1S3QA

Crystal structures of a novel open pore ferritin from the hyperthermophilic archaeon archaeoglobus fulgidus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
162
structure length
162
Chain Sequence
SISEKMVEALNRQINAEIYSAYLYLSMASYFDSIGLKGFSNWMRVQWQEELMHAMKMFDFVSERGGRVKLYAVEEPPSEWDSPLAAFEHVYEHEVNVTKRIHELVEMAMQEKDFATYNFLQWYVAEQVEEEASALDIVEKLRLIGEDKRALLFLDKELSLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ferritin
publication title Crystal structures of a tetrahedral open pore ferritin from the hyperthermophilic archaeon Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Metal binding protein
total genus 64
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1s3qA00
2FG8A 5FFCA 1JREA 4ITTA 2FZFA 4XGSA 2V2LA 2ZG8X 5J8SA 4DYYA 1JI5A 4XKSA 4CYAA 4TOAA 4TW3A 2PYBA 3UOFA 2X170 3F32A 2Z5QA 4RC5B 3E6SA 1YUXA 3ISEA 3WVVA 5I4JA 2ZG9X 3QZ3A 3FVBA 2VZBA 1TKPA 2FKZA 4II4A 4ZJKA 2ZA8A 2IU2A 5JKLG 1VLGA 3UNOA 5GN8A 2CF7A 2UX1A 2V2MA 5D8QA 1Z6OM 4U3GA 3QB9A 1TKOA 2V2NA 4KVRA 4M34A 3GVYA 4M33A 1S30A 1S3QA 2CN7A 2XJMA 4QUWA 1S2ZA 1DATA 2YW7A 3RAVA 5LBHA 2OH3A 5CMQA 5LS9A 1IESA 3R2OA 4TOBA 3BVFA 4M32A 1LKOA 1UMNA 3KA4A 3PZAA 1DVBA 2CN6A 3R2HA 1F33A 3U90A 4MY7A 3KA6A 4ZTTA 3ERZA 2IY4A 4ZKHA 2V2PA 2CHIA 1Z6OA 5JKMA 2G4HA 1UVHA 2D5KA 3OGHA 2Z5RA 3AK9A 3PWFA 5D8PA 1MOJA 3F33A 2FHAA 3F35A 2C2FA 1N1QA 4LPJA 3E1JA 4RC7B 4CVRA 3BT5A 1BG7A 4DI0A 4ZMCA 4CVSA 3PW8C 4TOFA 4PG1A 2OC5A 2CHPA 2V2JA 2CLBA 2BW1A 2V15A 3Q4NA 2JD80 4DYXA 3WVWA 2XGWA 3E1LA 3PW1A 1NNQA 4TOEA 2QF9A 4RC8A 3PWQA 5GOUA 1NF4A 4AM5A 4LQNA 5LG8A 4RC6B 3F34A 2FG4A 5GU2X 2ZURX 1ZS3A 5JACA 1RYTA 3F38A 3A9QA 3A68A 5JKLA 3PVYA 2YW6A 5E1UA 4REUA 2JD60 1EUMA 3AK8A 1JGCA 4AM2A 2JD70 4CYBA 4ZKWA 1KRQA 3IS8A 5D8SA 1JTSA 4TODA 2BKCA 5J8WA 2Z5PA 2IB0A 2YJJA 2XJNA 4TOHA 3FSEA 5J93A 1BFRA 2C41A 4ML5A 3PVTB 1LKPA 4EVBA 4CMYV 4DASA 5FEJA 3O7SA 5C6FA 5FFAA 3TA8A 3E1PA 4IXKA 2XJOA 4ZKXA 1LB3A 1TJOA 1RCCA 3QHBA 2V2IA 4ZLWA 2HTNA 4CVPA 3E1NA 5ERKA 2WLUA 3E6RA 1ZUJA 2Z90A 3KX9A 3AJPA 1VJXA 1VEIA 4KVSA 4MUDA 3F37A 2WLAA 1XZ3A 4ZL5A 2GYQA 3PWQC 2V2RA 1VEQA 1HRSA 3BVEA 1L8HA 5D8YA 3EGMA 2GS4A 1QGHA 1DPSA 3PVRA 2YJKA 5D8XA 3EZUA 3ES3A 5FFDA 3RGDA 4Z5SA 4TOCA 3T9JA 4LYUA 4MN9A 4OYNA 1RCGA 2FL0A 5D8OA 3UOIA 2W0OA 4LYXA 3R2KA 1SQ3A 4TOGA 1R03A 3QD8A 4XKUA 1RCDA 2ITBA 4A25A 1YUZA 2C6RA 5JKMG 1O9IA 3IS7A 3RE7A 2V2OA 5HJFA 4E6KA 5GU3X 2FJCA 3KA3A 3OJ5A 3Q4QA 3NP0X 4RC6A 4ETRA 4YKHA 1IERA 3EZ0A 2VXIA 3PW1B 4Z3BA 3AF7X 4Y08A 5E2DA 3KWOA 4R42A 5J9VA 3QHCA 1NF6A 3KXUA 4TO9A 3E1QA 4RC5A 3AF8X 2XKQA 4DYZA 5HQOA 2F7NA 1LKMA 3PVYB 1JI4A 1H96A 5LG2A 4ISMA 3RD0A 3R2LA 2ZG7X 3E1OA 3O7RA 3WVUA 4DYUA 4EVEA 3PW8A 3BVKA 3AJOA 5GU0X 5CZUA 4II4B 1XZ1A 2GYDA 3E2CA 4AM4A 3R2RA 3MPSA 3NOZX 3BKNA 5GN8B 2WTLA 1Z4AA 1RCIA 4KVQA 3Q4RA 3PVTA 4IWKA 4LQVA 5GU1X 4DZ0A 3KA9A 1GWGA 3H7GA 3QVDA 4P18A 3SE1A 3HIUA 1VELA 4ITWA 5AXSA 1L8IA 3ISFA 3SH6A 1RCEA 2ZA6A 3R2SA 3FI6A 1O9RA 2BJYA 4CY9A 1TK6A 5CMRA 5FFBA 1OTKA 1JIGA 1JKVA 2C2JA 4LPNA 1QYBA 3VNXA 2CLUA 2Y3QA 2FFXJ 3SIDA 4M35A 3R2MA 5FFEA 5D8RA 3E1MA 1YV1A 2QQYA 3F39A 2HR5A 5HJHA 4EVDA 2Z6MA 1SOFA 3Q4OA 3WNWA 4CVTA 3GHQA 4RC7A 1JKUA 4XKTA 1NFVA 3F36A 4LPMA 3BVIA 1BCFA 3PVRB 1FHAA 2VXXA 3HL1A 2V2SA 4ZL6A 3BVLA 5K52A 4PGKA 2ZA7A 3KA8A 4IWJA 1MFRA 2C2UA 4MKUA 3GE4A 4LQHA 1B71A 1J30A 4LQJA 1F30A 2CIHA 4DE6A 4ISPA 3RBCA 3NP2X 2RBDA 4PG0A 3AF9X 3AJQA 2CEIA 5ERJA 4ERUA 4CMYA 4EVCA 2BK6A 3IQ1A 5K53A 1AEWA 4PGIA 5IX6A 1JYBA 4MJYA 3SHXA
chains in the Genus database with same CATH superfamily
2FG8A 4W4LB 5FFCA 1JREA 4ITTA 2FZFA 4XGSA 2V2LA 3FRRA 2ZG8X 5J8SA 4DYYA 1JI5A 4XKSA 4CYAA 4TOAA 4TW3A 2PYBA 3UOFA 2X170 3F32A 2Z5QA 4RC5B 3E6SA 1YUXA 3ISEA 3WVVA 5I4JA 2ZG9X 3QZ3A 3FVBA 2VZBA 1TKPA 2FKZA 3D19A 4II4A 4ZJKA 2ZA8A 2IU2A 5JKLG 1VLGA 3UNOA 5GN8A 2CF7A 2UX1A 2V2MA 5D8QA 3L0MA 1Z6OM 4U3GA 3QB9A 1TKOA 2V2NA 4KVRA 4M34A 3GVYA 4M33A 1S30A 1S3QA 2CN7A 2XJMA 4QUWA 1S2ZA 2WWXB 1DATA 2YW7A 3RAVA 5LBHA 2OH3A 3KHKA 5CMQA 5LS9A 1IESA 2Y44A 3R2OA 4TOBA 3BVFA 4M32A 1LKOA 1UMNA 3KA4A 3PZAA 1DVBA 2CN6A 4E40A 3R2HA 1F33A 3U90A 4MY7A 3KA6A 4ZTTA 3ERZA 2IY4A 4ZKHA 2V2PA 2CHIA 1Z6OA 5JKMA 2G4HA 4YVZA 1UVHA 2D5KA 3OGHA 2Z5RA 3AK9A 3PWFA 5D8PA 1MOJA 3M6JA 3F33A 2FHAA 3F35A 2C2FA 1N1QA 4LPJA 3E1JA 4RC7B 4CVRA 3BT5A 1BG7A 4DI0A 4ZMCA 4CVSA 2OKCA 3PW8C 4TOFA 4PG1A 2V8TA 2OC5A 4W4KB 2CHPA 2V2JA 2CLBA 2BW1A 2V15A 3Q4NA 2JD80 4DYXA 3WVWA 2XGWA 3E1LA 3PW1A 1NNQA 4TOEA 2QF9A 4RC8A 3PWQA 5GOUA 3GGYA 1NF4A 4AM5A 4LQNA 5LG8A 4RC6B 3F34A 2FG4A 5GU2X 2ZURX 1ZS3A 5JACA 1RYTA 3F38A 3A9QA 3A68A 5JKLA 3PVYA 3V3KB 2YW6A 5E1UA 4REUA 2JD60 1EUMA 3AK8A 1JGCA 4AM2A 2JD70 4CYBA 4ZKWA 3KDQA 1KRQA 3IS8A 5D8SA 1JTSA 4TODA 2BKCA 5J8WA 2Z5PA 2IB0A 2YJJA 2XJNA 4TOHA 3FSEA 5J93A 1BFRA 2C41A 4ML5A 3PVTB 1LKPA 4EVBA 4CMYV 4DASA 5FEJA 3O7SA 5C6FA 5FFAA 3TA8A 3DBYA 3E1PA 4IXKA 2XJOA 4ZKXA 1LB3A 3C23A 1TJOA 1RCCA 3QHBA 2V2IA 3UFBA 4ZLWA 2HTNA 4CVPA 3JZ9A 3E1NA 5ERKA 5JDOA 2WLUA 3E6RA 4YXJA 1ZUJA 2Z90A 3KX9A 2V8UA 3AJPA 1VJXA 1VEIA 4KVSA 4MUDA 3F37A 2WLAA 1XZ3A 4ZL5A 2GYQA 3PWQC 2V2RA 1VEQA 1HRSA 3BVEA 1L8HA 5D8YA 3EGMA 3VV9A 2GS4A 1QGHA 1DPSA 3PVRA 2YJKA 5D8XA 3EZUA 3ES3A 5FFDA 3RGDA 4Z5SA 4TOCA 3T9JA 4LYUA 4MN9A 4OYNA 1RCGA 2FL0A 5D8OA 3UOIA 2W0OA 4LYXA 3R2KA 1SQ3A 4TOGA 1R03A 4WJG4 3QD8A 4XKUA 1RCDA 2ITBA 4A25A 1YUZA 2C6RA 5JKMG 2AR0A 1O9IA 3IS7A 3RE7A 2V2OA 3GGZA 5HJFA 3N6OA 4E6KA 5GU3X 2FJCA 3KA3A 3C1ZA 3OJ5A 3Q4QA 3NP0X 4RC6A 4ETRA 4YKHA 1IERA 3EZ0A 2VXIA 3PW1B 4Z3BA 3VVAA 3AF7X 4Y08A 5E2DA 3KWOA 4R42A 5J9VA 3QHCA 1NF6A 3KXUA 4TO9A 4X0JA 3E1QA 4RC5A 3AF8X 2XKQA 4DYZA 5HQOA 2F7NA 1LKMA 3PVYB 1JI4A 2N02A 1H96A 5LG2A 4ISMA 3RD0A 3R2LA 2ZG7X 3E1OA 3O7RA 3WVUA 4DYUA 2CWLA 4EVEA 3PW8A 3BVKA 3AJOA 5GU0X 5CZUA 4II4B 1XZ1A 2GYDA 3E2CA 4AM4A 3R2RA 3MPSA 3NOZX 3BKNA 5GN8B 2WTLA 1Z4AA 1RCIA 4KVQA 3Q4RA 3PVTA 4IWKA 4LQVA 5GU1X 4DZ0A 3KA9A 3W54A 3FRSA 5HU6D 1GWGA 3H7GA 3QVDA 4P18A 3SE1A 3HIUA 1VELA 4ITWA 5AXSA 1L8IA 3ISFA 3SH6A 1RCEA 2ZA6A 3R2SA 3FI6A 1O9RA 2BJYA 4CY9A 1TK6A 5CMRA 3LKDA 5FFBA 1OTKA 1JIGA 1JKVA 2C2JA 4LPNA 1QYBA 3VNXA 3C1YA 2CLUA 2Y3QA 2FFXJ 3SIDA 4M35A 3R2MA 5FFEA 5D8RA 3E1MA 1YV1A 2QQYA 3F39A 2HR5A 4KXRB 5HJHA 5JDOB 4EVDA 2Z6MA 1SOFA 3C21A 3Q4OA 3WNWA 4CVTA 3GHQA 4RC7A 1JKUA 2MGYA 4XKTA 1NFVA 3F36A 4LPMA 3BVIA 2G38B 1BCFA 3PVRB 1FHAA 2VXXA 3HL1A 2V2SA 4ZL6A 3BVLA 5K52A 4PGKA 2ZA7A 3KA8A 4IWJA 1MFRA 2C2UA 4MKUA 3GE4A 4LQHA 1B71A 1J30A 4LQJA 1F30A 2CIHA 4DE6A 4ISPA 3RBCA 3NP2X 2RBDA 4PG0A 4YXMA 3AF9X 3AJQA 2CEIA 5ERJA 4ERUA 4CMYA 4EVCA 2BK6A 3IQ1A 5K53A 1AEWA 4PGIA 5IX6A 1JYBA 4MJYA 3SHXA 4MXPA 3JZAB
chains in the Genus database with same CATH topology
2FG8A 4W4LB 5FFCA 1JREA 4ITTA 2FZFA 4XGSA 2V2LA 3FRRA 2ZG8X 5J8SA 4DYYA 1JI5A 4XKSA 4CYAA 4TOAA 4TW3A 2PYBA 3UOFA 2X170 3F32A 2Z5QA 4RC5B 3E6SA 1YUXA 3ISEA 3WVVA 5I4JA 2ZG9X 3QZ3A 3FVBA 2VZBA 1TKPA 2FKZA 3D19A 4II4A 4ZJKA 2ZA8A 2IU2A 5JKLG 1VLGA 3UNOA 5GN8A 2CF7A 2UX1A 2V2MA 5D8QA 3L0MA 1Z6OM 4U3GA 3QB9A 1TKOA 2V2NA 4KVRA 4M34A 3GVYA 4M33A 1S30A 1S3QA 2CN7A 2XJMA 4QUWA 1S2ZA 2WWXB 1DATA 2YW7A 3RAVA 5LBHA 2OH3A 3KHKA 5CMQA 5LS9A 1IESA 2Y44A 3R2OA 4TOBA 3BVFA 4M32A 1LKOA 1UMNA 3KA4A 3PZAA 1DVBA 2CN6A 4E40A 3R2HA 1F33A 3U90A 4MY7A 3KA6A 4ZTTA 3ERZA 2IY4A 4ZKHA 2V2PA 2CHIA 1Z6OA 5JKMA 2G4HA 4YVZA 1UVHA 2D5KA 3OGHA 2Z5RA 3AK9A 3PWFA 5D8PA 1MOJA 3M6JA 3F33A 2FHAA 3F35A 2C2FA 1N1QA 4LPJA 3E1JA 4RC7B 4CVRA 3BT5A 1BG7A 4DI0A 4ZMCA 4CVSA 2OKCA 3PW8C 4TOFA 4PG1A 2V8TA 2OC5A 4W4KB 2CHPA 2V2JA 2CLBA 2BW1A 2V15A 3Q4NA 2JD80 4DYXA 3WVWA 2XGWA 3E1LA 3PW1A 1NNQA 4TOEA 2QF9A 4RC8A 3PWQA 5GOUA 3GGYA 1NF4A 4AM5A 4LQNA 5LG8A 4RC6B 3F34A 2FG4A 5GU2X 2ZURX 1ZS3A 5JACA 1RYTA 3F38A 3A9QA 3A68A 5JKLA 3PVYA 3V3KB 2YW6A 5E1UA 4REUA 2JD60 1EUMA 3AK8A 1JGCA 4AM2A 2JD70 4CYBA 4ZKWA 3KDQA 1KRQA 3IS8A 5D8SA 1JTSA 4TODA 2BKCA 5J8WA 2Z5PA 2IB0A 2YJJA 2XJNA 4TOHA 3FSEA 5J93A 1BFRA 2C41A 4ML5A 3PVTB 1LKPA 4EVBA 4CMYV 4DASA 5FEJA 3O7SA 5C6FA 5FFAA 3TA8A 3DBYA 3E1PA 4IXKA 2XJOA 4ZKXA 1LB3A 3C23A 1TJOA 1RCCA 3QHBA 2V2IA 3UFBA 4ZLWA 2HTNA 4CVPA 3JZ9A 3E1NA 5ERKA 5JDOA 2WLUA 3E6RA 4YXJA 1ZUJA 2Z90A 3KX9A 2V8UA 3AJPA 1VJXA 1VEIA 4KVSA 4MUDA 3F37A 2WLAA 1XZ3A 4ZL5A 2GYQA 3PWQC 2V2RA 1VEQA 1HRSA 3BVEA 1L8HA 5D8YA 3EGMA 3VV9A 2GS4A 1QGHA 1DPSA 3PVRA 2YJKA 5D8XA 3EZUA 3ES3A 5FFDA 3RGDA 4Z5SA 4TOCA 3T9JA 4LYUA 4MN9A 4OYNA 1RCGA 2FL0A 5D8OA 3UOIA 2W0OA 4LYXA 3R2KA 1SQ3A 4TOGA 1R03A 4WJG4 3QD8A 4XKUA 1RCDA 2ITBA 4A25A 1YUZA 2C6RA 5JKMG 2AR0A 1O9IA 3IS7A 3RE7A 2V2OA 3GGZA 5HJFA 3N6OA 4E6KA 5GU3X 2FJCA 3KA3A 3C1ZA 3OJ5A 3Q4QA 3NP0X 4RC6A 4ETRA 4YKHA 1IERA 3EZ0A 2VXIA 3PW1B 4Z3BA 3VVAA 3AF7X 4Y08A 5E2DA 3KWOA 4R42A 5J9VA 3QHCA 1NF6A 3KXUA 4TO9A 4X0JA 3E1QA 4RC5A 3AF8X 2XKQA 4DYZA 5HQOA 2F7NA 1LKMA 3PVYB 1JI4A 2N02A 1H96A 5LG2A 4ISMA 3RD0A 3R2LA 2ZG7X 3E1OA 3O7RA 3WVUA 4DYUA 2CWLA 4EVEA 3PW8A 3BVKA 3AJOA 5GU0X 5CZUA 4II4B 1XZ1A 2GYDA 3E2CA 4AM4A 3R2RA 3MPSA 3NOZX 3BKNA 5GN8B 2WTLA 1Z4AA 1RCIA 4KVQA 3Q4RA 3PVTA 4IWKA 4LQVA 5GU1X 4DZ0A 3KA9A 3W54A 3FRSA 5HU6D 1GWGA 3H7GA 3QVDA 4P18A 3SE1A 3HIUA 1VELA 4ITWA 5AXSA 1L8IA 3ISFA 3SH6A 1RCEA 2ZA6A 3R2SA 3FI6A 1O9RA 2BJYA 4CY9A 1TK6A 5CMRA 3LKDA 5FFBA 1OTKA 1JIGA 1JKVA 2C2JA 4LPNA 1QYBA 3VNXA 3C1YA 2CLUA 2Y3QA 2FFXJ 3SIDA 4M35A 3R2MA 5FFEA 5D8RA 3E1MA 1YV1A 2QQYA 3F39A 2HR5A 4KXRB 5HJHA 5JDOB 4EVDA 2Z6MA 1SOFA 3C21A 3Q4OA 3WNWA 4CVTA 3GHQA 4RC7A 1JKUA 2MGYA 4XKTA 1NFVA 3F36A 4LPMA 3BVIA 2G38B 1BCFA 3PVRB 1FHAA 2VXXA 3HL1A 2V2SA 4ZL6A 3BVLA 5K52A 4PGKA 2ZA7A 3KA8A 4IWJA 1MFRA 2C2UA 4MKUA 3GE4A 4LQHA 1B71A 1J30A 4LQJA 1F30A 2CIHA 4DE6A 4ISPA 3RBCA 3NP2X 2RBDA 4PG0A 4YXMA 3AF9X 3AJQA 2CEIA 5ERJA 4ERUA 4CMYA 4EVCA 2BK6A 3IQ1A 5K53A 1AEWA 4PGIA 5IX6A 1JYBA 4MJYA 3SHXA 4MXPA 3JZAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FG8 A;  5FFC A;  1JRE A;  4ITT A;  2FZF A;  4XGS A;  2V2L A;  2ZG8 X;  5J8S A;  4DYY A;  1JI5 A;  4XKS A;  4CYA A;  4TOA A;  4TW3 A;  2PYB A;  3UOF A;  2X17 0;  3F32 A;  2Z5Q A;  4RC5 B;  3E6S A;  1YUX A;  3ISE A;  3WVV A;  5I4J A;  2ZG9 X;  3QZ3 A;  3FVB A;  2VZB A;  1TKP A;  2FKZ A;  4II4 A;  4ZJK A;  2ZA8 A;  2IU2 A;  5JKL G;  1VLG A;  3UNO A;  5GN8 A;  2CF7 A;  2UX1 A;  2V2M A;  5D8Q A;  1Z6O M;  4U3G A;  3QB9 A;  1TKO A;  2V2N A;  4KVR A;  4M34 A;  3GVY A;  4M33 A;  1S30 A;  1S3Q A;  2CN7 A;  2XJM A;  4QUW A;  1S2Z A;  1DAT A;  2YW7 A;  3RAV A;  5LBH A;  2OH3 A;  5CMQ A;  5LS9 A;  1IES A;  3R2O A;  4TOB A;  3BVF A;  4M32 A;  1LKO A;  1UMN A;  3KA4 A;  3PZA A;  1DVB A;  2CN6 A;  3R2H A;  1F33 A;  3U90 A;  4MY7 A;  3KA6 A;  4ZTT A;  3ERZ A;  2IY4 A;  4ZKH A;  2V2P A;  2CHI A;  1Z6O A;  5JKM A;  2G4H A;  1UVH A;  2D5K A;  3OGH A;  2Z5R A;  3AK9 A;  3PWF A;  5D8P A;  1MOJ A;  3F33 A;  2FHA A;  3F35 A;  2C2F A;  1N1Q A;  4LPJ A;  3E1J A;  4RC7 B;  4CVR A;  3BT5 A;  1BG7 A;  4DI0 A;  4ZMC A;  4CVS A;  3PW8 C;  4TOF A;  4PG1 A;  2OC5 A;  2CHP A;  2V2J A;  2CLB A;  2BW1 A;  2V15 A;  3Q4N A;  2JD8 0;  4DYX A;  3WVW A;  2XGW A;  3E1L A;  3PW1 A;  1NNQ A;  4TOE A;  2QF9 A;  4RC8 A;  3PWQ A;  5GOU A;  1NF4 A;  4AM5 A;  4LQN A;  5LG8 A;  4RC6 B;  3F34 A;  2FG4 A;  5GU2 X;  2ZUR X;  1ZS3 A;  5JAC A;  1RYT A;  3F38 A;  3A9Q A;  3A68 A;  5JKL A;  3PVY A;  2YW6 A;  5E1U A;  4REU A;  2JD6 0;  1EUM A;  3AK8 A;  1JGC A;  4AM2 A;  2JD7 0;  4CYB A;  4ZKW A;  1KRQ A;  3IS8 A;  5D8S A;  1JTS A;  4TOD A;  2BKC A;  5J8W A;  2Z5P A;  2IB0 A;  2YJJ A;  2XJN A;  4TOH A;  3FSE A;  5J93 A;  1BFR A;  2C41 A;  4ML5 A;  3PVT B;  1LKP A;  4EVB A;  4CMY V;  4DAS A;  5FEJ A;  3O7S A;  5C6F A;  5FFA A;  3TA8 A;  3E1P A;  4IXK A;  2XJO A;  4ZKX A;  1LB3 A;  1TJO A;  1RCC A;  3QHB A;  2V2I A;  4ZLW A;  2HTN A;  4CVP A;  3E1N A;  5ERK A;  2WLU A;  3E6R A;  1ZUJ A;  2Z90 A;  3KX9 A;  3AJP A;  1VJX A;  1VEI A;  4KVS A;  4MUD A;  3F37 A;  2WLA A;  1XZ3 A;  4ZL5 A;  2GYQ A;  3PWQ C;  2V2R A;  1VEQ A;  1HRS A;  3BVE A;  1L8H A;  5D8Y A;  3EGM A;  2GS4 A;  1QGH A;  1DPS A;  3PVR A;  2YJK A;  5D8X A;  3EZU A;  3ES3 A;  5FFD A;  3RGD A;  4Z5S A;  4TOC A;  3T9J A;  4LYU A;  4MN9 A;  4OYN A;  1RCG A;  2FL0 A;  5D8O A;  3UOI A;  2W0O A;  4LYX A;  3R2K A;  1SQ3 A;  4TOG A;  1R03 A;  3QD8 A;  4XKU A;  1RCD A;  2ITB A;  4A25 A;  1YUZ A;  2C6R A;  5JKM G;  1O9I A;  3IS7 A;  3RE7 A;  2V2O A;  5HJF A;  4E6K A;  5GU3 X;  2FJC A;  3KA3 A;  3OJ5 A;  3Q4Q A;  3NP0 X;  4RC6 A;  4ETR A;  4YKH A;  1IER A;  3EZ0 A;  2VXI A;  3PW1 B;  4Z3B A;  3AF7 X;  4Y08 A;  5E2D A;  3KWO A;  4R42 A;  5J9V A;  3QHC A;  1NF6 A;  3KXU A;  4TO9 A;  3E1Q A;  4RC5 A;  3AF8 X;  2XKQ A;  4DYZ A;  5HQO A;  2F7N A;  1LKM A;  3PVY B;  1JI4 A;  1H96 A;  5LG2 A;  4ISM A;  3RD0 A;  3R2L A;  2ZG7 X;  3E1O A;  3O7R A;  3WVU A;  4DYU A;  4EVE A;  3PW8 A;  3BVK A;  3AJO A;  5GU0 X;  5CZU A;  4II4 B;  1XZ1 A;  2GYD A;  3E2C A;  4AM4 A;  3R2R A;  3MPS A;  3NOZ X;  3BKN A;  5GN8 B;  2WTL A;  1Z4A A;  1RCI A;  4KVQ A;  3Q4R A;  3PVT A;  4IWK A;  4LQV A;  5GU1 X;  4DZ0 A;  3KA9 A;  1GWG A;  3H7G A;  3QVD A;  4P18 A;  3SE1 A;  3HIU A;  1VEL A;  4ITW A;  5AXS A;  1L8I A;  3ISF A;  3SH6 A;  1RCE A;  2ZA6 A;  3R2S A;  3FI6 A;  1O9R A;  2BJY A;  4CY9 A;  1TK6 A;  5CMR A;  5FFB A;  1OTK A;  1JIG A;  1JKV A;  2C2J A;  4LPN A;  1QYB A;  3VNX A;  2CLU A;  2Y3Q A;  2FFX J;  3SID A;  4M35 A;  3R2M A;  5FFE A;  5D8R A;  3E1M A;  1YV1 A;  2QQY A;  3F39 A;  2HR5 A;  5HJH A;  4EVD A;  2Z6M A;  1SOF A;  3Q4O A;  3WNW A;  4CVT A;  3GHQ A;  4RC7 A;  1JKU A;  4XKT A;  1NFV A;  3F36 A;  4LPM A;  3BVI A;  1BCF A;  3PVR B;  1FHA A;  2VXX A;  3HL1 A;  2V2S A;  4ZL6 A;  3BVL A;  5K52 A;  4PGK A;  2ZA7 A;  3KA8 A;  4IWJ A;  1MFR A;  2C2U A;  4MKU A;  3GE4 A;  4LQH A;  1B71 A;  1J30 A;  4LQJ A;  1F30 A;  2CIH A;  4DE6 A;  4ISP A;  3RBC A;  3NP2 X;  2RBD A;  4PG0 A;  3AF9 X;  3AJQ A;  2CEI A;  5ERJ A;  4ERU A;  4CMY A;  4EVC A;  2BK6 A;  3IQ1 A;  5K53 A;  1AEW A;  4PGI A;  5IX6 A;  1JYB A;  4MJY A;  3SHX A; 
#chains in the Genus database with same CATH topology
 2FG8 A;  4W4L B;  5FFC A;  1JRE A;  4ITT A;  2FZF A;  4XGS A;  2V2L A;  3FRR A;  2ZG8 X;  5J8S A;  4DYY A;  1JI5 A;  4XKS A;  4CYA A;  4TOA A;  4TW3 A;  2PYB A;  3UOF A;  2X17 0;  3F32 A;  2Z5Q A;  4RC5 B;  3E6S A;  1YUX A;  3ISE A;  3WVV A;  5I4J A;  2ZG9 X;  3QZ3 A;  3FVB A;  2VZB A;  1TKP A;  2FKZ A;  3D19 A;  4II4 A;  4ZJK A;  2ZA8 A;  2IU2 A;  5JKL G;  1VLG A;  3UNO A;  5GN8 A;  2CF7 A;  2UX1 A;  2V2M A;  5D8Q A;  3L0M A;  1Z6O M;  4U3G A;  3QB9 A;  1TKO A;  2V2N A;  4KVR A;  4M34 A;  3GVY A;  4M33 A;  1S30 A;  1S3Q A;  2CN7 A;  2XJM A;  4QUW A;  1S2Z A;  2WWX B;  1DAT A;  2YW7 A;  3RAV A;  5LBH A;  2OH3 A;  3KHK A;  5CMQ A;  5LS9 A;  1IES A;  2Y44 A;  3R2O A;  4TOB A;  3BVF A;  4M32 A;  1LKO A;  1UMN A;  3KA4 A;  3PZA A;  1DVB A;  2CN6 A;  4E40 A;  3R2H A;  1F33 A;  3U90 A;  4MY7 A;  3KA6 A;  4ZTT A;  3ERZ A;  2IY4 A;  4ZKH A;  2V2P A;  2CHI A;  1Z6O A;  5JKM A;  2G4H A;  4YVZ A;  1UVH A;  2D5K A;  3OGH A;  2Z5R A;  3AK9 A;  3PWF A;  5D8P A;  1MOJ A;  3M6J A;  3F33 A;  2FHA A;  3F35 A;  2C2F A;  1N1Q A;  4LPJ A;  3E1J A;  4RC7 B;  4CVR A;  3BT5 A;  1BG7 A;  4DI0 A;  4ZMC A;  4CVS A;  2OKC A;  3PW8 C;  4TOF A;  4PG1 A;  2V8T A;  2OC5 A;  4W4K B;  2CHP A;  2V2J A;  2CLB A;  2BW1 A;  2V15 A;  3Q4N A;  2JD8 0;  4DYX A;  3WVW A;  2XGW A;  3E1L A;  3PW1 A;  1NNQ A;  4TOE A;  2QF9 A;  4RC8 A;  3PWQ A;  5GOU A;  3GGY A;  1NF4 A;  4AM5 A;  4LQN A;  5LG8 A;  4RC6 B;  3F34 A;  2FG4 A;  5GU2 X;  2ZUR X;  1ZS3 A;  5JAC A;  1RYT A;  3F38 A;  3A9Q A;  3A68 A;  5JKL A;  3PVY A;  3V3K B;  2YW6 A;  5E1U A;  4REU A;  2JD6 0;  1EUM A;  3AK8 A;  1JGC A;  4AM2 A;  2JD7 0;  4CYB A;  4ZKW A;  3KDQ A;  1KRQ A;  3IS8 A;  5D8S A;  1JTS A;  4TOD A;  2BKC A;  5J8W A;  2Z5P A;  2IB0 A;  2YJJ A;  2XJN A;  4TOH A;  3FSE A;  5J93 A;  1BFR A;  2C41 A;  4ML5 A;  3PVT B;  1LKP A;  4EVB A;  4CMY V;  4DAS A;  5FEJ A;  3O7S A;  5C6F A;  5FFA A;  3TA8 A;  3DBY A;  3E1P A;  4IXK A;  2XJO A;  4ZKX A;  1LB3 A;  3C23 A;  1TJO A;  1RCC A;  3QHB A;  2V2I A;  3UFB A;  4ZLW A;  2HTN A;  4CVP A;  3JZ9 A;  3E1N A;  5ERK A;  5JDO A;  2WLU A;  3E6R A;  4YXJ A;  1ZUJ A;  2Z90 A;  3KX9 A;  2V8U A;  3AJP A;  1VJX A;  1VEI A;  4KVS A;  4MUD A;  3F37 A;  2WLA A;  1XZ3 A;  4ZL5 A;  2GYQ A;  3PWQ C;  2V2R A;  1VEQ A;  1HRS A;  3BVE A;  1L8H A;  5D8Y A;  3EGM A;  3VV9 A;  2GS4 A;  1QGH A;  1DPS A;  3PVR A;  2YJK A;  5D8X A;  3EZU A;  3ES3 A;  5FFD A;  3RGD A;  4Z5S A;  4TOC A;  3T9J A;  4LYU A;  4MN9 A;  4OYN A;  1RCG A;  2FL0 A;  5D8O A;  3UOI A;  2W0O A;  4LYX A;  3R2K A;  1SQ3 A;  4TOG A;  1R03 A;  4WJG 4;  3QD8 A;  4XKU A;  1RCD A;  2ITB A;  4A25 A;  1YUZ A;  2C6R A;  5JKM G;  2AR0 A;  1O9I A;  3IS7 A;  3RE7 A;  2V2O A;  3GGZ A;  5HJF A;  3N6O A;  4E6K A;  5GU3 X;  2FJC A;  3KA3 A;  3C1Z A;  3OJ5 A;  3Q4Q A;  3NP0 X;  4RC6 A;  4ETR A;  4YKH A;  1IER A;  3EZ0 A;  2VXI A;  3PW1 B;  4Z3B A;  3VVA A;  3AF7 X;  4Y08 A;  5E2D A;  3KWO A;  4R42 A;  5J9V A;  3QHC A;  1NF6 A;  3KXU A;  4TO9 A;  4X0J A;  3E1Q A;  4RC5 A;  3AF8 X;  2XKQ A;  4DYZ A;  5HQO A;  2F7N A;  1LKM A;  3PVY B;  1JI4 A;  2N02 A;  1H96 A;  5LG2 A;  4ISM A;  3RD0 A;  3R2L A;  2ZG7 X;  3E1O A;  3O7R A;  3WVU A;  4DYU A;  2CWL A;  4EVE A;  3PW8 A;  3BVK A;  3AJO A;  5GU0 X;  5CZU A;  4II4 B;  1XZ1 A;  2GYD A;  3E2C A;  4AM4 A;  3R2R A;  3MPS A;  3NOZ X;  3BKN A;  5GN8 B;  2WTL A;  1Z4A A;  1RCI A;  4KVQ A;  3Q4R A;  3PVT A;  4IWK A;  4LQV A;  5GU1 X;  4DZ0 A;  3KA9 A;  3W54 A;  3FRS A;  5HU6 D;  1GWG A;  3H7G A;  3QVD A;  4P18 A;  3SE1 A;  3HIU A;  1VEL A;  4ITW A;  5AXS A;  1L8I A;  3ISF A;  3SH6 A;  1RCE A;  2ZA6 A;  3R2S A;  3FI6 A;  1O9R A;  2BJY A;  4CY9 A;  1TK6 A;  5CMR A;  3LKD A;  5FFB A;  1OTK A;  1JIG A;  1JKV A;  2C2J A;  4LPN A;  1QYB A;  3VNX A;  3C1Y A;  2CLU A;  2Y3Q A;  2FFX J;  3SID A;  4M35 A;  3R2M A;  5FFE A;  5D8R A;  3E1M A;  1YV1 A;  2QQY A;  3F39 A;  2HR5 A;  4KXR B;  5HJH A;  5JDO B;  4EVD A;  2Z6M A;  1SOF A;  3C21 A;  3Q4O A;  3WNW A;  4CVT A;  3GHQ A;  4RC7 A;  1JKU A;  2MGY A;  4XKT A;  1NFV A;  3F36 A;  4LPM A;  3BVI A;  2G38 B;  1BCF A;  3PVR B;  1FHA A;  2VXX A;  3HL1 A;  2V2S A;  4ZL6 A;  3BVL A;  5K52 A;  4PGK A;  2ZA7 A;  3KA8 A;  4IWJ A;  1MFR A;  2C2U A;  4MKU A;  3GE4 A;  4LQH A;  1B71 A;  1J30 A;  4LQJ A;  1F30 A;  2CIH A;  4DE6 A;  4ISP A;  3RBC A;  3NP2 X;  2RBD A;  4PG0 A;  4YXM A;  3AF9 X;  3AJQ A;  2CEI A;  5ERJ A;  4ERU A;  4CMY A;  4EVC A;  2BK6 A;  3IQ1 A;  5K53 A;  1AEW A;  4PGI A;  5IX6 A;  1JYB A;  4MJY A;  3SHX A;  4MXP A;  3JZA B; 
#chains in the Genus database with same CATH homology
 2FG8 A;  4W4L B;  5FFC A;  1JRE A;  4ITT A;  2FZF A;  4XGS A;  2V2L A;  3FRR A;  2ZG8 X;  5J8S A;  4DYY A;  1JI5 A;  4XKS A;  4CYA A;  4TOA A;  4TW3 A;  2PYB A;  3UOF A;  2X17 0;  3F32 A;  2Z5Q A;  4RC5 B;  3E6S A;  1YUX A;  3ISE A;  3WVV A;  5I4J A;  2ZG9 X;  3QZ3 A;  3FVB A;  2VZB A;  1TKP A;  2FKZ A;  3D19 A;  4II4 A;  4ZJK A;  2ZA8 A;  2IU2 A;  5JKL G;  1VLG A;  3UNO A;  5GN8 A;  2CF7 A;  2UX1 A;  2V2M A;  5D8Q A;  3L0M A;  1Z6O M;  4U3G A;  3QB9 A;  1TKO A;  2V2N A;  4KVR A;  4M34 A;  3GVY A;  4M33 A;  1S30 A;  1S3Q A;  2CN7 A;  2XJM A;  4QUW A;  1S2Z A;  2WWX B;  1DAT A;  2YW7 A;  3RAV A;  5LBH A;  2OH3 A;  3KHK A;  5CMQ A;  5LS9 A;  1IES A;  2Y44 A;  3R2O A;  4TOB A;  3BVF A;  4M32 A;  1LKO A;  1UMN A;  3KA4 A;  3PZA A;  1DVB A;  2CN6 A;  4E40 A;  3R2H A;  1F33 A;  3U90 A;  4MY7 A;  3KA6 A;  4ZTT A;  3ERZ A;  2IY4 A;  4ZKH A;  2V2P A;  2CHI A;  1Z6O A;  5JKM A;  2G4H A;  4YVZ A;  1UVH A;  2D5K A;  3OGH A;  2Z5R A;  3AK9 A;  3PWF A;  5D8P A;  1MOJ A;  3M6J A;  3F33 A;  2FHA A;  3F35 A;  2C2F A;  1N1Q A;  4LPJ A;  3E1J A;  4RC7 B;  4CVR A;  3BT5 A;  1BG7 A;  4DI0 A;  4ZMC A;  4CVS A;  2OKC A;  3PW8 C;  4TOF A;  4PG1 A;  2V8T A;  2OC5 A;  4W4K B;  2CHP A;  2V2J A;  2CLB A;  2BW1 A;  2V15 A;  3Q4N A;  2JD8 0;  4DYX A;  3WVW A;  2XGW A;  3E1L A;  3PW1 A;  1NNQ A;  4TOE A;  2QF9 A;  4RC8 A;  3PWQ A;  5GOU A;  3GGY A;  1NF4 A;  4AM5 A;  4LQN A;  5LG8 A;  4RC6 B;  3F34 A;  2FG4 A;  5GU2 X;  2ZUR X;  1ZS3 A;  5JAC A;  1RYT A;  3F38 A;  3A9Q A;  3A68 A;  5JKL A;  3PVY A;  3V3K B;  2YW6 A;  5E1U A;  4REU A;  2JD6 0;  1EUM A;  3AK8 A;  1JGC A;  4AM2 A;  2JD7 0;  4CYB A;  4ZKW A;  3KDQ A;  1KRQ A;  3IS8 A;  5D8S A;  1JTS A;  4TOD A;  2BKC A;  5J8W A;  2Z5P A;  2IB0 A;  2YJJ A;  2XJN A;  4TOH A;  3FSE A;  5J93 A;  1BFR A;  2C41 A;  4ML5 A;  3PVT B;  1LKP A;  4EVB A;  4CMY V;  4DAS A;  5FEJ A;  3O7S A;  5C6F A;  5FFA A;  3TA8 A;  3DBY A;  3E1P A;  4IXK A;  2XJO A;  4ZKX A;  1LB3 A;  3C23 A;  1TJO A;  1RCC A;  3QHB A;  2V2I A;  3UFB A;  4ZLW A;  2HTN A;  4CVP A;  3JZ9 A;  3E1N A;  5ERK A;  5JDO A;  2WLU A;  3E6R A;  4YXJ A;  1ZUJ A;  2Z90 A;  3KX9 A;  2V8U A;  3AJP A;  1VJX A;  1VEI A;  4KVS A;  4MUD A;  3F37 A;  2WLA A;  1XZ3 A;  4ZL5 A;  2GYQ A;  3PWQ C;  2V2R A;  1VEQ A;  1HRS A;  3BVE A;  1L8H A;  5D8Y A;  3EGM A;  3VV9 A;  2GS4 A;  1QGH A;  1DPS A;  3PVR A;  2YJK A;  5D8X A;  3EZU A;  3ES3 A;  5FFD A;  3RGD A;  4Z5S A;  4TOC A;  3T9J A;  4LYU A;  4MN9 A;  4OYN A;  1RCG A;  2FL0 A;  5D8O A;  3UOI A;  2W0O A;  4LYX A;  3R2K A;  1SQ3 A;  4TOG A;  1R03 A;  4WJG 4;  3QD8 A;  4XKU A;  1RCD A;  2ITB A;  4A25 A;  1YUZ A;  2C6R A;  5JKM G;  2AR0 A;  1O9I A;  3IS7 A;  3RE7 A;  2V2O A;  3GGZ A;  5HJF A;  3N6O A;  4E6K A;  5GU3 X;  2FJC A;  3KA3 A;  3C1Z A;  3OJ5 A;  3Q4Q A;  3NP0 X;  4RC6 A;  4ETR A;  4YKH A;  1IER A;  3EZ0 A;  2VXI A;  3PW1 B;  4Z3B A;  3VVA A;  3AF7 X;  4Y08 A;  5E2D A;  3KWO A;  4R42 A;  5J9V A;  3QHC A;  1NF6 A;  3KXU A;  4TO9 A;  4X0J A;  3E1Q A;  4RC5 A;  3AF8 X;  2XKQ A;  4DYZ A;  5HQO A;  2F7N A;  1LKM A;  3PVY B;  1JI4 A;  2N02 A;  1H96 A;  5LG2 A;  4ISM A;  3RD0 A;  3R2L A;  2ZG7 X;  3E1O A;  3O7R A;  3WVU A;  4DYU A;  2CWL A;  4EVE A;  3PW8 A;  3BVK A;  3AJO A;  5GU0 X;  5CZU A;  4II4 B;  1XZ1 A;  2GYD A;  3E2C A;  4AM4 A;  3R2R A;  3MPS A;  3NOZ X;  3BKN A;  5GN8 B;  2WTL A;  1Z4A A;  1RCI A;  4KVQ A;  3Q4R A;  3PVT A;  4IWK A;  4LQV A;  5GU1 X;  4DZ0 A;  3KA9 A;  3W54 A;  3FRS A;  5HU6 D;  1GWG A;  3H7G A;  3QVD A;  4P18 A;  3SE1 A;  3HIU A;  1VEL A;  4ITW A;  5AXS A;  1L8I A;  3ISF A;  3SH6 A;  1RCE A;  2ZA6 A;  3R2S A;  3FI6 A;  1O9R A;  2BJY A;  4CY9 A;  1TK6 A;  5CMR A;  3LKD A;  5FFB A;  1OTK A;  1JIG A;  1JKV A;  2C2J A;  4LPN A;  1QYB A;  3VNX A;  3C1Y A;  2CLU A;  2Y3Q A;  2FFX J;  3SID A;  4M35 A;  3R2M A;  5FFE A;  5D8R A;  3E1M A;  1YV1 A;  2QQY A;  3F39 A;  2HR5 A;  4KXR B;  5HJH A;  5JDO B;  4EVD A;  2Z6M A;  1SOF A;  3C21 A;  3Q4O A;  3WNW A;  4CVT A;  3GHQ A;  4RC7 A;  1JKU A;  2MGY A;  4XKT A;  1NFV A;  3F36 A;  4LPM A;  3BVI A;  2G38 B;  1BCF A;  3PVR B;  1FHA A;  2VXX A;  3HL1 A;  2V2S A;  4ZL6 A;  3BVL A;  5K52 A;  4PGK A;  2ZA7 A;  3KA8 A;  4IWJ A;  1MFR A;  2C2U A;  4MKU A;  3GE4 A;  4LQH A;  1B71 A;  1J30 A;  4LQJ A;  1F30 A;  2CIH A;  4DE6 A;  4ISP A;  3RBC A;  3NP2 X;  2RBD A;  4PG0 A;  4YXM A;  3AF9 X;  3AJQ A;  2CEI A;  5ERJ A;  4ERU A;  4CMY A;  4EVC A;  2BK6 A;  3IQ1 A;  5K53 A;  1AEW A;  4PGI A;  5IX6 A;  1JYB A;  4MJY A;  3SHX A;  4MXP A;  3JZA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...