1S40A

Solution structure of the cdc13 dna-binding domain complexed with a single-stranded telomeric dna 11-mer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
187
structure length
187
Chain Sequence
b'KMARKDPTIEFCQLGLDTFETKYITMFGMLVSCSFDKPAFISFVFSDFTKNDIVQNYLYDRYLIDYENKLELNEGFKAIMYKNQFETFDSKLRKIFNNGLRDLQNGRDENLSQYGIVCKMNIKVKMYNGKLNAIVRECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISRYFEEYRRFFPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*GP*TP*GP*GP*GP*TP*GP*TP*G)-3'
publication title Structural basis for telomeric single-stranded DNA recognition by yeast Cdc13
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 27
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2004-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1s40A00
4YCVA 4DUYQ 3PUXA 4DR5L 3W5OA 3S1RH 1IBMQ 4GKJL 1XMOQ 3TRZA 3H0GG 2K5HA 2VZAA 3K80C 4IPHA 3ICEA 4IFDJ 2A1AA 4UP8A 3H3VI 2R7ZH 3RN2A 3J80c 1XMQQ 5IP7H 2UUAL 2ID0A 2MQHA 4A3KG 4AH6A 3D31A 1X9NA 4NXMQ 1N33L 2KHJA 3A74A 4A3MH 2CFMA 4B3RQ 4GLXA 4JI2Q 5IP9G 1TXYA 2Z6KC 2WP8J 4AYBE 2K5VA 5FJ8G 4DV5Q 3RZDH 4OONA 4TQUS 1PH7A 2PQAA 1C7YA 1HR0L 1N32Q 4R4TA 1EWIA 5C0XG 1HZBA 5JJIA 4DUYL 4DR4Q 1IBML 4DR2Q 3RNUA 1XMOL 4LF9Q 5C3EG 2I5HA 3GD7A 5HGQA 2UXCQ 4IFDG 1LYLA 1YZ6A 4NXNQ 1XMQL 2QEXA 4A3EH 3AYHB 4NXML 1X56A 4H02A 3JC66 2JA7H 3STBC 3GO5A 4GLVB 4B3RL 1OXUA 2UU9Q 1PYSB 3CC4A 2JA6H 4JI2L 5FLMH 1UE1A 2K14A 4KLKA 1VQCA 4GOPA 3RLOA 1VQMA 2NVYH 4UY8C 1J6QA 5ELNA 4DV5L 3S17H 4JG2A 4QL5A 2Q2IA 1A8VA 3M4OH 1YHBA 2Q2HA 3K7UC 5M5YH 1TWGH 1IXRA 4LWCA 2ZM6Q 1PHJA 1YNXA 4JI4Q 4OWWB 2R7ZG 1E1TA 1RIPA 3WWVA 4HJ9A 4DR4L 4DR2L 4EQ5A 4HJAA 4LF9L 3TS2A 4BXXH 1MJCA 3S2HH 1Y1VG 3W1BA 1B70B 1YJ9A 4ALPA 4HIDA 2EIFA 4UP7A 4GNXC 1PH1A 4A3MG 4JI7L 3I4NH 2UXCL 3T1YQ 1W3SA 2VNUD 2IT1A 4RMFA 1UE6A 4JYAQ 1SRUA 4OWXB 2HIXA 4LW1A 3K7AH 4OO1I 3DM3A 1Q1EA 3ER0A 4A3BH 1KAWA 2XGTA 2NZHA 4KHZA 5GAEC 2UU9L 1HNWQ 1YEZA 1EQQA 4X64Q 1EIYB 4YCWA 3LGJA 3PF5A 2JA5H 4HIMA 1A0IA 1E7ZA 1KD1C 4JI0Q 2OCEA 1IZ6A 2OTJA 1I6HH 4DKAC 2K52A 2RF4A 4PZ8A 2ZM6L 4A3IH 4JI4L 1NMGA 3PIOA 2UUBQ 1A63A 2MFIA 4A3FH 1PA6A 3KJOA 1VQ7A 4DV1Q 4A93G 3CCEA 3T1YL 3KDFB 1XPRA 4JYAL 3TS0A 5FLMG 2D62A 5IT9c 1HZCA 1CKNB 1C9OA 3CCMA 1QVFA 2NVXH 3H0GH 4JOIA 4JV5Q 1QUQA 3JAMc 4OX9Q 4NB3A 3GTPH 1HNWL 4JOIC 2MO1A 4A75A 5IYDH 4X64L 4B3SL 2AWNA 1ASZA 4A3KH 3S1QH 2JE6I 1AH9A 1OXXK 1HR0W 4R4IA 4BXXG 1G6PA 1PYBA 2VY3A 1WYDA 4BY1G 4YWKA 1Z47A 4QGUA 2ZTCA 1QVGA 3CD6A 4X62Q 3I4NG 1VQFA 2CWPA 2CWAA 1XNQQ 2VUMG 5IP9H 3CMAA 1UE7A 3OTOQ 3L0OA 5FJ8H 2E2HH 1NE3A 4DV1L 1PH9A 1IBLQ 1IBKQ 2WB1G 4X65Q 1JE5A 3PUYA 3M85A 1N36Q 3E9IA 1WFQA 1YJWA 1VQEA 1HNXQ 2JA5G 5C3EH 1PV4A 4BBRH 4OX9L 1UE5A 2JA9A 2PQAB 3HOWG 2JK8A 2E2IH 3PCOB 1VQBA 1PH6A 1VQHA 1YVCA 1V1QA 3PSIA 3KF6A 1VQ4A 1Z9FA 5C44G 4JI1L 2KCMA 2R93G 1AE3A 1VQJA 2HQLA 4X62L 3PUWA 1XNQL 4K0KQ 4R4CA 5C0XJ 4B3MQ 5ELOA 3I55A 2YYZA 3CCRA 4DV2Q 3OTOL 4DAMA 1JT8A 3K0XA 4FDBA 4P73A 2KBNA 1IBKL 1X3GA 5IYDG 2XTIA 1OXSC 4X65L 1IBLL 1X65A 1N36L 5IYCH 4L5SA 2UXDQ 2OQ0A 1MJEA 4BY7G 2AKWB 3RN5A 3HOVH 1QZGA 3CPWA 1VQNA 2HIVA 5LMNQ 2B29A 2PI2E 2YTYA 1Y1VH 3ULLA 4GOPB 4A3JH 1HNXL 4DV0Q 1MKHA 4DAYB 1EUJA 1E3PA 1G291 1E24A 1OTCA 3OW2A 1JJCB 2GN5A 1KQSA 4OWTB 4LF5Q 5GROA 1HNZQ 4JI6Q 2Z6KA 2OTLA 3GTKH 1LM0A 4QJFA 4X66Q 3GTMH 1PFSA 4QY7A 1JMCA 1KRTA 3J81c 2JA8G 3CAMA 4GN4B 1VQ8A 2RHQB 1TWCH 4IFDI 4K0KL 1OXVA 1KL9A 2R6GA 3MXNB 4L5TA 4DV2L 4B3ML 3S1MH 4YY3Q 2JQOA 4DR3Q 4JBKA 4B3SQ 3S16H 4LFBQ 3ERSX 3D0FA 4BBRG 1L1OC 3F2BA 1RL2A 3HOXH 1PH3A 1TWFH 3BJUA 2K4KA 2R7DA 1XPOA 3S2DH 5DLQE 2UXDL 1X55A 1PH2A 5IY0A 5LMNL 3U58A 4LNQA 2QA4A 4O2DA 1Q82C 1NY4A 4JI0L 4BA2I 2BA0A 4NPSA 5C4XH 1BVSA 4A4IA 3DLLA 4DV0L 4LF5L 4LF7Q 3PF4A 4A93H 5GADC 1B8AA 1SN8A 4A3DH 1HNZL 4JI6L 4X66L 3A5UA 3K81C 2HHHQ 3GTGH 2VW9A 3S1NH 4DV6Q 1IL2A 5JEAG 1CSPA 1O7IA 2BH2A 1YBYA 3GTLH 1K8GA 1N32L 2EXDA 2FXQA 2Y0SE 4R4OA 5IYBG 2F3IA 4P74A 5GQOA 3HOZG 4L5QA 2R92G 2UXBQ 2Y0SG 1KRSA 2JEAI 3RLFA 1VQ5A 3PUVA 1Q8KA 3J80i 3HOVG 1MIUA 1EIFA 4GNXA 1Q46A 4DR3L 3KLWA 4A3JG 1CKMA 2WAQG 1S3OA 3CW2C 3H15A 1YJNA 4BY1H 1QUQB 1EFWA 1VQGA 3AQQA 4PZ6A 5H1SE 1HJPA 4DV4Q 4LUZA 1KIXA 1XNRQ 2VUMH 4NXNL 5J3BA 4AQYQ 4GN5A 4DR7Q 2PI2A 1D8LA 2LXKA 2RCNA 2JEBI 2KCTA 3KYHC 4GLAC 1T9HA 1U5KA 2CKZB 5M3MG 1R9TH 4JI3Q 1XPUA 4DV3Q 1L0WA 4WJ3M 1L2FA 1BBWA 3GTOH 2HHHL 3CP0A 3CC7A 1WJJA 1CUKA 4R4QA 4DV6L 3I7FA 1Q81C 4JI5Q 2NVTH 4IJLA 1KXLA 2I0QA 1VQAA 3CCUA 4LF6Q 1VS0A 2QGQA 3J7A5 3HOWH 2C35B 2YTVA 3HOXG 4JBMA 2EQSA 3T1HQ 1YHQA 1K8AC 3CC2A 3Q8DA 2HT1A 5BR8Q 4PMWA 5C44H 2UUBL 1J5EQ 1SFOH 4UP9A 1NJIC 5C4XG 2R93H 4A3CH 4C3IH 1D7QA 4DV4L 3M4PA 4BA1I 1EYGA 1XNRL 1G51A 1OXTA 4YWLA 4A3DG 1PH8A 1S72A 3KF6B 1YIJA 1Q12A 3M7NA 4DNIA 3F2DA 4AQYL 1VQ6A 4DR7L 3M4QA 1WI5A 3J81j 3VDYA 4JI3L 3I56A 4DV3L 4HJ8A 1M90C 1PVOA 1B7YB 1K9MC 4BY7H 2PMZE 4JBJA 4IO9A 2YU9H 1CKOA 2B3GA 1TWAH 1Y1WG 4JI5L 5E7NA 4DR6Q 1P8LA 3CCJA 2I5MX 2VS1A 2RHSB 2R7FA 4LUOA 1QVCA 3F1ZA 5EAYA 3ULPA 3T1HL 1FJGQ 4HIOA 4GN3B 1FL0A 1LUZA 5BR8L 2UUCQ 2KENA 3UE1A 4DPGA 3PO3G 4A3GG 1JJ2A 2WB1E 4O0AA 1J5EL 2NN6G 2JA8H 1HH2P 4MTNA 1H95A 3G6EA 2A19A 3G4SA 3G71A 2VQEQ 1YHAA 5LMNW 3I4OA 1SROA 5AJ3Q 4EX5A 4P72A 5C4JH 4TVAB 3CMEA 4JV5L 4JI8Q 3PO2G 1BBUA 3HFZB 2NVQH 3U4VA 1NBWA 3I4MG 2OWOA 2VL6A 4JBWA 4OXPA 3BZCA 4DUZQ 2YV5A 3SGIA 1XJVA 1ASYA 4BBSG 3H3VH 2IX0A 4DR6L 1GKHA 4YWMA 5LMUQ 4AIMA 4A3CG 4RG1A 1FJGL 1V9PA 3KFUA 2ATWA 2UUCL 3UDFA 3I2ZA 5IYBH 1SLJA 3HOZH 3M9BA 1GM5A 2R92H 3JAMi 1E1OA 2L15A 3KF8B 4QIWE 2VQEL 1Q7YC 5AJ3L 3HKZG 2CCZA 1E22A 2OQKA 4JI8L 4WJ4A 3CCSA 5C0XI 1I50H 2YTXA 4YHHQ 2I5LX 1NTGA 2NZOA 5JEAJ 4GNXB 3TEHB 5M3MH 5LMUL 2IX1A 2D0PA 1I5FA 4IOAA 1SE8A 4IPGA 3W1GA 1EOVA 3CCVA 4IOCA 1W2BA 2BA1A 4POFA 2AWOA 3ULJA 3J7ZC 2GVAA 2E5LQ 1L1OA 1KHIA 2BH8A 3CXCA 3PIPA 4A3LG 4XIGS 4XTCS 5M5WH 5M5XH 4B3TQ 1GVPA 4KHPQ 1V43A 2F4VQ 4POGA 2N8NA 2ZTEA 1BKBA 4IPCA 4DV7Q 2ES2A 2A8VA 5JJKA 2PNHA 1WOCA 1P16A 2N78A 2Z0SA 4YHHL 2ZJQA 3HKSA 4YCUA 4HJ5A 4AYBG 1QZHA 3S24A 1X3EA 1LTLA 3TQYA 2MO0A 4LFAQ 3S14H 3AFQA 2K5NA 2Q2TA 4YY3L 1Y1WH 2WAQE 4JI7Q 2IHFA 1Q1BA 1XTDA 2E5LL 2ALYB 3AEVA 3RZOH 4MNOA 4DK6C 1VQLA 1SR3A 3K8AA 4B3TL 2CQOA 1FGUA 3FP9A 4P75A 4KHPL 4A3GH 2F4VL 5M3FH 3PO3H 4HIKA 3FKIH 2K75A 4DV7L 3E9HA 2ZJPA 3TREA 1Y14B 5IYCG 4LF7L 1I3QH 1JB7A 1NMFA 3NBHB 3J81i 4LFCQ 1YI2A 4GOPC 1K73C 4IPDA 1VQDA 3EN2A 2ZJRA 3CPFA 4JC0A 3PO2H 4LFAL 5IP7G 1VQ9A 4L5RC 3UDIA 3I4MH 2UXBL 3EIVA 4DR1Q 1VQKA 4QQBX 4BBSH 3EBEA 2F52A 5IE8A 1X3FA 1UWVA 2N3SA 3HOUH 1K3RA 3RLNA 2B63H 3BU2A 2DGYA 1HZAA 1DGSA 3FHWA 3GTJH 3U4ZA 1WCMH 2VQFQ 2MNAA 4J15A 2AHOB 4C3HH 2V1CC 4UPAA 4A76A 4GKKQ 4Y52H 1JJGA 4LFCL 1SMXA 3NEMA 3KOJA 5GAGC 4OO1G 2WFWA 4PG3A 3UDXA 3PV0A 2H5XA 4KI0A 5IWAQ 1X54A 3KJPA 2NN6I 4JCVE 3HOYH 3PUZA 4LF6L 2D0OA 3F2CA 4C3JH 1GD7A 4A3EG 1VCIA 4R1JA 2IHEA 4DR1L 1TWHH 1I94Q 2JA7G 5M3FG 3A5ZB 3FKIG 2JA6G 1KC8C 3G48A 1PH4A 3IRBA 4LUVA 1U0LA 2GVBA 2K50A 1VQOA 3S15H 1N34Q 3STBD 2Q2UA 3MEFA 3AFPA 3NENA 4GS3A 2VQFL 1FVIA 4GKKL 2AMCB 2KHIA 4MZ9A 2IY5B 2ZTDA 4A3LH 5JJLA 3GDEA 1VQIA 2N49A 3U50C 1PH5A 4LF4Q 1EQRA 4JI1Q 5IWAL 1K0RA 3BZKA 5GAHC 2DUDA 3L2PA 3HOUG 1YITA 5HY6A 1L1OB 3CCQA 4LF8Q 1CSQA 3B6YA 2LXJA 2B63G 4DR5Q 4GKJQ 4PZ7A 1S40A 2ASBA 4A3BG 3PGZA 5FLXc 3CF5A 1Q86C 2JJQA 3OYYA 4DK3C 4P71A 1I94L 4LFBL 3M3YH 1WCMG 5K36G 4ME3A 1IYJB 4X6AH 1HZ9A 1A62A 2UUAQ 4IJHA 1M1KC 1X6OA 4APVA 1N34L 3HKZE 4C2MH 1N33Q 1AE2A 3A0JA 3KDFA 2E8GA 4HJ7A 3CCLA 4A3IG 1VQPA 3HOYG 3F8TA 1C0AA 3ZJYC 1CKNA 1K83H 3UE0A 4Y7NH 2LSSA 4LF4L 3L7ZC 4A3FG 2E2JH 3GTQH 1UEBA 1N8RC 4DUZL 3CQZH 3UDGA 3NELA 3RR5A 1HR0Q 1N9WA 3E0EA 4LF8L 1GO3E
chains in the Genus database with same CATH superfamily
2A68D 4YCVA 4DUYQ 3PUXA 2CQAA 4FF1A 3N6RA 5NUCA 2AQ1B 3H3VI 2R7ZH 3J80c 1XMQQ 3ZYYX 4A3KG 2B2YC 1X9NA 1NUCA 1N33L 1EY5A 2KHJA 3A74A 2CFMA 2A6HC 1SE4A 1ML0D 5CORA 5IP9G 4QUFA 2K5VA 4C1NK 1PH7A 2PQAA 4R4TA 5JJIA 1HQMC 4DR2Q 1XMOL 1S5ED 1H9MA 3W3AA 5CV8A 2EPBA 2WINB 3A7LA 2E75C 1E2WA 4EQPA 2F4IA 4GLVB 4B3RL 3CRKC 3V96A 1PYSB 2B39A 4IUTA 2G5DA 2JA6H 2HDLA 4JI2L 2CH4W 3AU7A 3TBIB 1S4ZA 5I4DA 4UY8C 1J6QA 1S5FD 3S17H 4XQNA 3HOVB 4KD3A 3HS0C 4A3JB 1KABA 4KHVA 5M5YH 3ND9A 2R7ZG 4DR4L 4NKLA 4HJAA 4LF9L 3TS2A 1H9KA 2F0UA 3S2HH 3W1BA 1U4PA 3PMFA 4UP7A 4GNXC 1UE6A 1DM0B 3H94A 2HIXA 4LW1A 4OO1I 1TWCB 2B8FA 3K0YA 4I7ZC 3VR6A 3ER0A 1SXTA 4JK1C 2A6HD 5GAEC 1SYCA 1SJED 3PF5A 2JA5H 1TWFB 4WRDA 2OCEA 1IZ6A 4FXKC 1I6HH 2J0TD 5C5LA 1EWHA 2ZM6L 4A3IH 1NMGA 2JP1A 4P2CB 4A3FH 1PA6A 1A15A 4TKOB 3KJOA 1STAA 3TZUA 3T1YL 3N52A 3KDFB 4IUNA 5EKIA 5LL6S 3S14B 1LLRD 1HZCA 4LK1C 3QG1A 1QUQA 4J8QA 1XX8A 4OX9Q 4JV5Q 1HNWL 2LMCB 4CDFC 4F87A 2AWNA 5BN4A 3S1QH 1EYAA 5I6YA 2VY3A 1Z47A 3CD6A 1VF7A 4X62Q 2F3WA 5FJ8H 3GTOB 2E2HH 2A74C 1RD9D 4ID6A 4DV1L 1PH9A 1ET9A 2NVTB 1EWCA 3QJYA 1V1OA 4DFAA 3PO2B 1CTMA 1QNUA 2VB3X 1WFQA 2DJFC 1HNXQ 2JA5G 1DCZA 4BBRH 5DM73 2JA9A 2PQAB 3PCOB 1VQBA 1VQHA 3VR5A 1PZJD 2BOSA 3J7AF 5C44G 3KLRA 4EVOA 4BWGB 1VQJA 1AZQA 3FPUB 4YIJA 4ZQ3A 2YYZA 3I55A 3CCRA 3OTOL 3R2TA 2GA4B 4F8MA 1X65A 2UXDQ 3BZDB 2OQ0A 4RCNA 2AKWB 3RN5A 3CPWA 2YTYA 3ULLA 1OTCA 5GROA 3T4AC 2KEDA 3PQIA 2Z6KA 1HNZQ 2D2CC 4X66Q 1EU4A 3J81c 2F0EA 3CAMA 4GN4B 2RHQB 3K5OA 1GUTA 3P7JA 2FINB 2JQOA 2EJMA 3ERSX 4BBRG 4JVZA 2QILA 3HOXH 3BJUA 5C4ZA 5DLQE 1PH2A 2QA4A 1NY4A 2XVSA 1BVSA 4A93H 4AYBB 1UEAB 2HHHQ 2KJXA 5JVG3 3HRZC 1YBYA 2EYFA 1N32L 1VDZA 4R4OA 2F3IA 4P74A 4N9TA 1ENAA 4L5QA 2R92G 1JOQA 2EYLA 3D4WA 4XYOA 4DAPA 1D5ZC 4QUCA 1EQTA 5KRUA 3WDNA 1CKMA 3CW2C 1S3OA 4OHJA 5CV4A 1QUQB 4FP5D 1VQGA 4DV4Q 1KIXA 1HJPA 2A69C 4LUZA 2VUMH 1HRJA 5J3BA 1EIGA 4AQYQ 2F0GA 4CDDC 5M3MG 3KYHC 1XPUA 1U5KA 4ZKBB 1FR3A 3O13A 1I4PA 1PTOH 1Q81C 2E2DC 1VQAA 1XWEA 2QGQA 4F7XA 5A2QL 5D3IB 3HOWH 5T1IA 3HOXG 1RDPD 3CC2A 1BUVT 2N88A 2HT1A 2EE1A 1SFOH 1JWMD 2F0WA 1CZWA 4BA1I 1EYGA 5EGTA 2VXWA 1YIJA 4DR7L 3M4QA 3VDYA 1B7YB 4BY7H 5EBDA 1B44D 4A3EB 1TWAH 1Y1WG 2KA7A 1MI2A 1RTNA 1P8LA 2HUGA 2JA7B 3CCJA 4MIUA 3Q6SA 2VS1A 2R7FA 1QVCA 3T1HL 4CJ1B 1FJGQ 2EYPA 2UUCQ 5BR8L 3PO3G 2NVYB 4DPGA 4O0AA 2NN6G 1FGBD 1HH2P 4MTNA 1ICWA 2A69D 2A19A 1PZID 4JW0A 3EVQA 1YHAA 3IKJA 5AJ3Q 1STGA 4P72A 1IL8A 4BBSB 3CMEA 4JI8Q 2NVQH 1F2YA 3K7AB 3VYRA 1LTBD 3BZCA 3MFYA 3A54A 1XJVA 4BBSG 2IX0A 5LMUQ 1SYDA 1V9PA 1DONA 4K5VA 3UDFA 1PRTF 4WORA 5E4XA 2BCOA 1SLJA 5FOBB 2B2TA 1SNQA 4H7BA 1GM5A 5I2YA 3JAMi 3RMHA 1KTKA 4QIWE 4C3JB 2VQEL 2OQKA 1M4VA 4KK7A 2YTXA 2X6GA 3G6JB 2I5LX 1NTGA 4DAVA 2SNSA 3J80E 2EYJA 2EVBA 1SE8A 4IPGA 2M2LA 4OGQC 1M8AA 3W1GA 3K57A 4KTAA 2BA1A 4POFA 2AWOA 3K5MA 2X69A 1EL0A 1F9RA 2BH8A 4KKUA 3PIPA 1U4MA 4B3TQ 4OIKA 3W2DA 1V43A 2A8VA 3GQBA 4J1MA 1P16A 1G6ZA 4YHHL 3HKSA 3KK7A 5EKKA 4HJ5A 1G2TA 1B50A 1LTLA 1KDBA 4LFAQ 1K28A 1K83B 2WAQE 3RZOH 2ALYB 1SR3A 4K6LA 3K8AA 5KYIA 3FP9A 4KHPL 4TSSA 2EOTA 5M3FH 4DV7L 4PMCA 1ZYRC 1YI2A 1K73C 1CA6A 4WJWA 3CPFA 4A3MB 3BG3A 5IP7G 4M1UB 1S5DD 2OEOA 4L5RC 4EQNA 3EIVA 4DR1Q 3L9AX 1I4GA 2LY7A 1L0YB 3BU2A 2AUKA 1Q8IA 3S16B 4C3HH 4GKKQ 3A8JE 2ZXOA 1JJGA 4LFCL 5GAGC 4V0BA 3PV0A 4KI0A 5IWAQ 3KJPA 4FXDA 2NN6I 3HOYH 4LF6L 1A3UA 3F2CA 1AP0A 1GD7A 1HUMA 5DM63 3BS1A 5M3FG 3A5ZB 2HD3A 2HDMA 1PH4A 4KJOA 3IRBA 4LUVA 3M4OB 1LO5D 2GVBA 1EOTA 3S15H 3MEFA 2NYZD 2VQFL 5BN5A 2AMCB 1EY7A 1ZYRD 4MZ9A 4ULLA 3GDEA 3K58A 1RCVD 1GUWA 1CI3M 1PH5A 1JR0D 1SNDA 4JI1Q 4ODGA 3A8IE 3CCQA 4RGTA 4DR5Q 1C8CA 4GKJQ 4IN3A 4PZ7A 1I94L 3OYYA 4DK3C 5CV6A 3M3YH 1CFMA 1IYJB 3DHQA 1D1IA 2UUAQ 5CGKA 1N34L 3HKZE 5HGTA 1B4OA 2HQEA 3OWEB 3HOYG 4CKBA 1C0AA 3BVZA 3ZJYC 5L37A 5LL6X 3UE0A 1I4QA 4CJ0B 3GTQH 2H1EA 1UEBA 1HR0Q 3NELA 2F0IA 4LF8L 3S1RH 3W5OA 1RJTA 1E2VA 3H0GG 2K5HA 2VZAA 3ICEA 3AB9A 1BBXC 4IFDJ 1EY8A 2EYMA 4NXMQ 3J81E 3M7GA 2K1BA 1A3TA 1R4PB 4XXEA 2JA8B 5CR3A 4X3SA 2WP8J 4DV5Q 1C7YA 4TQUS 3TDQA 4K6DA 2IWHA 1HZBA 4DUYL 1H9SA 4OO1H 4R8IA 1MD2D 2F0MA 3ITPA 1KNEA 1LYLA 1XMQL 3FDTA 4HSPA 1X56A 1JCKB 3CC4A 1B9NA 1DXMA 4KN7C 3HOZB 4DAYA 1MSGA 4QL5A 1F9QA 1Y1VB 1PHJA 4R8NA 4JI4Q 1YNXA 1RIPA 3WWVA 1I50B 1CQVA 4EQ5A 4DR2L 4BXXH 3GTMB 2PZTA 1Y1VG 1B70B 1YJ9A 3I4NH 2EIFA 1PH1A 1GUSA 3MXNA 1QOHA 2F0SA 3TSSA 4JYAQ 3DM3A 2J4XA 4A3BH 2RQXA 2XGTA 3KBGA 3BYYB 4DK1A 1YEZA 4X64Q 1SNPA 4RGMA 1EIYB 4YCWA 1BQQT 4IUQA 3P20A 4E6IA 1DZ1A 5CYUA 5CMDA 2RF4A 4PZ8A 5KNBA 5C4XB 2A68C 1A63A 3TP5A 3CCEA 5C5MA 2RCFA 1QVFA 2EY2A 2NVXH 3QO2A 1AW7A 3GTPH 1IHZA 3JAMc 3E0JA 4A75A 1ASZA 2EYOA 3C46A 4A3KH 2JE6I 2IW3A 4R4IA 4BXXG 1EQVA 4BY1G 4MHEA 4QGUA 3I4NG 2CWPA 2CWAA 2RDFA 5IP9H 4ABNA 3J7AV 1QNKA 4JPBW 2NWGA 1IBLQ 1IBKQ 2WB1G 4X65Q 1TS5A 1E2ZA 1TT2A 3I4MB 2SEBD 1PV4A 2QDBA 4OX9L 1EEID 2KUMA 1H9SB 2XWJB 3GTJB 4J6HA 2Q8TA 2R93G 1AE3A 4X62L 2L0CA 3PUWA 5C0XJ 3LX0A 1JICA 5ELDA 1ZEQX 2KBNA 1OXSC 4CDCC 4L5SA 5I6WA 1FNUA 1WVLA 3HOVH 1QZGA 1GHKA 1VQNA 1HNXL 5LMNQ 2B29A 2PI2E 4RCOA 4A3JH 4DAYB 1EUJA 1G291 4LF5Q 1E24A 3OW2A 1JJCB 1ICFB 4OWTB 1KQSA 1HTPA 1LTAD 4JI6Q 2TSSA 1Q3LA 4IQZA 1SEBD 1TWCH 5C4JB 2LKVA 2R6GA 3MXNB 3X3MA 4YY3Q 4DR3Q 4LFBQ 1KLGD 2BDNA 1L1OC 5F2DA 2UXDL 1TWFH 2F03A 2K4KA 2L12A 4FF4A 1TS3A 2K32A 4LNQA 4O2DA 1Q82C 1H95A 4BA2I 2BA0A 4LF7Q 3DLLA 1HNZL 3CKIB 2WKDA 4X66L 3K81C 3GTGH 3S1NH 2B2WC 1G91A 4DV6Q 1CSPA 1O7IA 2FXQA 1SNOA 4K5WA 2UXBQ 1QCBD 5ELCA 4KMUC 4QCLA 3RLFA 1VQ5A 3HOVG 2OXPA 4A3JG 1Q46A 2EJGC 3KLWA 1YJNA 3H15A 3CQZB 1SNMA 2KCCA 5H1SE 5DEHA 2IX3A 1U4RA 4NXNL 1Y8OB 5M9OA 4GN5A 2F0OA 2RCNA 4GLAC 1T9HA 2DJGC 4DV3Q 4DNTB 4HMIA 5LHY1 1A2TA 1BBWA 4FNFA 4DN4M 2HHHL 3CC7A 1WJJA 1CUKA 1GXDC 3GTOH 1KXLA 2NVTH 1STBA 1EZ8A 3CCUA 2F0JA 2YTVA 4JBMA 5EBCA 1YHQA 1K8AC 4OELB 1SSOA 3Q8DA 1JORA 2QF7A 5C44H 1J5EQ 1K8MA 4A3CH 1ILQA 4DV4L 1S72A 5C4HA 2EZVA 1Q12A 4DNIA 2L55A 3F2DA 4AQYL 4ILWA 3QIAA 1WI5A 3J81j 3D6CA 3I56A 5CV5A 1PVOA 1K9MC 4JBJA 4IO9A 2YU9H 1EY6A 1BNZA 1PTOF 5E7NA 4RHSA 5KNCA 2K33A 1CT1D 3NBHA 1I6VC 1HHVA 2JA6B 2J7ZA 3BYTB 5EAYA 4HIOA 1FL0A 3R3OA 4DU9A 1HA5A 3FVQA 3S17B 4RGNA 3QB3A 5FLXL 5M5YB 1S5BD 4QB4A 3DWPA 3S2HB 5IODA 3HOUB 3PO2G 1BBUA 4I7AA 3NSWA 2OWOA 2VL6A 1ASYA 2YV5A 3SGIA 1GKHA 1Y8PB 1WCMB 3OIQA 4AIMA 4A3CG 2JYOA 4RG1A 2I46A 1EY4A 3MVVA 1FJGL 2F0LA 3KFUA 2UUCL 5G3LD 2L4NA 2BE5C 1DOKA 3SVMA 4A3IB 2R92H 4H44C 1K0SA 1H9RA 3NWTA 5AJ3L 5C6AA 4A3FB 1Z7TA 2CCZA 2F0NA 4JI8L 4WJ4A 1LTTD 4Z9CB 3SK4A 1JWSD 2IL8A 2NZOA 5JEAJ 5M3MH 5FO9B 5LMUL 1I5FA 1C48A 3KLSX 3T13A 1W2BA 2QCPX 2GVAA 1FYCA 2O5JC 4IZ8A 5M5WH 1GVPA 2Q8RE 2F4VQ 3NTIA 4IURA 2N8NA 1BKBA 3VYSA 2ES2A 2E2HB 5JJKA 1MGSA 5I2XA 1ENCA 4YCUA 4AYBG 4C2MB 1X3EA 3TQYA 1QILA 1UAPA 1V8QA 2MO0A 1NAPA 1Y1WH 3SE0A 2IHFA 3DM1A 4Y7NB 3AEVA 2Z6BA 4HEDA 2BE5D 2MUYA 2E2JB 4MNOA 4RWSC 1VQLA 4B3TL 2BDOA 2CQOA 2K7VA 2XWBB 3QWNA 4P75A 3PO3H 5FO7B 1B53A 2NN6H 2HCCA 3TREA 5IYCG 3NBHB 2A6EC 4KN4C 5ELBA 4IPDA 3EN2A 4LFAL 1VQ9A 2B2VA 5E1FA 4QQBX 4BBSH 2F52A 1X3FA 2N3SA 3MXUA 3RZDB 2NUCA 4QF4A 2EYHA 3U4ZA 4J15A 2V1CC 3KOJA 2WFWA 2MGSA 5C3WA 3UDXA 2WACA 4DK0A 4A93B 4C3JH 4A3EG 1E0BA 1B9MA 1G8ZD 1VCIA 4DR1L 1TWHH 5TSSA 2JA7G 3JAME 4N8X1 1DJRD 2PNRC 3I90A 1VQOA 1OO9B 3STBD 1SYFA 3AFPA 4GS3A 3NE5B 1TIID 4GKKL 2KHIA 1LTID 2A6ED 5JJLA 3CHBD 2VUMB 1VQIA 2N49A 2SOBA 4DNRB 5IWAL 4S3SA 3L2PA 2IJ0A 4ZKCB 3FRPB 1PTOB 2ASBA 1KDAA 2JJQA 4OL7A 3I8ZA 4P71A 1U9RA 3HOWB 2KECA 4KJNA 1X6OA 3T16A 5COYA 1QE6A 1AE2A 3E5SA 3A0JA 2E8GA 1X3QA 3CCLA 2FFKB 1LTGD 2OF1A 1VQPA 3F8TA 1CKNA 1K83H 4C3JG 4N9PA 5EPKA 4DUZL 3UDGA 2CVRA 1QG7A 1GO3E 3T53B 4DR5L 4GKJL 1IBMQ 4BY7B 2Z4HA 3VR4A 3K80C 4IPHA 1U4LA 1SE3A 4QIWB 3RN2A 5IP7H 2UUAL 1BCPF 2KOLA 2MQHA 5JJZA 4AH6A 3D31A 2I07B 2M00A 4A3MH 4GLXA 2B2UA 2QW7A 4MTKA 2Z6KC 4O42A 1VF5C 1TQOA 1IYVA 1N32Q 5ELFA 1TU2B 4OONA 1SBBB 1HR0L 2L5TA 3EQLC 1II3A 5C3EB 1TS4A 1EWIA 5C0XG 2ZXPA 2NVQB 3RNUA 5C3EG 2DY7A 1EY0A 3GD7A 5HGQA 2UXCQ 3VR2A 2F0FA 3MXPA 2QEXA 1SE2A 4NXML 3DUZA 3GO5A 2EY6A 5EKLA 1OXUA 2UU9Q 3I91A 4F88A 5FLMH 1X3PA 2K14A 4GOPA 1VQCA 3MAQA 1VQMA 2Y0SB 4DV5L 4JG2A 1BO0A 3M4OH 1TWGH 2WAQB 4LWCA 2OTJA 1IYUA 1E1TA 1DOLA 2PQEA 4ALPA 4HIDA 4JI7L 4A3MG 1W3SA 2VNUD 2R3ZA 1PFBA 4OWXB 5E4WC 2NZHA 4KHZA 4X3TA 4CDEC 3HZXA 3FPPA 3LGJA 4HIMA 1A0IA 3S2DB 2RVLA 2O4XA 2WV6D 1LT6D 4JI4L 3D4RA 3J7YW 1TY0A 3PIOA 4A3DB 1MHWC 1SDFA 4LJZC 1DOMA 1VQ7A 3GTLB 1XPRA 4JYAL 3TS0A 5FLMG 2D62A 5IT9c 4XQQA 1C9OA 1CKNB 3D4DA 3H0GH 5A35A 5J1ZA 3SK6A 4JOIC 2K03A 5CV9A 4X64L 2AUJD 1S5CD 1AH9A 1AN8A 1PYBA 1G6PA 1CHPD 2ZTCA 1XNQQ 3VR3A 1J9OA 3CMAA 1UE7A 3DEPA 4WFN3 2MHVA 4FF2A 1GUGA 2PYKA 1JE5A 2C5CA 2PW7A 1N36Q 3E9IA 1YJWA 1VQEA 1JOOA 1PYWD 1UE5A 3KLSA 4K2KA 3DWAA 1F9PA 2E2IH 4G7HC 3SXHA 4C3IB 1WTWA 1NR2A 1Z9FA 4K5XA 2EXZA 1HA6A 2RSOA 2KCMA 2HQLA 1LTSD 4K0KQ 4R4CA 4B3MQ 4DV2Q 1GHJA 3KBXA 3NBIA 3HP3A 1JT8A 4RAUC 1EEFD 3HKZB 3QOLA 1IBLL 1IBKL 4X65L 2X6LA 3NHHA 1CA5A 1MJEA 2B2YA 3GP7A 2HIVA 4GOPB 3CU7A 1Y1VH 1PRTB 4JI0Q 1T5XD 2HCIA 1GUOA 4DV0Q 1E3PA 2GN5A 2DNCA 4O1NA 1QWYA 3OMCA 3GTKH 2Z1CA 3GTMH 1LM0A 4QJFA 1PFSA 1WTPA 4QY7A 4G7ZC 1KRTA 3S15B 3OIPA 2JA8G 1OXVA 1KL9A 4L5TA 3S1MH 2K6AA 4JBKA 1A2UA 4B3SQ 2PO4A 3D0FA 3F2BA 1NR4A 1PH3A 1XPOA 1X55A 4ZLTF 1UUPA 1Z6HA 3K6OA 5IY0A 4PMBA 3TP7A 5LMNL 4NPSA 5C4XH 4A4IA 4LF5L 3M3YB 2DN8A 5GADC 1B8AA 1GUNA 3SK5A 4JI6L 1CM9A 5C3XA 1TS2A 2VW9A 2XIWA 1IL2A 5JEAG 2BH2A 3DEOA 2K28A 1LT3D 5IYBG 5GQOA 5KIXA 3HOZG 5KNDA 1MIUA 1EIFA 2F0PA 4GNXA 3I3CA 3KUPA 4DR3L 2UUBQ 3OOCA 4BY1H 4LFBL 3AQQA 1XNRQ 3S1RB 4LAAA 1NCVA 1JQYD 3GV6A 2PI2A 1D8LA 4L8JA 3QR8A 2KCTA 2KCNA 2NTTA 1R9TH 4JI3Q 3OW7A 1L2FA 4CKEA 2FMMA 5M5XB 1WD1A 4DV6L 4JI5Q 4IJLA 2I0QA 4LF6Q 2MJ8A 1VS0A 2QDLA 3F2UA 3GTPB 2MPMA 5JOBA 3I4LA 2EDGA 1BF4A 5IGGA 4PQXA 4KV6A 3NTKA 1WTVA 1NJIC 5C4XG 2R93H 1PZKD 3H3VC 1HUNA 3JAML 3NXWA 4DV3L 2OT2A 3D3RA 2PMZE 1CKOA 2B3GA 4DR6Q 4A3GB 3FKIB 1ZXTA 4LUOA 3ULPA 1I4RA 1HFGA 1I3QB 1SMYC 3ERQA 4GN3B 4A3GG 3UE1A 1JJ2A 2WB1E 1J5EL 2F0HA 1JOKA 4FYDA 3G6EA 5JPNC 4CJ2C 4RFBA 5EPJA 1B1ZA 3TN2A 4RHRA 3I4OA 1SROA 4UAIA 4EX5A 5C4JH 4L6TB 4TVAB 4JV5L 2L1BA 1NNXA 3IAYA 3HFZB 2L9HA 3A56A 1NBWA 2EY1A 3I4MG 2B63B 4XDXA 5D65A 4JBWA 1TKWB 4A3BB 3PIO3 2FHTA 1HQRD 3ND8A 2RDHA 2F1MA 3Q0AA 2N55A 3NWSA 3I2ZA 1F9SA 3M9BA 2L15A 1Q7YC 2AQ3B 3J80L 1MSHA 2Z9HA 2PCFB 3CCSA 3A7AB 4CBVA 2PZUA 4XT3B 4GNXB 3TEHB 1WTQA 1YNJC 1SMYD 4PNYA 4IOCA 4V190 4A3KB 3ULJA 5E3FA 2E5LQ 3CXCA 5JPMC 4A3LG 4XIGS 3LNNA 1SNCA 3EJIA 3MXGA 3A55A 4IPCA 1PXUA 2E74C 2PNHA 2N78A 3G7LA 3C1FA 4QMGA 3T51B 1TR5A 2K01A 5KYLA 5ISRA 3S14H 2EY5A 3AFQA 1STHA 3SK8A 1ENFA 2K5NA 2Q2TA 4G4KA 4KD4A 1XTDA 3A8KE 4UHVA 3AMUA 5HURA 1FGUA 2SNMA 4DXFA 2F4VL 4IUPA 3E9HA 2K05A 4L63B 2XSCA 3R93A 1Y69U 1LV9A 1NMFA 1JB7A 1GJXA 2CW0D 1K8OA 2R7ZB 5DNFA 3MHBA 1XYIA 3V05A 4JC0A 3PO2H 1YNJD 1L0XB 3UDIA 3S9WA 3EBEA 3HOUH 2D9UA 3TZDA 3BDOA 1O7ZA 2DGYA 2R61A 1WTRA 4LMQD 1DGSA 1I4HA 2PW5A 5K36H 1WCMH 3MA2B 4XYQA 2AHOB 4A76A 1V1PA 4UPAA 3X3NA 1BXTA 1O7LA 1SAPA 3NEMA 5K5PA 2H5XA 1FD7D 1DD2A 1X54A 2D0OA 4C56C 5IT9E 4R1JA 2IHEA 3EROA 3GTGB 3S1NB 3NTHA 3HGBA 1LT5D 4I65A 2JA6G 1CQFA 1STNA 1KC8C 3VA7A 1EZ6A 2WKCA 1LTRD 3SHLA 3I70A 1IW7C 1FNVA 1FVIA 2QKIC 4RH6A 5FKAC 1Y8NB 2ZXRA 4LF4Q 1B2TA 1EQRA 4C1NI 5GAHC 2DUDA 3SR1A 3HOUG 4U68A 2FJ2A 1CSQA 3B6YA 4EGVA 3PGZA 4CHTB 5FLXc 3CF5A 1Q86C 3URYA 5K36G 2JA5B 1WCMG 2XN9C 5D3DA 3OSOA 1I6HB 1A62A 3CRLC 4IJHA 1D1KA 1M1KC 3I73A 4C2MH 1N33Q 4IFDH 5C44B 1XXGA 2DY8A 3BVMA 4A3IG 1EIHA 1PFMA 2V4DA 4Y7NH 3L7ZC 4A3FG 2E2JH 5KEEA 4NW2A 2LS01 3RR5A 4B9WA 1N9WA 3E0EA 5IYCH 3J81L 4ZUIA 1KLUD 1XMOQ 2YU9B 1MBYA 3TRZA 3S1QB 2A1AA 4UP8A 5DAUA 2ID0A 3OMGA 5CBAE 1VMPA 4ZCKA 1IW7D 5D14A 3WOEA 4B3RQ 4UDUC 4JI2Q 1TXYA 2O5IC 4ZYSA 5EPLA 4Q5VA 4AYBE 5FJ8G 3RZDH 2K5QA 4DA2A 4OIJA 4BBRB 3NQIA 3D8GA 3EFXD 2TMPA 4ZRZA 4DR4Q 1IBML 1HTLD 4LF9Q 2G9DA 1D2BA 2I5HA 3HG9A 4IFDG 1YZ6A 4KY7A 1V1PB 1RF2D 4NXNQ 2O2LD 3LWUA 4A3EH 3AYHB 4H02A 3JC66 2WIIB 2JA7H 5FK9C 3STBC 1K3BC 3H91A 1VMCA 1BOSA 1UE1A 1LT4D 2B8GA 3WOFA 2R92B 4KLKA 3RLOA 2NVYH 5ELNA 5JAVA 1W6KA 4IUUA 2Q2IA 1A8VA 4RKBA 1YHBA 2Q2HA 3K7UC 4HCEA 3DWQA 1IXRA 2ZM6Q 4OWWB 4NDXA 4XQJA 4HJ9A 1WTHA 5CBEE 4CKCA 1MJCA 4RGOS 2UXCL 2IPKD 3T1YQ 5M3MB 1HFNA 2IT1A 4RMFA 1SRUA 3FEWX 3K7AH 3TP6A 3ONAB 1Q1EA 1AZPA 1KAWA 3NPPA 2UU9L 1HNWQ 1EQQA 4R9WA 5M5WB 3HOXB 1E7ZA 1KNAA 1KD1C 5I9OA 4DKAC 1HXYD 1RTOA 2K52A 1ESFA 3DXJC 1PMRA 2D5DA 5IOCA 1WTOA 4G7OC 2MFIA 4HCSA 5IGFA 1O7YA 4DV1Q 4A93G 1EU3A 2KHSA 1RODA 4M8AA 1F77A 3M4YA 5EJWA 3OPOA 4KKSA 3CCMA 1X32A 4HAEA 4JOIA 1Y1WB 1SJHD 1Q90A 1ESRA 5IYDH 4NB3A 2MO1A 1TY2A 2AQ2B 3L3OC 1O80A 1OXXK 1HR0W 4H13C 3PO3B 1WYDA 1QVGA 4YWKA 1VQFA 3R2IA 2VUMG 3NP8A 1STYA 3OTOQ 3L0OA 1RHPA 1O78A 1NE3A 3MTSA 5C0XH 1PLFA 3PUYA 3M85A 1D5XC 3E3XA 5C3EH 4DF7A 1JWUD 3NUCA 3HOWG 4H0LC 2JK8A 1SFOB 1PH6A 3PSIA 1YVCA 1V1QA 4IALA 1STEA 3KF6A 1VQ4A 5BN3A 4FVMA 3MWYW 3HEJA 2F0VA 2JN4A 4JI1L 2M9VA 1XNQL 1BDOA 1A6XA 5ELOA 4DAMA 1TWAB 3K0XA 4FDBA 4P73A 3T56B 1X3GA 5IYDG 1C4QA 2XTIA 3C2PA 1N36L 4BY7G 2Z4IA 1TWHB 1MKHA 1T5EA 1AEXA 3Q24A 3H09A 2OTLA 1JMCA 4GZYC 1ONLA 1VQ8A 4IFDI 4HN7A 4ZK9B 4K0KL 1BR9A 4B3ML 4DV2L 3EA6A 2ZT9C 4HMJA 5IIFA 3S16H 1SYBA 2CH4A 1EFID 1RL2A 2R7DA 3S2DH 5J39A 3IL8A 1PTOC 3U58A 4JI0L 4DV0L 3PF4A 1KDCA 1SN8A 5KGUA 4FO2A 3BVGA 3KF8A 3IFTA 4KKTA 3A5UA 4A3DH 1QJOA 2G9HD 5I9PA 3GTLH 1K8GA 2EXDA 1LACA 2Y0SE 4Q0FA 3SEBA 3VA5A 2RA4A 2Y0SG 1KRSA 2JEAI 1B3AA 1EY9A 3PUVA 1Q8KA 3J80i 1D5MC 4B3SL 2WAQG 2MP1A 1EFWA 1NSNS 1R4QB 1G2SA 4PZ6A 4FXGC 4DR7Q 4IUVA 2C9OA 1UNSA 5ELEA 2LXKA 2JEBI 2CKZB 5IGBA 1L0WA 3TMEA 2XNAC 3CP0A 4R4QA 1QB5D 3I7FA 1EYDA 4B9XA 4X3KA 3J7A5 1W6JA 2C35B 3D6WA 2EQSA 3T1HQ 5CC4A 2F0KA 2B2VC 5BR8Q 4PMWA 2UUBL 5T1GA 4UP9A 3Q22A 4C3IH 1D7QA 2F0QA 3M4PA 1XNRL 1G51A 1OXTA 4HTHA 4YWLA 1PH8A 1PTOD 4A3DG 3KF6B 2RDGA 3M7NA 5IT9L 1VQ6A 2NZ1D 1CZGA 3RZOB 2KEEA 4JI3L 3VYTA 4HJ8A 2XRQD 1M90C 4CGYB 4JI5L 2I5MX 2RHSB 5M3FB 4DGZA 3F1ZA 1F2ZA 1LUZA 1GOZA 2KENA 2FMCA 3U9OA 1PFNA 2JA8H 2JSOA 3LWEA 1TWGB 3G4SA 3G71A 2Z8LA 2VQEQ 5LMNW 2NBFA 2A73B 4HR7B 4U673 1YNNC 3U4VA 5FLXE 1D6EC 4OXPA 4DUZQ 2NTSA 4DR6L 3H3VH 1SYEA 4YWMA 3OWFA 2PZWA 4C3HB 4C3IG 1WD0A 2NB0A 3H6MA 1SYGA 4FF3A 2ATWA 5JEAH 3VYUA 4K8IA 4C3HG 1H9JA 3P1HA 5IYBH 4ME5A 3HOZH 3HOYB 3R8BA 1E1OA 3KF8B 2B2TC 4KY6A 2ICEC 1KAAA 5EQ0A 4MN3A 3HKZG 1E22A 5G3LF 5C0XI 1I50H 2F3VA 4YHHQ 2JXMB 3H0GB 2IX1A 2F0DA 2D0PA 3K59A 1F2MA 4IOAA 4K14A 1AFPA 3CCVA 1EOVA 5JVH3 2F0TA 3J7ZC 2H4OA 1IKMA 1L1OA 1KHIA 4B08A 5FO8B 3RD4A 4XTCS 5M5XH 3OHXC 2SDFA 4RKLA 4N8FA 4KHPQ 1JE4A 4POGA 1I4XA 4X3UA 2ZTEA 3MC0B 4DV7Q 1TVXA 3E6ZX 2B2UC 1WOCA 1YNND 4RA8A 3RUZA 1CHQD 2B2WA 2Z0SA 1XTCD 1BCPB 4NMZA 2ZJQA 4KY5A 4XT1B 2LFNA 1QZHA 4EQOA 2CHBD 3S24A 2E2IB 2P5ZX 4YY3L 4G57A 1DYQA 4JI7Q 1Q1BA 2E5LL 2L11A 4K2LA 3GTQB 4DK6C 3C1EA 3TP8A 1JB3A 1A3VA 1EYCA 4K8JA 4A3GH 4HIKA 3FKIH 2K75A 2ZJPA 4LF7L 1Y14B 1ET6A 1I3QH 3J81i 4LFCQ 5IGCA 3BDLA 4GOPC 1PRTC 1VQDA 2ZJRA 3NK9A 2K04A 3SDZA 4HSVA 3V2TA 3DMUA 5AFWA 3GTKB 3I4MH 2UXBL 3PIP3 5IGDA 3UI2A 4DXGA 1VQKA 5IE8A 1FNWA 3QOJA 1UWVA 3GV3A 1K3RA 2RKSA 3K5NA 3RLNA 2B63H 3S1MB 1F2LA 1HZAA 3FHWA 4NP5A 5A2QE 3GTJH 3NQTA 1HPCA 2VQFQ 2MNAA 2ICIA 3K5LA 4Y52H 2RSNA 1SMXA 4OO1G 4PG3A 4TRDA 1LABA 4JCVE 3PUZA 1HCZA 2PPBC 1BCPC 1PDQA 3Q23A 4BS9A 2XRSD 5IGEA 1I94Q 1ZKOA 3FKIG 2RBMA 3BDCA 3G48A 4PV1C 5J22A 1U0LA 2K50A 3FMCA 3U9SA 1N34Q 2DNEA 2Q2UA 2K5DA 3P75A 3NENA 1J8IA 2PMZB 3IFDA 1RKNA 2K5WA 5CV7A 4BY1B 3I4NB 2EJFC 2IY5B 1IKLA 2ZTDA 4ZAIA 4A3LH 3U50C 1JC7A 3C3LA 4OEMB 1PRTD 2KVMA 2KQ3A 1K0RA 3BZKA 1YITA 5HY6A 1L1OB 2E76C 3MFGA 4LF8Q 2WB1B 1R9TB 2LXJA 3MEHA 2B63G 1S40A 4A3BG 4WJ3M 3MZ5A 4ME3A 1WTXA 4X6AH 1B3QA 1HZ9A 2ENBA 4APVA 3I72A 1CK1A 3KDFA 4HJ7A 2R93B 4ZUJA 1ILPA 2LSSA 4LF4L 2CW0C 2Q8IB 1N8RC 3CQZH 2QEJC 2NVXB 2VB2X 2A5HA 1BCPD
chains in the Genus database with same CATH topology
4YCVA 4DUYQ 3PUXA 4DR5L 3W5OA 3S1RH 1IBMQ 4GKJL 1XMOQ 3TRZA 3H0GG 2K5HA 2VZAA 3K80C 4IPHA 3ICEA 4IFDJ 2A1AA 4UP8A 3H3VI 2R7ZH 3RN2A 3J80c 1XMQQ 5IP7H 2UUAL 2ID0A 2MQHA 4A3KG 4AH6A 3D31A 1X9NA 4NXMQ 1N33L 2KHJA 3A74A 4A3MH 2CFMA 4B3RQ 4GLXA 4JI2Q 5IP9G 1TXYA 2Z6KC 2WP8J 4AYBE 2K5VA 5FJ8G 4DV5Q 3RZDH 4OONA 4TQUS 1PH7A 2PQAA 1C7YA 1HR0L 1N32Q 4R4TA 1EWIA 5C0XG 1HZBA 5JJIA 4DUYL 4DR4Q 1IBML 4DR2Q 3RNUA 1XMOL 4LF9Q 5C3EG 2I5HA 3GD7A 5HGQA 2UXCQ 4IFDG 1LYLA 1YZ6A 4NXNQ 1XMQL 2QEXA 4A3EH 3AYHB 4NXML 1X56A 4H02A 3JC66 2JA7H 3STBC 3GO5A 4GLVB 4B3RL 1OXUA 2UU9Q 1PYSB 3CC4A 2JA6H 4JI2L 5FLMH 1UE1A 2K14A 4KLKA 1VQCA 4GOPA 3RLOA 1VQMA 2NVYH 4UY8C 1J6QA 5ELNA 4DV5L 3S17H 4JG2A 4QL5A 2Q2IA 1A8VA 3M4OH 1YHBA 2Q2HA 3K7UC 5M5YH 1TWGH 1IXRA 4LWCA 2ZM6Q 1PHJA 1YNXA 4JI4Q 4OWWB 2R7ZG 1E1TA 1RIPA 3WWVA 4HJ9A 4DR4L 4DR2L 4EQ5A 4HJAA 4LF9L 3TS2A 4BXXH 1MJCA 3S2HH 1Y1VG 3W1BA 1B70B 1YJ9A 4ALPA 4HIDA 2EIFA 4UP7A 4GNXC 1PH1A 4A3MG 4JI7L 3I4NH 2UXCL 3T1YQ 1W3SA 2VNUD 2IT1A 4RMFA 1UE6A 4JYAQ 1SRUA 4OWXB 2HIXA 4LW1A 3K7AH 4OO1I 3DM3A 1Q1EA 3ER0A 4A3BH 1KAWA 2XGTA 2NZHA 4KHZA 5GAEC 2UU9L 1HNWQ 1YEZA 1EQQA 4X64Q 1EIYB 4YCWA 3LGJA 3PF5A 2JA5H 4HIMA 1A0IA 1E7ZA 1KD1C 4JI0Q 2OCEA 1IZ6A 2OTJA 1I6HH 4DKAC 2K52A 2RF4A 4PZ8A 2ZM6L 4A3IH 4JI4L 1NMGA 3PIOA 2UUBQ 1A63A 2MFIA 4A3FH 1PA6A 3KJOA 1VQ7A 4DV1Q 4A93G 3CCEA 3T1YL 3KDFB 1XPRA 4JYAL 3TS0A 5FLMG 2D62A 5IT9c 1HZCA 1CKNB 1C9OA 3CCMA 1QVFA 2NVXH 3H0GH 4JOIA 4JV5Q 1QUQA 3JAMc 4OX9Q 4NB3A 3GTPH 1HNWL 4JOIC 2MO1A 4A75A 5IYDH 4X64L 4B3SL 2AWNA 1ASZA 4A3KH 3S1QH 2JE6I 1AH9A 1OXXK 1HR0W 4R4IA 4BXXG 1G6PA 1PYBA 2VY3A 1WYDA 4BY1G 4YWKA 1Z47A 4QGUA 2ZTCA 1QVGA 3CD6A 4X62Q 3I4NG 1VQFA 2CWPA 2CWAA 1XNQQ 2VUMG 5IP9H 3CMAA 1UE7A 3OTOQ 3L0OA 5FJ8H 2E2HH 1NE3A 4DV1L 1PH9A 1IBLQ 1IBKQ 2WB1G 4X65Q 1JE5A 3PUYA 3M85A 1N36Q 3E9IA 1WFQA 1YJWA 1VQEA 1HNXQ 2JA5G 5C3EH 1PV4A 4BBRH 4OX9L 1UE5A 2JA9A 2PQAB 3HOWG 2JK8A 2E2IH 3PCOB 1VQBA 1PH6A 1VQHA 1YVCA 1V1QA 3PSIA 3KF6A 1VQ4A 1Z9FA 5C44G 4JI1L 2KCMA 2R93G 1AE3A 1VQJA 2HQLA 4X62L 3PUWA 1XNQL 4K0KQ 4R4CA 5C0XJ 4B3MQ 5ELOA 3I55A 2YYZA 3CCRA 4DV2Q 3OTOL 4DAMA 1JT8A 3K0XA 4FDBA 4P73A 2KBNA 1IBKL 1X3GA 5IYDG 2XTIA 1OXSC 4X65L 1IBLL 1X65A 1N36L 5IYCH 4L5SA 2UXDQ 2OQ0A 1MJEA 4BY7G 2AKWB 3RN5A 3HOVH 1QZGA 3CPWA 1VQNA 2HIVA 5LMNQ 2B29A 2PI2E 2YTYA 1Y1VH 3ULLA 4GOPB 4A3JH 1HNXL 4DV0Q 1MKHA 4DAYB 1EUJA 1E3PA 1G291 1E24A 1OTCA 3OW2A 1JJCB 2GN5A 1KQSA 4OWTB 4LF5Q 5GROA 1HNZQ 4JI6Q 2Z6KA 2OTLA 3GTKH 1LM0A 4QJFA 4X66Q 3GTMH 1PFSA 4QY7A 1JMCA 1KRTA 3J81c 2JA8G 3CAMA 4GN4B 1VQ8A 2RHQB 1TWCH 4IFDI 4K0KL 1OXVA 1KL9A 2R6GA 3MXNB 4L5TA 4DV2L 4B3ML 3S1MH 4YY3Q 2JQOA 4DR3Q 4JBKA 4B3SQ 3S16H 4LFBQ 3ERSX 3D0FA 4BBRG 1L1OC 3F2BA 1RL2A 3HOXH 1PH3A 1TWFH 3BJUA 2K4KA 2R7DA 1XPOA 3S2DH 5DLQE 2UXDL 1X55A 1PH2A 5IY0A 5LMNL 3U58A 4LNQA 2QA4A 4O2DA 1Q82C 1NY4A 4JI0L 4BA2I 2BA0A 4NPSA 5C4XH 1BVSA 4A4IA 3DLLA 4DV0L 4LF5L 4LF7Q 3PF4A 4A93H 5GADC 1B8AA 1SN8A 4A3DH 1HNZL 4JI6L 4X66L 3A5UA 3K81C 2HHHQ 3GTGH 2VW9A 3S1NH 4DV6Q 1IL2A 5JEAG 1CSPA 1O7IA 2BH2A 1YBYA 3GTLH 1K8GA 1N32L 2EXDA 2FXQA 2Y0SE 4R4OA 5IYBG 2F3IA 4P74A 5GQOA 3HOZG 4L5QA 2R92G 2UXBQ 2Y0SG 1KRSA 2JEAI 3RLFA 1VQ5A 3PUVA 1Q8KA 3J80i 3HOVG 1MIUA 1EIFA 4GNXA 1Q46A 4DR3L 3KLWA 4A3JG 1CKMA 2WAQG 1S3OA 3CW2C 3H15A 1YJNA 4BY1H 1QUQB 1EFWA 1VQGA 3AQQA 4PZ6A 5H1SE 1HJPA 4DV4Q 4LUZA 1KIXA 1XNRQ 2VUMH 4NXNL 5J3BA 4AQYQ 4GN5A 4DR7Q 2PI2A 1D8LA 2LXKA 2RCNA 2JEBI 2KCTA 3KYHC 4GLAC 1T9HA 1U5KA 2CKZB 5M3MG 1R9TH 4JI3Q 1XPUA 4DV3Q 1L0WA 4WJ3M 1L2FA 1BBWA 3GTOH 2HHHL 3CP0A 3CC7A 1WJJA 1CUKA 4R4QA 4DV6L 3I7FA 1Q81C 4JI5Q 2NVTH 4IJLA 1KXLA 2I0QA 1VQAA 3CCUA 4LF6Q 1VS0A 2QGQA 3J7A5 3HOWH 2C35B 2YTVA 3HOXG 4JBMA 2EQSA 3T1HQ 1YHQA 1K8AC 3CC2A 3Q8DA 2HT1A 5BR8Q 4PMWA 5C44H 2UUBL 1J5EQ 1SFOH 4UP9A 1NJIC 5C4XG 2R93H 4A3CH 4C3IH 1D7QA 4DV4L 3M4PA 4BA1I 1EYGA 1XNRL 1G51A 1OXTA 4YWLA 4A3DG 1PH8A 1S72A 3KF6B 1YIJA 1Q12A 3M7NA 4DNIA 3F2DA 4AQYL 1VQ6A 4DR7L 3M4QA 1WI5A 3J81j 3VDYA 4JI3L 3I56A 4DV3L 4HJ8A 1M90C 1PVOA 1B7YB 1K9MC 4BY7H 2PMZE 4JBJA 4IO9A 2YU9H 1CKOA 2B3GA 1TWAH 1Y1WG 4JI5L 5E7NA 4DR6Q 1P8LA 3CCJA 2I5MX 2VS1A 2RHSB 2R7FA 4LUOA 1QVCA 3F1ZA 5EAYA 3ULPA 3T1HL 1FJGQ 4HIOA 4GN3B 1FL0A 1LUZA 5BR8L 2UUCQ 2KENA 3UE1A 4DPGA 3PO3G 4A3GG 1JJ2A 2WB1E 4O0AA 1J5EL 2NN6G 2JA8H 1HH2P 4MTNA 1H95A 3G6EA 2A19A 3G4SA 3G71A 2VQEQ 1YHAA 5LMNW 3I4OA 1SROA 5AJ3Q 4EX5A 4P72A 5C4JH 4TVAB 3CMEA 4JV5L 4JI8Q 3PO2G 1BBUA 3HFZB 2NVQH 3U4VA 1NBWA 3I4MG 2OWOA 2VL6A 4JBWA 4OXPA 3BZCA 4DUZQ 2YV5A 3SGIA 1XJVA 1ASYA 4BBSG 3H3VH 2IX0A 4DR6L 1GKHA 4YWMA 5LMUQ 4AIMA 4A3CG 4RG1A 1FJGL 1V9PA 3KFUA 2ATWA 2UUCL 3UDFA 3I2ZA 5IYBH 1SLJA 3HOZH 3M9BA 1GM5A 2R92H 3JAMi 1E1OA 2L15A 3KF8B 4QIWE 2VQEL 1Q7YC 5AJ3L 3HKZG 2CCZA 1E22A 2OQKA 4JI8L 4WJ4A 3CCSA 5C0XI 1I50H 2YTXA 4YHHQ 2I5LX 1NTGA 2NZOA 5JEAJ 4GNXB 3TEHB 5M3MH 5LMUL 2IX1A 2D0PA 1I5FA 4IOAA 1SE8A 4IPGA 3W1GA 1EOVA 3CCVA 4IOCA 1W2BA 2BA1A 4POFA 2AWOA 3ULJA 3J7ZC 2GVAA 2E5LQ 1L1OA 1KHIA 2BH8A 3CXCA 3PIPA 4A3LG 4XIGS 4XTCS 5M5WH 5M5XH 4B3TQ 1GVPA 4KHPQ 1V43A 2F4VQ 4POGA 2N8NA 2ZTEA 1BKBA 4IPCA 4DV7Q 2ES2A 2A8VA 5JJKA 2PNHA 1WOCA 1P16A 2N78A 2Z0SA 4YHHL 2ZJQA 3HKSA 4YCUA 4HJ5A 4AYBG 1QZHA 3S24A 1X3EA 1LTLA 3TQYA 2MO0A 4LFAQ 3S14H 3AFQA 2K5NA 2Q2TA 4YY3L 1Y1WH 2WAQE 4JI7Q 2IHFA 1Q1BA 1XTDA 2E5LL 2ALYB 3AEVA 3RZOH 4MNOA 4DK6C 1VQLA 1SR3A 3K8AA 4B3TL 2CQOA 1FGUA 3FP9A 4P75A 4KHPL 4A3GH 2F4VL 5M3FH 3PO3H 4HIKA 3FKIH 2K75A 4DV7L 3E9HA 2ZJPA 3TREA 1Y14B 5IYCG 4LF7L 1I3QH 1JB7A 1NMFA 3NBHB 3J81i 4LFCQ 1YI2A 4GOPC 1K73C 4IPDA 1VQDA 3EN2A 2ZJRA 3CPFA 4JC0A 3PO2H 4LFAL 5IP7G 1VQ9A 4L5RC 3UDIA 3I4MH 2UXBL 3EIVA 4DR1Q 1VQKA 4QQBX 4BBSH 3EBEA 2F52A 5IE8A 1X3FA 1UWVA 2N3SA 3HOUH 1K3RA 3RLNA 2B63H 3BU2A 2DGYA 1HZAA 1DGSA 3FHWA 3GTJH 3U4ZA 1WCMH 2VQFQ 2MNAA 4J15A 2AHOB 4C3HH 2V1CC 4UPAA 4A76A 4GKKQ 4Y52H 1JJGA 4LFCL 1SMXA 3NEMA 3KOJA 5GAGC 4OO1G 2WFWA 4PG3A 3UDXA 3PV0A 2H5XA 4KI0A 5IWAQ 1X54A 3KJPA 2NN6I 4JCVE 3HOYH 3PUZA 4LF6L 2D0OA 3F2CA 4C3JH 1GD7A 4A3EG 1VCIA 4R1JA 2IHEA 4DR1L 1TWHH 1I94Q 2JA7G 5M3FG 3A5ZB 3FKIG 2JA6G 1KC8C 3G48A 1PH4A 3IRBA 4LUVA 1U0LA 2GVBA 2K50A 1VQOA 3S15H 1N34Q 3STBD 2Q2UA 3MEFA 3AFPA 3NENA 4GS3A 2VQFL 1FVIA 4GKKL 2AMCB 2KHIA 4MZ9A 2IY5B 2ZTDA 4A3LH 5JJLA 3GDEA 1VQIA 2N49A 3U50C 1PH5A 4LF4Q 1EQRA 4JI1Q 5IWAL 1K0RA 3BZKA 5GAHC 2DUDA 3L2PA 3HOUG 1YITA 5HY6A 1L1OB 3CCQA 4LF8Q 1CSQA 3B6YA 2LXJA 2B63G 4DR5Q 4GKJQ 4PZ7A 1S40A 2ASBA 4A3BG 3PGZA 5FLXc 3CF5A 1Q86C 2JJQA 3OYYA 4DK3C 4P71A 1I94L 4LFBL 3M3YH 1WCMG 5K36G 4ME3A 1IYJB 4X6AH 1HZ9A 1A62A 2UUAQ 4IJHA 1M1KC 1X6OA 4APVA 1N34L 3HKZE 4C2MH 1N33Q 1AE2A 3A0JA 3KDFA 2E8GA 4HJ7A 3CCLA 4A3IG 1VQPA 3HOYG 3F8TA 1C0AA 3ZJYC 1CKNA 1K83H 3UE0A 4Y7NH 2LSSA 4LF4L 3L7ZC 4A3FG 2E2JH 3GTQH 1UEBA 1N8RC 4DUZL 3CQZH 3UDGA 3NELA 3RR5A 1HR0Q 1N9WA 3E0EA 4LF8L 1GO3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCV A;  4DUY Q;  3PUX A;  4DR5 L;  3W5O A;  3S1R H;  1IBM Q;  4GKJ L;  1XMO Q;  3TRZ A;  3H0G G;  2K5H A;  2VZA A;  3K80 C;  4IPH A;  3ICE A;  4IFD J;  2A1A A;  4UP8 A;  3H3V I;  2R7Z H;  3RN2 A;  3J80 c;  1XMQ Q;  5IP7 H;  2UUA L;  2ID0 A;  2MQH A;  4A3K G;  4AH6 A;  3D31 A;  1X9N A;  4NXM Q;  1N33 L;  2KHJ A;  3A74 A;  4A3M H;  2CFM A;  4B3R Q;  4GLX A;  4JI2 Q;  5IP9 G;  1TXY A;  2Z6K C;  2WP8 J;  4AYB E;  2K5V A;  5FJ8 G;  4DV5 Q;  3RZD H;  4OON A;  4TQU S;  1PH7 A;  2PQA A;  1C7Y A;  1HR0 L;  1N32 Q;  4R4T A;  1EWI A;  5C0X G;  1HZB A;  5JJI A;  4DUY L;  4DR4 Q;  1IBM L;  4DR2 Q;  3RNU A;  1XMO L;  4LF9 Q;  5C3E G;  2I5H A;  3GD7 A;  5HGQ A;  2UXC Q;  4IFD G;  1LYL A;  1YZ6 A;  4NXN Q;  1XMQ L;  2QEX A;  4A3E H;  3AYH B;  4NXM L;  1X56 A;  4H02 A;  3JC6 6;  2JA7 H;  3STB C;  3GO5 A;  4GLV B;  4B3R L;  1OXU A;  2UU9 Q;  1PYS B;  3CC4 A;  2JA6 H;  4JI2 L;  5FLM H;  1UE1 A;  2K14 A;  4KLK A;  1VQC A;  4GOP A;  3RLO A;  1VQM A;  2NVY H;  4UY8 C;  1J6Q A;  5ELN A;  4DV5 L;  3S17 H;  4JG2 A;  4QL5 A;  2Q2I A;  1A8V A;  3M4O H;  1YHB A;  2Q2H A;  3K7U C;  5M5Y H;  1TWG H;  1IXR A;  4LWC A;  2ZM6 Q;  1PHJ A;  1YNX A;  4JI4 Q;  4OWW B;  2R7Z G;  1E1T A;  1RIP A;  3WWV A;  4HJ9 A;  4DR4 L;  4DR2 L;  4EQ5 A;  4HJA A;  4LF9 L;  3TS2 A;  4BXX H;  1MJC A;  3S2H H;  1Y1V G;  3W1B A;  1B70 B;  1YJ9 A;  4ALP A;  4HID A;  2EIF A;  4UP7 A;  4GNX C;  1PH1 A;  4A3M G;  4JI7 L;  3I4N H;  2UXC L;  3T1Y Q;  1W3S A;  2VNU D;  2IT1 A;  4RMF A;  1UE6 A;  4JYA Q;  1SRU A;  4OWX B;  2HIX A;  4LW1 A;  3K7A H;  4OO1 I;  3DM3 A;  1Q1E A;  3ER0 A;  4A3B H;  1KAW A;  2XGT A;  2NZH A;  4KHZ A;  5GAE C;  2UU9 L;  1HNW Q;  1YEZ A;  1EQQ A;  4X64 Q;  1EIY B;  4YCW A;  3LGJ A;  3PF5 A;  2JA5 H;  4HIM A;  1A0I A;  1E7Z A;  1KD1 C;  4JI0 Q;  2OCE A;  1IZ6 A;  2OTJ A;  1I6H H;  4DKA C;  2K52 A;  2RF4 A;  4PZ8 A;  2ZM6 L;  4A3I H;  4JI4 L;  1NMG A;  3PIO A;  2UUB Q;  1A63 A;  2MFI A;  4A3F H;  1PA6 A;  3KJO A;  1VQ7 A;  4DV1 Q;  4A93 G;  3CCE A;  3T1Y L;  3KDF B;  1XPR A;  4JYA L;  3TS0 A;  5FLM G;  2D62 A;  5IT9 c;  1HZC A;  1CKN B;  1C9O A;  3CCM A;  1QVF A;  2NVX H;  3H0G H;  4JOI A;  4JV5 Q;  1QUQ A;  3JAM c;  4OX9 Q;  4NB3 A;  3GTP H;  1HNW L;  4JOI C;  2MO1 A;  4A75 A;  5IYD H;  4X64 L;  4B3S L;  2AWN A;  1ASZ A;  4A3K H;  3S1Q H;  2JE6 I;  1AH9 A;  1OXX K;  1HR0 W;  4R4I A;  4BXX G;  1G6P A;  1PYB A;  2VY3 A;  1WYD A;  4BY1 G;  4YWK A;  1Z47 A;  4QGU A;  2ZTC A;  1QVG A;  3CD6 A;  4X62 Q;  3I4N G;  1VQF A;  2CWP A;  2CWA A;  1XNQ Q;  2VUM G;  5IP9 H;  3CMA A;  1UE7 A;  3OTO Q;  3L0O A;  5FJ8 H;  2E2H H;  1NE3 A;  4DV1 L;  1PH9 A;  1IBL Q;  1IBK Q;  2WB1 G;  4X65 Q;  1JE5 A;  3PUY A;  3M85 A;  1N36 Q;  3E9I A;  1WFQ A;  1YJW A;  1VQE A;  1HNX Q;  2JA5 G;  5C3E H;  1PV4 A;  4BBR H;  4OX9 L;  1UE5 A;  2JA9 A;  2PQA B;  3HOW G;  2JK8 A;  2E2I H;  3PCO B;  1VQB A;  1PH6 A;  1VQH A;  1YVC A;  1V1Q A;  3PSI A;  3KF6 A;  1VQ4 A;  1Z9F A;  5C44 G;  4JI1 L;  2KCM A;  2R93 G;  1AE3 A;  1VQJ A;  2HQL A;  4X62 L;  3PUW A;  1XNQ L;  4K0K Q;  4R4C A;  5C0X J;  4B3M Q;  5ELO A;  3I55 A;  2YYZ A;  3CCR A;  4DV2 Q;  3OTO L;  4DAM A;  1JT8 A;  3K0X A;  4FDB A;  4P73 A;  2KBN A;  1IBK L;  1X3G A;  5IYD G;  2XTI A;  1OXS C;  4X65 L;  1IBL L;  1X65 A;  1N36 L;  5IYC H;  4L5S A;  2UXD Q;  2OQ0 A;  1MJE A;  4BY7 G;  2AKW B;  3RN5 A;  3HOV H;  1QZG A;  3CPW A;  1VQN A;  2HIV A;  5LMN Q;  2B29 A;  2PI2 E;  2YTY A;  1Y1V H;  3ULL A;  4GOP B;  4A3J H;  1HNX L;  4DV0 Q;  1MKH A;  4DAY B;  1EUJ A;  1E3P A;  1G29 1;  1E24 A;  1OTC A;  3OW2 A;  1JJC B;  2GN5 A;  1KQS A;  4OWT B;  4LF5 Q;  5GRO A;  1HNZ Q;  4JI6 Q;  2Z6K A;  2OTL A;  3GTK H;  1LM0 A;  4QJF A;  4X66 Q;  3GTM H;  1PFS A;  4QY7 A;  1JMC A;  1KRT A;  3J81 c;  2JA8 G;  3CAM A;  4GN4 B;  1VQ8 A;  2RHQ B;  1TWC H;  4IFD I;  4K0K L;  1OXV A;  1KL9 A;  2R6G A;  3MXN B;  4L5T A;  4DV2 L;  4B3M L;  3S1M H;  4YY3 Q;  2JQO A;  4DR3 Q;  4JBK A;  4B3S Q;  3S16 H;  4LFB Q;  3ERS X;  3D0F A;  4BBR G;  1L1O C;  3F2B A;  1RL2 A;  3HOX H;  1PH3 A;  1TWF H;  3BJU A;  2K4K A;  2R7D A;  1XPO A;  3S2D H;  5DLQ E;  2UXD L;  1X55 A;  1PH2 A;  5IY0 A;  5LMN L;  3U58 A;  4LNQ A;  2QA4 A;  4O2D A;  1Q82 C;  1NY4 A;  4JI0 L;  4BA2 I;  2BA0 A;  4NPS A;  5C4X H;  1BVS A;  4A4I A;  3DLL A;  4DV0 L;  4LF5 L;  4LF7 Q;  3PF4 A;  4A93 H;  5GAD C;  1B8A A;  1SN8 A;  4A3D H;  1HNZ L;  4JI6 L;  4X66 L;  3A5U A;  3K81 C;  2HHH Q;  3GTG H;  2VW9 A;  3S1N H;  4DV6 Q;  1IL2 A;  5JEA G;  1CSP A;  1O7I A;  2BH2 A;  1YBY A;  3GTL H;  1K8G A;  1N32 L;  2EXD A;  2FXQ A;  2Y0S E;  4R4O A;  5IYB G;  2F3I A;  4P74 A;  5GQO A;  3HOZ G;  4L5Q A;  2R92 G;  2UXB Q;  2Y0S G;  1KRS A;  2JEA I;  3RLF A;  1VQ5 A;  3PUV A;  1Q8K A;  3J80 i;  3HOV G;  1MIU A;  1EIF A;  4GNX A;  1Q46 A;  4DR3 L;  3KLW A;  4A3J G;  1CKM A;  2WAQ G;  1S3O A;  3CW2 C;  3H15 A;  1YJN A;  4BY1 H;  1QUQ B;  1EFW A;  1VQG A;  3AQQ A;  4PZ6 A;  5H1S E;  1HJP A;  4DV4 Q;  4LUZ A;  1KIX A;  1XNR Q;  2VUM H;  4NXN L;  5J3B A;  4AQY Q;  4GN5 A;  4DR7 Q;  2PI2 A;  1D8L A;  2LXK A;  2RCN A;  2JEB I;  2KCT A;  3KYH C;  4GLA C;  1T9H A;  1U5K A;  2CKZ B;  5M3M G;  1R9T H;  4JI3 Q;  1XPU A;  4DV3 Q;  1L0W A;  4WJ3 M;  1L2F A;  1BBW A;  3GTO H;  2HHH L;  3CP0 A;  3CC7 A;  1WJJ A;  1CUK A;  4R4Q A;  4DV6 L;  3I7F A;  1Q81 C;  4JI5 Q;  2NVT H;  4IJL A;  1KXL A;  2I0Q A;  1VQA A;  3CCU A;  4LF6 Q;  1VS0 A;  2QGQ A;  3J7A 5;  3HOW H;  2C35 B;  2YTV A;  3HOX G;  4JBM A;  2EQS A;  3T1H Q;  1YHQ A;  1K8A C;  3CC2 A;  3Q8D A;  2HT1 A;  5BR8 Q;  4PMW A;  5C44 H;  2UUB L;  1J5E Q;  1SFO H;  4UP9 A;  1NJI C;  5C4X G;  2R93 H;  4A3C H;  4C3I H;  1D7Q A;  4DV4 L;  3M4P A;  4BA1 I;  1EYG A;  1XNR L;  1G51 A;  1OXT A;  4YWL A;  4A3D G;  1PH8 A;  1S72 A;  3KF6 B;  1YIJ A;  1Q12 A;  3M7N A;  4DNI A;  3F2D A;  4AQY L;  1VQ6 A;  4DR7 L;  3M4Q A;  1WI5 A;  3J81 j;  3VDY A;  4JI3 L;  3I56 A;  4DV3 L;  4HJ8 A;  1M90 C;  1PVO A;  1B7Y B;  1K9M C;  4BY7 H;  2PMZ E;  4JBJ A;  4IO9 A;  2YU9 H;  1CKO A;  2B3G A;  1TWA H;  1Y1W G;  4JI5 L;  5E7N A;  4DR6 Q;  1P8L A;  3CCJ A;  2I5M X;  2VS1 A;  2RHS B;  2R7F A;  4LUO A;  1QVC A;  3F1Z A;  5EAY A;  3ULP A;  3T1H L;  1FJG Q;  4HIO A;  4GN3 B;  1FL0 A;  1LUZ A;  5BR8 L;  2UUC Q;  2KEN A;  3UE1 A;  4DPG A;  3PO3 G;  4A3G G;  1JJ2 A;  2WB1 E;  4O0A A;  1J5E L;  2NN6 G;  2JA8 H;  1HH2 P;  4MTN A;  1H95 A;  3G6E A;  2A19 A;  3G4S A;  3G71 A;  2VQE Q;  1YHA A;  5LMN W;  3I4O A;  1SRO A;  5AJ3 Q;  4EX5 A;  4P72 A;  5C4J H;  4TVA B;  3CME A;  4JV5 L;  4JI8 Q;  3PO2 G;  1BBU A;  3HFZ B;  2NVQ H;  3U4V A;  1NBW A;  3I4M G;  2OWO A;  2VL6 A;  4JBW A;  4OXP A;  3BZC A;  4DUZ Q;  2YV5 A;  3SGI A;  1XJV A;  1ASY A;  4BBS G;  3H3V H;  2IX0 A;  4DR6 L;  1GKH A;  4YWM A;  5LMU Q;  4AIM A;  4A3C G;  4RG1 A;  1FJG L;  1V9P A;  3KFU A;  2ATW A;  2UUC L;  3UDF A;  3I2Z A;  5IYB H;  1SLJ A;  3HOZ H;  3M9B A;  1GM5 A;  2R92 H;  3JAM i;  1E1O A;  2L15 A;  3KF8 B;  4QIW E;  2VQE L;  1Q7Y C;  5AJ3 L;  3HKZ G;  2CCZ A;  1E22 A;  2OQK A;  4JI8 L;  4WJ4 A;  3CCS A;  5C0X I;  1I50 H;  2YTX A;  4YHH Q;  2I5L X;  1NTG A;  2NZO A;  5JEA J;  4GNX B;  3TEH B;  5M3M H;  5LMU L;  2IX1 A;  2D0P A;  1I5F A;  4IOA A;  1SE8 A;  4IPG A;  3W1G A;  1EOV A;  3CCV A;  4IOC A;  1W2B A;  2BA1 A;  4POF A;  2AWO A;  3ULJ A;  3J7Z C;  2GVA A;  2E5L Q;  1L1O A;  1KHI A;  2BH8 A;  3CXC A;  3PIP A;  4A3L G;  4XIG S;  4XTC S;  5M5W H;  5M5X H;  4B3T Q;  1GVP A;  4KHP Q;  1V43 A;  2F4V Q;  4POG A;  2N8N A;  2ZTE A;  1BKB A;  4IPC A;  4DV7 Q;  2ES2 A;  2A8V A;  5JJK A;  2PNH A;  1WOC A;  1P16 A;  2N78 A;  2Z0S A;  4YHH L;  2ZJQ A;  3HKS A;  4YCU A;  4HJ5 A;  4AYB G;  1QZH A;  3S24 A;  1X3E A;  1LTL A;  3TQY A;  2MO0 A;  4LFA Q;  3S14 H;  3AFQ A;  2K5N A;  2Q2T A;  4YY3 L;  1Y1W H;  2WAQ E;  4JI7 Q;  2IHF A;  1Q1B A;  1XTD A;  2E5L L;  2ALY B;  3AEV A;  3RZO H;  4MNO A;  4DK6 C;  1VQL A;  1SR3 A;  3K8A A;  4B3T L;  2CQO A;  1FGU A;  3FP9 A;  4P75 A;  4KHP L;  4A3G H;  2F4V L;  5M3F H;  3PO3 H;  4HIK A;  3FKI H;  2K75 A;  4DV7 L;  3E9H A;  2ZJP A;  3TRE A;  1Y14 B;  5IYC G;  4LF7 L;  1I3Q H;  1JB7 A;  1NMF A;  3NBH B;  3J81 i;  4LFC Q;  1YI2 A;  4GOP C;  1K73 C;  4IPD A;  1VQD A;  3EN2 A;  2ZJR A;  3CPF A;  4JC0 A;  3PO2 H;  4LFA L;  5IP7 G;  1VQ9 A;  4L5R C;  3UDI A;  3I4M H;  2UXB L;  3EIV A;  4DR1 Q;  1VQK A;  4QQB X;  4BBS H;  3EBE A;  2F52 A;  5IE8 A;  1X3F A;  1UWV A;  2N3S A;  3HOU H;  1K3R A;  3RLN A;  2B63 H;  3BU2 A;  2DGY A;  1HZA A;  1DGS A;  3FHW A;  3GTJ H;  3U4Z A;  1WCM H;  2VQF Q;  2MNA A;  4J15 A;  2AHO B;  4C3H H;  2V1C C;  4UPA A;  4A76 A;  4GKK Q;  4Y52 H;  1JJG A;  4LFC L;  1SMX A;  3NEM A;  3KOJ A;  5GAG C;  4OO1 G;  2WFW A;  4PG3 A;  3UDX A;  3PV0 A;  2H5X A;  4KI0 A;  5IWA Q;  1X54 A;  3KJP A;  2NN6 I;  4JCV E;  3HOY H;  3PUZ A;  4LF6 L;  2D0O A;  3F2C A;  4C3J H;  1GD7 A;  4A3E G;  1VCI A;  4R1J A;  2IHE A;  4DR1 L;  1TWH H;  1I94 Q;  2JA7 G;  5M3F G;  3A5Z B;  3FKI G;  2JA6 G;  1KC8 C;  3G48 A;  1PH4 A;  3IRB A;  4LUV A;  1U0L A;  2GVB A;  2K50 A;  1VQO A;  3S15 H;  1N34 Q;  3STB D;  2Q2U A;  3MEF A;  3AFP A;  3NEN A;  4GS3 A;  2VQF L;  1FVI A;  4GKK L;  2AMC B;  2KHI A;  4MZ9 A;  2IY5 B;  2ZTD A;  4A3L H;  5JJL A;  3GDE A;  1VQI A;  2N49 A;  3U50 C;  1PH5 A;  4LF4 Q;  1EQR A;  4JI1 Q;  5IWA L;  1K0R A;  3BZK A;  5GAH C;  2DUD A;  3L2P A;  3HOU G;  1YIT A;  5HY6 A;  1L1O B;  3CCQ A;  4LF8 Q;  1CSQ A;  3B6Y A;  2LXJ A;  2B63 G;  4DR5 Q;  4GKJ Q;  4PZ7 A;  1S40 A;  2ASB A;  4A3B G;  3PGZ A;  5FLX c;  3CF5 A;  1Q86 C;  2JJQ A;  3OYY A;  4DK3 C;  4P71 A;  1I94 L;  4LFB L;  3M3Y H;  1WCM G;  5K36 G;  4ME3 A;  1IYJ B;  4X6A H;  1HZ9 A;  1A62 A;  2UUA Q;  4IJH A;  1M1K C;  1X6O A;  4APV A;  1N34 L;  3HKZ E;  4C2M H;  1N33 Q;  1AE2 A;  3A0J A;  3KDF A;  2E8G A;  4HJ7 A;  3CCL A;  4A3I G;  1VQP A;  3HOY G;  3F8T A;  1C0A A;  3ZJY C;  1CKN A;  1K83 H;  3UE0 A;  4Y7N H;  2LSS A;  4LF4 L;  3L7Z C;  4A3F G;  2E2J H;  3GTQ H;  1UEB A;  1N8R C;  4DUZ L;  3CQZ H;  3UDG A;  3NEL A;  3RR5 A;  1HR0 Q;  1N9W A;  3E0E A;  4LF8 L;  1GO3 E; 
#chains in the Genus database with same CATH topology
 2A68 D;  4YCV A;  4DUY Q;  3PUX A;  2CQA A;  4FF1 A;  3N6R A;  5NUC A;  2AQ1 B;  3H3V I;  2R7Z H;  3J80 c;  1XMQ Q;  3ZYY X;  4A3K G;  2B2Y C;  1X9N A;  1NUC A;  1N33 L;  1EY5 A;  2KHJ A;  3A74 A;  2CFM A;  2A6H C;  1SE4 A;  1ML0 D;  5COR A;  5IP9 G;  4QUF A;  2K5V A;  4C1N K;  1PH7 A;  2PQA A;  4R4T A;  5JJI A;  1HQM C;  4DR2 Q;  1XMO L;  1S5E D;  1H9M A;  3W3A A;  5CV8 A;  2EPB A;  2WIN B;  3A7L A;  2E75 C;  1E2W A;  4EQP A;  2F4I A;  4GLV B;  4B3R L;  3CRK C;  3V96 A;  1PYS B;  2B39 A;  4IUT A;  2G5D A;  2JA6 H;  2HDL A;  4JI2 L;  2CH4 W;  3AU7 A;  3TBI B;  1S4Z A;  5I4D A;  4UY8 C;  1J6Q A;  1S5F D;  3S17 H;  4XQN A;  3HOV B;  4KD3 A;  3HS0 C;  4A3J B;  1KAB A;  4KHV A;  5M5Y H;  3ND9 A;  2R7Z G;  4DR4 L;  4NKL A;  4HJA A;  4LF9 L;  3TS2 A;  1H9K A;  2F0U A;  3S2H H;  3W1B A;  1U4P A;  3PMF A;  4UP7 A;  4GNX C;  1UE6 A;  1DM0 B;  3H94 A;  2HIX A;  4LW1 A;  4OO1 I;  1TWC B;  2B8F A;  3K0Y A;  4I7Z C;  3VR6 A;  3ER0 A;  1SXT A;  4JK1 C;  2A6H D;  5GAE C;  1SYC A;  1SJE D;  3PF5 A;  2JA5 H;  1TWF B;  4WRD A;  2OCE A;  1IZ6 A;  4FXK C;  1I6H H;  2J0T D;  5C5L A;  1EWH A;  2ZM6 L;  4A3I H;  1NMG A;  2JP1 A;  4P2C B;  4A3F H;  1PA6 A;  1A15 A;  4TKO B;  3KJO A;  1STA A;  3TZU A;  3T1Y L;  3N52 A;  3KDF B;  4IUN A;  5EKI A;  5LL6 S;  3S14 B;  1LLR D;  1HZC A;  4LK1 C;  3QG1 A;  1QUQ A;  4J8Q A;  1XX8 A;  4OX9 Q;  4JV5 Q;  1HNW L;  2LMC B;  4CDF C;  4F87 A;  2AWN A;  5BN4 A;  3S1Q H;  1EYA A;  5I6Y A;  2VY3 A;  1Z47 A;  3CD6 A;  1VF7 A;  4X62 Q;  2F3W A;  5FJ8 H;  3GTO B;  2E2H H;  2A74 C;  1RD9 D;  4ID6 A;  4DV1 L;  1PH9 A;  1ET9 A;  2NVT B;  1EWC A;  3QJY A;  1V1O A;  4DFA A;  3PO2 B;  1CTM A;  1QNU A;  2VB3 X;  1WFQ A;  2DJF C;  1HNX Q;  2JA5 G;  1DCZ A;  4BBR H;  5DM7 3;  2JA9 A;  2PQA B;  3PCO B;  1VQB A;  1VQH A;  3VR5 A;  1PZJ D;  2BOS A;  3J7A F;  5C44 G;  3KLR A;  4EVO A;  4BWG B;  1VQJ A;  1AZQ A;  3FPU B;  4YIJ A;  4ZQ3 A;  2YYZ A;  3I55 A;  3CCR A;  3OTO L;  3R2T A;  2GA4 B;  4F8M A;  1X65 A;  2UXD Q;  3BZD B;  2OQ0 A;  4RCN A;  2AKW B;  3RN5 A;  3CPW A;  2YTY A;  3ULL A;  1OTC A;  5GRO A;  3T4A C;  2KED A;  3PQI A;  2Z6K A;  1HNZ Q;  2D2C C;  4X66 Q;  1EU4 A;  3J81 c;  2F0E A;  3CAM A;  4GN4 B;  2RHQ B;  3K5O A;  1GUT A;  3P7J A;  2FIN B;  2JQO A;  2EJM A;  3ERS X;  4BBR G;  4JVZ A;  2QIL A;  3HOX H;  3BJU A;  5C4Z A;  5DLQ E;  1PH2 A;  2QA4 A;  1NY4 A;  2XVS A;  1BVS A;  4A93 H;  4AYB B;  1UEA B;  2HHH Q;  2KJX A;  5JVG 3;  3HRZ C;  1YBY A;  2EYF A;  1N32 L;  1VDZ A;  4R4O A;  2F3I A;  4P74 A;  4N9T A;  1ENA A;  4L5Q A;  2R92 G;  1JOQ A;  2EYL A;  3D4W A;  4XYO A;  4DAP A;  1D5Z C;  4QUC A;  1EQT A;  5KRU A;  3WDN A;  1CKM A;  3CW2 C;  1S3O A;  4OHJ A;  5CV4 A;  1QUQ B;  4FP5 D;  1VQG A;  4DV4 Q;  1KIX A;  1HJP A;  2A69 C;  4LUZ A;  2VUM H;  1HRJ A;  5J3B A;  1EIG A;  4AQY Q;  2F0G A;  4CDD C;  5M3M G;  3KYH C;  1XPU A;  1U5K A;  4ZKB B;  1FR3 A;  3O13 A;  1I4P A;  1PTO H;  1Q81 C;  2E2D C;  1VQA A;  1XWE A;  2QGQ A;  4F7X A;  5A2Q L;  5D3I B;  3HOW H;  5T1I A;  3HOX G;  1RDP D;  3CC2 A;  1BUV T;  2N88 A;  2HT1 A;  2EE1 A;  1SFO H;  1JWM D;  2F0W A;  1CZW A;  4BA1 I;  1EYG A;  5EGT A;  2VXW A;  1YIJ A;  4DR7 L;  3M4Q A;  3VDY A;  1B7Y B;  4BY7 H;  5EBD A;  1B44 D;  4A3E B;  1TWA H;  1Y1W G;  2KA7 A;  1MI2 A;  1RTN A;  1P8L A;  2HUG A;  2JA7 B;  3CCJ A;  4MIU A;  3Q6S A;  2VS1 A;  2R7F A;  1QVC A;  3T1H L;  4CJ1 B;  1FJG Q;  2EYP A;  2UUC Q;  5BR8 L;  3PO3 G;  2NVY B;  4DPG A;  4O0A A;  2NN6 G;  1FGB D;  1HH2 P;  4MTN A;  1ICW A;  2A69 D;  2A19 A;  1PZI D;  4JW0 A;  3EVQ A;  1YHA A;  3IKJ A;  5AJ3 Q;  1STG A;  4P72 A;  1IL8 A;  4BBS B;  3CME A;  4JI8 Q;  2NVQ H;  1F2Y A;  3K7A B;  3VYR A;  1LTB D;  3BZC A;  3MFY A;  3A54 A;  1XJV A;  4BBS G;  2IX0 A;  5LMU Q;  1SYD A;  1V9P A;  1DON A;  4K5V A;  3UDF A;  1PRT F;  4WOR A;  5E4X A;  2BCO A;  1SLJ A;  5FOB B;  2B2T A;  1SNQ A;  4H7B A;  1GM5 A;  5I2Y A;  3JAM i;  3RMH A;  1KTK A;  4QIW E;  4C3J B;  2VQE L;  2OQK A;  1M4V A;  4KK7 A;  2YTX A;  2X6G A;  3G6J B;  2I5L X;  1NTG A;  4DAV A;  2SNS A;  3J80 E;  2EYJ A;  2EVB A;  1SE8 A;  4IPG A;  2M2L A;  4OGQ C;  1M8A A;  3W1G A;  3K57 A;  4KTA A;  2BA1 A;  4POF A;  2AWO A;  3K5M A;  2X69 A;  1EL0 A;  1F9R A;  2BH8 A;  4KKU A;  3PIP A;  1U4M A;  4B3T Q;  4OIK A;  3W2D A;  1V43 A;  2A8V A;  3GQB A;  4J1M A;  1P16 A;  1G6Z A;  4YHH L;  3HKS A;  3KK7 A;  5EKK A;  4HJ5 A;  1G2T A;  1B50 A;  1LTL A;  1KDB A;  4LFA Q;  1K28 A;  1K83 B;  2WAQ E;  3RZO H;  2ALY B;  1SR3 A;  4K6L A;  3K8A A;  5KYI A;  3FP9 A;  4KHP L;  4TSS A;  2EOT A;  5M3F H;  4DV7 L;  4PMC A;  1ZYR C;  1YI2 A;  1K73 C;  1CA6 A;  4WJW A;  3CPF A;  4A3M B;  3BG3 A;  5IP7 G;  4M1U B;  1S5D D;  2OEO A;  4L5R C;  4EQN A;  3EIV A;  4DR1 Q;  3L9A X;  1I4G A;  2LY7 A;  1L0Y B;  3BU2 A;  2AUK A;  1Q8I A;  3S16 B;  4C3H H;  4GKK Q;  3A8J E;  2ZXO A;  1JJG A;  4LFC L;  5GAG C;  4V0B A;  3PV0 A;  4KI0 A;  5IWA Q;  3KJP A;  4FXD A;  2NN6 I;  3HOY H;  4LF6 L;  1A3U A;  3F2C A;  1AP0 A;  1GD7 A;  1HUM A;  5DM6 3;  3BS1 A;  5M3F G;  3A5Z B;  2HD3 A;  2HDM A;  1PH4 A;  4KJO A;  3IRB A;  4LUV A;  3M4O B;  1LO5 D;  2GVB A;  1EOT A;  3S15 H;  3MEF A;  2NYZ D;  2VQF L;  5BN5 A;  2AMC B;  1EY7 A;  1ZYR D;  4MZ9 A;  4ULL A;  3GDE A;  3K58 A;  1RCV D;  1GUW A;  1CI3 M;  1PH5 A;  1JR0 D;  1SND A;  4JI1 Q;  4ODG A;  3A8I E;  3CCQ A;  4RGT A;  4DR5 Q;  1C8C A;  4GKJ Q;  4IN3 A;  4PZ7 A;  1I94 L;  3OYY A;  4DK3 C;  5CV6 A;  3M3Y H;  1CFM A;  1IYJ B;  3DHQ A;  1D1I A;  2UUA Q;  5CGK A;  1N34 L;  3HKZ E;  5HGT A;  1B4O A;  2HQE A;  3OWE B;  3HOY G;  4CKB A;  1C0A A;  3BVZ A;  3ZJY C;  5L37 A;  5LL6 X;  3UE0 A;  1I4Q A;  4CJ0 B;  3GTQ H;  2H1E A;  1UEB A;  1HR0 Q;  3NEL A;  2F0I A;  4LF8 L;  3S1R H;  3W5O A;  1RJT A;  1E2V A;  3H0G G;  2K5H A;  2VZA A;  3ICE A;  3AB9 A;  1BBX C;  4IFD J;  1EY8 A;  2EYM A;  4NXM Q;  3J81 E;  3M7G A;  2K1B A;  1A3T A;  1R4P B;  4XXE A;  2JA8 B;  5CR3 A;  4X3S A;  2WP8 J;  4DV5 Q;  1C7Y A;  4TQU S;  3TDQ A;  4K6D A;  2IWH A;  1HZB A;  4DUY L;  1H9S A;  4OO1 H;  4R8I A;  1MD2 D;  2F0M A;  3ITP A;  1KNE A;  1LYL A;  1XMQ L;  3FDT A;  4HSP A;  1X56 A;  1JCK B;  3CC4 A;  1B9N A;  1DXM A;  4KN7 C;  3HOZ B;  4DAY A;  1MSG A;  4QL5 A;  1F9Q A;  1Y1V B;  1PHJ A;  4R8N A;  4JI4 Q;  1YNX A;  1RIP A;  3WWV A;  1I50 B;  1CQV A;  4EQ5 A;  4DR2 L;  4BXX H;  3GTM B;  2PZT A;  1Y1V G;  1B70 B;  1YJ9 A;  3I4N H;  2EIF A;  1PH1 A;  1GUS A;  3MXN A;  1QOH A;  2F0S A;  3TSS A;  4JYA Q;  3DM3 A;  2J4X A;  4A3B H;  2RQX A;  2XGT A;  3KBG A;  3BYY B;  4DK1 A;  1YEZ A;  4X64 Q;  1SNP A;  4RGM A;  1EIY B;  4YCW A;  1BQQ T;  4IUQ A;  3P20 A;  4E6I A;  1DZ1 A;  5CYU A;  5CMD A;  2RF4 A;  4PZ8 A;  5KNB A;  5C4X B;  2A68 C;  1A63 A;  3TP5 A;  3CCE A;  5C5M A;  2RCF A;  1QVF A;  2EY2 A;  2NVX H;  3QO2 A;  1AW7 A;  3GTP H;  1IHZ A;  3JAM c;  3E0J A;  4A75 A;  1ASZ A;  2EYO A;  3C46 A;  4A3K H;  2JE6 I;  2IW3 A;  4R4I A;  4BXX G;  1EQV A;  4BY1 G;  4MHE A;  4QGU A;  3I4N G;  2CWP A;  2CWA A;  2RDF A;  5IP9 H;  4ABN A;  3J7A V;  1QNK A;  4JPB W;  2NWG A;  1IBL Q;  1IBK Q;  2WB1 G;  4X65 Q;  1TS5 A;  1E2Z A;  1TT2 A;  3I4M B;  2SEB D;  1PV4 A;  2QDB A;  4OX9 L;  1EEI D;  2KUM A;  1H9S B;  2XWJ B;  3GTJ B;  4J6H A;  2Q8T A;  2R93 G;  1AE3 A;  4X62 L;  2L0C A;  3PUW A;  5C0X J;  3LX0 A;  1JIC A;  5ELD A;  1ZEQ X;  2KBN A;  1OXS C;  4CDC C;  4L5S A;  5I6W A;  1FNU A;  1WVL A;  3HOV H;  1QZG A;  1GHK A;  1VQN A;  1HNX L;  5LMN Q;  2B29 A;  2PI2 E;  4RCO A;  4A3J H;  4DAY B;  1EUJ A;  1G29 1;  4LF5 Q;  1E24 A;  3OW2 A;  1JJC B;  1ICF B;  4OWT B;  1KQS A;  1HTP A;  1LTA D;  4JI6 Q;  2TSS A;  1Q3L A;  4IQZ A;  1SEB D;  1TWC H;  5C4J B;  2LKV A;  2R6G A;  3MXN B;  3X3M A;  4YY3 Q;  4DR3 Q;  4LFB Q;  1KLG D;  2BDN A;  1L1O C;  5F2D A;  2UXD L;  1TWF H;  2F03 A;  2K4K A;  2L12 A;  4FF4 A;  1TS3 A;  2K32 A;  4LNQ A;  4O2D A;  1Q82 C;  1H95 A;  4BA2 I;  2BA0 A;  4LF7 Q;  3DLL A;  1HNZ L;  3CKI B;  2WKD A;  4X66 L;  3K81 C;  3GTG H;  3S1N H;  2B2W C;  1G91 A;  4DV6 Q;  1CSP A;  1O7I A;  2FXQ A;  1SNO A;  4K5W A;  2UXB Q;  1QCB D;  5ELC A;  4KMU C;  4QCL A;  3RLF A;  1VQ5 A;  3HOV G;  2OXP A;  4A3J G;  1Q46 A;  2EJG C;  3KLW A;  1YJN A;  3H15 A;  3CQZ B;  1SNM A;  2KCC A;  5H1S E;  5DEH A;  2IX3 A;  1U4R A;  4NXN L;  1Y8O B;  5M9O A;  4GN5 A;  2F0O A;  2RCN A;  4GLA C;  1T9H A;  2DJG C;  4DV3 Q;  4DNT B;  4HMI A;  5LHY 1;  1A2T A;  1BBW A;  4FNF A;  4DN4 M;  2HHH L;  3CC7 A;  1WJJ A;  1CUK A;  1GXD C;  3GTO H;  1KXL A;  2NVT H;  1STB A;  1EZ8 A;  3CCU A;  2F0J A;  2YTV A;  4JBM A;  5EBC A;  1YHQ A;  1K8A C;  4OEL B;  1SSO A;  3Q8D A;  1JOR A;  2QF7 A;  5C44 H;  1J5E Q;  1K8M A;  4A3C H;  1ILQ A;  4DV4 L;  1S72 A;  5C4H A;  2EZV A;  1Q12 A;  4DNI A;  2L55 A;  3F2D A;  4AQY L;  4ILW A;  3QIA A;  1WI5 A;  3J81 j;  3D6C A;  3I56 A;  5CV5 A;  1PVO A;  1K9M C;  4JBJ A;  4IO9 A;  2YU9 H;  1EY6 A;  1BNZ A;  1PTO F;  5E7N A;  4RHS A;  5KNC A;  2K33 A;  1CT1 D;  3NBH A;  1I6V C;  1HHV A;  2JA6 B;  2J7Z A;  3BYT B;  5EAY A;  4HIO A;  1FL0 A;  3R3O A;  4DU9 A;  1HA5 A;  3FVQ A;  3S17 B;  4RGN A;  3QB3 A;  5FLX L;  5M5Y B;  1S5B D;  4QB4 A;  3DWP A;  3S2H B;  5IOD A;  3HOU B;  3PO2 G;  1BBU A;  4I7A A;  3NSW A;  2OWO A;  2VL6 A;  1ASY A;  2YV5 A;  3SGI A;  1GKH A;  1Y8P B;  1WCM B;  3OIQ A;  4AIM A;  4A3C G;  2JYO A;  4RG1 A;  2I46 A;  1EY4 A;  3MVV A;  1FJG L;  2F0L A;  3KFU A;  2UUC L;  5G3L D;  2L4N A;  2BE5 C;  1DOK A;  3SVM A;  4A3I B;  2R92 H;  4H44 C;  1K0S A;  1H9R A;  3NWT A;  5AJ3 L;  5C6A A;  4A3F B;  1Z7T A;  2CCZ A;  2F0N A;  4JI8 L;  4WJ4 A;  1LTT D;  4Z9C B;  3SK4 A;  1JWS D;  2IL8 A;  2NZO A;  5JEA J;  5M3M H;  5FO9 B;  5LMU L;  1I5F A;  1C48 A;  3KLS X;  3T13 A;  1W2B A;  2QCP X;  2GVA A;  1FYC A;  2O5J C;  4IZ8 A;  5M5W H;  1GVP A;  2Q8R E;  2F4V Q;  3NTI A;  4IUR A;  2N8N A;  1BKB A;  3VYS A;  2ES2 A;  2E2H B;  5JJK A;  1MGS A;  5I2X A;  1ENC A;  4YCU A;  4AYB G;  4C2M B;  1X3E A;  3TQY A;  1QIL A;  1UAP A;  1V8Q A;  2MO0 A;  1NAP A;  1Y1W H;  3SE0 A;  2IHF A;  3DM1 A;  4Y7N B;  3AEV A;  2Z6B A;  4HED A;  2BE5 D;  2MUY A;  2E2J B;  4MNO A;  4RWS C;  1VQL A;  4B3T L;  2BDO A;  2CQO A;  2K7V A;  2XWB B;  3QWN A;  4P75 A;  3PO3 H;  5FO7 B;  1B53 A;  2NN6 H;  2HCC A;  3TRE A;  5IYC G;  3NBH B;  2A6E C;  4KN4 C;  5ELB A;  4IPD A;  3EN2 A;  4LFA L;  1VQ9 A;  2B2V A;  5E1F A;  4QQB X;  4BBS H;  2F52 A;  1X3F A;  2N3S A;  3MXU A;  3RZD B;  2NUC A;  4QF4 A;  2EYH A;  3U4Z A;  4J15 A;  2V1C C;  3KOJ A;  2WFW A;  2MGS A;  5C3W A;  3UDX A;  2WAC A;  4DK0 A;  4A93 B;  4C3J H;  4A3E G;  1E0B A;  1B9M A;  1G8Z D;  1VCI A;  4DR1 L;  1TWH H;  5TSS A;  2JA7 G;  3JAM E;  4N8X 1;  1DJR D;  2PNR C;  3I90 A;  1VQO A;  1OO9 B;  3STB D;  1SYF A;  3AFP A;  4GS3 A;  3NE5 B;  1TII D;  4GKK L;  2KHI A;  1LTI D;  2A6E D;  5JJL A;  3CHB D;  2VUM B;  1VQI A;  2N49 A;  2SOB A;  4DNR B;  5IWA L;  4S3S A;  3L2P A;  2IJ0 A;  4ZKC B;  3FRP B;  1PTO B;  2ASB A;  1KDA A;  2JJQ A;  4OL7 A;  3I8Z A;  4P71 A;  1U9R A;  3HOW B;  2KEC A;  4KJN A;  1X6O A;  3T16 A;  5COY A;  1QE6 A;  1AE2 A;  3E5S A;  3A0J A;  2E8G A;  1X3Q A;  3CCL A;  2FFK B;  1LTG D;  2OF1 A;  1VQP A;  3F8T A;  1CKN A;  1K83 H;  4C3J G;  4N9P A;  5EPK A;  4DUZ L;  3UDG A;  2CVR A;  1QG7 A;  1GO3 E;  3T53 B;  4DR5 L;  4GKJ L;  1IBM Q;  4BY7 B;  2Z4H A;  3VR4 A;  3K80 C;  4IPH A;  1U4L A;  1SE3 A;  4QIW B;  3RN2 A;  5IP7 H;  2UUA L;  1BCP F;  2KOL A;  2MQH A;  5JJZ A;  4AH6 A;  3D31 A;  2I07 B;  2M00 A;  4A3M H;  4GLX A;  2B2U A;  2QW7 A;  4MTK A;  2Z6K C;  4O42 A;  1VF5 C;  1TQO A;  1IYV A;  1N32 Q;  5ELF A;  1TU2 B;  4OON A;  1SBB B;  1HR0 L;  2L5T A;  3EQL C;  1II3 A;  5C3E B;  1TS4 A;  1EWI A;  5C0X G;  2ZXP A;  2NVQ B;  3RNU A;  5C3E G;  2DY7 A;  1EY0 A;  3GD7 A;  5HGQ A;  2UXC Q;  3VR2 A;  2F0F A;  3MXP A;  2QEX A;  1SE2 A;  4NXM L;  3DUZ A;  3GO5 A;  2EY6 A;  5EKL A;  1OXU A;  2UU9 Q;  3I91 A;  4F88 A;  5FLM H;  1X3P A;  2K14 A;  4GOP A;  1VQC A;  3MAQ A;  1VQM A;  2Y0S B;  4DV5 L;  4JG2 A;  1BO0 A;  3M4O H;  1TWG H;  2WAQ B;  4LWC A;  2OTJ A;  1IYU A;  1E1T A;  1DOL A;  2PQE A;  4ALP A;  4HID A;  4JI7 L;  4A3M G;  1W3S A;  2VNU D;  2R3Z A;  1PFB A;  4OWX B;  5E4W C;  2NZH A;  4KHZ A;  4X3T A;  4CDE C;  3HZX A;  3FPP A;  3LGJ A;  4HIM A;  1A0I A;  3S2D B;  2RVL A;  2O4X A;  2WV6 D;  1LT6 D;  4JI4 L;  3D4R A;  3J7Y W;  1TY0 A;  3PIO A;  4A3D B;  1MHW C;  1SDF A;  4LJZ C;  1DOM A;  1VQ7 A;  3GTL B;  1XPR A;  4JYA L;  3TS0 A;  5FLM G;  2D62 A;  5IT9 c;  4XQQ A;  1C9O A;  1CKN B;  3D4D A;  3H0G H;  5A35 A;  5J1Z A;  3SK6 A;  4JOI C;  2K03 A;  5CV9 A;  4X64 L;  2AUJ D;  1S5C D;  1AH9 A;  1AN8 A;  1PYB A;  1G6P A;  1CHP D;  2ZTC A;  1XNQ Q;  3VR3 A;  1J9O A;  3CMA A;  1UE7 A;  3DEP A;  4WFN 3;  2MHV A;  4FF2 A;  1GUG A;  2PYK A;  1JE5 A;  2C5C A;  2PW7 A;  1N36 Q;  3E9I A;  1YJW A;  1VQE A;  1JOO A;  1PYW D;  1UE5 A;  3KLS A;  4K2K A;  3DWA A;  1F9P A;  2E2I H;  4G7H C;  3SXH A;  4C3I B;  1WTW A;  1NR2 A;  1Z9F A;  4K5X A;  2EXZ A;  1HA6 A;  2RSO A;  2KCM A;  2HQL A;  1LTS D;  4K0K Q;  4R4C A;  4B3M Q;  4DV2 Q;  1GHJ A;  3KBX A;  3NBI A;  3HP3 A;  1JT8 A;  4RAU C;  1EEF D;  3HKZ B;  3QOL A;  1IBL L;  1IBK L;  4X65 L;  2X6L A;  3NHH A;  1CA5 A;  1MJE A;  2B2Y A;  3GP7 A;  2HIV A;  4GOP B;  3CU7 A;  1Y1V H;  1PRT B;  4JI0 Q;  1T5X D;  2HCI A;  1GUO A;  4DV0 Q;  1E3P A;  2GN5 A;  2DNC A;  4O1N A;  1QWY A;  3OMC A;  3GTK H;  2Z1C A;  3GTM H;  1LM0 A;  4QJF A;  1PFS A;  1WTP A;  4QY7 A;  4G7Z C;  1KRT A;  3S15 B;  3OIP A;  2JA8 G;  1OXV A;  1KL9 A;  4L5T A;  3S1M H;  2K6A A;  4JBK A;  1A2U A;  4B3S Q;  2PO4 A;  3D0F A;  3F2B A;  1NR4 A;  1PH3 A;  1XPO A;  1X55 A;  4ZLT F;  1UUP A;  1Z6H A;  3K6O A;  5IY0 A;  4PMB A;  3TP7 A;  5LMN L;  4NPS A;  5C4X H;  4A4I A;  4LF5 L;  3M3Y B;  2DN8 A;  5GAD C;  1B8A A;  1GUN A;  3SK5 A;  4JI6 L;  1CM9 A;  5C3X A;  1TS2 A;  2VW9 A;  2XIW A;  1IL2 A;  5JEA G;  2BH2 A;  3DEO A;  2K28 A;  1LT3 D;  5IYB G;  5GQO A;  5KIX A;  3HOZ G;  5KND A;  1MIU A;  1EIF A;  2F0P A;  4GNX A;  3I3C A;  3KUP A;  4DR3 L;  2UUB Q;  3OOC A;  4BY1 H;  4LFB L;  3AQQ A;  1XNR Q;  3S1R B;  4LAA A;  1NCV A;  1JQY D;  3GV6 A;  2PI2 A;  1D8L A;  4L8J A;  3QR8 A;  2KCT A;  2KCN A;  2NTT A;  1R9T H;  4JI3 Q;  3OW7 A;  1L2F A;  4CKE A;  2FMM A;  5M5X B;  1WD1 A;  4DV6 L;  4JI5 Q;  4IJL A;  2I0Q A;  4LF6 Q;  2MJ8 A;  1VS0 A;  2QDL A;  3F2U A;  3GTP B;  2MPM A;  5JOB A;  3I4L A;  2EDG A;  1BF4 A;  5IGG A;  4PQX A;  4KV6 A;  3NTK A;  1WTV A;  1NJI C;  5C4X G;  2R93 H;  1PZK D;  3H3V C;  1HUN A;  3JAM L;  3NXW A;  4DV3 L;  2OT2 A;  3D3R A;  2PMZ E;  1CKO A;  2B3G A;  4DR6 Q;  4A3G B;  3FKI B;  1ZXT A;  4LUO A;  3ULP A;  1I4R A;  1HFG A;  1I3Q B;  1SMY C;  3ERQ A;  4GN3 B;  4A3G G;  3UE1 A;  1JJ2 A;  2WB1 E;  1J5E L;  2F0H A;  1JOK A;  4FYD A;  3G6E A;  5JPN C;  4CJ2 C;  4RFB A;  5EPJ A;  1B1Z A;  3TN2 A;  4RHR A;  3I4O A;  1SRO A;  4UAI A;  4EX5 A;  5C4J H;  4L6T B;  4TVA B;  4JV5 L;  2L1B A;  1NNX A;  3IAY A;  3HFZ B;  2L9H A;  3A56 A;  1NBW A;  2EY1 A;  3I4M G;  2B63 B;  4XDX A;  5D65 A;  4JBW A;  1TKW B;  4A3B B;  3PIO 3;  2FHT A;  1HQR D;  3ND8 A;  2RDH A;  2F1M A;  3Q0A A;  2N55 A;  3NWS A;  3I2Z A;  1F9S A;  3M9B A;  2L15 A;  1Q7Y C;  2AQ3 B;  3J80 L;  1MSH A;  2Z9H A;  2PCF B;  3CCS A;  3A7A B;  4CBV A;  2PZU A;  4XT3 B;  4GNX B;  3TEH B;  1WTQ A;  1YNJ C;  1SMY D;  4PNY A;  4IOC A;  4V19 0;  4A3K B;  3ULJ A;  5E3F A;  2E5L Q;  3CXC A;  5JPM C;  4A3L G;  4XIG S;  3LNN A;  1SNC A;  3EJI A;  3MXG A;  3A55 A;  4IPC A;  1PXU A;  2E74 C;  2PNH A;  2N78 A;  3G7L A;  3C1F A;  4QMG A;  3T51 B;  1TR5 A;  2K01 A;  5KYL A;  5ISR A;  3S14 H;  2EY5 A;  3AFQ A;  1STH A;  3SK8 A;  1ENF A;  2K5N A;  2Q2T A;  4G4K A;  4KD4 A;  1XTD A;  3A8K E;  4UHV A;  3AMU A;  5HUR A;  1FGU A;  2SNM A;  4DXF A;  2F4V L;  4IUP A;  3E9H A;  2K05 A;  4L63 B;  2XSC A;  3R93 A;  1Y69 U;  1LV9 A;  1NMF A;  1JB7 A;  1GJX A;  2CW0 D;  1K8O A;  2R7Z B;  5DNF A;  3MHB A;  1XYI A;  3V05 A;  4JC0 A;  3PO2 H;  1YNJ D;  1L0X B;  3UDI A;  3S9W A;  3EBE A;  3HOU H;  2D9U A;  3TZD A;  3BDO A;  1O7Z A;  2DGY A;  2R61 A;  1WTR A;  4LMQ D;  1DGS A;  1I4H A;  2PW5 A;  5K36 H;  1WCM H;  3MA2 B;  4XYQ A;  2AHO B;  4A76 A;  1V1P A;  4UPA A;  3X3N A;  1BXT A;  1O7L A;  1SAP A;  3NEM A;  5K5P A;  2H5X A;  1FD7 D;  1DD2 A;  1X54 A;  2D0O A;  4C56 C;  5IT9 E;  4R1J A;  2IHE A;  3ERO A;  3GTG B;  3S1N B;  3NTH A;  3HGB A;  1LT5 D;  4I65 A;  2JA6 G;  1CQF A;  1STN A;  1KC8 C;  3VA7 A;  1EZ6 A;  2WKC A;  1LTR D;  3SHL A;  3I70 A;  1IW7 C;  1FNV A;  1FVI A;  2QKI C;  4RH6 A;  5FKA C;  1Y8N B;  2ZXR A;  4LF4 Q;  1B2T A;  1EQR A;  4C1N I;  5GAH C;  2DUD A;  3SR1 A;  3HOU G;  4U68 A;  2FJ2 A;  1CSQ A;  3B6Y A;  4EGV A;  3PGZ A;  4CHT B;  5FLX c;  3CF5 A;  1Q86 C;  3URY A;  5K36 G;  2JA5 B;  1WCM G;  2XN9 C;  5D3D A;  3OSO A;  1I6H B;  1A62 A;  3CRL C;  4IJH A;  1D1K A;  1M1K C;  3I73 A;  4C2M H;  1N33 Q;  4IFD H;  5C44 B;  1XXG A;  2DY8 A;  3BVM A;  4A3I G;  1EIH A;  1PFM A;  2V4D A;  4Y7N H;  3L7Z C;  4A3F G;  2E2J H;  5KEE A;  4NW2 A;  2LS0 1;  3RR5 A;  4B9W A;  1N9W A;  3E0E A;  5IYC H;  3J81 L;  4ZUI A;  1KLU D;  1XMO Q;  2YU9 B;  1MBY A;  3TRZ A;  3S1Q B;  2A1A A;  4UP8 A;  5DAU A;  2ID0 A;  3OMG A;  5CBA E;  1VMP A;  4ZCK A;  1IW7 D;  5D14 A;  3WOE A;  4B3R Q;  4UDU C;  4JI2 Q;  1TXY A;  2O5I C;  4ZYS A;  5EPL A;  4Q5V A;  4AYB E;  5FJ8 G;  3RZD H;  2K5Q A;  4DA2 A;  4OIJ A;  4BBR B;  3NQI A;  3D8G A;  3EFX D;  2TMP A;  4ZRZ A;  4DR4 Q;  1IBM L;  1HTL D;  4LF9 Q;  2G9D A;  1D2B A;  2I5H A;  3HG9 A;  4IFD G;  1YZ6 A;  4KY7 A;  1V1P B;  1RF2 D;  4NXN Q;  2O2L D;  3LWU A;  4A3E H;  3AYH B;  4H02 A;  3JC6 6;  2WII B;  2JA7 H;  5FK9 C;  3STB C;  1K3B C;  3H91 A;  1VMC A;  1BOS A;  1UE1 A;  1LT4 D;  2B8G A;  3WOF A;  2R92 B;  4KLK A;  3RLO A;  2NVY H;  5ELN A;  5JAV A;  1W6K A;  4IUU A;  2Q2I A;  1A8V A;  4RKB A;  1YHB A;  2Q2H A;  3K7U C;  4HCE A;  3DWQ A;  1IXR A;  2ZM6 Q;  4OWW B;  4NDX A;  4XQJ A;  4HJ9 A;  1WTH A;  5CBE E;  4CKC A;  1MJC A;  4RGO S;  2UXC L;  2IPK D;  3T1Y Q;  5M3M B;  1HFN A;  2IT1 A;  4RMF A;  1SRU A;  3FEW X;  3K7A H;  3TP6 A;  3ONA B;  1Q1E A;  1AZP A;  1KAW A;  3NPP A;  2UU9 L;  1HNW Q;  1EQQ A;  4R9W A;  5M5W B;  3HOX B;  1E7Z A;  1KNA A;  1KD1 C;  5I9O A;  4DKA C;  1HXY D;  1RTO A;  2K52 A;  1ESF A;  3DXJ C;  1PMR A;  2D5D A;  5IOC A;  1WTO A;  4G7O C;  2MFI A;  4HCS A;  5IGF A;  1O7Y A;  4DV1 Q;  4A93 G;  1EU3 A;  2KHS A;  1ROD A;  4M8A A;  1F77 A;  3M4Y A;  5EJW A;  3OPO A;  4KKS A;  3CCM A;  1X32 A;  4HAE A;  4JOI A;  1Y1W B;  1SJH D;  1Q90 A;  1ESR A;  5IYD H;  4NB3 A;  2MO1 A;  1TY2 A;  2AQ2 B;  3L3O C;  1O80 A;  1OXX K;  1HR0 W;  4H13 C;  3PO3 B;  1WYD A;  1QVG A;  4YWK A;  1VQF A;  3R2I A;  2VUM G;  3NP8 A;  1STY A;  3OTO Q;  3L0O A;  1RHP A;  1O78 A;  1NE3 A;  3MTS A;  5C0X H;  1PLF A;  3PUY A;  3M85 A;  1D5X C;  3E3X A;  5C3E H;  4DF7 A;  1JWU D;  3NUC A;  3HOW G;  4H0L C;  2JK8 A;  1SFO B;  1PH6 A;  3PSI A;  1YVC A;  1V1Q A;  4IAL A;  1STE A;  3KF6 A;  1VQ4 A;  5BN3 A;  4FVM A;  3MWY W;  3HEJ A;  2F0V A;  2JN4 A;  4JI1 L;  2M9V A;  1XNQ L;  1BDO A;  1A6X A;  5ELO A;  4DAM A;  1TWA B;  3K0X A;  4FDB A;  4P73 A;  3T56 B;  1X3G A;  5IYD G;  1C4Q A;  2XTI A;  3C2P A;  1N36 L;  4BY7 G;  2Z4I A;  1TWH B;  1MKH A;  1T5E A;  1AEX A;  3Q24 A;  3H09 A;  2OTL A;  1JMC A;  4GZY C;  1ONL A;  1VQ8 A;  4IFD I;  4HN7 A;  4ZK9 B;  4K0K L;  1BR9 A;  4B3M L;  4DV2 L;  3EA6 A;  2ZT9 C;  4HMJ A;  5IIF A;  3S16 H;  1SYB A;  2CH4 A;  1EFI D;  1RL2 A;  2R7D A;  3S2D H;  5J39 A;  3IL8 A;  1PTO C;  3U58 A;  4JI0 L;  4DV0 L;  3PF4 A;  1KDC A;  1SN8 A;  5KGU A;  4FO2 A;  3BVG A;  3KF8 A;  3IFT A;  4KKT A;  3A5U A;  4A3D H;  1QJO A;  2G9H D;  5I9P A;  3GTL H;  1K8G A;  2EXD A;  1LAC A;  2Y0S E;  4Q0F A;  3SEB A;  3VA5 A;  2RA4 A;  2Y0S G;  1KRS A;  2JEA I;  1B3A A;  1EY9 A;  3PUV A;  1Q8K A;  3J80 i;  1D5M C;  4B3S L;  2WAQ G;  2MP1 A;  1EFW A;  1NSN S;  1R4Q B;  1G2S A;  4PZ6 A;  4FXG C;  4DR7 Q;  4IUV A;  2C9O A;  1UNS A;  5ELE A;  2LXK A;  2JEB I;  2CKZ B;  5IGB A;  1L0W A;  3TME A;  2XNA C;  3CP0 A;  4R4Q A;  1QB5 D;  3I7F A;  1EYD A;  4B9X A;  4X3K A;  3J7A 5;  1W6J A;  2C35 B;  3D6W A;  2EQS A;  3T1H Q;  5CC4 A;  2F0K A;  2B2V C;  5BR8 Q;  4PMW A;  2UUB L;  5T1G A;  4UP9 A;  3Q22 A;  4C3I H;  1D7Q A;  2F0Q A;  3M4P A;  1XNR L;  1G51 A;  1OXT A;  4HTH A;  4YWL A;  1PH8 A;  1PTO D;  4A3D G;  3KF6 B;  2RDG A;  3M7N A;  5IT9 L;  1VQ6 A;  2NZ1 D;  1CZG A;  3RZO B;  2KEE A;  4JI3 L;  3VYT A;  4HJ8 A;  2XRQ D;  1M90 C;  4CGY B;  4JI5 L;  2I5M X;  2RHS B;  5M3F B;  4DGZ A;  3F1Z A;  1F2Z A;  1LUZ A;  1GOZ A;  2KEN A;  2FMC A;  3U9O A;  1PFN A;  2JA8 H;  2JSO A;  3LWE A;  1TWG B;  3G4S A;  3G71 A;  2Z8L A;  2VQE Q;  5LMN W;  2NBF A;  2A73 B;  4HR7 B;  4U67 3;  1YNN C;  3U4V A;  5FLX E;  1D6E C;  4OXP A;  4DUZ Q;  2NTS A;  4DR6 L;  3H3V H;  1SYE A;  4YWM A;  3OWF A;  2PZW A;  4C3H B;  4C3I G;  1WD0 A;  2NB0 A;  3H6M A;  1SYG A;  4FF3 A;  2ATW A;  5JEA H;  3VYU A;  4K8I A;  4C3H G;  1H9J A;  3P1H A;  5IYB H;  4ME5 A;  3HOZ H;  3HOY B;  3R8B A;  1E1O A;  3KF8 B;  2B2T C;  4KY6 A;  2ICE C;  1KAA A;  5EQ0 A;  4MN3 A;  3HKZ G;  1E22 A;  5G3L F;  5C0X I;  1I50 H;  2F3V A;  4YHH Q;  2JXM B;  3H0G B;  2IX1 A;  2F0D A;  2D0P A;  3K59 A;  1F2M A;  4IOA A;  4K14 A;  1AFP A;  3CCV A;  1EOV A;  5JVH 3;  2F0T A;  3J7Z C;  2H4O A;  1IKM A;  1L1O A;  1KHI A;  4B08 A;  5FO8 B;  3RD4 A;  4XTC S;  5M5X H;  3OHX C;  2SDF A;  4RKL A;  4N8F A;  4KHP Q;  1JE4 A;  4POG A;  1I4X A;  4X3U A;  2ZTE A;  3MC0 B;  4DV7 Q;  1TVX A;  3E6Z X;  2B2U C;  1WOC A;  1YNN D;  4RA8 A;  3RUZ A;  1CHQ D;  2B2W A;  2Z0S A;  1XTC D;  1BCP B;  4NMZ A;  2ZJQ A;  4KY5 A;  4XT1 B;  2LFN A;  1QZH A;  4EQO A;  2CHB D;  3S24 A;  2E2I B;  2P5Z X;  4YY3 L;  4G57 A;  1DYQ A;  4JI7 Q;  1Q1B A;  2E5L L;  2L11 A;  4K2L A;  3GTQ B;  4DK6 C;  3C1E A;  3TP8 A;  1JB3 A;  1A3V A;  1EYC A;  4K8J A;  4A3G H;  4HIK A;  3FKI H;  2K75 A;  2ZJP A;  4LF7 L;  1Y14 B;  1ET6 A;  1I3Q H;  3J81 i;  4LFC Q;  5IGC A;  3BDL A;  4GOP C;  1PRT C;  1VQD A;  2ZJR A;  3NK9 A;  2K04 A;  3SDZ A;  4HSV A;  3V2T A;  3DMU A;  5AFW A;  3GTK B;  3I4M H;  2UXB L;  3PIP 3;  5IGD A;  3UI2 A;  4DXG A;  1VQK A;  5IE8 A;  1FNW A;  3QOJ A;  1UWV A;  3GV3 A;  1K3R A;  2RKS A;  3K5N A;  3RLN A;  2B63 H;  3S1M B;  1F2L A;  1HZA A;  3FHW A;  4NP5 A;  5A2Q E;  3GTJ H;  3NQT A;  1HPC A;  2VQF Q;  2MNA A;  2ICI A;  3K5L A;  4Y52 H;  2RSN A;  1SMX A;  4OO1 G;  4PG3 A;  4TRD A;  1LAB A;  4JCV E;  3PUZ A;  1HCZ A;  2PPB C;  1BCP C;  1PDQ A;  3Q23 A;  4BS9 A;  2XRS D;  5IGE A;  1I94 Q;  1ZKO A;  3FKI G;  2RBM A;  3BDC A;  3G48 A;  4PV1 C;  5J22 A;  1U0L A;  2K50 A;  3FMC A;  3U9S A;  1N34 Q;  2DNE A;  2Q2U A;  2K5D A;  3P75 A;  3NEN A;  1J8I A;  2PMZ B;  3IFD A;  1RKN A;  2K5W A;  5CV7 A;  4BY1 B;  3I4N B;  2EJF C;  2IY5 B;  1IKL A;  2ZTD A;  4ZAI A;  4A3L H;  3U50 C;  1JC7 A;  3C3L A;  4OEM B;  1PRT D;  2KVM A;  2KQ3 A;  1K0R A;  3BZK A;  1YIT A;  5HY6 A;  1L1O B;  2E76 C;  3MFG A;  4LF8 Q;  2WB1 B;  1R9T B;  2LXJ A;  3MEH A;  2B63 G;  1S40 A;  4A3B G;  4WJ3 M;  3MZ5 A;  4ME3 A;  1WTX A;  4X6A H;  1B3Q A;  1HZ9 A;  2ENB A;  4APV A;  3I72 A;  1CK1 A;  3KDF A;  4HJ7 A;  2R93 B;  4ZUJ A;  1ILP A;  2LSS A;  4LF4 L;  2CW0 C;  2Q8I B;  1N8R C;  3CQZ H;  2QEJ C;  2NVX B;  2VB2 X;  2A5H A;  1BCP D; 
#chains in the Genus database with same CATH homology
 4YCV A;  4DUY Q;  3PUX A;  4DR5 L;  3W5O A;  3S1R H;  1IBM Q;  4GKJ L;  1XMO Q;  3TRZ A;  3H0G G;  2K5H A;  2VZA A;  3K80 C;  4IPH A;  3ICE A;  4IFD J;  2A1A A;  4UP8 A;  3H3V I;  2R7Z H;  3RN2 A;  3J80 c;  1XMQ Q;  5IP7 H;  2UUA L;  2ID0 A;  2MQH A;  4A3K G;  4AH6 A;  3D31 A;  1X9N A;  4NXM Q;  1N33 L;  2KHJ A;  3A74 A;  4A3M H;  2CFM A;  4B3R Q;  4GLX A;  4JI2 Q;  5IP9 G;  1TXY A;  2Z6K C;  2WP8 J;  4AYB E;  2K5V A;  5FJ8 G;  4DV5 Q;  3RZD H;  4OON A;  4TQU S;  1PH7 A;  2PQA A;  1C7Y A;  1HR0 L;  1N32 Q;  4R4T A;  1EWI A;  5C0X G;  1HZB A;  5JJI A;  4DUY L;  4DR4 Q;  1IBM L;  4DR2 Q;  3RNU A;  1XMO L;  4LF9 Q;  5C3E G;  2I5H A;  3GD7 A;  5HGQ A;  2UXC Q;  4IFD G;  1LYL A;  1YZ6 A;  4NXN Q;  1XMQ L;  2QEX A;  4A3E H;  3AYH B;  4NXM L;  1X56 A;  4H02 A;  3JC6 6;  2JA7 H;  3STB C;  3GO5 A;  4GLV B;  4B3R L;  1OXU A;  2UU9 Q;  1PYS B;  3CC4 A;  2JA6 H;  4JI2 L;  5FLM H;  1UE1 A;  2K14 A;  4KLK A;  1VQC A;  4GOP A;  3RLO A;  1VQM A;  2NVY H;  4UY8 C;  1J6Q A;  5ELN A;  4DV5 L;  3S17 H;  4JG2 A;  4QL5 A;  2Q2I A;  1A8V A;  3M4O H;  1YHB A;  2Q2H A;  3K7U C;  5M5Y H;  1TWG H;  1IXR A;  4LWC A;  2ZM6 Q;  1PHJ A;  1YNX A;  4JI4 Q;  4OWW B;  2R7Z G;  1E1T A;  1RIP A;  3WWV A;  4HJ9 A;  4DR4 L;  4DR2 L;  4EQ5 A;  4HJA A;  4LF9 L;  3TS2 A;  4BXX H;  1MJC A;  3S2H H;  1Y1V G;  3W1B A;  1B70 B;  1YJ9 A;  4ALP A;  4HID A;  2EIF A;  4UP7 A;  4GNX C;  1PH1 A;  4A3M G;  4JI7 L;  3I4N H;  2UXC L;  3T1Y Q;  1W3S A;  2VNU D;  2IT1 A;  4RMF A;  1UE6 A;  4JYA Q;  1SRU A;  4OWX B;  2HIX A;  4LW1 A;  3K7A H;  4OO1 I;  3DM3 A;  1Q1E A;  3ER0 A;  4A3B H;  1KAW A;  2XGT A;  2NZH A;  4KHZ A;  5GAE C;  2UU9 L;  1HNW Q;  1YEZ A;  1EQQ A;  4X64 Q;  1EIY B;  4YCW A;  3LGJ A;  3PF5 A;  2JA5 H;  4HIM A;  1A0I A;  1E7Z A;  1KD1 C;  4JI0 Q;  2OCE A;  1IZ6 A;  2OTJ A;  1I6H H;  4DKA C;  2K52 A;  2RF4 A;  4PZ8 A;  2ZM6 L;  4A3I H;  4JI4 L;  1NMG A;  3PIO A;  2UUB Q;  1A63 A;  2MFI A;  4A3F H;  1PA6 A;  3KJO A;  1VQ7 A;  4DV1 Q;  4A93 G;  3CCE A;  3T1Y L;  3KDF B;  1XPR A;  4JYA L;  3TS0 A;  5FLM G;  2D62 A;  5IT9 c;  1HZC A;  1CKN B;  1C9O A;  3CCM A;  1QVF A;  2NVX H;  3H0G H;  4JOI A;  4JV5 Q;  1QUQ A;  3JAM c;  4OX9 Q;  4NB3 A;  3GTP H;  1HNW L;  4JOI C;  2MO1 A;  4A75 A;  5IYD H;  4X64 L;  4B3S L;  2AWN A;  1ASZ A;  4A3K H;  3S1Q H;  2JE6 I;  1AH9 A;  1OXX K;  1HR0 W;  4R4I A;  4BXX G;  1G6P A;  1PYB A;  2VY3 A;  1WYD A;  4BY1 G;  4YWK A;  1Z47 A;  4QGU A;  2ZTC A;  1QVG A;  3CD6 A;  4X62 Q;  3I4N G;  1VQF A;  2CWP A;  2CWA A;  1XNQ Q;  2VUM G;  5IP9 H;  3CMA A;  1UE7 A;  3OTO Q;  3L0O A;  5FJ8 H;  2E2H H;  1NE3 A;  4DV1 L;  1PH9 A;  1IBL Q;  1IBK Q;  2WB1 G;  4X65 Q;  1JE5 A;  3PUY A;  3M85 A;  1N36 Q;  3E9I A;  1WFQ A;  1YJW A;  1VQE A;  1HNX Q;  2JA5 G;  5C3E H;  1PV4 A;  4BBR H;  4OX9 L;  1UE5 A;  2JA9 A;  2PQA B;  3HOW G;  2JK8 A;  2E2I H;  3PCO B;  1VQB A;  1PH6 A;  1VQH A;  1YVC A;  1V1Q A;  3PSI A;  3KF6 A;  1VQ4 A;  1Z9F A;  5C44 G;  4JI1 L;  2KCM A;  2R93 G;  1AE3 A;  1VQJ A;  2HQL A;  4X62 L;  3PUW A;  1XNQ L;  4K0K Q;  4R4C A;  5C0X J;  4B3M Q;  5ELO A;  3I55 A;  2YYZ A;  3CCR A;  4DV2 Q;  3OTO L;  4DAM A;  1JT8 A;  3K0X A;  4FDB A;  4P73 A;  2KBN A;  1IBK L;  1X3G A;  5IYD G;  2XTI A;  1OXS C;  4X65 L;  1IBL L;  1X65 A;  1N36 L;  5IYC H;  4L5S A;  2UXD Q;  2OQ0 A;  1MJE A;  4BY7 G;  2AKW B;  3RN5 A;  3HOV H;  1QZG A;  3CPW A;  1VQN A;  2HIV A;  5LMN Q;  2B29 A;  2PI2 E;  2YTY A;  1Y1V H;  3ULL A;  4GOP B;  4A3J H;  1HNX L;  4DV0 Q;  1MKH A;  4DAY B;  1EUJ A;  1E3P A;  1G29 1;  1E24 A;  1OTC A;  3OW2 A;  1JJC B;  2GN5 A;  1KQS A;  4OWT B;  4LF5 Q;  5GRO A;  1HNZ Q;  4JI6 Q;  2Z6K A;  2OTL A;  3GTK H;  1LM0 A;  4QJF A;  4X66 Q;  3GTM H;  1PFS A;  4QY7 A;  1JMC A;  1KRT A;  3J81 c;  2JA8 G;  3CAM A;  4GN4 B;  1VQ8 A;  2RHQ B;  1TWC H;  4IFD I;  4K0K L;  1OXV A;  1KL9 A;  2R6G A;  3MXN B;  4L5T A;  4DV2 L;  4B3M L;  3S1M H;  4YY3 Q;  2JQO A;  4DR3 Q;  4JBK A;  4B3S Q;  3S16 H;  4LFB Q;  3ERS X;  3D0F A;  4BBR G;  1L1O C;  3F2B A;  1RL2 A;  3HOX H;  1PH3 A;  1TWF H;  3BJU A;  2K4K A;  2R7D A;  1XPO A;  3S2D H;  5DLQ E;  2UXD L;  1X55 A;  1PH2 A;  5IY0 A;  5LMN L;  3U58 A;  4LNQ A;  2QA4 A;  4O2D A;  1Q82 C;  1NY4 A;  4JI0 L;  4BA2 I;  2BA0 A;  4NPS A;  5C4X H;  1BVS A;  4A4I A;  3DLL A;  4DV0 L;  4LF5 L;  4LF7 Q;  3PF4 A;  4A93 H;  5GAD C;  1B8A A;  1SN8 A;  4A3D H;  1HNZ L;  4JI6 L;  4X66 L;  3A5U A;  3K81 C;  2HHH Q;  3GTG H;  2VW9 A;  3S1N H;  4DV6 Q;  1IL2 A;  5JEA G;  1CSP A;  1O7I A;  2BH2 A;  1YBY A;  3GTL H;  1K8G A;  1N32 L;  2EXD A;  2FXQ A;  2Y0S E;  4R4O A;  5IYB G;  2F3I A;  4P74 A;  5GQO A;  3HOZ G;  4L5Q A;  2R92 G;  2UXB Q;  2Y0S G;  1KRS A;  2JEA I;  3RLF A;  1VQ5 A;  3PUV A;  1Q8K A;  3J80 i;  3HOV G;  1MIU A;  1EIF A;  4GNX A;  1Q46 A;  4DR3 L;  3KLW A;  4A3J G;  1CKM A;  2WAQ G;  1S3O A;  3CW2 C;  3H15 A;  1YJN A;  4BY1 H;  1QUQ B;  1EFW A;  1VQG A;  3AQQ A;  4PZ6 A;  5H1S E;  1HJP A;  4DV4 Q;  4LUZ A;  1KIX A;  1XNR Q;  2VUM H;  4NXN L;  5J3B A;  4AQY Q;  4GN5 A;  4DR7 Q;  2PI2 A;  1D8L A;  2LXK A;  2RCN A;  2JEB I;  2KCT A;  3KYH C;  4GLA C;  1T9H A;  1U5K A;  2CKZ B;  5M3M G;  1R9T H;  4JI3 Q;  1XPU A;  4DV3 Q;  1L0W A;  4WJ3 M;  1L2F A;  1BBW A;  3GTO H;  2HHH L;  3CP0 A;  3CC7 A;  1WJJ A;  1CUK A;  4R4Q A;  4DV6 L;  3I7F A;  1Q81 C;  4JI5 Q;  2NVT H;  4IJL A;  1KXL A;  2I0Q A;  1VQA A;  3CCU A;  4LF6 Q;  1VS0 A;  2QGQ A;  3J7A 5;  3HOW H;  2C35 B;  2YTV A;  3HOX G;  4JBM A;  2EQS A;  3T1H Q;  1YHQ A;  1K8A C;  3CC2 A;  3Q8D A;  2HT1 A;  5BR8 Q;  4PMW A;  5C44 H;  2UUB L;  1J5E Q;  1SFO H;  4UP9 A;  1NJI C;  5C4X G;  2R93 H;  4A3C H;  4C3I H;  1D7Q A;  4DV4 L;  3M4P A;  4BA1 I;  1EYG A;  1XNR L;  1G51 A;  1OXT A;  4YWL A;  4A3D G;  1PH8 A;  1S72 A;  3KF6 B;  1YIJ A;  1Q12 A;  3M7N A;  4DNI A;  3F2D A;  4AQY L;  1VQ6 A;  4DR7 L;  3M4Q A;  1WI5 A;  3J81 j;  3VDY A;  4JI3 L;  3I56 A;  4DV3 L;  4HJ8 A;  1M90 C;  1PVO A;  1B7Y B;  1K9M C;  4BY7 H;  2PMZ E;  4JBJ A;  4IO9 A;  2YU9 H;  1CKO A;  2B3G A;  1TWA H;  1Y1W G;  4JI5 L;  5E7N A;  4DR6 Q;  1P8L A;  3CCJ A;  2I5M X;  2VS1 A;  2RHS B;  2R7F A;  4LUO A;  1QVC A;  3F1Z A;  5EAY A;  3ULP A;  3T1H L;  1FJG Q;  4HIO A;  4GN3 B;  1FL0 A;  1LUZ A;  5BR8 L;  2UUC Q;  2KEN A;  3UE1 A;  4DPG A;  3PO3 G;  4A3G G;  1JJ2 A;  2WB1 E;  4O0A A;  1J5E L;  2NN6 G;  2JA8 H;  1HH2 P;  4MTN A;  1H95 A;  3G6E A;  2A19 A;  3G4S A;  3G71 A;  2VQE Q;  1YHA A;  5LMN W;  3I4O A;  1SRO A;  5AJ3 Q;  4EX5 A;  4P72 A;  5C4J H;  4TVA B;  3CME A;  4JV5 L;  4JI8 Q;  3PO2 G;  1BBU A;  3HFZ B;  2NVQ H;  3U4V A;  1NBW A;  3I4M G;  2OWO A;  2VL6 A;  4JBW A;  4OXP A;  3BZC A;  4DUZ Q;  2YV5 A;  3SGI A;  1XJV A;  1ASY A;  4BBS G;  3H3V H;  2IX0 A;  4DR6 L;  1GKH A;  4YWM A;  5LMU Q;  4AIM A;  4A3C G;  4RG1 A;  1FJG L;  1V9P A;  3KFU A;  2ATW A;  2UUC L;  3UDF A;  3I2Z A;  5IYB H;  1SLJ A;  3HOZ H;  3M9B A;  1GM5 A;  2R92 H;  3JAM i;  1E1O A;  2L15 A;  3KF8 B;  4QIW E;  2VQE L;  1Q7Y C;  5AJ3 L;  3HKZ G;  2CCZ A;  1E22 A;  2OQK A;  4JI8 L;  4WJ4 A;  3CCS A;  5C0X I;  1I50 H;  2YTX A;  4YHH Q;  2I5L X;  1NTG A;  2NZO A;  5JEA J;  4GNX B;  3TEH B;  5M3M H;  5LMU L;  2IX1 A;  2D0P A;  1I5F A;  4IOA A;  1SE8 A;  4IPG A;  3W1G A;  1EOV A;  3CCV A;  4IOC A;  1W2B A;  2BA1 A;  4POF A;  2AWO A;  3ULJ A;  3J7Z C;  2GVA A;  2E5L Q;  1L1O A;  1KHI A;  2BH8 A;  3CXC A;  3PIP A;  4A3L G;  4XIG S;  4XTC S;  5M5W H;  5M5X H;  4B3T Q;  1GVP A;  4KHP Q;  1V43 A;  2F4V Q;  4POG A;  2N8N A;  2ZTE A;  1BKB A;  4IPC A;  4DV7 Q;  2ES2 A;  2A8V A;  5JJK A;  2PNH A;  1WOC A;  1P16 A;  2N78 A;  2Z0S A;  4YHH L;  2ZJQ A;  3HKS A;  4YCU A;  4HJ5 A;  4AYB G;  1QZH A;  3S24 A;  1X3E A;  1LTL A;  3TQY A;  2MO0 A;  4LFA Q;  3S14 H;  3AFQ A;  2K5N A;  2Q2T A;  4YY3 L;  1Y1W H;  2WAQ E;  4JI7 Q;  2IHF A;  1Q1B A;  1XTD A;  2E5L L;  2ALY B;  3AEV A;  3RZO H;  4MNO A;  4DK6 C;  1VQL A;  1SR3 A;  3K8A A;  4B3T L;  2CQO A;  1FGU A;  3FP9 A;  4P75 A;  4KHP L;  4A3G H;  2F4V L;  5M3F H;  3PO3 H;  4HIK A;  3FKI H;  2K75 A;  4DV7 L;  3E9H A;  2ZJP A;  3TRE A;  1Y14 B;  5IYC G;  4LF7 L;  1I3Q H;  1JB7 A;  1NMF A;  3NBH B;  3J81 i;  4LFC Q;  1YI2 A;  4GOP C;  1K73 C;  4IPD A;  1VQD A;  3EN2 A;  2ZJR A;  3CPF A;  4JC0 A;  3PO2 H;  4LFA L;  5IP7 G;  1VQ9 A;  4L5R C;  3UDI A;  3I4M H;  2UXB L;  3EIV A;  4DR1 Q;  1VQK A;  4QQB X;  4BBS H;  3EBE A;  2F52 A;  5IE8 A;  1X3F A;  1UWV A;  2N3S A;  3HOU H;  1K3R A;  3RLN A;  2B63 H;  3BU2 A;  2DGY A;  1HZA A;  1DGS A;  3FHW A;  3GTJ H;  3U4Z A;  1WCM H;  2VQF Q;  2MNA A;  4J15 A;  2AHO B;  4C3H H;  2V1C C;  4UPA A;  4A76 A;  4GKK Q;  4Y52 H;  1JJG A;  4LFC L;  1SMX A;  3NEM A;  3KOJ A;  5GAG C;  4OO1 G;  2WFW A;  4PG3 A;  3UDX A;  3PV0 A;  2H5X A;  4KI0 A;  5IWA Q;  1X54 A;  3KJP A;  2NN6 I;  4JCV E;  3HOY H;  3PUZ A;  4LF6 L;  2D0O A;  3F2C A;  4C3J H;  1GD7 A;  4A3E G;  1VCI A;  4R1J A;  2IHE A;  4DR1 L;  1TWH H;  1I94 Q;  2JA7 G;  5M3F G;  3A5Z B;  3FKI G;  2JA6 G;  1KC8 C;  3G48 A;  1PH4 A;  3IRB A;  4LUV A;  1U0L A;  2GVB A;  2K50 A;  1VQO A;  3S15 H;  1N34 Q;  3STB D;  2Q2U A;  3MEF A;  3AFP A;  3NEN A;  4GS3 A;  2VQF L;  1FVI A;  4GKK L;  2AMC B;  2KHI A;  4MZ9 A;  2IY5 B;  2ZTD A;  4A3L H;  5JJL A;  3GDE A;  1VQI A;  2N49 A;  3U50 C;  1PH5 A;  4LF4 Q;  1EQR A;  4JI1 Q;  5IWA L;  1K0R A;  3BZK A;  5GAH C;  2DUD A;  3L2P A;  3HOU G;  1YIT A;  5HY6 A;  1L1O B;  3CCQ A;  4LF8 Q;  1CSQ A;  3B6Y A;  2LXJ A;  2B63 G;  4DR5 Q;  4GKJ Q;  4PZ7 A;  1S40 A;  2ASB A;  4A3B G;  3PGZ A;  5FLX c;  3CF5 A;  1Q86 C;  2JJQ A;  3OYY A;  4DK3 C;  4P71 A;  1I94 L;  4LFB L;  3M3Y H;  1WCM G;  5K36 G;  4ME3 A;  1IYJ B;  4X6A H;  1HZ9 A;  1A62 A;  2UUA Q;  4IJH A;  1M1K C;  1X6O A;  4APV A;  1N34 L;  3HKZ E;  4C2M H;  1N33 Q;  1AE2 A;  3A0J A;  3KDF A;  2E8G A;  4HJ7 A;  3CCL A;  4A3I G;  1VQP A;  3HOY G;  3F8T A;  1C0A A;  3ZJY C;  1CKN A;  1K83 H;  3UE0 A;  4Y7N H;  2LSS A;  4LF4 L;  3L7Z C;  4A3F G;  2E2J H;  3GTQ H;  1UEB A;  1N8R C;  4DUZ L;  3CQZ H;  3UDG A;  3NEL A;  3RR5 A;  1HR0 Q;  1N9W A;  3E0E A;  4LF8 L;  1GO3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...