1S3IA

Crystal structure of the n terminal hydrolase domain of 10-formyltetrahydrofolate dehydrogenase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
307
structure length
307
Chain Sequence
MKIAVIGQSLFGQEVYCQLRKEGHEVVGVFTIPDKDGKADPDGLEAEKDGVPVFKFPRWRARGQALPEVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGTAPRCPQSEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTSGLSTQGEALPIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQLEDGKMMPASQFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase: mechanism of hydrolysis and its interplay with the dehydrogenase domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase, oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
total genus 92
structure length 307
sequence length 307
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 1s3iA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1s3iA01
1RBYA 4TT8A 3AUFA 1RBZA 5J9FA 1YRWA 1MENA 2YWRA 4NV1A 4ZZ2A 1RBMA 4DS3A 3TQQA 3N0VA 4S1NA 4ZYTA 3GARA 1RC1A 1CDDA 3R8XA 4Q12A 3KCQA 1GARA 4ZYWA 3LOUA 1ZLXA 2CFIA 1GRCA 4ZZ0A 4ZYUA 3O1LA 1C3EA 4QPDA 1RBQA 4TTSA 3DA8A 4EW3A 4ZZ3A 3TQRA 4IQFA 1MEJA 4ZZ1A 1FMTA 1C2TA 1ZGHA 1ZLYA 1CDEA 1JKXA 2GARA 3DCJA 2BLNA 1S3IA 3OBIA 5J63A 4QPCA 1RC0A 4TS4A 4YFVA 2FMTA 1MEOA 2BW0A 3NRBA 5CJJA 1NJSA 3W7BA 4EW1A 4ZYZA 3P9XA 4PZUA 4R8VA 3AV3A 4EW2A 4ZYYA 4YFYA 4ZYXA 4ZYVA 3Q0IA
chains in the Genus database with same CATH superfamily
3LE8A 4DKJA 1FQOA 1GRQA 3DMFA 1XWWA 3KG2A 2Q6OA 1M1YB 2RGDA 1QYXA 2FPXA 1NOKA 1L5HB 1X8KA 4A1FA 1AMOA 4JIMA 3WX0A 1YIOA 4YJ2B 3Q2OA 4CFZA 2P7HA 3O2SB 4PC7A 5FPQA 5UKDA 4KCGA 4PRLA 5T3YA 4D5EA 4GT1A 2ZS8A 3ZUPA 1ZHFA 1WUYA 2P8SA 3AVVA 3UQYS 2C59A 3WBKA 3ORRA 1AHPA 1JWLA 3GRFA 4ARZB 2OVFA 3TTWA 1MJHA 2FSVA 3EVGA 1V11B 4CLEA 1Z0UA 5CA0F 3HCBA 4FK8A 5JVDA 3SDZA 3AKZA 1E0JA 3A1FA 5HKAA 5DHFA 4QWWA 2OBXA 3UOGA 5EIOA 2AFIA 2E89A 2GO1A 3S2EA 4BHTA 1QVVA 3W6ZA 4MB6A 1RI1A 2HMWA 4M49A 2OAGA 3UMJA 1AKYA 1N32B 4A23A 3AT1A 1V7CA 4M46A 4KX3A 5H9WA 3IEXA 2ZR0A 4YC7A 1KOFA 1EIZA 2NACA 3TIGA 4D0RA 3IV9A 1NNSA 1V37A 5EVCA 1BEEA 2AG0A 2O52A 2UZ1A 4LECA 3TAXA 3UOAB 1B14A 4MA5A 5CDHA 3AF6A 3OTIA 4LMAA 3TD2A 3TE7A 2AOTA 1PLLA 1XZMA 2IUSA 2G08A 1ARZA 2HIHA 1V8OA 2KHZA 3G7NA 4OK5A 3WWYA 1HE1C 3MAJA 5ELMA 4CT0A 1XA3A 1YBFA 1LDYA 3RE1A 3ZLJA 4JUBA 2HNBA 4A0GA 1IAQA 1JR3E 4QOFA 5DGIA 5F3RA 3S68A 2EJUA 2RHHA 4BLRA 4XD2A 4HDKA 4DJTA 3K2EA 3PD0A 1HQYE 5L4LA 1CK4A 4MINA 1Z5ZA 2PS9A 3CO0S 3GAAA 3KYIB 1KAMA 4C9BA 4PLPA 1G38A 1SBQA 4U39A 4EELA 2FJUA 4C01A 3A10A 4G41A 3WHIA 2DFDA 2H07A 4Q3BA 2KS6A 1G7RA 2QNRA 4PLGA 1AG9A 4LRYA 4UVDA 3ZCVA 4J1QA 1UUFA 3ABZA 4R40A 5JYCA 5LMNB 2O8BB 3BA6A 4JSTA 4H3KB 5FLEX 2X3YA 4D9EA 5F1KA 3OQBA 3VISA 4BRZA 4WNAB 5DHAA 1P0QA 3IELA 4EYEA 4YBZA 2JAPA 3T9BA 3AW8A 1UFOA 4CM4A 4AS1A 1LDBA 4JLBA 1W2GA 4OXQA 4BNGA 3O8CA 2JDIA 2ZTHA 4LSWA 1AZWA 1VZ3A 3QPBA 1K66A 1N7HA 2V58A 4KLRA 5CHYA 3ZR4B 3FN4A 1VXOA 1BS2A 3G8CA 4R6XA 3DE0X 4DAEA 2PBFA 1Y3CE 3PUHA 1P17A 1C8LA 2D7JA 3S99A 1TKBA 5TJ9A 1X39A 1N92A 1N0WA 3GFRA 1JU9A 2CVZA 5JBNA 4IGAA 5J40A 4X7BA 3WAJA 1VHWA 1JMKC 2Z2XA 4TLMB 3ETLA 3K0FA 2AN3A 2GKSA 3BXOA 4OHBA 2X6QA 4GMHA 1TMYA 3DKRA 3FUTA 4Z86A 4ZC1A 3PTAA 2EF0A 3GNSA 5JJKA 2DBQA 4MIKA 1ZICA 4YRTA 5B37A 3R5JA 3TMAA 1H8HA 1KJIA 5F7OA 2R00C 3IP9A 3R3VA 5FBHA 4ZCLA 3OE4A 4CGYA 5H4HA 3UN1A 4QGAA 1Y34E 2BLNA 5J2UB 4V0SA 5ITVA 1PFGA 2H92A 4RW0A 2I3BA 1CWUA 3ORSA 2NU9B 4EEXA 2WJPA 2JW5A 4H1UA 3VKUA 1KF0A 2UZ4A 3B3QA 3A6JA 3NC1C 5E7QA 1YZKA 2N0SA 4EVIA 3MHTA 4HR7A 2Y0BA 1SVIA 5IT4A 1V3QE 2XCRB 3S1AA 1GAJA 4KW7A 5IP5A 4D1YA 3AP3A 3INNA 4G0PA 4H0CA 3TDNA 2OAEA 3VTFA 5JALA 1JFFB 3KWJA 3TR6A 3Q15C 3VZBA 5CLJA 1RI3A 2EW1A 5IJ9A 4RXUA 5J1SB 2PLAA 2BMEA 1DZIA 4LBYA 3EXIA 3O1HB 2P3OA 1RIFA 2J3MA 1TL7C 4FS3A 4ML3A 4Z8YA 3OEHD 1JFRA 4JR2A 3VXKA 2IUUA 5JYDA 1XZEA 1YJ5A 3AKCA 1R16A 2WQ7A 1Z63A 4CM4B 4CQNA 2RHRA 3EY4A 2DE0X 2GFQA 3HRKA 2WAAA 3KVVA 2HRDA 2ZSDA 3NBMA 1JBKA 4U7TB 3OZSA 1XN1A 4RD0A 5FBVB 4UKDA 2HF2A 4M98A 1RYEA 5KSYA 3KALA 4YRFA 4RCYA 2CHFA 1FYXA 3PUKA 1YA6A 2A0KA 2RHJA 2V7BA 2LIVA 3PBKA 1E4YA 2FEOA 3PENA 4I08A 4RJIA 3SC3A 3THWB 2ZUTA 1OF1A 4PIPA 3TOCA 2BRUA 4N8EA 1VJ0A 1KORA 1DOHA 1FRQA 3UQZA 4UVEA 2HF7A 2WHEA 5E1OA 1IY1A 1D04A 2YS7A 3GEIA 4CMBA 5CLFA 3F73A 3G2MA 3U48A 1K97A 2DGDA 2PZLA 2C7GA 3IC5A 5ENZA 3A58B 5BT9A 1XZBA 2WJ3A 2R6CA 3F9CA 1YL7A 4MW0A 1PKEA 1NXOA 3O1IC 4QFDA 5KIAA 2P6NA 4BKOA 3SQLA 5FJJA 2R87A 1EYZA 1VJTA 4XZ3A 1DI0A 3DGEC 4UHJA 3KWFA 3V7NA 2N1MA 3N59A 4Y2QA 1RHKA 1NUAA 3BDIA 3FZYA 5AW9A 1T1EA 1L5RA 1QSGA 2FN9A 3NIBA 1EE2A 1HLDA 4BKPA 4P3NA 3HXTA 3K4QA 2HJRA 5K0TA 3UCFA 4FILA 2LPMA 1B76A 3PITA 2V9ZA 3M0EA 1CP3A 1DJNA 4FP9A 4LOAA 4WNAA 1E9EA 4MKFA 5FFMA 4CUZA 2XYHA 1RE0A 3WZ2A 3OJ0A 5K0GA 3SF8B 3C87A 3IX7A 5KX5F 3RF6A 4JDPA 5KX5A 1E1QA 3CMMA 1RZRA 2VHJA 1BD4A 2B2NA 3VR6H 3UJNA 1GPH1 2P67A 3LP5A 1VSTA 3CH7A 2PQ0A 5ERGB 2FUG1 2QT1A 1G6OA 2QX9A 4R41A 4I5EA 3NNNA 4XAQA 4UAJA 2RB5A 2FY8A 2KQUA 3GUVA 3QNWA 5EIEA 3KDSE 3L07A 2G80A 4TV8A 1ZNYA 4WN9A 1XRRA 1JHYA 3DE3X 5AFSA 2XNCA 4G37A 1G6Q1 1YB4A 3EA4A 2KBFA 3H11A 4OMUA 5AKZA 5BSGA 1W9HA 3ZE8A 3LECA 3W7AA 3I5YA 1XD9A 2F8SA 2PWPA 1PWYE 4QUDA 3H4TA 3ZH2A 4OHZA 4BMNA 1U81A 1NMSA 3HLYA 3B8EA 4KWCA 1KTVA 4FFPA 4DYDA 2XT9A 4UEJA 3RT9A 3GQVA 4P81A 4RE6A 4CN9A 4W6ZA 1SUWA 2W83A 4E14A 2AQIA 4QJ3A 4IJ6A 1DEOA 2BE7A 2HX1A 3CUVA 4I4CA 4IXWA 1A8QA 2Q2QA 3IVXA 2P6PA 3KDAA 2IV7A 4R6WA 3DO8A 5HQ3B 5IXYA 1OVGA 3B2NA 1BOOA 1WHSB 3OF3A 2BWJA 3AW9A 1EGHA 2QMOA 3OQ6A 3BMNA 4G4SO 3U3KA 1DIRA 4QC2A 3GH1A 5SY4A 1CR2A 5THQA 7ABPA 1TJ4A 2C4KA 2WTAA 1OPRA 3M9LA 4O2BB 1K8YB 1HPLA 3IURA 2JI7A 2WFLB 3DYBA 3NKLA 4OVKA 1RQXA 4NCKA 4U7FA 1H6AA 3IO3A 5KINB 1VLLA 1DU4A 3E1KA 3CVWA 1EJ0A 3ROXA 3IS3A 2AZDA 1BG6A 1S3SA 2LNDA 1PR9A 3P71T 1FDOA 2HEIA 2ZSIA 3DZDA 3ESAA 3DEHA 5JD5A 3EWSA 2CB9A 4YRKA 4GU5A 3LO5A 3VM6A 5LXTF 4FDVA 5B30A 5FWXA 9ABPA 3C6BA 1KO7A 2QM8A 3PRKE 2JIZD 1Y89A 1U4OA 2QW8A 4W1RA 4R7ZA 3IPCA 4KACA 2LXNA 5AKGA 2XUDA 3X2EA 1WSDA 1WZUA 4HYEA 4UHHA 4Q1FA 3ADPA 4PWZA 2QP9X 3L05A 4YMGA 1XMQB 4B5LA 3DDNA 4IFEA 1UIRA 1ZA2A 1NF3A 1M1NB 3Q0EA 4HQFA 3LT4A 3OLYA 1FSPA 3HCNA 4GMFA 3TRKA 3QK7A 3EJ6A 3SICE 2YJ4A 1EVKA 1VXRA 1TO1E 4XWOA 2EYQA 4QAJA 3S44A 3V8NA 4B2IA 1U9YA 2UYYA 3TZQA 5BPHA 4M83A 4HDCA 3WYNA 4IOMA 4M1YA 3O95A 1VDZA 5CPFA 3A6ZA 2PBLA 3QI7A 4QGFA 4WOPA 1F6DA 1D4OA 5K20A 2C04A 3TK1A 3LT2A 1GRNA 3LZCA 4XW2A 1DEAA 2D00A 3QEJA 4MWSA 5EIAA 4YUVA 4RTNA 4LOKA 2QXYA 2Q99A 4K6OA 4DNFA 4HGOA 1PX2A 4GI2A 3MC1A 3S7ZA 3RASA 4BS9A 1HDIA 2JLSA 4CTOA 1TCAA 5ARBA 1A50B 5AVOA 5IDYA 3T3HA 5TB5A 1XC7A 2OHXA 3BQMB 3CUUA 3EWAA 3U4CA 3DT8A 2ECFA 4GXQA 3LLVA 4Q4CA 1E66A 3I9OA 3PCXA 4LJRA 1BSVA 4RM3A 1U6KA 3GAZA 1RVV1 4AJLA 4YNBA 4O0LA 4BFZA 3IAXA 4E70A 4G0VA 4EPXA 3UGQA 1IN7A 4IAOA 4Z4HA 3D2CA 1GTRA 1SCAA 3KU4A 3TOZA 2I87A 2XSZA 3IR6A 3TX6A 2I4IA 3G0GA 4Q9KA 5FULA 3MGCA 1CUHA 3H86A 3JZMA 4LTDA 1GKUB 3HV0A 1GXSA 1EE9A 1DWQA 2WIBA 1VHTA 3CX6A 3D43A 4WASA 5EWJA 3HB4X 3HZHA 2P90A 1AGRA 4WY2A 4BWYA 4PO9A 3GFTA 3EQ2A 1QRAA 3LBIA 1J5XA 4L8YA 2G9NA 4X45A 1GCOA 3TGWA 5LLTA 1W5TA 2QD2A 4KRYA 1O3YA 4TXMA 1A97A 4GX2A 3UNXA 2PMFA 4NCJA 5TMBA 1N0UA 4AUKA 4HXYA 1JU3A 3D0KA 1F3OA 1KVRA 2Z1NA 1V8DA 5I5GA 3NEJA 3AERB 3NWOA 3UAYA 2VC2B 5LXTA 4XPZA 3S81A 1JLHA 4IZHA 4LYFA 1E63A 3VR4A 2QAGA 4GLBA 2XTZA 3L1VA 4YP9A 4KFRA 2ORYA 2ZAGA 4HUQB 4PC1A 4FDTA 3OKPA 3EPJA 2Y0CA 3HY6A 3LNTA 4RSMA 4HL6A 3DVSX 2A9QA 3ZHVA 3R0JA 4F6CA 2HSWA 2GR9A 3EXG2 2WM2A 4ZT5A 1U28C 1VYVA 1NLZA 5HYVA 1JVBA 3KQOA 1FZTA 1T8YA 3JQAA 2JAUA 2NW6A 2WAMA 4JT8A 4E88A 3IKVA 5M3BA 2Q3BA 1AB5A 5I4CA 1SBHA 1ABEA 1UK9A 1V8PA 3GLHB 4MS3A 4EM6A 5B6PA 2H7YA 3B52X 3FYUC 2WWYA 3U7FB 4JT2A 3TW8B 1L8AA 2WYIA 4FDUA 1ODKA 5JSUA 2JI4A 2B78A 1YZ3A 3EQZA 1IB6A 3DAPA 3NV7A 4OHPA 3NOQA 4MRPA 1K0FA 4OFBA 2O3RA 3IESA 4M9UA 1ZISA 3K05A 3LHFA 1QE5A 1DL5A 1CUFA 1DO8A 1W59A 2HIAA 5D3QA 3CCBA 1I30A 5E9WA 4MHOA 2FTKE 1TAQA 2ZIVB 4WESB 2PQ2A 2JASA 3IUSA 1EE1A 3KXLA 1KAGA 4DMCA 3VBEA 3KT3A 1G5PA 1QIKA 2M98A 4MVJP 1VG8A 3T0GA 2YNMD 1SXPA 4OSEA 4PIVA 4MR7B 4TKVA 4YT8A 3U1TA 2I4NA 3RYCA 5AHRA 1GRVA 4S2UA 3WNBA 4LGCA 2GF2A 3CTMA 3FMFA 2VWPA 1AGYA 2PGNA 3IH5A 3OEEA 2GPSA 2VH5R 1RXVA 3BA1A 2HLNA 1KH3A 4NMHA 2VDMB 2C2XA 3PLAE 4ALJA 1OXVA 1FTNA 2VQ6A 3UAZA 2OHHA 3FVQA 1K75A 3GG9A 5HF5A 3USZA 4HV4A 1TEHA 5BRNA 3Q3HA 4PLWA 5CA0A 3K0CC 3LI2A 3RVMA 2WG0A 2FHPA 2XWQA 4ARIA 4GC5A 5A0VA 1P45A 4XM2A 4DMUB 4RZUA 1T0JB 3OPYI 4C89A 4HDNA 1ZO8A 3RJ5A 2F43A 3EC2A 4AULA 3G0CA 5FBWB 1A8IA 4J0GA 1HXHA 1IB0A 2G25A 5EIHA 1YCHA 2HXSA 3MWGA 3N87A 4PFKA 4R2HA 5F5NA 5K8IA 3IPXA 5EC8A 4BV2A 2F6RA 3I6YA 2GEVA 4X44A 2HO4A 5TIIA 3HE3A 1V8ZA 2D62A 1GYQA 4JLAA 3RU3A 4RHYA 4EPWA 2Y93A 2ZT6A 3N2EA 4FEYA 4HDRB 4R84A 1O4VA 4GMKA 2H06A 4AB1A 1ANKA 4RZXA 1RT9A 3ZD6A 2B1JA 3ESRA 2DPMA 4MDFA 5JH7B 1IBLB 1D2AA 1KPHA 2RGCA 2WU1A 3EOAI 3PU6A 4GECA 3OQIB 4GWLA 4JBXA 4LY0A 3TPZA 1EEHA 3D3NA 4UD6A 4ZQIA 2M1ZA 2IJGX 4JBNA 5LZ4A 2HDOA 3PWSA 5COQA 2XBMA 1RQNA 3P45A 4TKVB 3Q3JB 4MUIA 2F64A 1O4WA 1JB1A 4E0BA 1FSZA 3I92A 1A9QA 5B12A 5K2OA 1JA0A 4Q4DA 1MQ8B 3H16A 4GW3A 3A6EA 3IP8A 1G20B 4TKMA 4D6XA 5BSFA 2R44A 4L5BA 4NMWA 1F1JA 1NVGA 4TXHA 1FBTA 3O26A 4GGPA 2BM0A 3OQPA 1Y82A 2X1VA 3EF0A 4PLTA 5FLKA 3VZDA 2EW2A 3U2QA 5BV0A 3EPKA 3AF0A 4E30A 4MKGA 4AJ1A 4HKTA 4O59O 4JJGA 1H2XA 4OQMA 3QV2A 1TX4B 2GEBA 3GEHA 4MV4A 1NUSA 1L4YA 1SUFA 1XZCA 4GBJA 5B3AA 4R5HA 4RKQA 1Z0DA 2XRZA 1IN6A 1R10A 3DZBA 3OOJA 4ZZ0A 3MJVA 2VQDA 2AQ8A 4JI2B 3NIGB 3R3HA 5CDUA 4L8WB 2HMSA 2GVNA 1D07A 4JDUA 4BIIA 2V7UA 1I6KA 4JK3A 4IIVA 1Z7EA 3L01A 2M6KA 3THSA 1ZU4A 1CERA 2B7CA 1E7YA 1U7WA 2KYRA 1HYGA 1T34A 2YRWA 3LC2O 4KP7A 2H65A 1ND5A 4BN4A 3M7IA 1XEWX 4G4IA 1T2DA 1P1IA 5ECDA 2TECE 3U40A 3ZHSA 2BFPA 4F5ZA 4BTVA 1G4UR 1WPXA 5LDHA 1AVTA 4DMKA 2REBA 4HS4A 4AKTA 3PCTA 4KSCA 2AFIE 1C0LA 1NULA 2J08A 3AIKA 3LD9A 2IQ5A 4UE6A 4ABYA 4B4KA 4BP1A 2ZCVA 5SICE 2GN8A 2JHCA 2WWFA 1XVVA 3PI7A 1OKKD 1YRYE 5ALKA 1DHTA 3KYJB 1M54A 3EGXA 3GDGA 3TOSA 3ZWBA 1G21E 4ZXPA 1HDCA 2NZYA 2WTEA 4G5QA 2ECKA 2VFAA 3CISA 4E03A 3KVNA 3VYWA 2NXCA 4RTSA 2GETA 2GFIA 1AUQA 1GTMA 4H31A 2H48A 2OYRA 3JWGA 2QTRA 3G59A 3ET4A 1TGVA 2RI6A 5G2OA 5BUSA 3DT6A 3ND9A 1OLSB 4YMIA 3SYKA 2X6TA 3NHUA 3NM5A 4H7EA 4ENVA 2V9CA 5F64A 3NU1A 5TR9A 4EPYA 4E09A 3RC8A 3OSUA 4RD1A 5FCDA 3ZJYA 1G59A 1WOMA 4DBVO 4DHWA 2W2QA 1FYDA 4IDFA 5YASA 4HDSA 2PMDA 4EW3A 3TM5A 1BZYA 4LYJA 3ND6A 1AGXA 3IYLW 5A02A 1RD4A 3ZTYA 1HOXA 3ONFA 5BQOA 5BP7A 4P7GA 3FNRA 4WAUA 1NRIA 1VSQA 4CL0A 5KTRA 2CDCA 3AVUA 2QI9C 1NVVQ 1SQ6A 3BIFA 1TUEA 4XX0B 1VHQA 3FRHA 1M7BA 4I99A 5ALYA 2BHTA 1KBQA 3QBTA 3QYAA 4A2WA 4LUCA 1RBZA 2R9VA 5L3SB 4C1BA 5EJMA 1DQYA 4YA6A 4DA6A 3MWYW 3ZE6A 1C3LA 4KQ1A 4LHEA 1XNQB 4R8RA 1L5YA 4KLAA 1WPQA 4NIMA 2CV2A 1ODIA 4FJ1A 2GA9A 4QQRA 2DHEA 2OB2A 4Y8VA 2BMJA 2FX2A 3R7SA 4CU5A 2FFQA 1UWVA 4HFRA 3KWLA 4PYMA 3CR3C 1V5EA 3S2UA 4DW8A 1W88A 2BFCB 3RAGA 2YXPX 2W0MA 3SIPA 1VRVA 4F8YA 3HVRA 3TIFA 1CZHA 2E5LB 4NG5A 1TEVA 4H18A 5IT0A 3KC2A 1FUYB 3EG9B 3G79A 4KO2S 2VSFA 2P2LA 4BFTA 2HJVA 3QWFA 1U8ZA 2GDZA 2XCIA 2FYTA 1KQOA 3OICA 5K1ZA 5EJ9A 3IBGA 2HQRA 1P9NA 4G07A 1ZM7A 4MW2A 1DE0A 5DKFA 2W37A 2XUQA 3M5PA 3WI7A 4ARUA 4F8JA 6Q21A 3GWZA 4LG1A 2D6FA 5TNXA 3D6VA 3CZAA 3FTNA 1UAAA 3EVZA 3GDFA 4IX9A 1U31A 2C03A 4R1NA 3WYGA 2LCFA 2DBVO 1LTKA 3T3GA 5T57A 3DHVA 2H1SA 1OFGA 4PS0A 3CS3A 2PZ8A 2J3HA 4K9LA 1KPGA 5AP9A 1VPLA 1P9WA 2BEWB 2H1VA 1Y1TA 4YEDA 4D8YA 3CLUC 1DCTA 1YZVA 1FFXB 1JJVA 3QXSA 1EGAA 2O2XA 3PXDA 4ZIRA 2XIQA 3H2GA 2PMCA 2J9FA 4QUHA 2FW9A 5E4TA 3B5IA 5LYJF 2WA1A 2XRYA 4HX2A 4KR6A 3ULKA 1G1MA 4X62B 3BMNB 1K6IA 3LF2A 4XWGA 2J0VA 3GFFA 3IUEA 3NTUA 3PXBA 3E7PA 4OHRA 2XA1A 1NQXA 1SAYA 1DC5A 1YQUA 2B8EA 2CL6X 4YV7A 3FGPA 3K09A 4G67A 1MU0A 1DIOB 1QGYA 1TM7E 3PD7A 5EKDA 2J0UB 1LS1A 1D0IA 2OV6A 5ALLA 1HEIA 1II8B 1R9JA 2WSSA 3EBPA 3DCNA 4UCXA 3CZRA 4JR1A 1C8BA 4HDOB 4I55A 4IGEA 4N5IX 1KAEA 1A7JA 3F9IA 1U6IA 3HKEA 3QBDA 2EP5A 3IR7A 3GBVA 1EFAA 5AOVA 1IN8A 3HS3A 3C3JA 3NFRA 3QU7A 4D9CA 2CLFB 3DXZA 3ZCTA 4CIXA 2XXBA 4P4SA 2XOEA 4BX2A 2J30A 4IRUB 2NQ2C 1ADFA 1F0NA 1QONA 4JBHA 2O05A 4XIJA 2AOUB 1U3DA 3R6DA 2ZBGA 3R75A 4EQZA 4ZJPA 5DBHX 2WR8A 4JHXA 3ZWWA 1JDBB 3IIIA 5FTWA 3F98A 3BWYA 4GDMA 3O94A 1F1BA 1SVSA 1V11A 4G84A 4L75A 3W9SA 3ZXXA 3DFKA 1ULAA 2I4TA 3KQUA 1VL0A 2WMDA 2N46A 5F7ZA 4HPJB 4QREA 1DOAA 3HCWA 1T5SA 6REQB 1U7TA 2DFVA 3M83A 2Y1DA 4WLNA 2ACKA 2HPHA 1RKQA 4L02A 5AI8A 3NHZA 3T3MB 3JRNA 2AT1A 4ZCRA 3O9VA 5K8VA 3K8QA 1NV9A 1SOVA 4WLEA 4I1SA 2XGMA 1JQDA 5KYGA 2G4VA 3GLGA 2VRCA 2DMRA 4HMQA 3ZGOA 2WWHA 5TE9A 3VU8A 3E4DA 1J7KA 5HQJA 3BRQA 4CMGA 4RX1A 1EG2A 3RUDA 2HQOA 4EWLA 3CRW1 4S05A 5JWRA 1PZFA 2MR5A 4JOCA 5IDWA 3WGVA 4BO8A 2D7CA 4LJLA 5LDDC 4CXMA 4WKGA 3QU2A 5DT2A 4QYSA 3WHLA 1T8WA 4JLDA 2VATA 3C1TA 3DBVO 2W2LA 3G6WA 1Q2UA 4YP7A 5HR5A 5FUBA 2H4WA 1GHTA 2HOQA 2Q0XA 1ZINA 3B8HA 4TSFA 2FH5B 2Q1XA 2QWXA 4FYJA 3G1TA 4JLNA 4NFLA 3RWMB 3VDXA 1Z16A 3RC3A 3FNBA 2A0FA 2DH6A 2PTHA 3FOWA 4I19A 5CAEA 1V1RB 2N1BA 4LHSA 1P18A 3L6DA 3VPDA 3RVRA 1DFHA 1NYQA 1QYCA 1QH9A 3D2AA 2DQYA 2HRBA 2JFZA 1NU8A 1XZHA 1FDVA 2K4MA 3MAGA 1L5HA 3PXGA 4B8WA 2O2SA 4M9RA 4ZFNA 4Q7QA 1XTTA 4WZZA 3WG9A 4O4JB 5DLYA 2X86A 1M2WA 4YAFA 2BP7B 3CNEA 1IE3A 4UUOA 4KAJA 4L5AA 5K6AA 2YOGA 5J47A 1T2EA 1XPUA 1R8JA 1UXOA 5HMLA 5EXEA 1JVNA 1E2PA 4LVNA 1XGKA 3UWOA 3DFZA 1ZKMA 2KLHA 4A27A 3ZEIA 4M1ZA 1NYTA 4Q05A 3IKMB 3ZGYA 4DB2A 3A6LA 3ZY4A 2ZDHA 4IDOA 3G8AA 2RIRA 4JX8A 4TKUB 3ZJVA 3GRRA 3WWCA 1P0CA 1JSCA 4BXOB 4RTQA 2ZTSA 4TKZA 4C6TB 4RTRA 1I2ZA 3SOPA 2IWRA 4D9GA 1EESA 4WUVA 1GUAA 1ML3A 3DR5A 2NZ2A 3ZDRA 5CDSA 4KFSA 1YS9A 4LQCA 2BF7A 5CYGA 5L3QA 2AKYA 4OL9A 4DLWA 2XWJI 2C78A 2P9BA 4TMKA 5AW4A 3R7AA 3H9JA 4C0BA 5CA1A 2A4MA 1ZNWA 1LX7A 2HLPA 2IEBA 4O4HB 4RF5A 3MMPA 3NTRA 5PGMA 3RVJA 3QOXA 3FPSA 2I6FA 1Q74A 4QSMA 1PGOA 2FN7A 4P4LA 3DM9B 3EQ9A 5I01A 4BWFB 2X2FA 1SUBA 4GPTA 3ITDA 1K6JA 2HPAA 3G2IA 1A9XA 1H3FA 1ADCA 3FB1A 2P2SA 1DV2A 3TAUA 3KSMA 1D1SA 2BMVA 5EP4A 1CFZA 1X7GA 3WQHA 3IJPA 4B76A 3CKMA 1FNMA 1EM8B 2BZSA 2R4QA 3IV6A 1T8TA 3OT1A 2VP2A 4D8UA 4HUJA 1X2EA 3GJRA 4M8SA 4TMFA 1NQUA 4EH1A 4I1OA 3G1WA 4DOMA 1WHTA 4JYMA 1Q1AA 1VBNA 2P77A 2ZJ5A 1G4HA 2FF7A 3A1TA 2VSOA 3ICVA 1CS0A 1NG9A 1WMFA 2DUNA 3X1WA 4E5SA 1BXGA 3VPGA 3ICOA 1D2NA 4TL9A 4C0SA 1E3DA 2FMXA 1PHRA 1XJ5A 3M9XA 1K7SN 1ODCA 3ABOB 3N8GA 3CEAA 2Q62A 3MN1A 4H6PA 3K9NA 4R9NA 5FEMA 1VI5A 4O5AA 5TV2A 2ZJYA 3E9DA 3QVKA 2IYAA 3KTAA 3LQ1A 4HGPA 4GD3Q 3SYMA 2I03A 4C43A 3AYXB 1EFRA 1OTYA 1OV6A 3QNMA 4E1VA 1FMCA 2QYOA 3S2GA 3U44B 4J8PA 1V5IA 1OX4A 1MOZA 1UPUA 1J8FA 1BGXT 2WU4A 1DVRA 3GA7A 3HGTA 1ORHA 4TM7A 5DZSA 5GJVC 1JQKA 1BU8A 3WLIA 4LWZA 5CP8A 1T9BA 1KC3A 1RJGA 1WQ3A 3BMOA 3Q7PA 4Y2UA 4B3SB 2DWCA 4K28A 4FEEA 2BIFA 2UZ1B 2EVWX 4KODA 3OX1A 4M21A 3I4LA 4BY9E 4TX1A 3QBEA 3DCYA 3LT0A 2YX1A 2HA0A 5JPCA 1U2GC 4K0RA 5B3JA 4BFWA 4BQIA 1MO5A 4OB8A 3SR0A 3V1NA 4OX9B 5DFAA 1W0JD 2VDVE 3UTCA 2DETA 3DPIA 1XKTA 1CNMA 3R3XA 3WQRA 3AHHA 3G23A 1WMAA 1PK7A 2HQ1A 1YTLA 1KRHA 2A30A 2QE7A 4FIDA 1X1AA 4BKRA 2DUJA 5LD2C 3BDVA 3CO5A 2QL5A 1HLPA 1NVVR 3B70A 3LFUA 4J76A 1N3YA 1Y98A 2D3WA 3O74A 4YQYA 1T5IA 4J2TA 5B5SA 2IYEA 2DPGA 2J7PD 3HXLA 3LX8A 4HMOA 1XJ0A 5LMUB 3IVAA 3KYCB 2PKQO 3PF9A 2QA5A 1YVEI 4N49A 4BKUA 5KJCA 2F8TA 2OE2A 3I8SA 4JROA 4N0QA 1TZBA 3AEXA 3TIIA 3UJBA 5LKAA 1IPFA 3NS7A 1E3WB 2LR0A 5F78A 5A5DA 2PUEA 3D6MA 4TVSA 3FLEA 4ZK2A 3O3MB 1EP1B 4I5DA 3A7DA 3A4IA 3T7TA 2VYFA 3AV0B 3E0QA 1Z88A 3IDZA 1E5DA 5JU6A 4RCVA 4DCSA 2JLXA 2VT3A 1G2OA 2GAFA 4NAUA 1ZIXA 2F1KA 4LJYA 5IT5A 3I6QA 4HRVA 1YQWA 4DLSA 1MPXA 2V3WA 5IM4F 1WD5A 4TS3A 4GMDA 5ALGA 3OLXA 4GP6A 4MUNA 2FG6C 4HB3A 4M0FA 1W4BA 2VQ3A 4Z4QA 5BWOA 1BFUA 3AF1A 3HHEA 1BX1A 4BLWA 4NBTA 4P3XA 4A9AA 4DY4A 1URPA 3EMVA 5M7EA 2PLRA 5I7VA 3CW2A 1UXGA 1EP3B 2OCIA 4BLSA 3RLFA 1KHHA 1MB0A 2QORA 2EKDA 1T25A 1TFUA 4UDYX 5HDQA 3GU3A 4L27A 2QRNA 3COJA 1W96A 2QR5A 5EPOA 4BASA 1YZGA 1XI2A 2GJ9A 1GRCA 4KVAA 4A7PA 4POAA 1I4EB 5DNYB 1POWA 3G89A 4TYNA 3OA0A 1HDRA 3HUFA 1XZNA 2H3HA 3H1TA 1JG3A 2PSFA 4QBKA 1X7YB 4F9EA 2LKDA 2PD4A 2YFKA 1XTUA 4KN9S 3FCUB 3PRYA 3D8TA 3RO7A 4BQRA 3SKVA 3D3QA 1I1HA 3TBHA 5ICSA 3F47A 1FDRA 3HKDA 4EUKA 5F7JA 3TKAA 3A9WA 3TLJA 5J9FA 5IF9A 3BB1A 3UUWA 4O2BA 1TTHA 1XVUA 3OX4A 1X80B 2GQ0A 3SSNA 4X3OA 3PC7A 2V98A 2Q5QA 4YRDA 1A2BA 3N6XA 4PYNA 4WGFA 3D31A 1E62A 5CLLA 3O8DA 5L40A 3FZEA 4UUQA 1BKYA 1J5PA 5F12A 1WXWA 3DXFA 4G5YA 3NJRA 4D9KA 3HM2A 5FF9A 4ON9A 2BEKA 2X0JA 1GCIA 1UODA 1CYEA 1G5FA 1IDOA 4GLLA 1LBHA 4L4RA 3LYLA 4YRZA 2IKSA 1FUEA 5J4KA 1FY2A 2ET6A 4N03A 4PZZA 3ANYB 3B6ZA 4AP5A 4BNFA 5B1EA 5EQFA 2EZ9A 3CPHA 4ONEA 1SQFA 2ZI7A 3BHMA 1LA2A 3GZTB 1SXJA 4EATA 1YR9A 4MW7A 4YMHA 4JOSA 1U3CA 1U0FA 4UMFA 1XFAA 4LC0A 2PIAA 3QLTA 3HUUA 4NKRA 3PNYA 4M88A 1E9CA 2ISQA 1YHNA 2KW5A 4QULA 1ZZEA 3AMVA 1DKMA 1NVKA 4AKEA 2TYSB 1CQZA 1AQIA 3GYGA 2JLZA 2O1XA 5GM2A 4JXXA 2NYAA 1Y7HA 5ALRA 2VP5A 1W52X 1Q0PA 2Q1SA 4HLQB 4G09A 2H1CA 4Z51A 5DWVA 2FPOA 2OUKA 1R4ZA 1FFAA 1ZJ4A 2FWAA 2X8JB 1NVAA 2QDXA 1HQKA 1JXMA 3NC4A 2VKQA 4M9CA 1SOUA 4OP3A 5IG2A 5TEWA 2G7MC 3AHGA 4IYJA 3GAMA 2HWXA 3O9MA 4WNCA 3SHQA 1JDZA 1PJTA 5AUPB 4XM1A 2CJWB 1H1DA 2YQ4A 3H1GA 5HA5A 1XQ6A 4L28A 1D4FA 1P91A 1Z5GA 2HA3A 2JFYA 1QYDA 4R1UA 3MCTA 3RSFA 3UJ9A 3ZDZB 5JADA 1BYUA 5E0OA 4B32A 4ZQCB 4FE4A 4YRRA 1PG2A 3BJIC 1MVOA 2V7EA 1KI9A 3D2LA 1CVIA 1TD9A 2EJCA 1O97C 2POQX 3C8HA 3D4NA 4OGKA 1ZM2A 3TXYA 2RCYA 2X8AA 1U1EA 1EBUA 3ML1A 3M49A 3SEQA 1EWTA 3VKWA 3AX6A 3H6HA 3WGLA 5L9AA 2MTBA 4KC0A 1XXLA 3W78A 1RYZA 1Y4UA 2C5SA 5AHOA 1IJEA 3RU7A 3WA7A 2JA2A 1JLLA 4XJSA 2ZB4A 4AAYA 5DHSA 4CODB 2R2AA 3THYB 3OJWA 2LIPA 1IJBA 3KUKA 1YOBA 5CNMA 2XUZA 3HKCA 4DLZA 4LGYA 2EQ5A 2WKWA 4V0KA 1FDSA 3NCTA 5EWMB 3NOOA 3L1HA 4REQA 3NUGA 4A3SA 2O1EA 1KY2A 3IMFA 4UTVA 1IXYA 1QZTA 1YNSA 2ZE5A 4HAWA 5HJ7A 1ESMA 1QU3A 3ZLBA 3S2ZA 4ZAVA 2OOKA 5DK4A 3AHIA 1SWWA 1G5HA 2L17A 3O21A 2BM1A 5K0LA 4P32A 1H0RA 1VL8A 5JYBA 3DO5A 3K8ZA 1B6SA 4AJPA 4PVDA 1OXBB 3CGGA 5AKHA 4E7PA 4YV0A 3W05A 7MDHA 1GA4A 1W7AA 3HN6A 4AFNA 3O7MA 2K87A 3ZE9A 1WCXA 4TSRA 1DC6A 5JDCC 3GRZA 4Y1EA 4IIJF 3A37A 1WDTA 3IUJA 2ISCA 3KIPA 3PEVA 3IOCA 3DQPA 1OJLA 3F4BA 1NP3A 4HDMA 3KEGA 2FXVA 4HWGA 3GFQA 3G7UA 4MB0A 4CG2A 4ZI2A 3VKHA 4LJ5A 1U8UA 3AJDA 1XQXA 4P34A 1A7AA 1TVKA 5A6SA 1NJ5A 3DB1A 1DTWB 4MW6A 4M8LA 3TNJA 4B87A 5A9SB 1EM8A 3BCSA 3M4XA 4Z9YA 1GSIA 4EYQA 4HVCA 4OXKA 2VG8A 5KTSA 4R8KA 2GPTA 1U2QA 1GQOA 3VC3A 1XL1A 2FMHA 3GROA 3R3UA 4REOA 1Q1BA 3ETDA 3G88A 2G5GX 3DF7A 1GARA 4HH3C 4OQYA 5LR6A 1GQSA 5JANA 1H4QA 1NMZA 3TGLA 4YAJA 1LU9A 4UOEA 2YINC 3W34A 5IAKA 4D0NA 4YQZA 4E5PA 1U3UA 1RLMA 1TCBA 1YZQA 2FMUA 1B0ZA 1IXKA 1YKSA 1R7RA 2WP8J 2F3PA 3CZ4A 3MTDA 3PUZA 1LEHA 2FSHA 1Q92A 2O2GA 3KZVA 5AK6A 5J2UA 3FOEC 1O77A 5ARDA 1J09A 1RTKA 5HS6A 1P39A 2FNAA 3OPYA 2RGEA 2XYPA 1MAUA 4GP9A 4QASA 3M6FA 1RWXA 3QUBA 3UB4A 3CNHA 4WBSA 4RA6B 1R8YA 1E79D 1E3IA 2P5UA 3V4PB 1LPBB 5CTAA 3AZQA 3N75A 1AS2A 2HFJA 2ZBFA 4XVRA 2GEFA 5T67A 1W581 3VR2D 5A06A 1MV8A 1NI3A 1SBTA 1KZ1A 2ZR9A 3FLBA 5I3CA 3QEAZ 1AN9A 2IS4A 1AUOA 1SG6A 2V1XA 4PYJA 3OETA 2QGZA 2GXAA 4KYVA 1ZITA 4TVKA 3AY7A 4AZTA 2QUZA 1T0UA 1ZMXA 2D59A 1P3DA 3K5HA 1ITZA 3PUYA 2RKWA 1Q0QA 1XJQA 4K9MA 2HU2A 1G3MA 3DKPA 1ILWA 2VWHA 1Z2PX 2O7VA 4DTIA 3PK0A 5AVSA 4B0OA 3JALB 2D2EA 4QUBA 2PT5A 1VCMA 1DBSA 1ODSA 1M6NA 2B5WA 1J6UA 1KMQA 1X8LA 4LHXA 3QPDA 3BD6A 4JLOA 1KSJA 2BDUA 1C81A 1VJRA 2JH9A 3OZAA 2QE7D 4TUYF 3PFKA 1OX6A 1ZEMA 4QE3A 1ZNZA 4OLFA 3UPDA 4OV6B 3STWA 5HFJA 3FNGA 4MVYA 4XQCA 4Q1AA 3C7CB 3GK3A 5H83A 3WXBA 4K40A 2Q5OA 1E1YA 2WYWA 5JCXA 2JS7A 2MT9A 1JFTA 1GSAA 4N8SA 1B6RA 1Z73A 1R0ZA 2HQBA 1Y0BA 3OD1A 4M1WA 3CURA 1YQTA 3X3HA 3SEAA 4N6OA 2WTMA 2ZANA 3LUGA 2RGXA 3UT5B 3A04A 2ATIA 1O5IA 3DL4A 4XYEA 4N7RA 1W6UA 2WF9A 2IU3A 3DC7A 5K3AA 1MB4A 1KA9H 1S8OA 2WICA 1WXIA 2B61A 2RGWA 2WJ6A 1KDRA 1FLVA 1LQ2A 2ZZMA 2OZEA 1N6IA 3OLCX 1J5EB 2AMLA 1IZ9A 1SELA 2D13A 3FE2A 2ZIZA 3RR2A 4Y9DA 3KJIA 3VNSA 1O0BA 1UXJA 5AVUA 3KSUA 1FJXA 4CR8A 1L5MA 1MQAA 3A32A 3P26A 1GQFA 4LVUA 4DV2B 3CXUA 1E8MA 4JP5A 2HYIC 3NRBA 5JZBA 2IITA 2C1ZA 3HWX1 1A4XA 16PKA 4DEVA 5KO2A 1KMCA 4L51A 1LPSA 1NXSA 5AI6A 4NY1A 4MO2A 2C92A 4E21A 3WKEA 2OILA 3CJRA 3WSVA 1Q7BA 4I0WB 4KDFA 1Z7WA 5JNRA 5JFGA 1J2EA 3WO1A 3GFVA 4PNEA 1TT7A 1UBKS 3MCVA 1OUMA 4RLQA 4PINA 3SYLA 1EA5A 1QIHA 2XRMA 3JAWA 3MVEA 1OYYA 3OCJA 4MP3A 5F51A 1N36B 1RHMA 1Q0RA 4IS2A 4E46A 1OAAA 2VHCA 3SHWA 4P38A 5JNVA 3KHTA 1XXHE 1OCEA 1OFIA 4TS1A 2Z2YA 3WLHA 3C6ZA 5E8RA 5CFNA 2IP4A 3AJ9A 1Q1ZA 3HVJA 1E5VA 4J1TA 5C7OO 2QRVB 4GOXA 4NABA 3ROZA 1T9AA 3DS8A 5TMDA 1JDNA 1YB5A 2VDOB 2D0PB 5DXJA 1TJ5A 1MB3A 1VLMA 5BWNA 4ZVUA 4Y6LA 1O94C 3GLKA 4O2RA 4QGBA 3WFIA 5KREA 4OKIA 2ZJOA 2BSAA 4EG4A 4DR2B 4EP1A 4IZOA 2YRXA 4I4NA 2EARA 1W73A 1TPZA 3AEKB 2IDKA 2HWYA 3PIDA 3VPCA 2MSEB 4DC1A 4EJ0A 2JJ2A 2GARA 2H17A 2RHWA 3K9GA 3MRTA 5LD2B 2Q1YA 4ZCSA 2I7TA 1KFBB 3ZXSA 1GFWA 4G5OA 1E1RA 1ORRA 4YREA 3ZWOA 3DUFB 1EVJA 4LNHA 3NQ41 5BN5B 4EW2A 4KXFB 3L1JA 5DP1A 4B3RB 2CMGA 1DC3A 4NZ9A 1MB2A 5FYDA 2ZS7A 4HNRA 3T6KA 2Y4OA 2G6BA 2W48A 1U2SA 4BNHA 5JXHA 2WUFA 2WNSA 1LNSA 3C5EA 3RLIA 3JTEA 2OHFA 4BVKA 3R7DA 1N2GA 1XLVA 2AEMA 2B8JA 2WINI 2WIDA 3MPOA 3MD9A 4CV2A 3LFTA 4DLUA 3ANXA 1E18A 3MT0A 1VJ5A 2WZCA 1Z38A 1SQGA 1B41A 4X6XA 4Z9FA 4EHDA 2G6TA 3SKYA 1MD9A 1PZEA 1SPBS 5SYNA 5D86A 3I5XA 2PZFA 3FPCA 4YMTA 2ANBA 4JJ8A 3B2QA 1WMSA 3I9V6 1Z2OX 2Z3VA 2OYCA 3K35A 4BFUA 2BGJA 1NF9A 4JJKA 4WVFA 1RI2A 5HOEA 1H4SA 1YR8A 4O8ZA 5EZ5A 4B31A 5IRCD 3QLUC 3V80A 1QHSA 3SY8A 4MWBA 3R6WA 2FRXA 1UT8A 2FA9A 1DRJA 2IHTA 1BFKA 1KYVA 3IBTA 3JWIA 4GSYA 4I2VA 3ZW8A 4FQ8A 3O1LA 3HKBB 5LQUA 3VNUA 1D09A 2C4HA 2WZBA 1ZJJA 3NTQA 4G0YA 6ADHA 4B4VA 3KQWA 4RFSA 2ZRPA 4IXMA 5CCEA 2VVTA 4OOFA 5AM0A 3L93A 3E35A 3TFOA 4U7GA 2Q3HA 2CL0X 2VTKA 4BJHB 1I01A 4EITA 4RTOA 4X6UA 3PYMA 3B1WA 3O4GA 1IHPA 2A67A 4LW8A 4ER5A 1V16B 4RY8A 4LBVA 1DGQA 2XDAA 1P4GA 4CZ2A 2EZTA 4HBGA 3VSBA 2W2KA 2ZRQA 4FB4A 2OO3A 2OVBA 3FH0A 2GJ4A 1RXWA 2DSTA 5K6RA 3VU9A 1KY3A 1SQ5A 3EDCA 2BKEA 2OC4A 3G85A 4ARAA 2E82A 1X7ZA 4E08A 1T3GA 4TTJA 1RI5A 1UINA 2C57A 1KVQA 1HMYA 4F4IA 4KQKA 5CVEA 2G82A 5JUWA 2J9ZB 4HDKB 4YRPA 4UPEA 4F4FA 4Q4HB 1DO0A 4HT3B 3NNSA 4QZVA 2XXJA 2ZJ2A 4RTPA 1OH8A 4E1AA 1ZSVA 3K6JA 1I33A 2CMKA 3B36A 1UJ6A 3ZCRA 4J4TA 2F62A 1A5BB 3DAOA 1HDGO 4LSGA 5IMBA 4FJ0A 3TSAA 4B5KA 1J39A 4B3JA 3C85A 4HNAA 3F5MA 1GIAA 1MC4A 1ULBA 3HR4A 4JVSB 4ACBA 2JBHA 1DAFA 1QHNA 3URKA 4H7JA 1QAQA 3GELA 3F6BX 3WP0A 1G66A 4BLVA 4G26A 2YDYA 5MF6A 2NVOA 3GT0A 3VC7A 3PPXA 1QLHA 5T64A 4B3FX 5ISMA 2E7ZA 2HCTA 2Q29A 5G4KA 4X1IA 4B74A 2VDKB 4UUPA 2XBLA 3DMRA 3HDTA 3HUDA 4KPUA 3EF1A 1R1DA 2Q6LA 3I01M 3CH5A 2MSDB 2WJIA 5KWJA 3WMGA 1CUDA 5DE3A 2CT8A 4KPYA 1W30A 4M1KA 3TOXA 4YRIA 9LDTA 4KIWA 1YZTA 4F86A 5D8DA 3FKJA 2ZJ1A 4GGOA 4AG6A 4I6GA 2C9OA 3AR2A 1GCAA 4FGWA 4J4BA 1EP2B 2B5VA 2HA6A 3TNDA 4QG7A 5JD4A 1V9SA 4ZKEA 3WOVA 5FL7D 4EUHA 1F7UA 4A82A 1JNXX 1TAGA 4KIJA 1LI5A 1N1MA 1K3UB 5KSPA 3KDPA 3MIZA 2GTIA 5AVXA 2QBYA 4WIAA 1II9A 1YRAA 3BK2A 1U99A 3ORQA 4Y0NA 1GVNB 1IPHA 4F60A 1SHZA 3Q3IA 3FFBA 3GD7A 5IJZA 4WGGA 5BVHA 5LIPA 1M0SA 4MSUA 4NJMB 1SOMA 4YX9A 5K05A 2IUTA 1CZNA 2O3JA 3A3YA 3GXOA 4AP6A 2O8EB 1VJCA 4RA9B 3OCWA 4O1MA 3OIWA 3BB3A 4RK7A 2NYRA 1G2PA 2Y67A 3TLXA 1C9KA 4CIBA 3BXEA 3DMYA 2HTFA 4M9SA 4JBIA 5DULA 1VHLA 2H08A 4GPEA 1BHO1 3CB2A 3TUJC 2WHPB 3CF0A 3L7IA 4XUDA 5JH7F 4JX9A 2QRKA 2VJLA 1QDLB 1KIMA 1OC4A 4FTWA 1ZL0A 1I7NA 5GV7A 5HCIA 1Y9AA 2FFRA 2J5RA 5HMMA 3VRHA 1X92A 4CRWB 3A0UA 4DJJA 3NHBA 3OCVA 1L7BA 2BP7A 4MVJG 1EUQA 1V43A 4BE7B 2YV4A 3SZUA 3CZPA 5J2TF 1SCBA 2OGSA 3AUFA 1K8ZB 4HPWA 1VG1A 5HIMA 1TMKA 1VL5A 1QKJA 2O7NA 2VUSA 1WWKA 2MIIA 3K1ZA 5CIQA 2HWKA 3D6AA 5EZYB 1Q1GA 1OH6A 1F4PA 5CBKA 1QAMA 6REQA 1N5DA 2LDBA 1Y9EA 3NW9A 3PKIA 2OFFA 1PWXA 3QUSA 4C30A 2W6CX 7AT1A 3W5AA 3P8ZA 1XXHA 2WD7B 4BC0A 3BSFA 5C9ZA 3U4HA 3U7QA 3VR2A 1LSJA 4WLVA 5I4BA 2CJYA 4Y6SA 4ETWA 4KQWA 5TDHA 3AUXA 5DYTA 3I8XA 3IPAA 3KKPA 3ZDBA 4LXQA 1A2OA 2ONZA 5ITSA 2ACWA 3SF8A 2V9PA 3GGPA 1RHRA 2JGJA 1C4OA 4LDAA 5CD1A 4KQ2A 1KBZA 3M4NA 1PJLA 3C6YA 1LLCA 3O8OB 4DYVA 5E1DA 2IZ1A 1E1KA 4EFMA 2VJMA 1YJCA 1UBTS 3IRVA 4IDHA 3MUEA 4Z3DA 1KJ9A 2IU0A 1WM1A 4C0WA 2IYVA 2EZ8A 2FP4A 5FADA 1CR6A 1LRKA 3G8YA 3H5RA 3WTBA 1ZH6A 3FBTA 4IV0A 3LDHA 3AK4A 4P83A 1H9BA 2JI6A 6NULA 4AWXA 2PY6A 1K86A 1QG2A 2WE8A 3KKZA 3NHKA 4YDSA 3BQ9A 2I66A 3ITNA 3NZEA 4E2FA 4X20A 1OZFA 2MYNA 2NIPA 5FR2A 3MCUA 4WZAE 2AKAB 4TMWA 2J0EA 3R5FA 4D9FA 1WKVA 2ZB3A 3ILXA 2J46A 1H42A 3VHXA 1UPCA 1NM5A 2JD1A 1PZNA 1GZDA 1FBNA 2QTMA 2P5YA 4ZEXA 1AKEA 5BSVA 1QK5A 1X38A 2GDJA 1GL6A 2OUIA 3OKFA 1JJ7A 3HP4A 2WWWA 4OUDB 1KSGA 3RBXA 1QQ7A 4B7UA 1W4ZA 2H85A 4J7UA 4CIWA 2YHSA 4DIUA 3WWPA 2YXNA 4YAGA 3LC1O 4Z4GA 4DWWA 3FGNA 1QCYA 1W1WA 3HCFA 5DBIA 2AS0A 3UO8B 2DULA 1MA0A 1JAXA 4PNPA 4E31A 3INGA 4J16A 1W4CA 4Y1GA 2ZSEA 1MCZA 1GGEA 1JFVA 1OKKA 2JFHA 1ORVA 2NU6A 1LS6A 1ZWLA 2XNJA 3PFWO 4EGQA 2XUHA 4BNLA 5BYAA 2ZYGA 4FGZA 1NI5A 3BGOS 1GKYA 1OILA 7YASA 4G5HA 1UC5B 2AB0A 3RC7A 2PUTA 4ZRMA 1RABA 2O7SA 4RELA 1Y1KE 5TVKA 1MJFA 1RFLA 2PEZA 3BERA 3RUEA 4V2UA 2PYIA 4DSOA 4CEJA 2C7VA 1WQ4A 3DHEA 4OLAA 4XLTA 5A6VA 4PZ9A 3L49A 1JIUA 2HZBA 3LX6A 1FFBA 1TUGA 1RXYA 3NO4A 3R6LA 4HDAA 4HSGA 1PEAA 2YMLA 3EA0A 4JD5A 5F76A 3U16A 3TQFA 3QX8A 2O2YA 4Z7NB 4H7IA 4BXOA 1ZH2A 3AQ4A 1L4MA 1ML4A 3MTIA 3SHVA 1YI0A 4ZCTA 1HF3A 4UZFA 4JFRA 1LV7A 3U31A 3IEMA 5F2NA 4X61A 1JHRA 1XJCA 4PZYA 1T9ZA 2ZWIA 3QM1A 4IL5A 4HZUB 3VHLB 1R6VA 4HBZA 1GT91 1G8SA 1L8XA 4U02A 1XNJA 3N8NA 3ZNPA 4HTFA 4GQIA 1QVRA 4L8GA 4KSYA 2OKCA 4J0JA 4HVAA 3LPCA 1N33B 1QO0A 3DMPA 4YP6A 4BX8A 2JD2A 4RGQA 1NVXQ 4V39A 4I9NA 1CJVC 2GWRA 4WXPA 4R8SA 2VP9A 4OA8A 2NG1A 2AD1A 1Y1LA 3A1CA 4YAUA 3JAMA 2PKCA 3E1GA 2BFOA 4TS4A 3E05A 4RGVA 2AR7A 4M0PA 1I3OA 1WCIA 1TF5A 4QYMA 4WXHA 1XPRA 2CWWA 3K70B 1RM4A 2V3VA 2IPNA 1AF7A 5KNDH 1LDMA 3V4LA 4EKIA 1XLTA 2QRHA 4MVJD 1SCIA 4RZIA 4X8OA 4YPOA 2ZUSA 3E27A 4MLCA 1Z4OA 2WZDA 3QF4A 1BEZA 4RVOA 3UJCA 3CRVA 1KZGB 3UK7A 4AT1A 1VKHA 3C6XA 1CUSA 1C29B 1D6JA 3ETGA 2HO5A 3KFVA 1ZMRA 3OURA 4W8GA 1ZAYA 4YROA 1CY6A 2R47A 3S5UA 1TQHA 1FEZA 3K8OE 1RPJA 4NPAA 3T35A 5LMZA 2ILVA 4D9MA 3PGJA 4BB0A 2DKNA 4OP1A 4ZZ1A 3M6UA 3QXGA 1UDWA 3IMKA 4RV9A 5ERXA 1EVIA 4QYWA 3Q2IA 1FUKA 2EDCA 3SQOA 2OCDA 5PNTA 4I4LA 1LKZA 2PAFA 8ABPA 1IH8A 1V3TA 2BBWA 1ES9A 3OCYA 4JWTA 1FCJA 1L4FA 1LD3A 1VP3A 1QIGA 3N0WA 5D01A 4S1TA 2P2ZA 5SY9A 3WISA 2RKBA 2DPYA 4RH1A 1IXSB 2F8LA 4XIFA 1W49A 4W99A 4G4JA 3JAWB 4I4IA 4QXPA 3LLMA 4QDJA 1OGIA 4G36A 1E6CA 1KPIA 1TO6A 2GYVA 3I72A 5FV7A 2O48X 4ZEOA 4N7BA 2QTGA 4F3YA 4WFQA 3I58A 3NOXA 5CEFA 4UDOA 4ATNA 3BOSA 2DBZA 3P52A 2IY9A 2CWDA 4C4YA 3WB9A 4I9UA 1KHTA 1Y7PA 3JPWA 3U4MA 5DW3A 3DNPA 5CW1A 1NTRA 4OU4A 4P5EA 4PE5B 2DWOA 2QX4A 1R6UA 1WABA 2H18A 4Q93A 2I1LA 4A8HA 4WWHA 3N6RA 5HIJA 1RKVA 4GI1A 3I2FA 3STUA 3F1KA 4IXDA 4W9NC 3UUEA 4QEZA 1R5NA 4B44A 2PUJA 3PGLA 2PUBA 1V8BA 4PIMA 3HRIA 4G56A 3RV4A 1P1CA 4O2BF 1IN4A 4GZ6A 5JYEA 4KYUA 3F8TA 1LPMA 3HKEB 4LHVA 4Q3OA 3U6BA 1E2EA 1XTSA 3HJUA 3IULA 1NZDA 2XB6A 3PC8A 4J1NA 4QU9A 4D5GA 2CFRA 2BFMA 1R8QA 1IUOA 1NA5A 2OV2A 4MJ3A 4I46A 2IYTA 1SU7A 3DNMA 1KRWA 1G3QA 1BMTA 3UT5A 1QYRA 5KMGB 3EAQA 2IIVA 3W2EA 4P0QB 4MHTA 4BNVA 3HO8A 2BH9A 2I9KA 3HBAA 3ZV4A 4Z3OA 3R40A 1I1NA 2I3AA 3ASYA 3LWBA 2XMQA 5EINA 2IEZA 1JALA 3T9FA 4BVLA 1OASA 2PRIA 2HPZA 2X76A 5H4GA 4PHHA 4YJHA 4DQLA 1G19A 5LL6P 3B51X 1M8PA 1GTSA 4G86A 2QTVB 1WCIB 1BJRE 2JLRA 2DQSA 4M6WA 4B9EA 4E3WA 5ABPA 2Q0HA 3PGXA 4I50B 1ESZA 2NO4A 3JQBA 1JF8A 2F17A 5C8VA 1YTUA 1QH8B 2CHVA 2SCUB 1W76A 3LK7A 4KXQA 3KB2A 1A71A 2NQ8A 2OPHA 3K6SB 3JARB 1P44A 3GLFA 1LJ8A 1L4EA 2W6MA 1C7ZA 3WLQA 3IERA 3NHMA 4RO0A 13PKA 1UAYA 1KEKA 3LCVB 7REQB 3QFCA 3PHBE 1AQYA 5DRTA 1VSVA 2LDXA 2R60A 5DYGA 3ZKWB 3Q6NA 1W8DA 2H0AA 4OIMA 4U6QA 3ZBTA 2J6BA 3VZRA 5BR4A 5EXXA 5A9RA 3OPQA 4BGUA 2KBEA 5JAHA 4AURA 3OESA 2FMIA 4ZZIA 5HJEA 1XTJA 1XROA 3IP5A 4MVJH 1EX9A 2LUOA 4FGSA 3W79A 2QE6A 3IT1A 1SK8A 4FFDA 4F2DA 4IGIA 3KYDA 3UBMA 1NBIA 3E22A 3LYUA 4KN8A 4F6LA 4P35A 4F8EA 1CUJA 1PBTA 1BA2A 3LXUX 4Y1RA 4J0QA 1ONBA 1T8SA 1Y8AA 3QXXA 2I4MA 2TMGA 1C1XB 4UULA 2BF4A 3DBRB 4ECAA 4I5FA 2BR4A 2REQA 4UEQA 5ICFA 3VU1A 3ZZ1A 3EPLA 4DVGA 5LBUA 1B23P 1RCUA 1ACLA 2X4LA 4GR5A 1AQJA 2BEJA 1RBYA 4OJKA 2OCBA 3S6JA 4DCNA 3KHSA 1SIOA 4X93A 3DV0A 2PBRA 3KB8A 5DYNA 3P9QA 4FN5A 4EPVA 4YONB 3PWKA 1Y7LA 3FA2A 1E2GA 1J22A 2AZTA 3AL2A 3KR9A 4ZQGA 4D3ZA 3E0XA 2Z6AA 2ERXA 3GEDA 4LRSB 4PX3A 3DZFA 4GYWA 2PT6A 1P5RA 2AI1A 2ODWA 3Q41A 4FGLA 3TDKA 1Z33A 1H5QA 1O57A 1N2ZA 2EHJA 1DIHA 1D0SA 2R86A 4IO0A 5CRIA 5EJ7A 4AMYA 2GCOB 2ZPAA 4BCDA 1FTWA 3DYIA 1OI7A 2XMBA 2QLFA 4PM4A 3SP1A 4OM7A 3FD8A 3K0KA 2PL1A 4XD7A 4XQ0A 3H75A 3ZWPA 1Z5OA 2GO7A 1LSOA 2JCVA 2AYXA 4XEUA 4AUNA 4E5UA 4F56A 4U2CA 4JYAB 4BBJA 4F5EA 1DS6A 2I7DA 2P2GA 1W46A 3I6IA 3OQNA 3E9ZA 4IQ4A 4U7WA 4RCZA 5BN4A 5C7IO 1HETA 2DECA 2JGKA 4OYLA 1E6MA 3TVTA 5E0KB 3VJKA 3L84A 2AK2A 3ZXIA 4MTCA 4OGGA 5SY6A 2O2HA 4RLHA 3VDQA 3RG8A 2OD7A 2CLEB 3ZIUA 3PEFA 2NZUG 1P74A 2BFDA 2WB2A 2CXXA 3VGJA 1X1TA 1Y3FE 2HREA 1U2DA 4V0ME 4IS3A 2CVOA 5CJJA 1VLJA 3WLPA 1QOQB 2D1QA 3BIWA 4HSEA 3FSRA 1WV0A 4KPGA 3NKVA 4HYQA 1CEYA 3IP7A 3QV1A 1E6WA 4UU8A 3WK6A 3C8MA 3ZDFA 2V97A 1WLSA 2QMYA 1O8CA 2QOEA 2MMGA 1YRQA 3BWVA 1VYUA 4N6NA 4XPIA 2KJQA 2DTXA 3KP1A 1VSBA 2XMPA 3W2TA 4EB0A 2BJWA 4KKVA 4EZBA 1YDFA 3GUZA 4UMVA 5I7HA 3KJZA 2QAJA 2GN2A 4V0RA 4EKYA 1Q7CA 2EP7A 4HI0E 3SC6A 1TYEB 2ZREA 5K3DA 5TF0A 2XUOA 2QPLA 2UVDA 2JGDA 3ASUA 3A4VA 1RC0A 1RJ9A 2EP8A 5ALIA 2W8BB 5JQGB 1HDYA 3LGSA 1Z6QA 1AM4D 1C5KA 3ODPA 3DLBA 4W1QA 1SU6A 2YXEA 4K6GA 5LA6F 4JV5B 2E5WA 5I5EA 1NVDA 2ZCUA 1N1DA 2PVSA 4CLOA 2MYPA 1P8JA 1OI4A 3M6AA 4LJ8A 4CN8A 1DDOA 1UCFA 2OD9A 2X8BA 3SQDA 4DMHA 1BHJA 1W93A 1YC5A 2V6JA 4P9NA 4YUAA 1ZPDA 3BMCA 2IHZA 1TO2E 1W94A 3CBQA 4GI5A 4AF8A 4BATA 1BWPA 2C4TA 4Z0PA 2HNAA 2Y68A 4LQ4A 4ZO8A 1Z2EA 4WBNA 5AVJA 3N2NA 1PJQA 3NUZA 1XN4A 4JAVC 1H3NA 3HUEA 3EXEB 3OLZA 2ZG6A 4PLHA 1Z0SA 3L0SA 4NBWA 1IHDA 3HFRA 1KDYA 3RS2A 4ALIA 3VH1A 3CPJB 3PFNA 4BUZA 2BKAA 3SJCA 1E20A 2E4WA 4UXHA 1JDVA 1QO7A 3EZ7A 2G72A 3KLMX 4XARA 1GNTA 3F9RA 3LPNA 4TPKA 5JDCA 1E32A 3EHDA 1JFSA 3AHFA 2JPDA 2ZYVX 1AN0A 3IQDB 4CDMA 5C5DA 3TRFA 1M1XB 4Q03A 1SC3A 2HHAA 2Q49A 3E3LA 3H9GA 4OK3A 1P4HA 1U1CA 1UC8A 3M6LA 1QTRA 2XY4A 4PONA 3ZUGA 1AO3A 1FLNA 1HNNA 2IPXA 4UTZA 5GMOA 4YAKA 3NHWA 1UJCA 4QRDA 2XV1A 3WV4A 1QR6A 3MB5A 3TS1A 3WIEA 2GM9A 3T9EA 2FR8C 1P4AA 3HB0A 3CWCA 1L5GB 1TJYA 3COSA 2REQB 1PNTA 2IEYA 2A5JA 3QU4A 4XGKA 4AJNA 2QX8A 5CJPA 4DWVA 4EYGA 1MR3F 1E9SA 2M32A 4EUSA 3PLNA 2PWZA 2J9RA 3A27A 1XLTC 4CU2A 3O2QB 3I1FA 5CMLA 1DG3A 2N9UA 4QUIA 3AP1A 4KVGA 2O50A 4MGZR 2QM7A 3D02A 4D4IA 1IQRA 2QMEA 2NU8A 3H1BA 3WJ7A 1JXQA 4NZOA 3HPQA 4QUEA 5KB3A 1I4LD 3ZY5A 2Q3JA 2RHTA 3NVAA 1G9SA 4DMGA 4RHUA 4DG9A 3FDZA 1WHSA 2AE2A 3LT5A 3OIYA 2W2PA 4Q00A 1Z4MA 3W04A 1TF7A 4JMLA 2I3ZA 2D1YA 1JKXA 1Q1NA 2B2XA 4D74A 1H5NA 1JR3A 3TQTA 4PYIA 1TVCA 4UU0A 3W5JA 5E3JA 3UWPA 1KYWA 4ZT7A 5B3JC 3BSSA 1DKRA 1X7YA 2ZIFA 4G65A 2ODBA 2PPLA 4JEUA 2AXQA 3SS7X 1YFLA 5JJIA 2OHIA 2ZBUA 2AGVA 2GASA 4P4NA 4RENA 4RVHA 3IBSA 4GXRA 1OZAA 2NO5A 4KGZA 4WE3A 2VQSA 3TFWA 4FFNA 3VUFA 3L1UA 1QGOA 4LIPD 4Q02A 4EKNB 1X70A 4GKKB 1BHQ1 4IDQA 4HLUA 3JY6A 2OXFA 2FDCA 3H17A 4MV5A 1OLUB 5E6SA 4RKEA 5FHRA 1G17A 2GCPA 1F60A 4BEJA 4DCUA 4DA9A 5IBQA 1UBCA 4EO4A 1PJ4A 2CUTA 2HCRA 2RHGB 1NDHA 1Q14A 4WJZA 2BL4A 2FPRA 1X2BA 1OA0A 3O8NA 4R9VA 5HKBA 2VP0A 2H1OA 1N5IA 4WMLA 1U0GA 4GAEA 1JR2A 3BJEA 3THRA 2AK3A 3P4XA 4B7CA 1KQFA 4PC2A 1EK6A 1C9DB 2JJ1A 4NEQA 4QDXA 2Z2JA 3H5LA 1U8YA 2H31A 3DP9A 4HEA1 5JSKA 3W77A 5D3KA 4WBNB 4A03A 1X3LA 2P3QA 5KPJA 1UBGA 4JKIA 2WIFA 5B7PA 3NUQA 3IAFA 1WXQA 3LLUA 2X0IA 1AZLA 1WB5A 1Y3DE 1T0BA 3LQ4A 3R4VA 1RYDA 4HD8A 2WSYB 2YXBA 4H7PA 1MXFA 1QHEA 1PQPA 1TZ2A 3LYHA 3M3PA 3QKTA 1SD5A 4W5NA 3AEUB 3C7AA 3NX4A 2LRHA 4OIFA 4W82A 3EH2A 3I39X 1U0RA 3P0IA 4RIFA 4JP3A 3UF0A 5LC1A 4EARA 1ND6A 3H2SA 3M2TA 3QF4B 4KL8S 1ULTA 3UCXA 1KEPA 4RZ2A 1JGTA 5I7UA 3KQKA 3ZWKA 3T5PA 5LQDA 3QFFA 1AKNA 5LVAA 2PKYX 1N2SA 3ISJA 1P77A 2PJDA 4HWTA 4X63A 1EK0A 1XCLA 1G21A 1TDJA 2VDWA 3PQ2A 1ZGGA 4X54A 3WFJA 2TMDA 4DVJA 4KXXA 3JU3A 4OB6A 5CT8A 521PA 5J1TB 5ALNA 4YUWA 4CTKA 1O95A 4ITVA 1ZFNA 5CDGA 1LB1B 3EYWA 3O4IA 4LMPA 3RVDA 2Z2ZA 4L85A 4MWGA 3SX2A 2XTNA 2VDPB 3OPNA 4XVHA 2ZB7A 2QJRA 4B17A 5AJUA 4F3NA 4DWJA 5E95A 2R1VA 3G9ZA 4QPJC 3HCEA 2OGTA 4ZO9A 3RKRA 4FYVA 1H65A 1QF7A 1EWKA 3OECA 2CLMB 3S29A 1QV7A 2O4UX 2FMKA 2PT7A 2MWMA 3H99A 4TTTS 2B4RO 3FHTA 1CT9A 1IY8A 2XTAA 3IHLA 4LY6A 5K6AC 2PGJA 3H6GA 4W8HA 3H2ZA 2V6BA 3L6CA 2R1UA 2GM3A 4UE2A 4DM4A 1WDMA 1SA0A 1F17A 3ST7A 2GF9A 1WIWA 2OB1A 4XUCA 4ZVKA 2Q5HA 4R0NA 2XXAA 4K8RB 3ZDQA 4DIEA 5JC8A 2ZVPX 1P7ZA 1V4NA 3DJFA 3RT1A 5ICCA 5INTA 2CVFA 2ID9A 4D57A 3AR3A 3IQIX 3FWKA 5EAIA 3X1MA 4AO8A 4DUZB 2NU7A 3UA4A 5I8PA 4LRWA 3IE2A 3JVVA 4LEIA 1IQ0A 2QX7A 2EIXA 1KP9A 2GCOA 4MI6A 1YZNA 3SHFA 3KNZA 1A04A 2C5AA 2Q27A 4LMBA 3UG7A 4HNHA 1GRRA 1QHYA 4F5WA 2ODTX 4AN0A 1EFVA 3EEOA 3V46A 1XVAA 1UPTA 1OLXA 2ZYWX 3NIWA 4LE2A 3E3MA 3EGEA 1IHXA 5KTKA 2HGZA 3H2BA 4YRJA 5EIWA 2IHBA 1U9IA 4CDNA 2QN3A 2P40A 2GKGA 1X1CA 2CNWD 2HU8A 1HYQA 2NNLD 3KJGA 3CW9A 2FWNA 4M36A 4L22A 1DRUA 1S9DA 2BJHA 2MDTA 5DNVA 4YWJA 5KAPA 3WOHA 2BRUC 3K32A 3L04A 4RMNA 1P1HA 5KS2A 1CF4A 1MQSA 1U8FO 1KNQA 2FZCA 4JT9A 1UBRS 3A9RA 4LRQA 5EWLB 1U0TA 3F6EX 4Y9SA 1ONSA 3VOBA 4DMRA 4MR9A 5KZMB 2XR1A 3NONA 3IQFA 3SHOA 2ES4A 4BO3A 3LHKA 2C5BA 3FFWA 2OXIA 2ATVA 4RTKA 1X74A 2JVKA 2IV2X 2UZAA 3C5WP 5JCOA 4II7A 1JTFA 5AUNB 2FEMA 4V3BA 4C22A 2XZDA 2WMNB 3IVMA 1P19A 3K8YA 2ZUBA 2GJSA 3LUBA 3M1YA 1HT3A 3P9YA 1AK2A 4Q6BA 4B3XA 4C88A 4CLDA 5GQSA 1KI8A 2ZI5A 2PH5A 4QHYA 2OCXA 3EBOA 3EWNA 4TKUA 5IBPA 1LGYA 3TTVA 3RAJA 2YJ6A 3KU1A 1N7GA 4IICA 5TLSA 4BJ1A 3L7CA 3PYXA 4ND7A 5LP6C 1E2NA 2QEQA 1JQEA 3AB7A 3LK6A 4D4JA 3T1QA 2AR0A 2G5TA 1WCWA 3DCJA 3A1UA 3DDSA 2IZOA 3M81A 4XSVA 4AU1A 5CEEA 1UMCA 3INYA 1R18A 1JI3A 3JXEA 2HBZA 3VZQA 1DMRA 2Y99A 2C2BA 4DNXA 4ESVA 2I67A 4RD2A 1VDMA 2DY0A 3AEYA 3PQ6A 3INRA 5DEIA 4ER0A 3QE0A 2JIQA 2GBFA 2UDPA 2VK2A 4FKZA 5I48A 2J07A 2AUTA 4Y6OA 5FI5A 4YUZA 4A0RA 1DWOA 2XYRA 4N3NA 1ZR4A 4ZU3A 3W8NA 1T3HA 2XMGA 3IP3A 1MH1A 1J2JA 4HS9A 5CYOA 3DQQA 3WMFA 3HXPA 2O8BA 3E18A 2FUEA 4PR3A 1ZD3A 1BO6A 4URFA 5BQXA 2ZTVA 1FFWA 3IOMA 3K72B 3SVZA 3FGOA 1SU8A 4UEOA 5I9IA 1UZAA 1GZUA 3R20A 1XXHB 2IA5A 2ODNA 3HVIA 1WV1A 4JNKA 3ITEA 4ZPJA 4ZHQB 1Y6FA 1U7UA 1U3TA 4P36A 1M73E 2YTZA 3JQRA 1QTQA 1RRMA 2FW0A 1M2GA 3DULA 5G1OA 1RQGA 2QS9A 2C29D 3CLRD 3Q8XB 4WXMA 5JSZB 4O3FA 1EJ6A 2A1UB 2QQEA 3EZ6A 4F3KA 3DHYA 1UEJA 3VI4B 4WEQA 2FR0A 3GA5A 3ZHXA 5AJWA 1P7PA 2AW5A 4CMEA 4F45A 1NJFA 2A14A 3VNQA 4YY3B 4F2HA 1J9ZA 1QPBA 1VYTA 2AEJA 3BWCA 4L5IA 4WZAB 5JSYA 3OMLA 5HWSA 2GUWA 4TTSA 1M6WA 3NIDB 2IHNA 5JY6A 2VJNA 4X7MA 2H9AA 3TRJA 4D82A 1QFYA 2OGWA 2BR5A 2YHBA 1U8TA 3D4BA 1SVMA 3RFFA 3WK4A 1PBNA 2IEAA 3MLBA 4ZVOA 3G2KA 2F55A 1V35A 3ESBA 4JODA 2BFFB 4Z4CA 4ZYVA 2ZR7A 1RI4A 1TD1A 2P9TA 5JZOA 5HKKD 4GR9A 4HB2A 4JGGA 2G1UA 3A31A 2BBTA 3CEPB 1CHDA 5F1PA 1NF2A 1MP0A 1FJ2A 4P4TA 3VZPA 2YQ5A 4CTMA 1E89A 2VN8A 3IIJA 4RKWA 1PGQA 2EGHA 3ZV3A 1W25A 2I2FA 3BL8A 4YJKA 4G81A 2GBCA 1XOIA 1JDSA 2W4MA 5EZYA 2JAXA 2B1IA 4U5XA 3UH1A 4FHCA 5GM1A 1XL0A 3ZGLA 4RF3A 3FHOA 4ZICA 3L8HA 5TRTA 3QLUA 3TLGB 1YDHA 1GAWA 3DXYA 1SKQA 3RYHB 2IP1A 2NT4A 3MERA 4CF6A 1XRPA 2HPVA 2GMWA 3M34A 1XCMA 2HSDA 3QHPA 1ZCAA 2F1OA 4ZHSA 1E0KA 4TQUS 1C14A 1CV2A 2O6HA 2VUUA 2Z2IA 4IH1A 4MI9A 3UYKA 1B43A 3LVFO 3QYJA 3ZLVA 3I1YA 5IC5A 3Q6IA 3GVIA 3H5WA 1ZUNA 3EEFA 1XALA 2OHVA 3AC0A 1XDWA 9LDBA 4LXHA 2GBIA 2XYVA 5HP4A 4JI7B 1CY4A 3GR6A 3GMDA 1I4OA 1UPXA 4G1FA 4JJ4A 3LDGA 4OHUA 2YWJA 5IBRA 3CNLA 1RWNA 2DCMA 3MMZA 5ALEA 1L7AA 2CW5A 1GKLA 3IP6A 3OKAA 5FTMA 1S6YA 4NFHA 4O08A 1GV1A 2J6IA 5J3JA 3A28A 2W4QA 3NGMA 4MR8A 4O2AB 2V1UA 3C3AA 2ZZKA 1VOTA 2R8PA 3GLHE 5AWFC 4C7OB 3ZY6A 2ZUCA 3OJXA 5KYUA 1VMEA 4G5SA 4B84A 1ZRNA 3SQXA 2Q8NA 3H9EO 2Q3FA 1PO7A 2R7AA 3HP7A 2LWIA 1RM3A 1HRDA 4IW3B 3AM5A 2YYYA 2ZRFA 2R66A 4DDHA 2I54A 3LUDA 2WSMA 3QEMB 4HYYA 3NPAA 2RB4A 3C6KA 2W8BA 2BHLA 1OMOA 3WLJA 1EFPB 4TMTA 3GLFE 3C0KA 1TZKA 3P5BA 1O94A 4RJLA 2XW6A 3BHIA 3RBVA 3TLBA 3CN9A 2IL1A 3CH6A 2R8OA 1OU4A 1GYRA 1NIPA 3K4PA 1NJ6A 2IYXA 4K9NA 4MA0A 4UHFA 1P1BA 3WGNA 3P9PA 4HQLA 3FB4A 3UMBA 5JD6A 1HTTA 1J07A 4L4XA 3HYTA 3LQFA 5EHIA 4BGDA 2XGGA 2ZBVA 5JDIC 3K1TA 3OZCA 1SRRA 5JFOA 2CCJA 1KO5A 3E2PA 4DLLA 5I9SA 5EN4A 2P68A 5HIAA 3CKLA 4P8RA 3L6OO 3LH5A 2OTCA 4DL9A 4JLMA 4MUMA 1C3JA 4ER3A 3ID6C 2HWWA 4QLOA 5FIUA 1TMOA 1CIJA 1GNRA 1PYDA 1QPGA 3C3YA 3D6FA 3OEWA 1I8TA 3CINA 4J0FA 3HKBA 2ZIEA 2UUPA 2J4CA 4KGVA 3LDFA 1UZNA 4TLEA 4Q4HA 2B5OA 1ZWKA 1C41A 1P6UA 4S2EA 3FPHA 2IWHA 1NPTO 3ICQB 1N57A 4JBGA 3KZOA 1RRGA 3B13B 2X8LA 1P80A 4MWZA 3QVSA 4Z49A 5I4KA 5TGTA 4L0MA 4G01B 1AXGA 3T61A 5BN3A 2JGLA 2X5KO 2GD2A 3EDMA 1GTJ1 5EFOA 3USCS 1BA3A 1E2MA 1X9HA 1Z0FA 2YFHA 3RBZA 3AESA 3IDOA 4IHJF 2JIMA 2I2AA 4WZBE 1E2HA 2IKQA 2VDLB 4OBBA 3REQA 3SIRA 2JLYA 4ZKDA 1I5EA 2JIZA 1UBUS 3RFTA 1ZXXA 2IZ6A 4NCAA 3NBKA 2RGGA 1YCGA 2QU8A 2Q9UA 3G8DA 5EJEA 1R5OA 3JZFA 5ADWA 1QX3A 3PXXA 2BW0A 2G9UA 2WF5A 3R3YA 2C7OA 1DELA 5LWQA 4O4HF 1GD1O 4K6MA 1WG8A 2RHMA 1BROA 3MD0A 4XYLA 1HV8A 4BMOB 1U1GA 2YJZA 3AKEA 1LK0A 2F1IA 1K4MA 1TZCA 3FLMA 4UXIA 3VZCA 2R7KA 4DA8A 4OXNA 1JT2A 5K0FA 4A6EA 2DHDA 3E84A 2KSQA 2R6ZA 4MDEA 2V0GA 1ZD9A 1OGJA 1S3FA 4B6QA 2QNBA 4D9IA 8AT1A 5HPYB 1PLJA 3EB9A 4J7CA 5KQGA 1NW5A 4P5DA 4HEHA 3FDJA 1NAIA 5ALQA 2WV9A 3K9LA 1V2GA 2AA3A 5C8YA 3QA9A 2JFXA 1ZLYA 1W29A 2BONA 3EZLA 3OG9A 4QOIA 4QXQA 5EKUA 2OORA 4UTRA 2FMTA 3I0MA 4ZOLF 3G5LA 3ZU4A 2QDKA 3REOA 3JTMA 1BN7A 1UBHS 1CY0A 5JVDB 3DLIA 4QU5A 4NU5A 3QY0A 2ZRHA 5BVHB 4AD8A 2EBHX 2ZUWA 3HEAA 1NDUA 1AC5A 1GR0A 1T0IA 2CMHA 3C3PA 1OWPA 3KLOA 1P0MA 3K2BA 3TH5A 4J4HA 3VA7A 3EZGA 3ZD7A 4Q18A 1XTQA 1EAYA 1PS9A 2QI9F 4LRXA 4LQDA 3WLNA 5JCOC 1WR8A 2Z1DA 3WWDA 2CLDX 4M1TA 4DLXA 2FEXA 5E2BA 1DTEA 4IVNA 4IFTA 4DLAA 3TQRA 2Y6VA 1N2CB 2SCUA 3CLTC 5A4KA 4AUEA 1FC0A 1BFDA 1W5AA 3AG6A 1G42A 1KC1A 3WB1A 3CN7A 2ZM5A 1TZJA 4LJ6A 3CMCO 4NESA 2WAOA 3W5IA 3COVA 3F6PA 2VTBA 4HPXB 2IOFA 2QSZA 1EKXA 1DKPA 4KFCA 2L42A 2Z4TA 3PF8A 3N6VA 3PNBA 3I28A 4PO3X 4HFNA 2O59A 3UV7A 2GJKA 4TTPA 2GPYA 1L4GA 2DCUA 3CY6A 3GP8A 5G41A 5ALDA 2INGX 4KPUB 2Q2WA 4NFYA 4A73A 3BD8A 4M1MA 1W2WB 5BW4A 3MWDA 3KAPA 3SJAA 1EJBA 4MJ7A 3D0QA 2GH1A 1H22A 3Q3EA 3T94A 1BJTA 2QM3A 3HYCA 3QUQA 3ZN2A 5KOIA 3M1AA 1Y8ZA 4JXZA 3DCIA 4FFRA 1VG0B 2HF8A 3LOQA 4S1OA 4V3CA 3ROQA 2QKYA 2I6UA 3AFGA 3NMUF 1EUDB 2C95A 1QGZA 2HA4A 1RYNA 1FU7A 1NUUA 4K6FA 3WL6A 1EDDA 2GCEA 2P69A 4JI4B 1RCTE 4O29A 3MJDA 1XU9A 4ENTA 2O07A 4BFLA 5DP2A 1NR1A 4H2DA 5BMOA 2PUAA 4HO1X 4KIUA 5IUNC 1ISFA 2R6GA 1L3IA 1OX5A 2YJ5A 4I9FA 2LD4A 3SMVA 4GF5A 4EFDA 7MHTA 3KFXA 2VDJA 4W1PA 4XGIA 5AK3A 3OIGA 2ORWA 3BAZA 1IEQA 5CGZA 1OWMA 4MVCA 4OHFA 4YCAA 5CYFA 5M5BA 4G1CA 4P2GA 4K2AA 1Y8RA 1EBBA 1T35A 1CZLA 3GA0A 3K96A 5K3EA 4D43A 3ZZNA 2JLAA 3D1VA 3JQAB 5KBYA 1LI7A 4QDUA 4TRMA 4CM8A 2AWOA 2PK3A 5GP1A 1N3IA 2ECQA 3ZZMA 5AW3A 1P7WA 5LJLA 4FEGA 3C8DA 4IP0A 4QXMA 3U4QB 2J3KA 2NV6A 3MAAC 2AN1A 3DKKA 4DXDA 1XF9A 3DLTA 4LY3A 3VQTA 4R3WA 1DPGA 1WZIA 3LBFA 2BT4A 4RD4A 1G55A 3SJUA 2X0NA 4OI1A 1JIQA 4U2BA 2N47A 3Q98A 1NBME 4PC6A 2H4YA 4YJ3B 2FPGA 5FORA 5CB4B 1UP6A 3L7OA 3PL5A 3H3JA 1NX6A 3P9CA 4L95C 5G02A 3KR0A 1U5BA 4KLNA 5BV2P 5CBPA 5H81A 3Q4GA 4RZSA 3ROGA 1IWBB 3AVYA 3FY4A 4IV8A 3G2LA 2XB4A 1YKGA 2PRSA 2PM8A 3WGTA 5EHQA 2HT6A 1SC6A 3T1VA 2OLEA 3T41A 2YIDA 1N9KA 2XTMA 4JLPA 3IODA 4DMMA 4XE5A 3KUCA 1Q20A 4URWR 1JVSA 3H1AA 4BNYA 5DSZA 4RJKA 2WILA 1QZXA 1L7VC 3B9PA 3N39C 2Q5CA 4OF4A 4BQQA 4XWWA 5D87A 3SQWA 1GCGA 3R6GA 4JS0A 2AH5A 4UUAA 2WJGA 3PUWA 3SBEA 4E1BA 4EFNA 2P27A 5KNCH 3FWHA 4RC9A 1WF3A 4OQ4A 2BKUA 3E5MA 1XA4A 2R7NA 3C41J 1G7TA 3MHPA 4CBVA 4F4HA 1V4VA 4KPEC 4MUGA 4RL6A 4C08A 3LDAA 2Q50A 5TPWA 2BGWA 1O8BA 1QC5B 4RJ2A 4LF4B 1DXQA 2YXDA 2PUHA 3JCZA 3QVVA 2IZZA 1QB8A 2JAOA 1Z75A 4FI3F 3CFYA 3K7EA 4HQRA 1L4UA 4C0LA 6GPBA 4H1TA 2O19A 2XEDA 4URXR 1H66A 1Y5IA 1ZNXA 1V2HE 4XIGS 4EMUA 4FBMA 2ATCA 4PC3A 5BRAA 1UXKA 2VI5A 4IHAA 5IC4A 1JYEA 3AIOA 1Z5PA 1CUVA 2F1HA 3N70A 1HFEL 3U9TA 5GIPE 1JH9A 2XT6A 4MICA 4H3SA 1XZKA 1FFXA 3CNOA 4Q82A 2W43A 3H5AA 2PQMA 2RGNA 3CT4A 2GGSA 2P1RA 4JENA 1EB9A 2A9VA 2H2FA 2JK1A 2OPBA 2B83A 1BW9A 4EMSA 1HYBA 3QXCA 1U3FA 2BHSA 4JUFA 5EE1A 4C06A 4TYYA 1YQ9A 3JQBC 1FQJA 4UREA 1RWBA 2AI3A 4DTCA 3FVVA 1N2OA 4WZBB 1FUIA 1H1LA 2CHGA 2B6NA 4EAQA 4UHCA 5LOVB 2K7FA 3PJEA 3SE0A 4EG8A 3CU5A 2CXSA 1K6MA 1QKKA 2NU6B 4FW8A 2HJWA 2JG3A 4OAOA 3RHTA 4NFSA 1YH3A 4BCBA 2PGOA 3EW9A 4C04A 1PYGA 1EXVA 3BFPA 2GK6A 1ISPA 4LBWA 3HLTA 3RVKA 4E5NA 1MT3A 1VHDA 1MABA 3H0EA 4UVGA 5AI5A 2XH8A 5A3JA 3NTVA 4A6PA 2FZVA 1U0SY 3FJ1A 4BTLA 5HZMA 3DTYA 3STTA 2FR8A 4U9IS 1C0IA 2B94A 5M2QA 3DUFA 2E4AA 2A59A 5BWBA 3R3WA 4BZWA 2QR3A 3OPMA 3NGXA 3RREA 1ZMOA 5K0JA 3CCFA 4FR2A 2WVHA 4EA6A 1CTQA 3FI9A 1JDUA 2BELA 4MO9A 1KDVA 4DDMA 4D44A 3R24A 1XTBA 3E8SA 1A72A 4P58A 5J4VA 4ESOA 3VO1A 1DZ3A 2IY8A 1NI4A 1BC5A 1BKDR 1RYHA 3MILA 2I2BA 1N6RA