M3NA 1U6JA 4MVYA 2FZWA 3W8EA 5J4KA 4F8YA 1QB8A 3HB1A 5KVSA 1CIPA 2BF4A 1M0WA 3CSSA 1BJTA 4JGBA 4X7RA 3NFRA 5CDFA 2ETVA 1L4YA 3B60A 3C3XA 2QQ0A 4C30A 4YQZA 3RNOA 4BB9A 3EVBA 3REGA 4MKZA 4BDSA 1Z7YA 1JHPA 2O3TA 2XF8A 1RXYA 3LC7O 5CVUA 3WRYC 3L3BA 4XWKA 1CR4A 1VIDA 1M0SA 4DM4A 4Q00A 4OBXA 4JC8A 1SM4A 2BI8A 2WIJA 1JG2A 4NRDA 3QWHA 5LC1A 3REQB 5HUJA 3HP7A 4YP7A 4CFYA 1DXYA 3LXMA 1BHJA 3GEDA 4IWXA 4UUAA 1J56A 3WNVA 4LG1A 4HBGA 1U8XX 2CFCA 2QG4A 3MTEA 3RSZA 1V16A 1TEZA 1MFPA 1QO0D 4OMFG 1NDQA 3T5DA 4P8RA 1MO2A 4IGIA 4RK6A 2HYIC 3OCYA 3H6HA 2QZ9A 5ALMA 4MO2A 1PD1A 3PK0A 4TSFD 4Z7QB 3M5DA 1SELA 2CK3D 4WJKB 4TWAA 1K06A 4C89A 3IMKA 4XYEA 2B0JA 1E2MA 2IL1A 2Q3LA 3C3CA 4Y2QA 4Y2YA 3V4RA 1R0LA 5A0VA 2AYZA 2ACVA 1LBQA 1IEWA 2X15A 3RC3A 1N5KA 1RRPA 2OEPA 3HDVA 2C98A 3PGA1 3V2UA 4ETIA 3EOAI 1P7YA 2W70A 2QE6A 1HDCA 4PAMA 4A5OA 5LOVA 1KRWA 1D07A 1QNFA 2LCFA 4ETMA 3LIPA 5KNCD 3BQNB 3MQFA 4OP2A 1ZCFA 2NAPA 4KWCA 4MZXA 4UOEA 2ATXA 2QPOA 4K6MA 4KG7A 1VGRA 3WYCA 5LJIA 3DZCA 1ECBA 1USWA 4JX9A 4CKCB 3TR0A 4HH1A 3H4IA 2QN9A 4W5QA 2DHRA 2HEGA 4B4UA 1LBIA 3HYSA 4JL6A 5J2UB 3GOQA 1FDSA 4URVR 4Q9NA 4FSXA 2IU6A 5GGXA 5A03A 1Z2PX 4YMTA 1IOVA 1HNNA 1GA6A 2FW0A 1YS9A 3I0NA 2IELA 4O2BF 1KZ1A 1DBIA 2GDZA 1C80A 2VDRB 4HGQA 4CLHA 3TL6A 4WKCA 1I5RA 1UWKA 2J0UA 5F2EA 5G41A 2QS9A 1HPLA 5BVHB 4WSOA 2RDMA 2H2IA 3VPFA 4JHLA 4BNNA 4AYXA 2O0KA 3DLPX 5HSGA 3LOQA 4B8ZA 1WS6A 2I3AA 2XMRA 3BFVA 3RRMA 3V9AA 1VI6A 2IWRA 3LU1A 4LOHA 4JL8A 5ECGC 3RUPA 3QFRA 4E13A 4NC9A 1PV4A 1ZY2A 4FUTA 4ZQGA 1COWA 3MJVA 1YHNA 2ZI9A 3MYYA 4UD2A 2XCOA 1JB1A 4J4HA 3R4VA 3AP1A 3FTCA 4L5YA 3MJDA 2WBLC 1L5FA 3LA6A 5K3FA 4KVGA 2CGEA 3T7IA 4I3HA 3IHLA 4FS3A 2FU5C 3WLHA 2VOEA 1L5NA 3K6KA 1OYYA 2OD7A 4TLAA 1EPUA 1S3FA 5JIBA 2G0AA 1MB2A 3TI7A 5EJ2A 1FDUA 2QLBA 1RLJA 4BO0A 1YBHA 3LX4A 4PAOA 1L1QA 2MSWA 3RU3A 3AVWA 2GHTA 4XIIA 3RYFA 4KYVA 4FHCA 4BKRA 2G9RA 1E89A 1GU1A 2N46A 3ACDA 3BG5A 3DE6X 2A78A 2FZVA 2ZXUA 4TTAA 4PONA 4V0SA 2JS7A 4GI7A 3INNA 1M54A 5JSKA 2EW1A 1O5IA 3AR6A 3BWXA 1I0LA 3REFA 1U5AA 3U1VA 1FU7A 4PG7A 3WYNA 3R3HA 1IE3A 2GK6A 2OG1A 2OY0A 3F8TA 4O4HA 1B4DA 4Z7OB 4UEQA 4HB4A 1RM0A 2B2CA 4II2A 2Y27A 3E23A 1HZJA 4QRDA 4RD6A 1KQPA 4EABA 1UC5B 2WDPA 3FWNA 1VPEA 1YE8A 1XWIA 3L2OB 1PUIA 3VVMA 2CL5A 5JQGF 2EU8A 2Z04A 3CNEA 4B0PA 2JH3A 5F7JA 1Z34A 2OE2A 3DMTC 4PHTA 4RBNA 2XQKA 3WK7A 4J1TA 1QUFA 4WESB 1JEYB 4O4JA 4EOGA 4YMGA 4L9WA 2XADA 1E2NA 4AWXA 5KTYA 3LXUX 3QBJA 1U7HA 1KJZA 1IQ0A 1VJTA 2CXXA 2BEVB 2FR8C 1FMLA 2P2YA 2XMPA 2YJZA 3L05A 4YP5A 4Z0TA 4IIFA 1C7RA 1EDZA 2A35A 4KQXA 5H3HA 5IBQA 3T06B 1YCHA 3RAFC 1CUAA 3E5MA 3I32A 3PFKA 2H4HA 4QA9A 3JV7A 3W4JA 5L7WA 2VF4X 1XDGA 4E21A 1L9KA 4DADA 1HDIA 2YY6A 1LW6E 3AF5A 1Q6YA 4G0WA 3CX8A 3USZA 2FPOA 3SXUB 1ZHHA 3P5BA 2HEIA 2F17A 2QTAA 4TT3D 3SDBA 2YYSA 4JP3A 1PNTA 4TLBA 5MGBA 1XNQB 4LDJA 4AJ9A 3BXZA 3K4PA 4PNHA 3TL3A 2JFGA 2QJRA 4BZXA 5IPFA 3JAKB 2JIZD 2ZWAA 4PTZA 3V6MA 3HHPA 4JI7B 1JLHA 3IV6A 3DO5A 2X7JA 2Y0PA 5JNSA 4XSVA 5FUVA 4ZT2A 4ZPJA 5KSWB 1G41A 4RELA 3SX0A 3D4IA 4BNJA 3H1GA 3WL3A 3A04A 1FFHA 1GPKA 2IE0A 4QT0A 3TEJA 2UUCB 4HAVA 3RE1A 2OFOA 3R6DA 5JSZA 4S1PA 1OD6A 2V3WA 4UEKA 4A8JC 4D9EA 2YV5A 1RJ9B 2X0KA 2F64A 4PZ9A 4BO6A 2YWCA 3LHIA 4P6VF 3WYDA 2DPMA 2JGKA 4EJFA 2R3SA 2ZRFA 1KO4A 2HA6A 1ZIXA 4GG1A 1O95C 1K9VF 3M1YA 1V71A 3R7DA 2BFBB 1DBSA 2HFJA 4I4TB 1OWNA 1P75A 3ONFA 4TM8A 5F4ZA 5LUBA 4JI1B 1NMEA 1QE5A 1JHYA 4KQIA 3UHAA 3UIEA 4AMZA 2XA2A 1TM2A 4H2DA 3WGKA 1NJSA 1JSZA 3BB3A 2GRAA 3AB7A 3NRCA 1EZ4A 4IMJB 2ZRPA 2PX5A 1EE1A 2CK3A 3H5LA 1HG1A 1UZLA 1RM4A 4M0DA 3GYGA 4C7JA 1KI3A 1Y0BA 3I2JA 4URZR 3LT1A 3N5CA 4YRAA 3QWFA 3IBSA 3EZYA 4HYQA 2GBLA 2O7NA 3PUHA 5I8PA 4H1HA 3M1LA 4K26A 4PZEA 5ICMA 1OAKA 5K51A 3AYXB 1OLSB 3P0IA 5B7GA 2C2GA 5KTTA 1BWRA 3NWOA 2R5FA 4UREA 1DUVG 2QTNA 2X9QA 1QNLA 4MJXA 3TZCA 3ZJ5A 3ZVRA 3W3ZB 4YJHA 4BV9A 3LHKA 1FNNA 1SK9A 3MLAA 4RJIA 1KEEB 5DX0A 5JEDA 5AKZA 2HMUA 1CPYA 4HGNA 2O1XA 5FO0A 1GXSA 3KO8A 2WWYA 2PSDA 4P7FA 3UB2A 3KEFA 2AG1A 4GC9A 4O6VA 4UATA 2B1IA 4F5YA 4YUXA 1IG3A 2FLVA 4TV8A 2ZRHA 3Q3GE 3E35A 1G63A 3DVSX 1GPAA 4BGUA 2QE7D 1BWQA 4M9CA 2OG2A 3THWA 5H1YA 3BH7A 1ORRA 1EJBA 2KWIA 1M75A 3JATB 1MC4A 1BOOA 3A37A 2ZROA 3ILYA 4LECA 2Y0EA 4GLFA 1D7AA 3CC8A 1IJKA 1LK5A 4NZZA 2JCGA 3KQUA 3ELUA 3OE5A 1FMJA 3H6KA 4AWAA 4Z9BA 1T6XA 2R2GA 3PQEA 2WTNA 3HKDB 3HJFA 5DTJA 4KI0A 3PJDA 3F46A 1Q1ZA 1JQKA 4Y2PA 3P4YA 4JC5A 4YI3A 4S04A 3T61A 1ADFA 1J07A 3S2ZA 2DTXA 2MSDB 4IDNA 3SYMA 5B37A 4X62B 4L07A 5EJ6A 4FHZA 2B21A 2OOKA 3EQ8A 3NYRA 4YJDA 5TE9A 4JI6B 1R6UA 4DMKA 4GICA 1J1UA 1AHHA 1F1JA 3N2GA 4ZOEA 4PS1A 3ANYB 3A0UA 4JLMA 2R7MA 3L6EA 2XCQA 1NBMA 1PWZA 1RBMA 1GT91 1I5EA 4UC0A 3F6EX 1Y9EA 3K30A 4Q0MA 1CUSA 5BP7A 1RXVA 1ITZA 3NETA 1Z8DA 1T9ZA 2Q2OA 1WSAA 1SXJB 4M8IA 5I4IA 4IJUA 3ZE6A 1PZEA 4PG6A 4YUVA 2WKSA 3H2GA 1YR3A 3V3KA 5A6VA 1KY2A 4EG8A 1CUVA 3QE4A 3OBBA 4M55A 4QOSA 4R7GA 3EVTA 4F8JA 1CE8A 3JQ8B 1Y7PA 1YCFA 1DOHA 1IWPB 2JDID 5EQFA 3ZWNA 2WTMA 1H4SA 4R4JA 9MHTA 4ZOAA 1T9CA 2GLTA 3BCUA 1JFSA 1YQTA 3AEZA 4HB0A 1H2EA 1OLUA 1PR4A 3FVRA 1NBIA 3A9TA 3K0AA 3UXMA 3PFWO 4PX2A 1DXQA 5K3CA 2ONJA 1LDMA 4GMDA 4E5MA 2POQX 2E21A 2Z98A 2CLFB 1KEEA 1SXQA 2I4OA 1D2AA 1IEQA 1Z7EA 2DPLA 2DT8A 3W8DA 3TJZA 5IBRA 5A7FA 3THYA 2VSNA 4RCZA 2HBQA 2R6DA 2TMDA 3HFJA 4HDRA 3ST7A 3NR2A 3JYPA 4TXNA 1LTHR 3AVOA 3K20A 2P5TB 1DU4A 2A0YA 3PEVA 4M46A 4FZ3A 3CUSA 1QG6A 3HSYA 3BL6A 5TJ9A 5F2NA 1E94E 4MB0A 2HMVA 1W9MA 2XT6A 3W5JA 3QFTA 1TM5E 3PDJA 5CT4A 3OQMA 4QXQA 3HGMA 4RH0A 4DDWA 4WJLA 3X44A 1ADJA 2QGNA 4PIPA 1QCYA 4HV4A 1KSHA 3HB4X 1ZEMA 3B1FA 4HTFB 4TMZA 4XLLA 5COAA 4D56A 1SD2A 5EPEA 2W0SA 1SKMA 4QM6A 2K2QB 4WZAB 2QDXA 1A4XA 4M0FA 2P9HA 1O2DA 3HYNA 1ZQ1A 2C5SA 2FSUA 1DCMA 5K6AA 3NBFA 2ZVPX 4IXNA 4QYSA 5C7LO 3B20A 2B35A 1IBSA 1K5HA 3GJSA 3OAAA 5H02A 2W0MA 3T7CA 1TM1E 1TKCA 4JNCA 4RJLA 1ZJ6A 5K8VA 1VHJA 3MK31 4KL8S 2UZ4A 3RF7A 4NS4A 4HLUC 1E4VA 1OYWA 2I76A 3M89A 1RFGE 3ON5A 4GH5A 5DM2A 5EJ7A 1YU6A 2R7NA 1QCCA 1TKAA 1KHHA 2QI9F 2O05A 3R75A 2AH5A 5GIOE 1IJEA 2C42A 2I03A 2WT4A 2ID7A 3LUHA 3ZE2B 2Q6VA 4CDMA 1Z8HA 2PU7A 4RV9A 4UBOA 3EODA 4HSGA 1T2CA 2R86A 3OJWA 4DAEA 2X7HA 1ZH4A 2G9ZA 3STTA 3W04A 3NAQA 5AHOA 2GPNA 1ZQ9A 1SXIA 4A8JA 1YJXA 1AM4D 1M1ZA 3DVLA 3I04A 3H11B 4NMLA 1I3OA 1S4MA 3BWYA 2FGJA 1EVYA 1X92A 3MJTA 2P9TA 4O33A 2E4VA 4AF8A 1Z6YA 4DA0A 4EFLA 1T9GR 1KY3A 3VC3A 3Q3JB 3KYBA 4JR1A 2Q4DA 5J23A 1EUDB 1HUQA 1R3UA 2H1WA 2JGJA 1RTTA 2JASA 4D4LA 2P9CA 4CI0B 1E3SA 4QZVA 2MU1A 5CIWA 1TTTA 2DX7A 4KYTA 1GA1A 4L3OA 3K3PA 4MV6A 3W78A 3KSRA 1UM9B 3WLQA 5EXEA 1ZRMA 2H1SA 2DBQA 3TMAA 1LSOA 3UAWA 1NR5A 5DBHX 3VAZA 1ZOIA 2W4IA 5CBPB 4QUGA 4HFMA 3CS3A 1SBIA 2B61A 2CXPA 1KYYA 3L8FA 2W48A 4ZRDA 4F3KA 1EQUA 4YJ2A 5IT0A 2Y67A 4HNRA 4OGLA 4N7BA 2O8BA 3BGIA 3OF2A 4KQFA 4L2IB 1GZDA 1M2JA 2X3FA 1DXOA 4ZCRA 2HDHA 5IM4F 2AIRA 1T9BA 4DTIA 4GPBA 1U65A 1RABA 4MTCA 1KJYA 1LK0A 3STVA 2OZKA 3CLSD 4MPPA 5A4IS 4DIFA 4FYJA 3S3TA 2PUDA 5AVOA 5EERA 3FNIA 4F4DA 2VWQA 2I55A 2XNDD 2LV8A 1SCJA 4L8WB 1A9XA 1UZNA 2REQA 2ZRGA 3VISA 4F45A 2NPIA 2WSYB 1Y4AE 4C05A 4K9NA 3IMEA 3IKJA 1AZSC 1OCEA 4KVAA 3OU7A 1Y42X 4FI3C 2GM5A 1HEIA 4K86A 1GUAA 5AIBA 1RHJA 4UHKA 1CUDA 5C8VA 5K5EA 5JMOA 4RK7A 3SZLA 4C4OA 4R0NA 2ZT7A 4RF4A 4YRBA 1N2JA 2C94A 2WKQA 3C1UA 3I3SR 5MN6A 3COSA 3CU5A 4N8DA 2ILTA 1QJCA 4BE7B 4KR3A 2RGEA 2GPWA 4J9VA 4D8UA 3B5IA 2COEA 3K0KA 1YBAA 2HN9A 1UK7A 3KKQA 4IRXA 3IA2A 1IQRA 1EWYA 3I42A 4FE7A 2CLEB 1BAPA 1RYMA 3PTLA 4JVMA 4Q7QA 1H2BA 1NM5C 1DAHA 4YRMA 1XU9A 1BOFA 2OQRA 3A27A 3ESYA 3E58A 3JD3A 4YROA 3TNLA 1PL8A 2XCUA 1OR8A 4HNAA 3G9TA 2FZKA 2W4MA 4NZYA 1WL8A 3UT6A 4HF7A 2DR0A 4U7JA 3ZWVA 4KQ2A 1ZEJA 1LF0A 3NHJA 1Z74A 2PD4A 2JF0A 4E08A 3URKA 1LLFA 1XXHB 3SVTA 3E7XA 4G0XA 1N6NA 2QDKA 2R6FA 4LSZA 2BSXA 5E6RA 4MWDA 5I4BA 2G7ZA 1XUOA 3HA2A 3V8QA 3ZE8A 3ERCA 2JDIA 5EVJA 3LLMA 1XZDA 4K46A 1N6HA 2DQKA 1ZIYA 1ZVQA 1FRFS 4FOTA 4LWPA 2BHLA 5EP4A 3O2SB 1TJYA 2FJPA 4F96A 4IUDS 1RD4A 2FWAA 2R62A 5BWCA 2I6QA 2QOEA 4BJHB 2G76A 2NZJA 4KWTA 1Q83A 2WHEA 1PGOA 5SV2A 4IR7A 4D57A 4N39A 5NULA 4C5BA 1N7IA 3L4SO 4EAAA 2ZTLA 4E1AA 2WSLA 4L02A 4EB6B 3RYHA 1RT9A 4C1NA 3Q7PA 3U3MA 1ZUWA 5THQA 5BNZA 4NZPA 1SVWA 1F51E 4S0XA 4X6YA 3SF8A 3E8SA 3ZXUB 2VHJA 1P7CA 3CVJA 3D1VA 2XJ9A 1BRMA 1EVKA 1NW8A 3CUWA 4LJYA 1A9SA 4D5GA 5K8JB 3IS3A 3T3MB 1NLYA 2E2WA 5C3UA 3LOPA 1JF8A 4J1QA 1NVWQ 4RZIA 4TMTA 1A96A 3VOSA 1QHEA 4M1OA 1GV0A 5D00A 4CM1A 3K9GA 4KIJA 1BMTA 2Z2IA 4YXFA 3GRRA 1E77A 5BUCA 1QQBA 1DJNA 4RM3A 2JHCA 1HDZA 1WZNA 2R60A 1HEUA 2F3UA 2GYYA 3SJCA 3QHPA 3K96A 3OZ7A 2H00A 4ZI7F 2PRIA 3E82A 1IN1A 2HQOA 4IDBA 3WKAA 5DNYB 2C3UA 3R9XA 4YAOA 1P44A 3TRFA 3UJPA 3AF4A 3K1AA 3P4XA 4RHCA 2I4MA 3IXMA 4GUAA 2GCPA 2YX1A 4G56A 4X93A 2B4AA 3OC0A 3AOEA 4J07A 4KAAA 3RRFA