1S40A

Solution structure of the cdc13 dna-binding domain complexed with a single-stranded telomeric dna 11-mer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
187
structure length
187
Chain Sequence
KMARKDPTIEFCQLGLDTFETKYITMFGMLVSCSFDKPAFISFVFSDFTKNDIVQNYLYDRYLIDYENKLELNEGFKAIMYKNQFETFDSKLRKIFNNGLRDLQNGRDENLSQYGIVCKMNIKVKMYNGKLNAIVRECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISRYFEEYRRFFPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*GP*TP*GP*GP*GP*TP*GP*TP*G)-3'
publication title Structural basis for telomeric single-stranded DNA recognition by yeast Cdc13
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 27
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2004-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1s40A00
3AFQA 4BBRG 4DR4Q 3M4OH 4O0AA 5FJ8H 3CP0A 2AWNA 4IJLA 4C3HH 2A1AA 2F52A 2UXBL 3UDIA 5IYCG 3I4OA 1C9OA 2NVTH 1L1OC 2D62A 3KF6A 4A3KH 2PNHA 4JC0A 4C2MH 4AQYQ 2OQ0A 1YHQA 3FKIG 2WAQE 2IY5B 4TQUS 1M90C 3KF6B 4PMWA 1PH1A 3PSIA 4BBRH 3CC4A 4LFCL 1JJ2A 3TS0A 4B3ML 2UXCL 3NBHB 2HQLA 4L5QA 5E7NA 2PMZE 5IYCH 1CUKA 3CCSA 1PV4A 1OXSC 1G6PA 3PUYA 1G291 3FKIH 2B63G 2ID0A 3L2PA 1YJ9A 3PF5A 2ZTEA 1EWIA 1GKHA 1VCIA 2R7ZG 1N32L 4H02A 3K0XA 4A3IG 2OTJA 3FHWA 2F3IA 3I4NG 3CMEA 4DPGA 2C35B 4IFDI 2VNUD 2Q2TA 1Z47A 3HOUG 4B3RQ 2HT1A 4PZ6A 1X3GA 3E0EA 3J80c 4DV0L 1UE1A 2B63H 4DR5Q 1HNXQ 3S14H 5IYBG 1VQNA 3UDGA 3RLOA 1HZBA 1K9MC 2XGTA 2R7ZH 2KCTA 1N34Q 2WAQG 4IPCA 4A3IH 3SGIA 3I4NH 3U4ZA 5C4XG 4DV4L 3KJOA 2UUAQ 2JA6G 1K8GA 3HOUH 2VW9A 3S2DH 4P75A 1KC8C 4HJ7A 1KXLA 1YEZA 1WOCA 2YTYA 3HOZG 3RN5A 1N36L 5IYDG 4X65L 1VQFA 2E2JH 1EIYB 5IYBH 2N78A 1OXTA 3J81c 4BBSG 4IPGA 1V9PA 3D0FA 3BZKA 4JBWA 2UXBQ 4JI8L 3KYHC 2VQFL 5C4XH 3L7ZC 1QVCA 3B6YA 4OXPA 2JA6H 2UU9L 4HIDA 3S1RH 3WWVA 1YNXA 4JCVE 2K4KA 4LFCQ 1FGUA 2BH2A 3HOZH 5IYDH 1PYSB 4B3MQ 2ALYB 4NXNL 2AMCB 2ASBA 2ES2A 2UXCQ 4BBSH 2GVBA 1GM5A 1R9TH 4DV1L 3CCMA 4GKKL 1VQ9A 1DGSA 2JE6I 5LMUL 1EIFA 4JBJA 3TRZA 4LW1A 1HZCA 1OXUA 1GVPA 4PZ8A 4GNXA 3GTJH 3H0GG 1ASZA 1XNRL 1IBKL 4JI3L 4GLXA 1N32Q 4AYBE 4YWKA 1VQ7A 3CCVA 4JV5L 2MO0A 4GNXB 2BA1A 2CKZB 3GTOH 2ZM6L 1X9NA 1Q12A 1NY4A 5M5WH 4APVA 1CKOA 3UDXA 4WJ4A 4FDBA 2KHIA 3PO2G 4A3BG 1PH2A 3EBEA 4LFBL 3BU2A 3H0GH 4LWCA 4DV0Q 3AFPA 3EN2A 3ICEA 2CFMA 3NENA 2Z6KC 3S2HH 2NZOA 1A62A 1HH2P 1X6OA 4L5SA 4MZ9A 3TREA 1KHIA 2Q2IA 3GD7A 3ULPA 1XMOL 1M1KC 5HY6A 4DK3C 1B8AA 1D8LA 4A3JG 4DR6Q 4KHPL 1N9WA 1SROA 3UE1A 1VQPA 3PO2H 4UPAA 4DR7L 4LF7Q 2N8NA 1N36Q 2B29A 4X65Q 4QJFA 1NMFA 1HR0L 3NEMA 1VQHA 4A3MG 3A5ZB 4JI8Q 2VQFQ 4AIMA 4DUYL 4AYBG 1NE3A 5GAGC 1Q1BA 2HHHL 2UU9Q 3CCLA 4A3JH 1MJCA 4GN4B 2LXJA 1EFWA 1C7YA 3PO3G 4K0KL 1Y14B 2E2HH 1GD7A 4DK6C 1VQOA 4LFAL 1VQEA 4NXNQ 2PI2A 1SFOH 1PH5A 1I6HH 3PUXA 3I7FA 4GOPC 3RLFA 4A3MH 4RMFA 4DV1Q 4GKKQ 1PVOA 3GTGH 4X66Q 5LMUQ 1VQ8A 1V43A 4R1JA 3HOYG 1EUJA 3MXNB 1SRUA 1WFQA 4L5TA 5GQOA 4DR2L 1Y1WG 1KAWA 2ATWA 3E9IA 4NB3A 5AJ3L 4JI3Q 1CSQA 5JJIA 2UUCL 3PO3H 1XPRA 2I0QA 4JV5Q 5IP7G 2ZM6Q 4YCWA 4IO9A 3KLWA 3T1HL 1XMQL 2BA0A 2JA9A 2K5HA 2ZJQA 2GVAA 4B3TL 4RG1A 5JJLA 4P73A 1NJIC 4YCVA 1VQCA 2B3GA 4NPSA 1WI5A 5IWAL 2OQKA 1SMXA 1YIJA 1Y1WH 2CCZA 4LF6L 2VUMG 1NBWA 1K8AC 3GTLH 4LNQA 4LFBQ 2CQOA 4KLKA 3K81C 5IP7H 5FLXc 3AQQA 3W1BA 1OTCA 3CCJA 4OX9L 2VQEL 5JJKA 4JOIA 1VQDA 2WB1E 1X3FA 2KHJA 3F2DA 3F2BA 3CC2A 4KHPQ 1X55A 3CXCA 4OWWB 3G48A 1C0AA 5LMNW 2NZHA 4JI0Q 2ZTDA 1EQRA 1AE2A 3E9HA 1VQ6A 4YHHL 2VUMH 4DR7Q 1PH8A 1YJNA 4YWLA 1HR0Q 1KD1C 1QZGA 1XJVA 4B3SL 4GNXC 2NVQH 3A0JA 1JT8A 1BBWA 4A3FG 1PH9A 4DUYQ 2AWOA 1L0WA 4BXXG 4R4OA 2HHHQ 3S17H 2GN5A 1Z9FA 3U58A 1SN8A 2D0OA 5HGQA 1NTGA 3M7NA 3HKSA 4OO1I 3L0OA 3STBD 3TEHB 3GTMH 4LFAQ 1LUZA 4WJ3M 1S40A 2F4VL 2IHEA 5C0XJ 4MNOA 4A3FH 3S15H 3M4PA 5H1SE 2LXKA 4YCUA 2WP8J 3ULJA 2RHQB 3EIVA 4QQBX 4BXXH 4DR2Q 1KQSA 4C3IH 4X6AH 3PV0A 5AJ3Q 3M4QA 4GLAC 2UUCQ 1QZHA 3S16H 1YHBA 2WB1G 4IJHA 2AHOB 4IPDA 3T1HQ 2A8VA 4DUZL 1XMQQ 2RF4A 3I56A 3JAMi 1H95A 3OYYA 4B3TQ 1JE5A 4LF5L 4HJ9A 4TVAB 2OTLA 1XNQL 1S72A 4DR1L 4QY7A 5IWAQ 1HNWL 1YHAA 2KCMA 4MTNA 4LF6Q 1EYGA 4A3CG 1Q86C 1KRSA 4JBMA 2PQAA 4QGUA 3PUVA 2V1CC 1E1OA 1HZAA 4A4IA 3NELA 1JJGA 2UXDL 5GROA 2CWAA 2KENA 1P8LA 1L1OA 2QA4A 2PQAB 1UE6A 2R6GA 4BA1I 2VQEQ 4OX9Q 2JA8G 4UP7A 3STBC 5IE8A 4A76A 1EOVA 1O7IA 1L1OB 1NMGA 1HNZL 3H3VI 2I5MX 5GAEC 4YHHQ 2RHSB 4A3CH 2Y0SE 3BZCA 2Z0SA 1J6QA 5M3FG 1VQ4A 4B3SQ 1PHJA 2BH8A 2JA7G 1PA6A 1IBLL 1QVGA 1FJGL 4DV3L 2QGQA 1E7ZA 4A3DG 1UWVA 2JA8H 1JB7A 2CWPA 2N49A 4HIMA 1PFSA 1L2FA 5M5XH 3H3VH 1OXXK 1VQJA 3DM3A 5M3FH 5JEAJ 4IFDJ 3CCEA 1LYLA 1CSPA 2JA7H 4L5RC 2VL6A 3CAMA 1YZ6A 5IP9G 4DV4Q 2YV5A 1VQMA 1TWFH 4JI4L 2F4VQ 4LF9L 1IL2A 1D7QA 4A3DH 1W2BA 3GTKH 2VY3A 3K7AH 4PZ7A 4R4CA 2PI2E 1X54A 2K52A 2YYZA 5C3EG 1T9HA 1PYBA 4JOIC 2RCNA 4KHZA 1CKNA 1K83H 3K7UC 1IYJB 4QIWE 4X62L 1I94L 4HIOA 1YITA 1XPUA 3F8TA 4DUZQ 1AE3A 3RLNA 5IP9H 1CKNB 4DV7L 1HR0W 2Q2UA 2Y0SG 2YTXA 4LF5Q 3PF4A 3PIOA 1Q82C 1XPOA 1XNQQ 4Y52H 4DR1Q 1HNWQ 4JI6L 4NXML 3CQZH 3PIPA 2FXQA 2N3SA 4R4IA 3PGZA 5C3EH 3D31A 4LUOA 4UY8C 4YY3L 3CPFA 2E8GA 2JK8A 2UXDQ 4P72A 4LF7L 3T1YL 4IOAA 4K0KQ 1Q8KA 2YTVA 4LUVA 3S24A 2VZAA 1WYDA 2ZJRA 4GLVB 1MKHA 3RN2A 4DV5L 1XNRQ 3KOJA 1E1TA 2MFIA 2K75A 3PCOB 1IBKQ 4BY1G 1U5KA 1HNZQ 1YI2A 4JI2L 1LM0A 2IX0A 2I5HA 4EQ5A 1I50H 4JI7L 4XIGS 3G4SA 3AEVA 3U4VA 4JI5L 1PH3A 3K8AA 1IBLQ 3HKZG 4DV3Q 4POGA 4BY7G 1FL0A 1OXVA 1KRTA 2YU9H 1YVCA 1E22A 3J7A5 4KI0A 1QUQA 4GS3A 2DGYA 4OWTB 3J81i 4BY1H 1G51A 3S1QH 3UDFA 1SE8A 2K50A 4YWMA 3CC7A 1XMOQ 4JYAL 1QUQB 3HFZB 4LF4L 4J15A 4JI4Q 2MQHA 4C3JH 4A3GG 4LF9Q 4BY7H 3KF8B 2R7FA 4DKAC 5IT9c 4HJAA 1VQ5A 3F1ZA 1AH9A 1SLJA 3GDEA 3OTOL 3CPWA 2HIVA 2OCEA 4ALPA 2JEAI 4GKJL 1PH7A 2Z6KA 1RIPA 3K80C 1K0RA 1TWAH 2AKWB 1PH4A 4X62Q 1I94Q 1VQKA 1I3QH 1BBUA 1HZ9A 4AH6A 4IPHA 4DV7Q 4EX5A 4R4TA 4JI1L 4A3GH 3RNUA 2Q2HA 2EIFA 2OWOA 1ASYA 2DUDA 4JI6Q 4NXMQ 5LMNL 4OO1G 5GAHC 2ZJPA 1Q7YC 2E2IH 3HOVG 1EQQA 1N33L 1X56A 4YY3Q 4LF8L 1TXYA 3TS2A 1Q81C 4UP8A 1XTDA 3PUWA 1S3OA 4DR3L 1I5FA 5BR8L 1UEBA 3F2CA 3T1YQ 2LSSA 3PUZA 4DV6L 3IRBA 1BKBA 1MJEA 4DV5Q 4DAYB 5J3BA 2QEXA 3I2ZA 4R4QA 2IT1A 4JI2Q 3OW2A 4Y7NH 2NN6G 1TWHH 4JI7Q 2NN6I 3AYHB 4P74A 3J7ZC 4JI5Q 3HOVH 4X64L 4GOPA 3G6EA 3S1NH 4O2DA 1V1QA 1VQIA 1A8VA 1TWGH 3ERSX 3A74A 4POFA 4HJ8A 5M3MG 3I4MG 4A93G 1VQLA 5C4JH 3HOYH 4GOPB 1YBYA 4A3EG 3CCUA 4DR6L 3MEFA 4JG2A 2NVXH 4JYAQ 3RZDH 1P16A 3I55A 4LF4Q 1UE7A 3KJPA 2KBNA 3ULLA 5K36G 1U0LA 2UUBL 4A93H 2IHFA 4XTCS 5M3MH 5M5YH 3I4MH 3RZOH 1CKMA 1Q46A 5IY0A 3BJUA 4QL5A 3OTOQ 2JJQA 4A3EH 4DV2L 1KIXA 3KFUA 4GKJQ 1X65A 1VQAA 3M9BA 2E5LL 5GADC 1A0IA 2JEBI 3CD6A 3M3YH 2NVYH 1RL2A 2JA5G 3U50C 4JI1Q 1IBML 4JBKA 4BA2I 2R93G 5DLQE 1HJPA 3G71A 3TQYA 5FLMG 3CMAA 3Q8DA 5LMNQ 4LUZA 3GO5A 1J5EL 1QVFA 4X66L 2VS1A 3W1GA 1N33Q 4DR4L 1BVSA 4UP9A 1W3SA 3VDYA 2EQSA 5C0XG 3M85A 4LF8Q 5C0XI 1VQBA 4DR3Q 5BR8Q 1JJCB 1GO3E 4DV6Q 2JA5H 1FVIA 4A3LG 3HKZE 4DAMA 2JQOA 2MO1A 2D0PA 1B7YB 4ME3A 2R93H 3FP9A 5EAYA 1IZ6A 4AQYL 5FLMH 1KL9A 3JC66 2MNAA 1IXRA 3ER0A 2R7DA 3UE0A 1VS0A 4X64Q 3RR5A 3GTQH 5C44G 3ZJYC 4A75A 1JMCA 2I5LX 2IX1A 3GTPH 2K14A 4A3LH 2K5NA 1N8RC 4OONA 3HOXG 4HJ5A 2WFWA 3S1MH 3CF5A 1WCMG 1Q1EA 3JAMc 1A63A 4IOCA 3HOWG 3CCRA 4A3BH 4JI0L 1X3EA 4GN3B 2A19A 2K5VA 1YJWA 3DLLA 3J80i 5C44H 2UUBQ 1MIUA 1Y1VG 3H15A 1SR3A 2L15A 2ZTCA 2EXDA 4DNIA 1VQGA 4DV2Q 2R92G 4P71A 3HOXH 4B3RL 1UE5A 4GN5A 3A5UA 3LGJA 1E24A 1LTLA 5ELNA 1WCMH 5ELOA 5FJ8G 3CW2C 4HIKA 1K73C 2E5LQ 1FJGQ 4DR5L 1HNXL 1E3PA 4PG3A 3HOWH 4OWXB 1K3RA 3KDFA 1N34L 1TWCH 1IBMQ 1Y1VH 4A3KG 2H5XA 1PH6A 3W5OA 3CCQA 2UUAL 3J81j 5JEAG 2XTIA 3KDFB 1J5EQ 4IFDG 2R92H 1WJJA 1B70B 2HIXA
chains in the Genus database with same CATH superfamily
3AFQA 3FKIB 4BBRG 3MXGA 4FXGC 4O0AA 5FJ8H 1A3UA 3ZYYX 2XRQD 3UDIA 1HQRD 5IYCG 2NVTH 3KF6A 2DJFC 2G9DA 4OGQC 4X3TA 3FKIG 1M90C 3PSIA 3CC4A 2IW3A 2UXCL 3I4NB 1UUPA 3X3MA 1JOKA 1PV4A 1YNNC 4RAUC 2D2CC 1G6PA 4WORA 1WVLA 2ID0A 3RMHA 2QDLA 4ZLTF 1KDAA 4H02A 1KNAA 2OTJA 3I4NG 2VNUD 4DPGA 1LTAD 1JQYD 4DK0A 1Z47A 4FYDA 1KNEA 2RDHA 4PZ6A 5DEHA 2F0WA 4DV0L 1UE1A 2B63H 1TY2A 1HZBA 2I46A 1HCZA 2KCTA 1N34Q 5KEEA 4A3IH 2B2YC 3SGIA 2F0FA 4DV4L 3KJOA 5EQ0A 2UUAQ 2SEBD 3HOUH 1KXLA 4DNTB 4IUNA 3GTJB 4E6IA 2NUCA 4FVMA 2A5HA 2PYKA 3D0FA 3BZKA 2UXBQ 2VQFL 1XTCD 4FO2A 3MA2B 1EEFD 5C4XH 3B6YA 4OXPA 1MGSA 2F0KA 3K5LA 3S1RH 1YNXA 3H0GB 4LFCQ 1FGUA 5M9OA 4NXNL 4DV1L 4QB4A 4JBJA 4LW1A 3C1EA 1XNRL 1GVPA 3H0GG 1DCZA 4JI3L 2LMCB 3HP3A 3CCVA 3GTOH 2CKZB 2ZM6L 3MEHA 1EZ6A 1LABA 3IL8A 1U4LA 1XYIA 1GHJA 4K5XA 1S5DD 3EBEA 5C3XA 4F7XA 3S2HH 3KBXA 3KUPA 2Q2IA 1XMOL 1SFOB 2XVSA 1NR2A 2D5DA 4DK3C 1B8AA 1D8LA 4DR6Q 4KHPL 1BF4A 1SROA 1VQPA 3PO2H 3L9AX 4X65Q 3IAYA 1STAA 2F0VA 5CC4A 3A5ZB 4AIMA 4CHTB 4RCNA 1SNMA 3TP6A 4AYBG 2UU9Q 4A3JH 1MJCA 3PO3G 5TSSA 1VQEA 1CHQD 4GKKQ 3GTGH 4C3JB 5LMUQ 2Q8IB 1VQ8A 4R1JA 5IGDA 1DONA 1SRUA 2ATWA 4BY7B 1AEXA 1NAPA 4NB3A 3T56B 2VUMB 4QIWB 1XPRA 5IP7G 3PQIA 2NVQB 1Y8NB 3T1HL 2BA0A 2JA9A 3I90A 2K5HA 4CDCC 4DU9A 5JJLA 1NJIC 1VQCA 5IWAL 3E3XA 2VUMG 1YIJA 3I70A 1H9RA 2VQEL 4JOIA 2F0QA 4OWWB 3Q0AA 1C0AA 4JVZA 5K5PA 1QB5D 4DAPA 1EQRA 1VQ6A 4YHHL 3BVGA 3DWPA 1HR0Q 1T5EA 4UHVA 1TS3A 4BXXG 4R4OA 5DM63 1Z9FA 1HUMA 3MVVA 3M7NA 5EKKA 3TEHB 1I4RA 2CH4A 4RH6A 3S15H 3M4PA 5H1SE 3TZUA 2A68C 3OIPA 4QCLA 1KQSA 4X6AH 3GV6A 3PV0A 4GLAC 1BOSA 1QZHA 1YHBA 2ZXOA 2AHOB 4IPDA 1GUOA 4FP5D 2A8VA 1XMQQ 1H95A 4B3TQ 2NVYB 1XNQL 5EBDA 4DR1L 3OHXC 2XRSD 2KCMA 4MTNA 3EQLC 3TP7A 5LHY1 3NELA 1JJGA 1L1OA 1P8LA 2QA4A 4OX9Q 3NTHA 4UP7A 3STBC 1PTOB 1HNZL 3MTSA 2K5DA 3H3VI 2I5MX 3D8GA 2TMPA 1J6QA 1PHJA 3PMFA 1M4VA 1LTGD 1GHKA 1QVGA 4DV3L 2FJ2A 2X6GA 4K6DA 2QILA 5IGCA 2N49A 4HIMA 2TSSA 1L2FA 3DWQA 4ZK9B 3DM3A 5C3EB 5M3FH 3CCEA 1STYA 4ZAIA 4L5RC 2F4VQ 5T1IA 4LF9L 2VB2X 2PW5A 4PZ7A 2B8FA 2K52A 5C3EG 1SDFA 2A73B 4JOIC 3HOXB 4QIWE 1PYWD 3F8TA 4DUZQ 1B50A 2Y0SG 3PF4A 5IIFA 3CQZH 1SAPA 2QKIC 3PGZA 4XQNA 3S1QB 4UY8C 2R92B 1AP0A 4KY6A 1Q8KA 2YTVA 4LUVA 3SK8A 1QJOA 4DV5L 3KOJA 1IBKQ 4YIJA 2K75A 3QB3A 2PZWA 2IX0A 4JI7L 1RHPA 1EYCA 3K8AA 3IFDA 1IBLQ 4POGA 1S5CD 1HPCA 3H6MA 3CU7A 3NBIA 2F1MA 4O42A 4KI0A 4N8X1 4GS3A 4OWTB 4BY1H 3H3VC 4N8FA 1SE8A 3CC7A 2L1BA 3QIAA 1SBBB 3HFZB 3X3NA 3VR4A 5A2QL 3DWAA 2EY6A 4QUCA 4DKAC 5IT9c 3GDEA 3OTOL 3CPWA 2JEAI 4ODGA 3K80C 4EVOA 1PH4A 1TWAH 3P75A 2B2WC 5E4XA 4X62Q 1I94Q 2B63B 1HZ9A 2K04A 4DV7Q 1XX8A 2PO4A 2F4IA 4JI1L 1HTLD 3M4YA 4KJOA 1AW7A 2EIFA 3R2TA 1CHPD 3I4LA 3K5MA 4NXMQ 2A69C 1KTKA 1Q7YC 2E2IH 1F77A 5I9OA 4LMQD 3HOUB 1U4MA 4LF8L 2M00A 3U9SA 1XTDA 1S3OA 4DR3L 1MJEA 1Z6HA 3I4MB 3SEBA 2EJMA 3R3OA 4R4QA 2IT1A 3OW2A 5CV7A 5C4XB 2NN6G 3OIQA 2WKDA 3S1RB 1ML0D 3OSOA 1V1QA 3MFYA 3I4MG 1VQLA 3I91A 4FNFA 1GXDC 5EBCA 3V05A 4DR6L 5FO9B 1R4PB 4JG2A 4WJWA 4JYAQ 1P16A 1H9JA 1UE7A 3KJPA 3I72A 3OPOA 2L9HA 2IHFA 4HMIA 3GTOB 3RZOH 5KYIA 4QL5A 2A6HC 5C4HA 4DV2L 1LTBD 1KIXA 3KFUA 3A55A 4OHJA 2E5LL 2CH4W 1A0IA 3CD6A 4KK7A 3M3YH 2IWHA 3U50C 3SHLA 3VA5A 1BCPF 2MUYA 2B2UA 5DLQE 1BO0A 3CMAA 5LMNQ 2Z4IA 1N33Q 2EYPA 1DJRD 4UP9A 1W3SA 1II3A 3PO2B 1VQBA 3M7GA 4DV6Q 4A3LG 5CV5A 4DAMA 1V1PB 2EJFC 2MO1A 2D0PA 1H9MA 1IXRA 4A3JB 4N9PA 3GTQH 5CV4A 5L37A 1U9RA 3AU7A 2I5LX 2DNCA 4F87A 1N8RC 4OONA 1H9SA 1Q1EA 5CGKA 4IOCA 1LTTD 1EY6A 4U673 2P5ZX 3M4OB 1X3EA 3DLLA 3J80i 1ONLA 1Y1VG 4DNIA 1TU2B 2MJ8A 1PRTF 2KVMA 3VR5A 3LGJA 4HIKA 3FRPB 1FJGQ 1A3TA 1E3PA 4PG3A 3BYYB 4OWXB 1K3RA 3T4AC 5BN4A 3OW7A 3J81j 3KDFB 1WJJA 4S3SA 4Y7NH 4DR4Q 2MGSA 1VF5C 5E3FA 1CI3M 2JXMB 3CP0A 1F2YA 2AWNA 4IJLA 4C3HH 4ZQ3A 2RDGA 1G6ZA 4A3KH 4AQYQ 4KD3A 1GUNA 3P7JA 3KF6B 3E5SA 3NBHA 1JCKB 3TS0A 4LAAA 4B3ML 3J7AV 1B3AA 1B53A 1L0YB 3NWTA 4H0LC 4FF4A 4NMZA 4XYQA 1HFNA 2G9HD 3S2DB 4G7ZC 3L2PA 5IGGA 2B2UC 2B2TC 2ZTEA 1GKHA 1Y69U 5FO7B 1TQOA 4ZKBB 2E2JB 2ENBA 4MIUA 2RVLA 4M8AA 2Q2TA 1SNDA 4B3RQ 4ZYSA 5HGTA 1K28A 1X3GA 3CRLC 4KTAA 3J80c 2KA7A 4DR5Q 1HNXQ 5IYBG 2HQEA 3HOZB 2R7ZH 4IPCA 5CMDA 4RGTA 2F0HA 3N52A 3FVQA 2WB1B 3U4ZA 3CRKC 1K8GA 3H09A 1YEZA 3G7LA 1NNXA 1AN8A 2YTYA 3HOZG 3RN5A 5IYDG 1VQFA 1OXTA 3PIO3 4JI8L 2AQ2B 3L7ZC 2JA6H 3J80E 4XT3B 1HA6A 2K5QA 1AZPA 4WRDA 2F0TA 1TVXA 3RUZA 2AMCB 5G3LD 5M3FB 2ASBA 4BBSH 4EQOA 3CCMA 5EPJA 1VQ9A 1D6EC 1EIFA 3Q6SA 3TRZA 5LL6S 4PZ8A 1BDOA 3WOEA 4QMGA 2NBFA 1ASZA 3MFGA 1IBKL 4CKEA 1N32Q 4YWKA 2MO0A 2N55A 1H9KA 1Q12A 1NY4A 5M5WH 2SNSA 4APVA 1PMRA 1CKOA 1R4QB 1EU4A 4FDBA 4IUPA 4A3BG 4QUFA 3BU2A 4LWCA 3EN2A 2R3ZA 3NENA 5FLXL 1F2ZA 2E2HB 2NZOA 1A62A 2QCPX 4MZ9A 3TREA 1KHIA 1PRTD 4V0BA 1BQQT 5IT9L 1B9NA 1N9WA 1BBXC 1LT6D 2N8NA 3NUCA 1N36Q 2B29A 4QJFA 1NMFA 1SYCA 3SXHA 3EJIA 1ENAA 3N6RA 1VQHA 2IX3A 1NE3A 1DXMA 1X32A 1EFWA 4I7AA 3S9WA 3DEOA 3GTLB 2K5WA 1O80A 2IL8A 1GD7A 4BY1B 1PXUA 4DK6C 1NUCA 1VQOA 2PI2A 3UI2A 1I6HH 4A3MH 4RMFA 2ZXRA 1WTWA 4X66Q 1JC7A 4DR2L 1WFQA 4CJ0B 3E9IA 5AJ3L 5D3IB 2UUCL 2BDOA 4JV5Q 2EPBA 4YCWA 1O78A 3KLWA 1TWAB 4PV1C 1PFMA 1IW7C 4RHSA 4YCVA 2B3GA 3HOYH 1SNQA 1WI5A 1Y1WH 4DA2A 4LFBQ 3HZXA 1NBWA 2XSCA 1SNOA 2PW7A 5BN5A 3TN2A 4KLKA 1RD9D 3K81C 2A68D 3I73A 3QWNA 1JOQA 4IUUA 5JJKA 2WB1E 2KHJA 1EYAA 5LMNW 2NZHA 3E9HA 4DR7Q 4KY5A 2H4OA 2F0IA 3QOJA 1YJNA 5HURA 1SYGA 4PNYA 1BBWA 5JVG3 3KK7A 4DUYQ 3TMEA 2AWOA 1L0WA 2HHHQ 1ILPA 3S17H 1B1ZA 2D0OA 5HGQA 1NTGA 3K6OA 5J39A 3STBD 3GTMH 4LFAQ 2O2LD 4WJ3M 1MSGA 2IHEA 5C0XJ 4MNOA 4A3FH 2WP8J 2RHQB 3EIVA 1Q90A 4C3IH 3RZOB 3S16H 3MAQA 5EKLA 1WTRA 3JAMi 4RCOA 4HJ9A 1A6XA 3QJYA 1S72A 3OWFA 5ELBA 4LF6Q 1EYGA 1Q86C 1KLGD 5LL6X 3PUVA 3I8ZA 1E1OA 2UXDL 5GROA 2HDLA 2KCNA 4K0KL 1UE6A 2R6GA 4BA1I 1TWFB 2AUJD 3GTKB 3K7AB 1L1OB 4IUVA 4A3CH 1RJTA 3BZCA 1VQ4A 4B3SQ 1K83B 3E0JA 3FPPA 2BH8A 5DNFA 5IODA 1PA6A 1FJGL 3VYSA 4JPBW 3Q22A 2RSNA 2JA8H 2CWPA 3RD4A 4HAEA 5C6AA 2F03A 5M5XH 1O7ZA 3KLRA 5JEAJ 4IFDJ 1LYLA 3H91A 4G7HC 2JA7H 5IGFA 1VQMA 4JI4L 1QNKA 1IL2A 1TT2A 4A3DH 1W2BA 2KQ3A 1EEID 1CA6A 4FF1A 4ILWA 1X54A 2YYZA 1PYBA 2RCNA 4KHZA 1CKNA 1I50B 3K7UC 5ELEA 3IFTA 1EU3A 1STNA 4C56C 3ND8A 3BDCA 5IP9H 2Q2UA 3TP8A 4LF5Q 3PIOA 3MHBA 1XPOA 1HNWQ 3PIPA 4R4IA 2N3SA 2EYHA 3D31A 4H7BA 3CPFA 2E8GA 2I07B 4P72A 4LF7L 3T1YL 4IOAA 3KBGA 3S24A 1CQFA 2XNAC 2L5TA 1MKHA 2ZJRA 4RKBA 3C3LA 4NDXA 1YI2A 2I5HA 3R8BA 3SK5A 3AEVA 3J80L 3G4SA 4JI5L 3F2UA 4C3JG 4DXFA 1I3QB 4BY7G 1PTOF 2A69D 2KEDA 2YU9H 2WKCA 1E22A 3J7A5 1PFBA 1RKNA 3VR6A 1QUQA 3J81i 1G51A 1X3QA 3UDFA 3D4RA 3ITPA 2F0UA 4LF4L 4J15A 4TSSA 5KNCA 2QW7A 1SLJA 2HIVA 1NCVA 1PH7A 2Z6KA 2IPKD 1JOOA 1RDPD 4IURA 2AKWB 5D3DA 1VQKA 3S1NB 1BBUA 4IPHA 1TWGB 4B9WA 4R4TA 4A3GH 2R7ZB 4CGYB 3SVMA 5JOBA 5C4JB 2E2DC 4JI6Q 4OO1G 2ZJPA 1EQQA 1X56A 1HA5A 4YY3Q 3TS2A 4UP8A 4DAYA 5I6WA 1UEBA 2LSSA 1BKBA 3HG9A 1L0XB 5M3MB 5M5YB 2WAQB 5I2XA 3I2ZA 3DUZA 4JI2Q 4A3EB 4JW0A 3HOVH 4P74A 3C46A 3D3RA 1F9RA 4CKBA 4GOPA 2SDFA 4POFA 3ERSX 4HJ8A 5M3MG 1QNUA 1STGA 1MI2A 4A3EG 4DN4M 4LJZC 1SYDA 1ICFB 4XQJA 1SE3A 2NVXH 3RZDH 3I55A 2QEJC 2KBNA 4U68A 5K36G 1LT3D 1K3BC 2UUBL 4A93H 2JA5B 1DOLA 4TRDA 5CV6A 5IY0A 2MHVA 3BJUA 2JJQA 4GKJQ 1G2TA 1I4XA 2BOSA 1V1OA 3T13A 5GADC 2JEBI 1TS5A 2JA5G 1IBML 4JBKA 4DAVA 2HDMA 4LUZA 1J5EL 1QVFA 4X66L 3QR8A 1Y8PB 2EQSA 5BR8Q 1GO3E 5C44B 4CKCA 1A2UA 2R93H 3KLSX 5IOCA 5FLMH 1KL9A 4OIJA 2MNAA 2R7DA 1CZGA 4X64Q 5C0XH 5C44G 1JMCA 1GUSA 3GTPH 2K14A 4ABNA 2K5NA 1I6HB 3HOXG 1SMYD 2WV6D 1PFNA 3CCRA 4A3BH 1JWSD 1H9SB 1PTOD 5ELDA 2K5VA 3H15A 3TBIB 2NVTB 2EXDA 2R92G 1ILQA 1UE5A 3TSSA 3HS0C 2QF7A 1E24A 1LTLA 1WCMH 3D4DA 2F3WA 5FJ8G 5EGTA 3HOYB 3HOWH 1Y1WB 3NHHA 3T51B 1WTXA 1N34L 1TWCH 2NTSA 2H5XA 5FO8B 1ZYRD 3NXWA 1PH6A 2UUAL 3VA7A 1B70B 2KOLA 1ZXTA 3DMUA 2CHBD 2F0MA 1G8ZD 4PMBA 2F52A 2QDBA 2UXBL 3I4OA 1L1OC 2BE5C 2D62A 4X3KA 2EY1A 2PNHA 4ZUIA 4C2MH 1SE2A 4IZ8A 4NW2A 2WAQE 2IY5B 5JEAH 4IFDH 1PH1A 1FNUA 4BBRH 4LFCL 1CK1A 1LV9A 3BYTB 3NBHB 4L5QA 5E7NA 3GTMB 4A3IB 1ZKOA 5IYCH 1CUKA 3CCSA 1OXSC 1JB3A 2AQ1B 3URYA 1G291 1K8MA 3FKIH 1B9MA 1STEA 2B63G 5AFWA 2CW0C 3A56A 3K0XA 4A3IG 2C35B 3HOUG 4H44C 4QF4A 2Z4HA 3T16A 1FYCA 1WTPA 1EQTA 5EPLA 1ET6A 1OO9B 3UDGA 3RLOA 5D65A 3I4NH 1SNPA 5C4XG 4RA8A 1PZKD 3FPUB 2VW9A 5BN3A 4HJ7A 4X65L 2L12A 1S5ED 4IPGA 4JBWA 2F0SA 2LY7A 2UU9L 4M1UB 2K1BA 2JA8B 1D2BA 2JYOA 1PZJD 4RGOS 3S2HB 1PYSB 2ALYB 2UXCQ 1GM5A 4KKSA 4GKKL 2JA7B 1DGSA 1E2VA 2JE6I 5LMUL 1AZQA 4GNXA 3A7LA 3GTJH 1JORA 1CM9A 1VQ7A 4J6HA 2BA1A 4K5WA 1CFMA 5G3LF 4UDUC 3UDXA 4WJ4A 1JICA 3PO2G 3H0GH 4DV0Q 3A8IE 3AFPA 3ICEA 4HTHA 1F9QA 1X6OA 2HCIA 4L5SA 3ULPA 2F0OA 1M1KC 5HY6A 3GTGB 4A3JG 4UPAA 2FMCA 4HMJA 1IW7D 2PQEA 5ISRA 1HR0L 4KHVA 1LLRD 1QWYA 3MZ5A 1IYUA 2H1EA 1K8OA 2VQFQ 3OWEB 4J8QA 5GAGC 2YU9B 2R61A 2LXJA 1C7YA 1Y14B 3EA6A 4I65A 1YNND 1FNWA 1SE4A 5EPKA 4NXNQ 1LT5D 3MXNA 1SFOH 4DV1Q 1PVOA 2XIWA 4B08A 1B2TA 3DM1A 1V43A 4L5TA 5GQOA 4JI3Q 1CSQA 5JJIA 4RFBA 3PO3H 1J8IA 2I0QA 2C9OA 2ZM6Q 4IO9A 1XMQL 2PCFB 2GVAA 4B3TL 2L0CA 4FXDA 1G91A 1EY8A 3MC0B 2OQKA 1SMXA 1WD1A 3BS1A 2KECA 2L4NA 4EQNA 4LNQA 2K7VA 2CQOA 1KDCA 4G57A 2B2VA 5IP7H 1OTCA 2C5CA 3KLSA 1MD2D 4OX9L 3S15B 5J1ZA 3CC2A 1X3FA 3F2DA 3F2BA 4DGZA 1X55A 4KHPQ 3G48A 4JI0Q 2ZTDA 1AE2A 2VUMH 1BCPB 2RA4A 1JT8A 1KD1C 2Z8LA 1QZGA 2NVQH 4GNXC 3HOVB 2F0NA 1TS4A 3A7AB 3C1FA 1UEAB 4RWSC 3HKSA 1SXTA 3L0OA 1S40A 2F4VL 3RZDB 1EL0A 4YCUA 4QQBX 3BVZA 4BXXH 1WD0A 1C48A 2E76C 2EYOA 5C3WA 2DNEA 3L3OC 2WB1G 4IJHA 1EQVA 3T1HQ 4DUZL 2RF4A 1QG7A 2J0TD 1TKWB 1JE5A 4J1MA 2OTLA 4QY7A 5IWAQ 1YHAA 2ZXPA 1A3VA 2PQAA 1BXTA 4ZUJA 4QGUA 2V1CC 1RF2D 1PRTB 1FR3A 1DYQA 2VQEQ 3J7AF 2X6LA 1SNCA 4P2CB 5GAEC 4YHHQ 2R93B 3OMGA 4X3SA 5M3FG 2Z0SA 1E2WA 5KNBA 1EIGA 3K59A 1IBLL 2QGQA 2JN4A 4K2LA 4BS9A 3BDLA 1U4RA 3GTPB 2DJGC 3CQZB 1KLUD 4CBVA 1YNJC 1CSPA 2VL6A 3CAMA 1YZ6A 1SEBD 1PTOH 2VY3A 2O5JC 2PI2E 4HSVA 4K8IA 4XDXA 1B3QA 4Q5VA 4X62L 1I94L 2B2YA 4HIOA 1WCMB 1EIHA 4I7ZC 1AE3A 1SJHD 3GP7A 1CKNB 3RLNA 4DV7L 4HR7B 4Y52H 2NYZD 1XNQQ 4DR1Q 1TWCB 4NXML 1V8QA 2FXQA 1CTMA 3EVQA 5C3EH 4LUOA 3J7YW 1ICWA 2FFKB 1WTVA 5IGEA 4LK1C 4GLVB 1E1TA 2MFIA 1HNZQ 4BY1G 1U5KA 3LWEA 4KJNA 3SDZA 2F0JA 4C2MB 4L6TB 3U4VA 2HD3A 1PH3A 4DV3Q 4EQPA 4BBRB 1LTSD 1OXVA 1KRTA 1YVCA 2EOTA 2DGYA 4G4KA 3NTIA 2E2IB 1C8CA 3S1QH 3DXJC 4JYAL 3KF8A 1QUQB 4FF2A 1EY5A 2MQHA 4LF9Q 1MSHA 3CKIB 3F1ZA 3QOLA 4ALPA 1RIPA 1GUWA 1KABA 1K0RA 5JPNC 1I4QA 3W2DA 4AH6A 1ESRA 4EX5A 3FMCA 1EZ8A 2IJ0A 2Q2HA 1HHVA 2OWOA 1STBA 1I4HA 4TKOB 3OOCA 5LMNL 4DK1A 5GAHC 2JSOA 4K8JA 5I4DA 1N33L 2WIIB 4OIKA 1TXYA 4H13C 3PUWA 4DV6L 3PUZA 5FK9C 1QE6A 5EKIA 4DV5Q 3W3AA 4DAYB 3LWUA 1PZID 1SYBA 1QCBD 4HEDA 2XWBB 2WINB 2K32A 1TWHH 2MP1A 4JI7Q 3AYHB 3J7ZC 2A6EC 1DM0B 3G6EA 3G6JB 1S5BD 3HGBA 4O2DA 1A8VA 3M3YB 1FGBD 3A74A 2PMZB 2F3VA 4GOPB 1YBYA 3CCUA 1D5XC 2V4DA 3T53B 1QOHA 2NN6H 4L8JA 4G7OC 1C4QA 5CV8A 2RSOA 4DF7A 3ULLA 1U0LA 4XT1B 4XTCS 3I4MH 4IQZA 1CKMA 5I2YA 3OTOQ 1E2ZA 5JVH3 1X65A 3D6CA 1DOMA 3M9BA 2AQ3B 3GTQB 2PZTA 4ZRZA 4JI1Q 4BA2I 5J22A 1BR9A 3AB9A 3K57A 2VS1A 3W1GA 4DR4L 1BVSA 2NB0A 2BCOA 3M85A 4LF8Q 5C0XI 4DR3Q 5A2QE 2JQOA 4RGMA 4IUTA 1B7YB 1ZEQX 4AQYL 1IZ6A 1BCPC 3JC66 2M9VA 3ER0A 1VS0A 2RCFA 2N88A 4NKLA 3VYRA 3ZJYC 1HTPA 2IX1A 4A3LH 1HUNA 2EYMA 3K5NA 3S1MH 2WFWA 5CBAE 2M2LA 3CF5A 3JAMc 1TS2A 1A63A 5IGBA 4Y7NB 3WOFA 4KMUC 4AYBB 4JI0L 2A19A 2BE5D 4C3HB 1YJWA 1Q8IA 2K01A 3MXPA 3QG1A 4R9WA 3PO3B 4ME5A 1MIUA 1XXGA 2L15A 2X69A 5I6YA 1U4PA 4A3KB 4DV2Q 4B3RL 4KKTA 5ELOA 1K73C 2E5LQ 4DR5L 4C3HG 1HNXL 3EFXD 5ELFA 5I9PA 1EOTA 1Y1VH 3P1HA 4A3KG 4KKUA 3CCQA 3JAME 2XTIA 4IFDI 1X9NA 2CW0D 1O7LA 1PRTC 1JE4A 3M4OH 5COYA 2BDNA 3NE5B 2A1AA 2DY7A 1GOZA 4EGVA 1C9OA 2O4XA 4JC0A 5DM73 2OQ0A 1YHQA 4IALA 4TQUS 1G2SA 4PMWA 1UNSA 2ICIA 2CQAA 5C5MA 1JJ2A 3HEJA 1UAPA 1I4PA 2HQLA 3ERQA 1S4ZA 1PDQA 4DNRB 2PMZE 5E4WC 3PUYA 1TIID 1YJ9A 2LS01 3IKJA 3PF5A 1EWIA 1VCIA 2R7ZG 2A6HD 1N32L 1MHWC 3GV3A 4RGNA 4N9TA 3FHWA 2F3IA 3CMEA 3TDQA 1HQMC 4F88A 4B9XA 2HT1A 2JA6B 2J4XA 3E0EA 4HCEA 3S14H 3LNNA 1VQNA 1HFGA 1ET9A 4CDEC 2XGTA 1K9MC 1EY0A 1STHA 2WAQG 3QO2A 4BBSB 2JA6G 1F2MA 4XQQA 3S2DH 4P75A 2EVBA 3V96A 1KC8C 2E74C 3AMUA 1WOCA 1D5ZC 1KAAA 3NK9A 2OF1A 1DZ1A 1N36L 2E2JH 1EIYB 5IYBH 2N78A 3J81c 4BBSG 1V9PA 1VMPA 3KYHC 2EJGC 5M5WB 1QVCA 1AFPA 1F9PA 2O5IC 4HIDA 2L11A 1MBYA 3WWVA 1EYDA 4JCVE 2K4KA 2BH2A 3HOZH 4GZYC 2OT2A 3FDTA 5IYDH 1LTRD 3ND9A 4B3MQ 1F9SA 2ES2A 2EDGA 2GVBA 1R9TH 5D14A 2FMMA 3DHQA 5ELCA 1HZCA 1OXUA 2B2WA 1IHZA 1M8AA 1IKMA 2Q8TA 3J81E 1GUTA 4GLXA 4AYBE 4JV5L 4GNXB 4FF3A 1VMCA 2KHIA 1EY4A 5FKAC 1RODA 1PH2A 4LFBL 2CFMA 2FINB 2Z6KC 1HH2P 5CR3A 2RKSA 2JP1A 3GD7A 4A3MB 4OL7A 3NPPA 3UE1A 1I6VC 2Y0SB 4DR7L 2EY2A 1T5XD 3O13A 3NEMA 3I3CA 3VR3A 4A3MG 4JI8Q 1ENFA 4UAIA 4DUYL 1EY7A 5C4ZA 2HHHL 1Q1BA 2K03A 3BVMA 3CCLA 1XWEA 4GN4B 1WTHA 1EWHA 2E2HH 4LFAL 1PH5A 2XWJB 3PUXA 3I7FA 4GOPC 3RLFA 1Q3LA 4K6LA 3K0YA 3LX0A 3HOYG 1EUJA 5JJZA 3MXNB 1Y1WG 3GQBA 4ULLA 5FOBB 1KAWA 4CDFC 2FHTA 1KDBA 1FNVA 2RBMA 2Q8RE 2KUMA 3ONAB 2ZJQA 3V2TA 2ICEC 4RG1A 4MN3A 4P73A 4MTKA 4NPSA 2EYJA 3S17B 3GTLH 1EWCA 4LF6L 5CBEE 2CCZA 1K8AC 1S5FD 5FLXc 3AQQA 3W1BA 2Z1CA 2RQXA 1PLFA 2KEEA 3CCJA 1SJED 2A74C 4A3FB 1VQDA 1HXYD 3CXCA 4OELB 4C3IB 3OMCA 1W6JA 4PQXA 2KJXA 1PH8A 1IKLA 1Y8OB 4YWLA 4B3SL 2OEOA 3S16B 3H94A 1XJVA 1TWHB 3A0JA 4A3FG 1PH9A 3Q24A 1HRJA 2VXWA 4C3IG 3VYUA 2GN5A 3U58A 1SN8A 3R2IA 5FLXE 4OO1I 1IYVA 3FEWX 1D5MC 1LUZA 1ENCA 2LXKA 3ULJA 5IT9E 2LFNA 4Z9CB 4DR2Q 5AJ3Q 3M4QA 5KRUA 2UUCQ 4JK1C 1J9OA 2NTTA 2Z9HA 2NZ1D 3I56A 1EY9A 3OYYA 4LF5L 2EE1A 4TVAB 4OEMB 1HNWL 1ESFA 1YNJD 4A3CG 3EROA 3JAML 5M5XB 1KRSA 4JBMA 1HZAA 4A4IA 4NP5A 1DD2A 4R8NA 1F2LA 4DFAA 2CWAA 2KENA 5CYUA 2PQAB 3NWSA 3A54A 2JA8G 3SR1A 5IE8A 2AUKA 4A3DB 2LKVA 3WDNA 4A76A 1EOVA 1O7IA 1NMGA 5DAUA 2MPMA 2RHSB 2Y0SE 4K2KA 4XYOA 3SK4A 2JA7G 4PMCA 2K28A 2F0GA 1E7ZA 4A3DG 1UWVA 1JB7A 1QILA 1PFSA 4ID6A 2B2TA 3NQIA 3DEPA 3H3VH 1OXXK 1VQJA 2PNRC 1NR4A 4HN7A 3S1MB 1LACA 1SSOA 2F0EA 4DV4Q 5IP9G 2YV5A 1TWFH 1W6KA 1D7QA 3D6WA 3GTKH 3K7AH 4R4CA 4ZCKA 4KD4A 5T1GA 5C5LA 1T9HA 1K83H 1IYJB 1RTNA 1YITA 1XPUA 1WTQA 1HR0W 4L63B 2YTXA 1Q82C 4CJ1B 1SYEA 4JI6L 4HSPA 1Y1VB 3P20A 2EYFA 2B39A 4YY3L 2EY5A 4Q0FA 2JK8A 2UXDQ 2HCCA 1JWMD 4K0KQ 2EYLA 3HKZB 1CT1D 2VZAA 1WYDA 5KNDA 2EXZA 3RN2A 1XNRQ 3PCOB 2D9UA 3BDOA 1VDZA 5JPMC 4JI2L 1LM0A 4EQ5A 1I50H 4DXGA 4XIGS 3TP5A 2E75C 3A8KE 3C2PA 2XN9C 3HKZG 1SYFA 3TZDA 1FL0A 4BWGB 3SK6A 4A3GB 1B4OA 4CDDC 5CORA 3E6ZX 5NUCA 3CHBD 1TY0A 4V190 2K50A 5E1FA 5F2DA 4YWMA 1XMOQ 4JI4Q 4C3JH 3J81L 1SMYC 4KV6A 2NWGA 4A3GG 4BY7H 3K5OA 3KF8B 2R7FA 1VQ5A 4HJAA 1PTOC 2PPBC 1AH9A 2A6ED 4GKJL 2OCEA 1CZWA 3VR2A 1K0SA 1I3QH 3S14B 2K33A 1EFID 3RNUA 1ASYA 2DUDA 4R8IA 5CV9A 3HOVG 1E0BA 1ZYRC 1Q81C 2Z6BA 2NVXB 4LF7Q 1I5FA 5BR8L 3F2CA 3T1YQ 3NP8A 3IRBA 2KCCA 4A93B 1CA5A 1A15A 5J3BA 2QEXA 5KGUA 4OO1H 4ZKCB 2DY8A 3VYTA 2NN6I 4IN3A 1Z7TA 2HUGA 4JI5Q 4X64L 3NQTA 3S1NH 1VQIA 1TWGH 4A93G 4RHRA 4KN7C 2F0DA 5C4JH 2K05A 4O1NA 4WFN3 4X3UA 1R9TB 3MEFA 2K6AA 3NSWA 4LF4Q 2EZVA 1D1KA 3BZDB 3MWYW 4FXKC 1BCPD 3R93A 3NTKA 1LT4D 5M3MH 5M5YH 1Q46A 4A3EH 3PIP3 2SOBA 4K14A 1TR5A 4C1NI 1VQAA 2NVYH 1RL2A 5JAVA 3K58A 5K36H 1DOKA 1LO5D 3HRZC 2R93G 3G71A 1HJPA 1I4GA 1CQVA 4RKLA 1JWUD 4K5VA 3TQYA 3Q8DA 5FLMG 3GO5A 4C1NK 1GJXA 3BG3A 5EJWA 3VDYA 5C0XG 4A3BB 1V1PA 2RDFA 1JJCB 2JA5H 1IL8A 1FVIA 2B2VC 3HKZE 2L55A 1BUVT 3D4WA 3SE0A 4ME3A 3FP9A 5EAYA 4HCSA 2KHSA 2DN8A 4F8MA 3UE0A 3RR5A 1FD7D 1O7YA 2G5DA 3HOWB 5KIXA 1D1IA 4A75A 2OXPA 4CJ2C 2GA4B 5KYLA 4HJ5A 2ZT9C 1JR0D 2F0LA 1B44D 1WCMG 1WTOA 2F0PA 3HOWG 1X3PA 4GN3B 4KN4C 1RTOA 5C44H 4XXEA 2UUBQ 1SR3A 2ZTCA 1A2TA 1VQGA 2PZUA 2B8GA 3A8JE 4P71A 3HOXH 1BNZA 1VF7A 4IUQA 4GN5A 3A5UA 5ELNA 3MXUA 2WACA 3CW2C 1GUGA 2J7ZA 2SNMA 5A35A 2CVRA 3KDFA 1IBMQ 1NSNS 3W5OA 1LTID 4KY7A 1RCVD 5JEAG 4IFDG 3Q23A 1J5EQ 4MHEA 2VB3X 2R92H 2HIXA 3U9OA
chains in the Genus database with same CATH topology
3AFQA 4BBRG 4DR4Q 3M4OH 4O0AA 5FJ8H 3CP0A 2AWNA 4IJLA 4C3HH 2A1AA 2F52A 2UXBL 3UDIA 5IYCG 3I4OA 1C9OA 2NVTH 1L1OC 2D62A 3KF6A 4A3KH 2PNHA 4JC0A 4C2MH 4AQYQ 2OQ0A 1YHQA 3FKIG 2WAQE 2IY5B 4TQUS 1M90C 3KF6B 4PMWA 1PH1A 3PSIA 4BBRH 3CC4A 4LFCL 1JJ2A 3TS0A 4B3ML 2UXCL 3NBHB 2HQLA 4L5QA 5E7NA 2PMZE 5IYCH 1CUKA 3CCSA 1PV4A 1OXSC 1G6PA 3PUYA 1G291 3FKIH 2B63G 2ID0A 3L2PA 1YJ9A 3PF5A 2ZTEA 1EWIA 1GKHA 1VCIA 2R7ZG 1N32L 4H02A 3K0XA 4A3IG 2OTJA 3FHWA 2F3IA 3I4NG 3CMEA 4DPGA 2C35B 4IFDI 2VNUD 2Q2TA 1Z47A 3HOUG 4B3RQ 2HT1A 4PZ6A 1X3GA 3E0EA 3J80c 4DV0L 1UE1A 2B63H 4DR5Q 1HNXQ 3S14H 5IYBG 1VQNA 3UDGA 3RLOA 1HZBA 1K9MC 2XGTA 2R7ZH 2KCTA 1N34Q 2WAQG 4IPCA 4A3IH 3SGIA 3I4NH 3U4ZA 5C4XG 4DV4L 3KJOA 2UUAQ 2JA6G 1K8GA 3HOUH 2VW9A 3S2DH 4P75A 1KC8C 4HJ7A 1KXLA 1YEZA 1WOCA 2YTYA 3HOZG 3RN5A 1N36L 5IYDG 4X65L 1VQFA 2E2JH 1EIYB 5IYBH 2N78A 1OXTA 3J81c 4BBSG 4IPGA 1V9PA 3D0FA 3BZKA 4JBWA 2UXBQ 4JI8L 3KYHC 2VQFL 5C4XH 3L7ZC 1QVCA 3B6YA 4OXPA 2JA6H 2UU9L 4HIDA 3S1RH 3WWVA 1YNXA 4JCVE 2K4KA 4LFCQ 1FGUA 2BH2A 3HOZH 5IYDH 1PYSB 4B3MQ 2ALYB 4NXNL 2AMCB 2ASBA 2ES2A 2UXCQ 4BBSH 2GVBA 1GM5A 1R9TH 4DV1L 3CCMA 4GKKL 1VQ9A 1DGSA 2JE6I 5LMUL 1EIFA 4JBJA 3TRZA 4LW1A 1HZCA 1OXUA 1GVPA 4PZ8A 4GNXA 3GTJH 3H0GG 1ASZA 1XNRL 1IBKL 4JI3L 4GLXA 1N32Q 4AYBE 4YWKA 1VQ7A 3CCVA 4JV5L 2MO0A 4GNXB 2BA1A 2CKZB 3GTOH 2ZM6L 1X9NA 1Q12A 1NY4A 5M5WH 4APVA 1CKOA 3UDXA 4WJ4A 4FDBA 2KHIA 3PO2G 4A3BG 1PH2A 3EBEA 4LFBL 3BU2A 3H0GH 4LWCA 4DV0Q 3AFPA 3EN2A 3ICEA 2CFMA 3NENA 2Z6KC 3S2HH 2NZOA 1A62A 1HH2P 1X6OA 4L5SA 4MZ9A 3TREA 1KHIA 2Q2IA 3GD7A 3ULPA 1XMOL 1M1KC 5HY6A 4DK3C 1B8AA 1D8LA 4A3JG 4DR6Q 4KHPL 1N9WA 1SROA 3UE1A 1VQPA 3PO2H 4UPAA 4DR7L 4LF7Q 2N8NA 1N36Q 2B29A 4X65Q 4QJFA 1NMFA 1HR0L 3NEMA 1VQHA 4A3MG 3A5ZB 4JI8Q 2VQFQ 4AIMA 4DUYL 4AYBG 1NE3A 5GAGC 1Q1BA 2HHHL 2UU9Q 3CCLA 4A3JH 1MJCA 4GN4B 2LXJA 1EFWA 1C7YA 3PO3G 4K0KL 1Y14B 2E2HH 1GD7A 4DK6C 1VQOA 4LFAL 1VQEA 4NXNQ 2PI2A 1SFOH 1PH5A 1I6HH 3PUXA 3I7FA 4GOPC 3RLFA 4A3MH 4RMFA 4DV1Q 4GKKQ 1PVOA 3GTGH 4X66Q 5LMUQ 1VQ8A 1V43A 4R1JA 3HOYG 1EUJA 3MXNB 1SRUA 1WFQA 4L5TA 5GQOA 4DR2L 1Y1WG 1KAWA 2ATWA 3E9IA 4NB3A 5AJ3L 4JI3Q 1CSQA 5JJIA 2UUCL 3PO3H 1XPRA 2I0QA 4JV5Q 5IP7G 2ZM6Q 4YCWA 4IO9A 3KLWA 3T1HL 1XMQL 2BA0A 2JA9A 2K5HA 2ZJQA 2GVAA 4B3TL 4RG1A 5JJLA 4P73A 1NJIC 4YCVA 1VQCA 2B3GA 4NPSA 1WI5A 5IWAL 2OQKA 1SMXA 1YIJA 1Y1WH 2CCZA 4LF6L 2VUMG 1NBWA 1K8AC 3GTLH 4LNQA 4LFBQ 2CQOA 4KLKA 3K81C 5IP7H 5FLXc 3AQQA 3W1BA 1OTCA 3CCJA 4OX9L 2VQEL 5JJKA 4JOIA 1VQDA 2WB1E 1X3FA 2KHJA 3F2DA 3F2BA 3CC2A 4KHPQ 1X55A 3CXCA 4OWWB 3G48A 1C0AA 5LMNW 2NZHA 4JI0Q 2ZTDA 1EQRA 1AE2A 3E9HA 1VQ6A 4YHHL 2VUMH 4DR7Q 1PH8A 1YJNA 4YWLA 1HR0Q 1KD1C 1QZGA 1XJVA 4B3SL 4GNXC 2NVQH 3A0JA 1JT8A 1BBWA 4A3FG 1PH9A 4DUYQ 2AWOA 1L0WA 4BXXG 4R4OA 2HHHQ 3S17H 2GN5A 1Z9FA 3U58A 1SN8A 2D0OA 5HGQA 1NTGA 3M7NA 3HKSA 4OO1I 3L0OA 3STBD 3TEHB 3GTMH 4LFAQ 1LUZA 4WJ3M 1S40A 2F4VL 2IHEA 5C0XJ 4MNOA 4A3FH 3S15H 3M4PA 5H1SE 2LXKA 4YCUA 2WP8J 3ULJA 2RHQB 3EIVA 4QQBX 4BXXH 4DR2Q 1KQSA 4C3IH 4X6AH 3PV0A 5AJ3Q 3M4QA 4GLAC 2UUCQ 1QZHA 3S16H 1YHBA 2WB1G 4IJHA 2AHOB 4IPDA 3T1HQ 2A8VA 4DUZL 1XMQQ 2RF4A 3I56A 3JAMi 1H95A 3OYYA 4B3TQ 1JE5A 4LF5L 4HJ9A 4TVAB 2OTLA 1XNQL 1S72A 4DR1L 4QY7A 5IWAQ 1HNWL 1YHAA 2KCMA 4MTNA 4LF6Q 1EYGA 4A3CG 1Q86C 1KRSA 4JBMA 2PQAA 4QGUA 3PUVA 2V1CC 1E1OA 1HZAA 4A4IA 3NELA 1JJGA 2UXDL 5GROA 2CWAA 2KENA 1P8LA 1L1OA 2QA4A 2PQAB 1UE6A 2R6GA 4BA1I 2VQEQ 4OX9Q 2JA8G 4UP7A 3STBC 5IE8A 4A76A 1EOVA 1O7IA 1L1OB 1NMGA 1HNZL 3H3VI 2I5MX 5GAEC 4YHHQ 2RHSB 4A3CH 2Y0SE 3BZCA 2Z0SA 1J6QA 5M3FG 1VQ4A 4B3SQ 1PHJA 2BH8A 2JA7G 1PA6A 1IBLL 1QVGA 1FJGL 4DV3L 2QGQA 1E7ZA 4A3DG 1UWVA 2JA8H 1JB7A 2CWPA 2N49A 4HIMA 1PFSA 1L2FA 5M5XH 3H3VH 1OXXK 1VQJA 3DM3A 5M3FH 5JEAJ 4IFDJ 3CCEA 1LYLA 1CSPA 2JA7H 4L5RC 2VL6A 3CAMA 1YZ6A 5IP9G 4DV4Q 2YV5A 1VQMA 1TWFH 4JI4L 2F4VQ 4LF9L 1IL2A 1D7QA 4A3DH 1W2BA 3GTKH 2VY3A 3K7AH 4PZ7A 4R4CA 2PI2E 1X54A 2K52A 2YYZA 5C3EG 1T9HA 1PYBA 4JOIC 2RCNA 4KHZA 1CKNA 1K83H 3K7UC 1IYJB 4QIWE 4X62L 1I94L 4HIOA 1YITA 1XPUA 3F8TA 4DUZQ 1AE3A 3RLNA 5IP9H 1CKNB 4DV7L 1HR0W 2Q2UA 2Y0SG 2YTXA 4LF5Q 3PF4A 3PIOA 1Q82C 1XPOA 1XNQQ 4Y52H 4DR1Q 1HNWQ 4JI6L 4NXML 3CQZH 3PIPA 2FXQA 2N3SA 4R4IA 3PGZA 5C3EH 3D31A 4LUOA 4UY8C 4YY3L 3CPFA 2E8GA 2JK8A 2UXDQ 4P72A 4LF7L 3T1YL 4IOAA 4K0KQ 1Q8KA 2YTVA 4LUVA 3S24A 2VZAA 1WYDA 2ZJRA 4GLVB 1MKHA 3RN2A 4DV5L 1XNRQ 3KOJA 1E1TA 2MFIA 2K75A 3PCOB 1IBKQ 4BY1G 1U5KA 1HNZQ 1YI2A 4JI2L 1LM0A 2IX0A 2I5HA 4EQ5A 1I50H 4JI7L 4XIGS 3G4SA 3AEVA 3U4VA 4JI5L 1PH3A 3K8AA 1IBLQ 3HKZG 4DV3Q 4POGA 4BY7G 1FL0A 1OXVA 1KRTA 2YU9H 1YVCA 1E22A 3J7A5 4KI0A 1QUQA 4GS3A 2DGYA 4OWTB 3J81i 4BY1H 1G51A 3S1QH 3UDFA 1SE8A 2K50A 4YWMA 3CC7A 1XMOQ 4JYAL 1QUQB 3HFZB 4LF4L 4J15A 4JI4Q 2MQHA 4C3JH 4A3GG 4LF9Q 4BY7H 3KF8B 2R7FA 4DKAC 5IT9c 4HJAA 1VQ5A 3F1ZA 1AH9A 1SLJA 3GDEA 3OTOL 3CPWA 2HIVA 2OCEA 4ALPA 2JEAI 4GKJL 1PH7A 2Z6KA 1RIPA 3K80C 1K0RA 1TWAH 2AKWB 1PH4A 4X62Q 1I94Q 1VQKA 1I3QH 1BBUA 1HZ9A 4AH6A 4IPHA 4DV7Q 4EX5A 4R4TA 4JI1L 4A3GH 3RNUA 2Q2HA 2EIFA 2OWOA 1ASYA 2DUDA 4JI6Q 4NXMQ 5LMNL 4OO1G 5GAHC 2ZJPA 1Q7YC 2E2IH 3HOVG 1EQQA 1N33L 1X56A 4YY3Q 4LF8L 1TXYA 3TS2A 1Q81C 4UP8A 1XTDA 3PUWA 1S3OA 4DR3L 1I5FA 5BR8L 1UEBA 3F2CA 3T1YQ 2LSSA 3PUZA 4DV6L 3IRBA 1BKBA 1MJEA 4DV5Q 4DAYB 5J3BA 2QEXA 3I2ZA 4R4QA 2IT1A 4JI2Q 3OW2A 4Y7NH 2NN6G 1TWHH 4JI7Q 2NN6I 3AYHB 4P74A 3J7ZC 4JI5Q 3HOVH 4X64L 4GOPA 3G6EA 3S1NH 4O2DA 1V1QA 1VQIA 1A8VA 1TWGH 3ERSX 3A74A 4POFA 4HJ8A 5M3MG 3I4MG 4A93G 1VQLA 5C4JH 3HOYH 4GOPB 1YBYA 4A3EG 3CCUA 4DR6L 3MEFA 4JG2A 2NVXH 4JYAQ 3RZDH 1P16A 3I55A 4LF4Q 1UE7A 3KJPA 2KBNA 3ULLA 5K36G 1U0LA 2UUBL 4A93H 2IHFA 4XTCS 5M3MH 5M5YH 3I4MH 3RZOH 1CKMA 1Q46A 5IY0A 3BJUA 4QL5A 3OTOQ 2JJQA 4A3EH 4DV2L 1KIXA 3KFUA 4GKJQ 1X65A 1VQAA 3M9BA 2E5LL 5GADC 1A0IA 2JEBI 3CD6A 3M3YH 2NVYH 1RL2A 2JA5G 3U50C 4JI1Q 1IBML 4JBKA 4BA2I 2R93G 5DLQE 1HJPA 3G71A 3TQYA 5FLMG 3CMAA 3Q8DA 5LMNQ 4LUZA 3GO5A 1J5EL 1QVFA 4X66L 2VS1A 3W1GA 1N33Q 4DR4L 1BVSA 4UP9A 1W3SA 3VDYA 2EQSA 5C0XG 3M85A 4LF8Q 5C0XI 1VQBA 4DR3Q 5BR8Q 1JJCB 1GO3E 4DV6Q 2JA5H 1FVIA 4A3LG 3HKZE 4DAMA 2JQOA 2MO1A 2D0PA 1B7YB 4ME3A 2R93H 3FP9A 5EAYA 1IZ6A 4AQYL 5FLMH 1KL9A 3JC66 2MNAA 1IXRA 3ER0A 2R7DA 3UE0A 1VS0A 4X64Q 3RR5A 3GTQH 5C44G 3ZJYC 4A75A 1JMCA 2I5LX 2IX1A 3GTPH 2K14A 4A3LH 2K5NA 1N8RC 4OONA 3HOXG 4HJ5A 2WFWA 3S1MH 3CF5A 1WCMG 1Q1EA 3JAMc 1A63A 4IOCA 3HOWG 3CCRA 4A3BH 4JI0L 1X3EA 4GN3B 2A19A 2K5VA 1YJWA 3DLLA 3J80i 5C44H 2UUBQ 1MIUA 1Y1VG 3H15A 1SR3A 2L15A 2ZTCA 2EXDA 4DNIA 1VQGA 4DV2Q 2R92G 4P71A 3HOXH 4B3RL 1UE5A 4GN5A 3A5UA 3LGJA 1E24A 1LTLA 5ELNA 1WCMH 5ELOA 5FJ8G 3CW2C 4HIKA 1K73C 2E5LQ 1FJGQ 4DR5L 1HNXL 1E3PA 4PG3A 3HOWH 4OWXB 1K3RA 3KDFA 1N34L 1TWCH 1IBMQ 1Y1VH 4A3KG 2H5XA 1PH6A 3W5OA 3CCQA 2UUAL 3J81j 5JEAG 2XTIA 3KDFB 1J5EQ 4IFDG 2R92H 1WJJA 1B70B 2HIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFQ A;  4BBR G;  4DR4 Q;  3M4O H;  4O0A A;  5FJ8 H;  3CP0 A;  2AWN A;  4IJL A;  4C3H H;  2A1A A;  2F52 A;  2UXB L;  3UDI A;  5IYC G;  3I4O A;  1C9O A;  2NVT H;  1L1O C;  2D62 A;  3KF6 A;  4A3K H;  2PNH A;  4JC0 A;  4C2M H;  4AQY Q;  2OQ0 A;  1YHQ A;  3FKI G;  2WAQ E;  2IY5 B;  4TQU S;  1M90 C;  3KF6 B;  4PMW A;  1PH1 A;  3PSI A;  4BBR H;  3CC4 A;  4LFC L;  1JJ2 A;  3TS0 A;  4B3M L;  2UXC L;  3NBH B;  2HQL A;  4L5Q A;  5E7N A;  2PMZ E;  5IYC H;  1CUK A;  3CCS A;  1PV4 A;  1OXS C;  1G6P A;  3PUY A;  1G29 1;  3FKI H;  2B63 G;  2ID0 A;  3L2P A;  1YJ9 A;  3PF5 A;  2ZTE A;  1EWI A;  1GKH A;  1VCI A;  2R7Z G;  1N32 L;  4H02 A;  3K0X A;  4A3I G;  2OTJ A;  3FHW A;  2F3I A;  3I4N G;  3CME A;  4DPG A;  2C35 B;  4IFD I;  2VNU D;  2Q2T A;  1Z47 A;  3HOU G;  4B3R Q;  2HT1 A;  4PZ6 A;  1X3G A;  3E0E A;  3J80 c;  4DV0 L;  1UE1 A;  2B63 H;  4DR5 Q;  1HNX Q;  3S14 H;  5IYB G;  1VQN A;  3UDG A;  3RLO A;  1HZB A;  1K9M C;  2XGT A;  2R7Z H;  2KCT A;  1N34 Q;  2WAQ G;  4IPC A;  4A3I H;  3SGI A;  3I4N H;  3U4Z A;  5C4X G;  4DV4 L;  3KJO A;  2UUA Q;  2JA6 G;  1K8G A;  3HOU H;  2VW9 A;  3S2D H;  4P75 A;  1KC8 C;  4HJ7 A;  1KXL A;  1YEZ A;  1WOC A;  2YTY A;  3HOZ G;  3RN5 A;  1N36 L;  5IYD G;  4X65 L;  1VQF A;  2E2J H;  1EIY B;  5IYB H;  2N78 A;  1OXT A;  3J81 c;  4BBS G;  4IPG A;  1V9P A;  3D0F A;  3BZK A;  4JBW A;  2UXB Q;  4JI8 L;  3KYH C;  2VQF L;  5C4X H;  3L7Z C;  1QVC A;  3B6Y A;  4OXP A;  2JA6 H;  2UU9 L;  4HID A;  3S1R H;  3WWV A;  1YNX A;  4JCV E;  2K4K A;  4LFC Q;  1FGU A;  2BH2 A;  3HOZ H;  5IYD H;  1PYS B;  4B3M Q;  2ALY B;  4NXN L;  2AMC B;  2ASB A;  2ES2 A;  2UXC Q;  4BBS H;  2GVB A;  1GM5 A;  1R9T H;  4DV1 L;  3CCM A;  4GKK L;  1VQ9 A;  1DGS A;  2JE6 I;  5LMU L;  1EIF A;  4JBJ A;  3TRZ A;  4LW1 A;  1HZC A;  1OXU A;  1GVP A;  4PZ8 A;  4GNX A;  3GTJ H;  3H0G G;  1ASZ A;  1XNR L;  1IBK L;  4JI3 L;  4GLX A;  1N32 Q;  4AYB E;  4YWK A;  1VQ7 A;  3CCV A;  4JV5 L;  2MO0 A;  4GNX B;  2BA1 A;  2CKZ B;  3GTO H;  2ZM6 L;  1X9N A;  1Q12 A;  1NY4 A;  5M5W H;  4APV A;  1CKO A;  3UDX A;  4WJ4 A;  4FDB A;  2KHI A;  3PO2 G;  4A3B G;  1PH2 A;  3EBE A;  4LFB L;  3BU2 A;  3H0G H;  4LWC A;  4DV0 Q;  3AFP A;  3EN2 A;  3ICE A;  2CFM A;  3NEN A;  2Z6K C;  3S2H H;  2NZO A;  1A62 A;  1HH2 P;  1X6O A;  4L5S A;  4MZ9 A;  3TRE A;  1KHI A;  2Q2I A;  3GD7 A;  3ULP A;  1XMO L;  1M1K C;  5HY6 A;  4DK3 C;  1B8A A;  1D8L A;  4A3J G;  4DR6 Q;  4KHP L;  1N9W A;  1SRO A;  3UE1 A;  1VQP A;  3PO2 H;  4UPA A;  4DR7 L;  4LF7 Q;  2N8N A;  1N36 Q;  2B29 A;  4X65 Q;  4QJF A;  1NMF A;  1HR0 L;  3NEM A;  1VQH A;  4A3M G;  3A5Z B;  4JI8 Q;  2VQF Q;  4AIM A;  4DUY L;  4AYB G;  1NE3 A;  5GAG C;  1Q1B A;  2HHH L;  2UU9 Q;  3CCL A;  4A3J H;  1MJC A;  4GN4 B;  2LXJ A;  1EFW A;  1C7Y A;  3PO3 G;  4K0K L;  1Y14 B;  2E2H H;  1GD7 A;  4DK6 C;  1VQO A;  4LFA L;  1VQE A;  4NXN Q;  2PI2 A;  1SFO H;  1PH5 A;  1I6H H;  3PUX A;  3I7F A;  4GOP C;  3RLF A;  4A3M H;  4RMF A;  4DV1 Q;  4GKK Q;  1PVO A;  3GTG H;  4X66 Q;  5LMU Q;  1VQ8 A;  1V43 A;  4R1J A;  3HOY G;  1EUJ A;  3MXN B;  1SRU A;  1WFQ A;  4L5T A;  5GQO A;  4DR2 L;  1Y1W G;  1KAW A;  2ATW A;  3E9I A;  4NB3 A;  5AJ3 L;  4JI3 Q;  1CSQ A;  5JJI A;  2UUC L;  3PO3 H;  1XPR A;  2I0Q A;  4JV5 Q;  5IP7 G;  2ZM6 Q;  4YCW A;  4IO9 A;  3KLW A;  3T1H L;  1XMQ L;  2BA0 A;  2JA9 A;  2K5H A;  2ZJQ A;  2GVA A;  4B3T L;  4RG1 A;  5JJL A;  4P73 A;  1NJI C;  4YCV A;  1VQC A;  2B3G A;  4NPS A;  1WI5 A;  5IWA L;  2OQK A;  1SMX A;  1YIJ A;  1Y1W H;  2CCZ A;  4LF6 L;  2VUM G;  1NBW A;  1K8A C;  3GTL H;  4LNQ A;  4LFB Q;  2CQO A;  4KLK A;  3K81 C;  5IP7 H;  5FLX c;  3AQQ A;  3W1B A;  1OTC A;  3CCJ A;  4OX9 L;  2VQE L;  5JJK A;  4JOI A;  1VQD A;  2WB1 E;  1X3F A;  2KHJ A;  3F2D A;  3F2B A;  3CC2 A;  4KHP Q;  1X55 A;  3CXC A;  4OWW B;  3G48 A;  1C0A A;  5LMN W;  2NZH A;  4JI0 Q;  2ZTD A;  1EQR A;  1AE2 A;  3E9H A;  1VQ6 A;  4YHH L;  2VUM H;  4DR7 Q;  1PH8 A;  1YJN A;  4YWL A;  1HR0 Q;  1KD1 C;  1QZG A;  1XJV A;  4B3S L;  4GNX C;  2NVQ H;  3A0J A;  1JT8 A;  1BBW A;  4A3F G;  1PH9 A;  4DUY Q;  2AWO A;  1L0W A;  4BXX G;  4R4O A;  2HHH Q;  3S17 H;  2GN5 A;  1Z9F A;  3U58 A;  1SN8 A;  2D0O A;  5HGQ A;  1NTG A;  3M7N A;  3HKS A;  4OO1 I;  3L0O A;  3STB D;  3TEH B;  3GTM H;  4LFA Q;  1LUZ A;  4WJ3 M;  1S40 A;  2F4V L;  2IHE A;  5C0X J;  4MNO A;  4A3F H;  3S15 H;  3M4P A;  5H1S E;  2LXK A;  4YCU A;  2WP8 J;  3ULJ A;  2RHQ B;  3EIV A;  4QQB X;  4BXX H;  4DR2 Q;  1KQS A;  4C3I H;  4X6A H;  3PV0 A;  5AJ3 Q;  3M4Q A;  4GLA C;  2UUC Q;  1QZH A;  3S16 H;  1YHB A;  2WB1 G;  4IJH A;  2AHO B;  4IPD A;  3T1H Q;  2A8V A;  4DUZ L;  1XMQ Q;  2RF4 A;  3I56 A;  3JAM i;  1H95 A;  3OYY A;  4B3T Q;  1JE5 A;  4LF5 L;  4HJ9 A;  4TVA B;  2OTL A;  1XNQ L;  1S72 A;  4DR1 L;  4QY7 A;  5IWA Q;  1HNW L;  1YHA A;  2KCM A;  4MTN A;  4LF6 Q;  1EYG A;  4A3C G;  1Q86 C;  1KRS A;  4JBM A;  2PQA A;  4QGU A;  3PUV A;  2V1C C;  1E1O A;  1HZA A;  4A4I A;  3NEL A;  1JJG A;  2UXD L;  5GRO A;  2CWA A;  2KEN A;  1P8L A;  1L1O A;  2QA4 A;  2PQA B;  1UE6 A;  2R6G A;  4BA1 I;  2VQE Q;  4OX9 Q;  2JA8 G;  4UP7 A;  3STB C;  5IE8 A;  4A76 A;  1EOV A;  1O7I A;  1L1O B;  1NMG A;  1HNZ L;  3H3V I;  2I5M X;  5GAE C;  4YHH Q;  2RHS B;  4A3C H;  2Y0S E;  3BZC A;  2Z0S A;  1J6Q A;  5M3F G;  1VQ4 A;  4B3S Q;  1PHJ A;  2BH8 A;  2JA7 G;  1PA6 A;  1IBL L;  1QVG A;  1FJG L;  4DV3 L;  2QGQ A;  1E7Z A;  4A3D G;  1UWV A;  2JA8 H;  1JB7 A;  2CWP A;  2N49 A;  4HIM A;  1PFS A;  1L2F A;  5M5X H;  3H3V H;  1OXX K;  1VQJ A;  3DM3 A;  5M3F H;  5JEA J;  4IFD J;  3CCE A;  1LYL A;  1CSP A;  2JA7 H;  4L5R C;  2VL6 A;  3CAM A;  1YZ6 A;  5IP9 G;  4DV4 Q;  2YV5 A;  1VQM A;  1TWF H;  4JI4 L;  2F4V Q;  4LF9 L;  1IL2 A;  1D7Q A;  4A3D H;  1W2B A;  3GTK H;  2VY3 A;  3K7A H;  4PZ7 A;  4R4C A;  2PI2 E;  1X54 A;  2K52 A;  2YYZ A;  5C3E G;  1T9H A;  1PYB A;  4JOI C;  2RCN A;  4KHZ A;  1CKN A;  1K83 H;  3K7U C;  1IYJ B;  4QIW E;  4X62 L;  1I94 L;  4HIO A;  1YIT A;  1XPU A;  3F8T A;  4DUZ Q;  1AE3 A;  3RLN A;  5IP9 H;  1CKN B;  4DV7 L;  1HR0 W;  2Q2U A;  2Y0S G;  2YTX A;  4LF5 Q;  3PF4 A;  3PIO A;  1Q82 C;  1XPO A;  1XNQ Q;  4Y52 H;  4DR1 Q;  1HNW Q;  4JI6 L;  4NXM L;  3CQZ H;  3PIP A;  2FXQ A;  2N3S A;  4R4I A;  3PGZ A;  5C3E H;  3D31 A;  4LUO A;  4UY8 C;  4YY3 L;  3CPF A;  2E8G A;  2JK8 A;  2UXD Q;  4P72 A;  4LF7 L;  3T1Y L;  4IOA A;  4K0K Q;  1Q8K A;  2YTV A;  4LUV A;  3S24 A;  2VZA A;  1WYD A;  2ZJR A;  4GLV B;  1MKH A;  3RN2 A;  4DV5 L;  1XNR Q;  3KOJ A;  1E1T A;  2MFI A;  2K75 A;  3PCO B;  1IBK Q;  4BY1 G;  1U5K A;  1HNZ Q;  1YI2 A;  4JI2 L;  1LM0 A;  2IX0 A;  2I5H A;  4EQ5 A;  1I50 H;  4JI7 L;  4XIG S;  3G4S A;  3AEV A;  3U4V A;  4JI5 L;  1PH3 A;  3K8A A;  1IBL Q;  3HKZ G;  4DV3 Q;  4POG A;  4BY7 G;  1FL0 A;  1OXV A;  1KRT A;  2YU9 H;  1YVC A;  1E22 A;  3J7A 5;  4KI0 A;  1QUQ A;  4GS3 A;  2DGY A;  4OWT B;  3J81 i;  4BY1 H;  1G51 A;  3S1Q H;  3UDF A;  1SE8 A;  2K50 A;  4YWM A;  3CC7 A;  1XMO Q;  4JYA L;  1QUQ B;  3HFZ B;  4LF4 L;  4J15 A;  4JI4 Q;  2MQH A;  4C3J H;  4A3G G;  4LF9 Q;  4BY7 H;  3KF8 B;  2R7F A;  4DKA C;  5IT9 c;  4HJA A;  1VQ5 A;  3F1Z A;  1AH9 A;  1SLJ A;  3GDE A;  3OTO L;  3CPW A;  2HIV A;  2OCE A;  4ALP A;  2JEA I;  4GKJ L;  1PH7 A;  2Z6K A;  1RIP A;  3K80 C;  1K0R A;  1TWA H;  2AKW B;  1PH4 A;  4X62 Q;  1I94 Q;  1VQK A;  1I3Q H;  1BBU A;  1HZ9 A;  4AH6 A;  4IPH A;  4DV7 Q;  4EX5 A;  4R4T A;  4JI1 L;  4A3G H;  3RNU A;  2Q2H A;  2EIF A;  2OWO A;  1ASY A;  2DUD A;  4JI6 Q;  4NXM Q;  5LMN L;  4OO1 G;  5GAH C;  2ZJP A;  1Q7Y C;  2E2I H;  3HOV G;  1EQQ A;  1N33 L;  1X56 A;  4YY3 Q;  4LF8 L;  1TXY A;  3TS2 A;  1Q81 C;  4UP8 A;  1XTD A;  3PUW A;  1S3O A;  4DR3 L;  1I5F A;  5BR8 L;  1UEB A;  3F2C A;  3T1Y Q;  2LSS A;  3PUZ A;  4DV6 L;  3IRB A;  1BKB A;  1MJE A;  4DV5 Q;  4DAY B;  5J3B A;  2QEX A;  3I2Z A;  4R4Q A;  2IT1 A;  4JI2 Q;  3OW2 A;  4Y7N H;  2NN6 G;  1TWH H;  4JI7 Q;  2NN6 I;  3AYH B;  4P74 A;  3J7Z C;  4JI5 Q;  3HOV H;  4X64 L;  4GOP A;  3G6E A;  3S1N H;  4O2D A;  1V1Q A;  1VQI A;  1A8V A;  1TWG H;  3ERS X;  3A74 A;  4POF A;  4HJ8 A;  5M3M G;  3I4M G;  4A93 G;  1VQL A;  5C4J H;  3HOY H;  4GOP B;  1YBY A;  4A3E G;  3CCU A;  4DR6 L;  3MEF A;  4JG2 A;  2NVX H;  4JYA Q;  3RZD H;  1P16 A;  3I55 A;  4LF4 Q;  1UE7 A;  3KJP A;  2KBN A;  3ULL A;  5K36 G;  1U0L A;  2UUB L;  4A93 H;  2IHF A;  4XTC S;  5M3M H;  5M5Y H;  3I4M H;  3RZO H;  1CKM A;  1Q46 A;  5IY0 A;  3BJU A;  4QL5 A;  3OTO Q;  2JJQ A;  4A3E H;  4DV2 L;  1KIX A;  3KFU A;  4GKJ Q;  1X65 A;  1VQA A;  3M9B A;  2E5L L;  5GAD C;  1A0I A;  2JEB I;  3CD6 A;  3M3Y H;  2NVY H;  1RL2 A;  2JA5 G;  3U50 C;  4JI1 Q;  1IBM L;  4JBK A;  4BA2 I;  2R93 G;  5DLQ E;  1HJP A;  3G71 A;  3TQY A;  5FLM G;  3CMA A;  3Q8D A;  5LMN Q;  4LUZ A;  3GO5 A;  1J5E L;  1QVF A;  4X66 L;  2VS1 A;  3W1G A;  1N33 Q;  4DR4 L;  1BVS A;  4UP9 A;  1W3S A;  3VDY A;  2EQS A;  5C0X G;  3M85 A;  4LF8 Q;  5C0X I;  1VQB A;  4DR3 Q;  5BR8 Q;  1JJC B;  1GO3 E;  4DV6 Q;  2JA5 H;  1FVI A;  4A3L G;  3HKZ E;  4DAM A;  2JQO A;  2MO1 A;  2D0P A;  1B7Y B;  4ME3 A;  2R93 H;  3FP9 A;  5EAY A;  1IZ6 A;  4AQY L;  5FLM H;  1KL9 A;  3JC6 6;  2MNA A;  1IXR A;  3ER0 A;  2R7D A;  3UE0 A;  1VS0 A;  4X64 Q;  3RR5 A;  3GTQ H;  5C44 G;  3ZJY C;  4A75 A;  1JMC A;  2I5L X;  2IX1 A;  3GTP H;  2K14 A;  4A3L H;  2K5N A;  1N8R C;  4OON A;  3HOX G;  4HJ5 A;  2WFW A;  3S1M H;  3CF5 A;  1WCM G;  1Q1E A;  3JAM c;  1A63 A;  4IOC A;  3HOW G;  3CCR A;  4A3B H;  4JI0 L;  1X3E A;  4GN3 B;  2A19 A;  2K5V A;  1YJW A;  3DLL A;  3J80 i;  5C44 H;  2UUB Q;  1MIU A;  1Y1V G;  3H15 A;  1SR3 A;  2L15 A;  2ZTC A;  2EXD A;  4DNI A;  1VQG A;  4DV2 Q;  2R92 G;  4P71 A;  3HOX H;  4B3R L;  1UE5 A;  4GN5 A;  3A5U A;  3LGJ A;  1E24 A;  1LTL A;  5ELN A;  1WCM H;  5ELO A;  5FJ8 G;  3CW2 C;  4HIK A;  1K73 C;  2E5L Q;  1FJG Q;  4DR5 L;  1HNX L;  1E3P A;  4PG3 A;  3HOW H;  4OWX B;  1K3R A;  3KDF A;  1N34 L;  1TWC H;  1IBM Q;  1Y1V H;  4A3K G;  2H5X A;  1PH6 A;  3W5O A;  3CCQ A;  2UUA L;  3J81 j;  5JEA G;  2XTI A;  3KDF B;  1J5E Q;  4IFD G;  2R92 H;  1WJJ A;  1B70 B;  2HIX A; 
#chains in the Genus database with same CATH topology
 3AFQ A;  3FKI B;  4BBR G;  3MXG A;  4FXG C;  4O0A A;  5FJ8 H;  1A3U A;  3ZYY X;  2XRQ D;  3UDI A;  1HQR D;  5IYC G;  2NVT H;  3KF6 A;  2DJF C;  2G9D A;  4OGQ C;  4X3T A;  3FKI G;  1M90 C;  3PSI A;  3CC4 A;  2IW3 A;  2UXC L;  3I4N B;  1UUP A;  3X3M A;  1JOK A;  1PV4 A;  1YNN C;  4RAU C;  2D2C C;  1G6P A;  4WOR A;  1WVL A;  2ID0 A;  3RMH A;  2QDL A;  4ZLT F;  1KDA A;  4H02 A;  1KNA A;  2OTJ A;  3I4N G;  2VNU D;  4DPG A;  1LTA D;  1JQY D;  4DK0 A;  1Z47 A;  4FYD A;  1KNE A;  2RDH A;  4PZ6 A;  5DEH A;  2F0W A;  4DV0 L;  1UE1 A;  2B63 H;  1TY2 A;  1HZB A;  2I46 A;  1HCZ A;  2KCT A;  1N34 Q;  5KEE A;  4A3I H;  2B2Y C;  3SGI A;  2F0F A;  4DV4 L;  3KJO A;  5EQ0 A;  2UUA Q;  2SEB D;  3HOU H;  1KXL A;  4DNT B;  4IUN A;  3GTJ B;  4E6I A;  2NUC A;  4FVM A;  2A5H A;  2PYK A;  3D0F A;  3BZK A;  2UXB Q;  2VQF L;  1XTC D;  4FO2 A;  3MA2 B;  1EEF D;  5C4X H;  3B6Y A;  4OXP A;  1MGS A;  2F0K A;  3K5L A;  3S1R H;  1YNX A;  3H0G B;  4LFC Q;  1FGU A;  5M9O A;  4NXN L;  4DV1 L;  4QB4 A;  4JBJ A;  4LW1 A;  3C1E A;  1XNR L;  1GVP A;  3H0G G;  1DCZ A;  4JI3 L;  2LMC B;  3HP3 A;  3CCV A;  3GTO H;  2CKZ B;  2ZM6 L;  3MEH A;  1EZ6 A;  1LAB A;  3IL8 A;  1U4L A;  1XYI A;  1GHJ A;  4K5X A;  1S5D D;  3EBE A;  5C3X A;  4F7X A;  3S2H H;  3KBX A;  3KUP A;  2Q2I A;  1XMO L;  1SFO B;  2XVS A;  1NR2 A;  2D5D A;  4DK3 C;  1B8A A;  1D8L A;  4DR6 Q;  4KHP L;  1BF4 A;  1SRO A;  1VQP A;  3PO2 H;  3L9A X;  4X65 Q;  3IAY A;  1STA A;  2F0V A;  5CC4 A;  3A5Z B;  4AIM A;  4CHT B;  4RCN A;  1SNM A;  3TP6 A;  4AYB G;  2UU9 Q;  4A3J H;  1MJC A;  3PO3 G;  5TSS A;  1VQE A;  1CHQ D;  4GKK Q;  3GTG H;  4C3J B;  5LMU Q;  2Q8I B;  1VQ8 A;  4R1J A;  5IGD A;  1DON A;  1SRU A;  2ATW A;  4BY7 B;  1AEX A;  1NAP A;  4NB3 A;  3T56 B;  2VUM B;  4QIW B;  1XPR A;  5IP7 G;  3PQI A;  2NVQ B;  1Y8N B;  3T1H L;  2BA0 A;  2JA9 A;  3I90 A;  2K5H A;  4CDC C;  4DU9 A;  5JJL A;  1NJI C;  1VQC A;  5IWA L;  3E3X A;  2VUM G;  1YIJ A;  3I70 A;  1H9R A;  2VQE L;  4JOI A;  2F0Q A;  4OWW B;  3Q0A A;  1C0A A;  4JVZ A;  5K5P A;  1QB5 D;  4DAP A;  1EQR A;  1VQ6 A;  4YHH L;  3BVG A;  3DWP A;  1HR0 Q;  1T5E A;  4UHV A;  1TS3 A;  4BXX G;  4R4O A;  5DM6 3;  1Z9F A;  1HUM A;  3MVV A;  3M7N A;  5EKK A;  3TEH B;  1I4R A;  2CH4 A;  4RH6 A;  3S15 H;  3M4P A;  5H1S E;  3TZU A;  2A68 C;  3OIP A;  4QCL A;  1KQS A;  4X6A H;  3GV6 A;  3PV0 A;  4GLA C;  1BOS A;  1QZH A;  1YHB A;  2ZXO A;  2AHO B;  4IPD A;  1GUO A;  4FP5 D;  2A8V A;  1XMQ Q;  1H95 A;  4B3T Q;  2NVY B;  1XNQ L;  5EBD A;  4DR1 L;  3OHX C;  2XRS D;  2KCM A;  4MTN A;  3EQL C;  3TP7 A;  5LHY 1;  3NEL A;  1JJG A;  1L1O A;  1P8L A;  2QA4 A;  4OX9 Q;  3NTH A;  4UP7 A;  3STB C;  1PTO B;  1HNZ L;  3MTS A;  2K5D A;  3H3V I;  2I5M X;  3D8G A;  2TMP A;  1J6Q A;  1PHJ A;  3PMF A;  1M4V A;  1LTG D;  1GHK A;  1QVG A;  4DV3 L;  2FJ2 A;  2X6G A;  4K6D A;  2QIL A;  5IGC A;  2N49 A;  4HIM A;  2TSS A;  1L2F A;  3DWQ A;  4ZK9 B;  3DM3 A;  5C3E B;  5M3F H;  3CCE A;  1STY A;  4ZAI A;  4L5R C;  2F4V Q;  5T1I A;  4LF9 L;  2VB2 X;  2PW5 A;  4PZ7 A;  2B8F A;  2K52 A;  5C3E G;  1SDF A;  2A73 B;  4JOI C;  3HOX B;  4QIW E;  1PYW D;  3F8T A;  4DUZ Q;  1B50 A;  2Y0S G;  3PF4 A;  5IIF A;  3CQZ H;  1SAP A;  2QKI C;  3PGZ A;  4XQN A;  3S1Q B;  4UY8 C;  2R92 B;  1AP0 A;  4KY6 A;  1Q8K A;  2YTV A;  4LUV A;  3SK8 A;  1QJO A;  4DV5 L;  3KOJ A;  1IBK Q;  4YIJ A;  2K75 A;  3QB3 A;  2PZW A;  2IX0 A;  4JI7 L;  1RHP A;  1EYC A;  3K8A A;  3IFD A;  1IBL Q;  4POG A;  1S5C D;  1HPC A;  3H6M A;  3CU7 A;  3NBI A;  2F1M A;  4O42 A;  4KI0 A;  4N8X 1;  4GS3 A;  4OWT B;  4BY1 H;  3H3V C;  4N8F A;  1SE8 A;  3CC7 A;  2L1B A;  3QIA A;  1SBB B;  3HFZ B;  3X3N A;  3VR4 A;  5A2Q L;  3DWA A;  2EY6 A;  4QUC A;  4DKA C;  5IT9 c;  3GDE A;  3OTO L;  3CPW A;  2JEA I;  4ODG A;  3K80 C;  4EVO A;  1PH4 A;  1TWA H;  3P75 A;  2B2W C;  5E4X A;  4X62 Q;  1I94 Q;  2B63 B;  1HZ9 A;  2K04 A;  4DV7 Q;  1XX8 A;  2PO4 A;  2F4I A;  4JI1 L;  1HTL D;  3M4Y A;  4KJO A;  1AW7 A;  2EIF A;  3R2T A;  1CHP D;  3I4L A;  3K5M A;  4NXM Q;  2A69 C;  1KTK A;  1Q7Y C;  2E2I H;  1F77 A;  5I9O A;  4LMQ D;  3HOU B;  1U4M A;  4LF8 L;  2M00 A;  3U9S A;  1XTD A;  1S3O A;  4DR3 L;  1MJE A;  1Z6H A;  3I4M B;  3SEB A;  2EJM A;  3R3O A;  4R4Q A;  2IT1 A;  3OW2 A;  5CV7 A;  5C4X B;  2NN6 G;  3OIQ A;  2WKD A;  3S1R B;  1ML0 D;  3OSO A;  1V1Q A;  3MFY A;  3I4M G;  1VQL A;  3I91 A;  4FNF A;  1GXD C;  5EBC A;  3V05 A;  4DR6 L;  5FO9 B;  1R4P B;  4JG2 A;  4WJW A;  4JYA Q;  1P16 A;  1H9J A;  1UE7 A;  3KJP A;  3I72 A;  3OPO A;  2L9H A;  2IHF A;  4HMI A;  3GTO B;  3RZO H;  5KYI A;  4QL5 A;  2A6H C;  5C4H A;  4DV2 L;  1LTB D;  1KIX A;  3KFU A;  3A55 A;  4OHJ A;  2E5L L;  2CH4 W;  1A0I A;  3CD6 A;  4KK7 A;  3M3Y H;  2IWH A;  3U50 C;  3SHL A;  3VA5 A;  1BCP F;  2MUY A;  2B2U A;  5DLQ E;  1BO0 A;  3CMA A;  5LMN Q;  2Z4I A;  1N33 Q;  2EYP A;  1DJR D;  4UP9 A;  1W3S A;  1II3 A;  3PO2 B;  1VQB A;  3M7G A;  4DV6 Q;  4A3L G;  5CV5 A;  4DAM A;  1V1P B;  2EJF C;  2MO1 A;  2D0P A;  1H9M A;  1IXR A;  4A3J B;  4N9P A;  3GTQ H;  5CV4 A;  5L37 A;  1U9R A;  3AU7 A;  2I5L X;  2DNC A;  4F87 A;  1N8R C;  4OON A;  1H9S A;  1Q1E A;  5CGK A;  4IOC A;  1LTT D;  1EY6 A;  4U67 3;  2P5Z X;  3M4O B;  1X3E A;  3DLL A;  3J80 i;  1ONL A;  1Y1V G;  4DNI A;  1TU2 B;  2MJ8 A;  1PRT F;  2KVM A;  3VR5 A;  3LGJ A;  4HIK A;  3FRP B;  1FJG Q;  1A3T A;  1E3P A;  4PG3 A;  3BYY B;  4OWX B;  1K3R A;  3T4A C;  5BN4 A;  3OW7 A;  3J81 j;  3KDF B;  1WJJ A;  4S3S A;  4Y7N H;  4DR4 Q;  2MGS A;  1VF5 C;  5E3F A;  1CI3 M;  2JXM B;  3CP0 A;  1F2Y A;  2AWN A;  4IJL A;  4C3H H;  4ZQ3 A;  2RDG A;  1G6Z A;  4A3K H;  4AQY Q;  4KD3 A;  1GUN A;  3P7J A;  3KF6 B;  3E5S A;  3NBH A;  1JCK B;  3TS0 A;  4LAA A;  4B3M L;  3J7A V;  1B3A A;  1B53 A;  1L0Y B;  3NWT A;  4H0L C;  4FF4 A;  4NMZ A;  4XYQ A;  1HFN A;  2G9H D;  3S2D B;  4G7Z C;  3L2P A;  5IGG A;  2B2U C;  2B2T C;  2ZTE A;  1GKH A;  1Y69 U;  5FO7 B;  1TQO A;  4ZKB B;  2E2J B;  2ENB A;  4MIU A;  2RVL A;  4M8A A;  2Q2T A;  1SND A;  4B3R Q;  4ZYS A;  5HGT A;  1K28 A;  1X3G A;  3CRL C;  4KTA A;  3J80 c;  2KA7 A;  4DR5 Q;  1HNX Q;  5IYB G;  2HQE A;  3HOZ B;  2R7Z H;  4IPC A;  5CMD A;  4RGT A;  2F0H A;  3N52 A;  3FVQ A;  2WB1 B;  3U4Z A;  3CRK C;  1K8G A;  3H09 A;  1YEZ A;  3G7L A;  1NNX A;  1AN8 A;  2YTY A;  3HOZ G;  3RN5 A;  5IYD G;  1VQF A;  1OXT A;  3PIO 3;  4JI8 L;  2AQ2 B;  3L7Z C;  2JA6 H;  3J80 E;  4XT3 B;  1HA6 A;  2K5Q A;  1AZP A;  4WRD A;  2F0T A;  1TVX A;  3RUZ A;  2AMC B;  5G3L D;  5M3F B;  2ASB A;  4BBS H;  4EQO A;  3CCM A;  5EPJ A;  1VQ9 A;  1D6E C;  1EIF A;  3Q6S A;  3TRZ A;  5LL6 S;  4PZ8 A;  1BDO A;  3WOE A;  4QMG A;  2NBF A;  1ASZ A;  3MFG A;  1IBK L;  4CKE A;  1N32 Q;  4YWK A;  2MO0 A;  2N55 A;  1H9K A;  1Q12 A;  1NY4 A;  5M5W H;  2SNS A;  4APV A;  1PMR A;  1CKO A;  1R4Q B;  1EU4 A;  4FDB A;  4IUP A;  4A3B G;  4QUF A;  3BU2 A;  4LWC A;  3EN2 A;  2R3Z A;  3NEN A;  5FLX L;  1F2Z A;  2E2H B;  2NZO A;  1A62 A;  2QCP X;  4MZ9 A;  3TRE A;  1KHI A;  1PRT D;  4V0B A;  1BQQ T;  5IT9 L;  1B9N A;  1N9W A;  1BBX C;  1LT6 D;  2N8N A;  3NUC A;  1N36 Q;  2B29 A;  4QJF A;  1NMF A;  1SYC A;  3SXH A;  3EJI A;  1ENA A;  3N6R A;  1VQH A;  2IX3 A;  1NE3 A;  1DXM A;  1X32 A;  1EFW A;  4I7A A;  3S9W A;  3DEO A;  3GTL B;  2K5W A;  1O80 A;  2IL8 A;  1GD7 A;  4BY1 B;  1PXU A;  4DK6 C;  1NUC A;  1VQO A;  2PI2 A;  3UI2 A;  1I6H H;  4A3M H;  4RMF A;  2ZXR A;  1WTW A;  4X66 Q;  1JC7 A;  4DR2 L;  1WFQ A;  4CJ0 B;  3E9I A;  5AJ3 L;  5D3I B;  2UUC L;  2BDO A;  4JV5 Q;  2EPB A;  4YCW A;  1O78 A;  3KLW A;  1TWA B;  4PV1 C;  1PFM A;  1IW7 C;  4RHS A;  4YCV A;  2B3G A;  3HOY H;  1SNQ A;  1WI5 A;  1Y1W H;  4DA2 A;  4LFB Q;  3HZX A;  1NBW A;  2XSC A;  1SNO A;  2PW7 A;  5BN5 A;  3TN2 A;  4KLK A;  1RD9 D;  3K81 C;  2A68 D;  3I73 A;  3QWN A;  1JOQ A;  4IUU A;  5JJK A;  2WB1 E;  2KHJ A;  1EYA A;  5LMN W;  2NZH A;  3E9H A;  4DR7 Q;  4KY5 A;  2H4O A;  2F0I A;  3QOJ A;  1YJN A;  5HUR A;  1SYG A;  4PNY A;  1BBW A;  5JVG 3;  3KK7 A;  4DUY Q;  3TME A;  2AWO A;  1L0W A;  2HHH Q;  1ILP A;  3S17 H;  1B1Z A;  2D0O A;  5HGQ A;  1NTG A;  3K6O A;  5J39 A;  3STB D;  3GTM H;  4LFA Q;  2O2L D;  4WJ3 M;  1MSG A;  2IHE A;  5C0X J;  4MNO A;  4A3F H;  2WP8 J;  2RHQ B;  3EIV A;  1Q90 A;  4C3I H;  3RZO B;  3S16 H;  3MAQ A;  5EKL A;  1WTR A;  3JAM i;  4RCO A;  4HJ9 A;  1A6X A;  3QJY A;  1S72 A;  3OWF A;  5ELB A;  4LF6 Q;  1EYG A;  1Q86 C;  1KLG D;  5LL6 X;  3PUV A;  3I8Z A;  1E1O A;  2UXD L;  5GRO A;  2HDL A;  2KCN A;  4K0K L;  1UE6 A;  2R6G A;  4BA1 I;  1TWF B;  2AUJ D;  3GTK B;  3K7A B;  1L1O B;  4IUV A;  4A3C H;  1RJT A;  3BZC A;  1VQ4 A;  4B3S Q;  1K83 B;  3E0J A;  3FPP A;  2BH8 A;  5DNF A;  5IOD A;  1PA6 A;  1FJG L;  3VYS A;  4JPB W;  3Q22 A;  2RSN A;  2JA8 H;  2CWP A;  3RD4 A;  4HAE A;  5C6A A;  2F03 A;  5M5X H;  1O7Z A;  3KLR A;  5JEA J;  4IFD J;  1LYL A;  3H91 A;  4G7H C;  2JA7 H;  5IGF A;  1VQM A;  4JI4 L;  1QNK A;  1IL2 A;  1TT2 A;  4A3D H;  1W2B A;  2KQ3 A;  1EEI D;  1CA6 A;  4FF1 A;  4ILW A;  1X54 A;  2YYZ A;  1PYB A;  2RCN A;  4KHZ A;  1CKN A;  1I50 B;  3K7U C;  5ELE A;  3IFT A;  1EU3 A;  1STN A;  4C56 C;  3ND8 A;  3BDC A;  5IP9 H;  2Q2U A;  3TP8 A;  4LF5 Q;  3PIO A;  3MHB A;  1XPO A;  1HNW Q;  3PIP A;  4R4I A;  2N3S A;  2EYH A;  3D31 A;  4H7B A;  3CPF A;  2E8G A;  2I07 B;  4P72 A;  4LF7 L;  3T1Y L;  4IOA A;  3KBG A;  3S24 A;  1CQF A;  2XNA C;  2L5T A;  1MKH A;  2ZJR A;  4RKB A;  3C3L A;  4NDX A;  1YI2 A;  2I5H A;  3R8B A;  3SK5 A;  3AEV A;  3J80 L;  3G4S A;  4JI5 L;  3F2U A;  4C3J G;  4DXF A;  1I3Q B;  4BY7 G;  1PTO F;  2A69 D;  2KED A;  2YU9 H;  2WKC A;  1E22 A;  3J7A 5;  1PFB A;  1RKN A;  3VR6 A;  1QUQ A;  3J81 i;  1G51 A;  1X3Q A;  3UDF A;  3D4R A;  3ITP A;  2F0U A;  4LF4 L;  4J15 A;  4TSS A;  5KNC A;  2QW7 A;  1SLJ A;  2HIV A;  1NCV A;  1PH7 A;  2Z6K A;  2IPK D;  1JOO A;  1RDP D;  4IUR A;  2AKW B;  5D3D A;  1VQK A;  3S1N B;  1BBU A;  4IPH A;  1TWG B;  4B9W A;  4R4T A;  4A3G H;  2R7Z B;  4CGY B;  3SVM A;  5JOB A;  5C4J B;  2E2D C;  4JI6 Q;  4OO1 G;  2ZJP A;  1EQQ A;  1X56 A;  1HA5 A;  4YY3 Q;  3TS2 A;  4UP8 A;  4DAY A;  5I6W A;  1UEB A;  2LSS A;  1BKB A;  3HG9 A;  1L0X B;  5M3M B;  5M5Y B;  2WAQ B;  5I2X A;  3I2Z A;  3DUZ A;  4JI2 Q;  4A3E B;  4JW0 A;  3HOV H;  4P74 A;  3C46 A;  3D3R A;  1F9R A;  4CKB A;  4GOP A;  2SDF A;  4POF A;  3ERS X;  4HJ8 A;  5M3M G;  1QNU A;  1STG A;  1MI2 A;  4A3E G;  4DN4 M;  4LJZ C;  1SYD A;  1ICF B;  4XQJ A;  1SE3 A;  2NVX H;  3RZD H;  3I55 A;  2QEJ C;  2KBN A;  4U68 A;  5K36 G;  1LT3 D;  1K3B C;  2UUB L;  4A93 H;  2JA5 B;  1DOL A;  4TRD A;  5CV6 A;  5IY0 A;  2MHV A;  3BJU A;  2JJQ A;  4GKJ Q;  1G2T A;  1I4X A;  2BOS A;  1V1O A;  3T13 A;  5GAD C;  2JEB I;  1TS5 A;  2JA5 G;  1IBM L;  4JBK A;  4DAV A;  2HDM A;  4LUZ A;  1J5E L;  1QVF A;  4X66 L;  3QR8 A;  1Y8P B;  2EQS A;  5BR8 Q;  1GO3 E;  5C44 B;  4CKC A;  1A2U A;  2R93 H;  3KLS X;  5IOC A;  5FLM H;  1KL9 A;  4OIJ A;  2MNA A;  2R7D A;  1CZG A;  4X64 Q;  5C0X H;  5C44 G;  1JMC A;  1GUS A;  3GTP H;  2K14 A;  4ABN A;  2K5N A;  1I6H B;  3HOX G;  1SMY D;  2WV6 D;  1PFN A;  3CCR A;  4A3B H;  1JWS D;  1H9S B;  1PTO D;  5ELD A;  2K5V A;  3H15 A;  3TBI B;  2NVT B;  2EXD A;  2R92 G;  1ILQ A;  1UE5 A;  3TSS A;  3HS0 C;  2QF7 A;  1E24 A;  1LTL A;  1WCM H;  3D4D A;  2F3W A;  5FJ8 G;  5EGT A;  3HOY B;  3HOW H;  1Y1W B;  3NHH A;  3T51 B;  1WTX A;  1N34 L;  1TWC H;  2NTS A;  2H5X A;  5FO8 B;  1ZYR D;  3NXW A;  1PH6 A;  2UUA L;  3VA7 A;  1B70 B;  2KOL A;  1ZXT A;  3DMU A;  2CHB D;  2F0M A;  1G8Z D;  4PMB A;  2F52 A;  2QDB A;  2UXB L;  3I4O A;  1L1O C;  2BE5 C;  2D62 A;  4X3K A;  2EY1 A;  2PNH A;  4ZUI A;  4C2M H;  1SE2 A;  4IZ8 A;  4NW2 A;  2WAQ E;  2IY5 B;  5JEA H;  4IFD H;  1PH1 A;  1FNU A;  4BBR H;  4LFC L;  1CK1 A;  1LV9 A;  3BYT B;  3NBH B;  4L5Q A;  5E7N A;  3GTM B;  4A3I B;  1ZKO A;  5IYC H;  1CUK A;  3CCS A;  1OXS C;  1JB3 A;  2AQ1 B;  3URY A;  1G29 1;  1K8M A;  3FKI H;  1B9M A;  1STE A;  2B63 G;  5AFW A;  2CW0 C;  3A56 A;  3K0X A;  4A3I G;  2C35 B;  3HOU G;  4H44 C;  4QF4 A;  2Z4H A;  3T16 A;  1FYC A;  1WTP A;  1EQT A;  5EPL A;  1ET6 A;  1OO9 B;  3UDG A;  3RLO A;  5D65 A;  3I4N H;  1SNP A;  5C4X G;  4RA8 A;  1PZK D;  3FPU B;  2VW9 A;  5BN3 A;  4HJ7 A;  4X65 L;  2L12 A;  1S5E D;  4IPG A;  4JBW A;  2F0S A;  2LY7 A;  2UU9 L;  4M1U B;  2K1B A;  2JA8 B;  1D2B A;  2JYO A;  1PZJ D;  4RGO S;  3S2H B;  1PYS B;  2ALY B;  2UXC Q;  1GM5 A;  4KKS A;  4GKK L;  2JA7 B;  1DGS A;  1E2V A;  2JE6 I;  5LMU L;  1AZQ A;  4GNX A;  3A7L A;  3GTJ H;  1JOR A;  1CM9 A;  1VQ7 A;  4J6H A;  2BA1 A;  4K5W A;  1CFM A;  5G3L F;  4UDU C;  3UDX A;  4WJ4 A;  1JIC A;  3PO2 G;  3H0G H;  4DV0 Q;  3A8I E;  3AFP A;  3ICE A;  4HTH A;  1F9Q A;  1X6O A;  2HCI A;  4L5S A;  3ULP A;  2F0O A;  1M1K C;  5HY6 A;  3GTG B;  4A3J G;  4UPA A;  2FMC A;  4HMJ A;  1IW7 D;  2PQE A;  5ISR A;  1HR0 L;  4KHV A;  1LLR D;  1QWY A;  3MZ5 A;  1IYU A;  2H1E A;  1K8O A;  2VQF Q;  3OWE B;  4J8Q A;  5GAG C;  2YU9 B;  2R61 A;  2LXJ A;  1C7Y A;  1Y14 B;  3EA6 A;  4I65 A;  1YNN D;  1FNW A;  1SE4 A;  5EPK A;  4NXN Q;  1LT5 D;  3MXN A;  1SFO H;  4DV1 Q;  1PVO A;  2XIW A;  4B08 A;  1B2T A;  3DM1 A;  1V43 A;  4L5T A;  5GQO A;  4JI3 Q;  1CSQ A;  5JJI A;  4RFB A;  3PO3 H;  1J8I A;  2I0Q A;  2C9O A;  2ZM6 Q;  4IO9 A;  1XMQ L;  2PCF B;  2GVA A;  4B3T L;  2L0C A;  4FXD A;  1G91 A;  1EY8 A;  3MC0 B;  2OQK A;  1SMX A;  1WD1 A;  3BS1 A;  2KEC A;  2L4N A;  4EQN A;  4LNQ A;  2K7V A;  2CQO A;  1KDC A;  4G57 A;  2B2V A;  5IP7 H;  1OTC A;  2C5C A;  3KLS A;  1MD2 D;  4OX9 L;  3S15 B;  5J1Z A;  3CC2 A;  1X3F A;  3F2D A;  3F2B A;  4DGZ A;  1X55 A;  4KHP Q;  3G48 A;  4JI0 Q;  2ZTD A;  1AE2 A;  2VUM H;  1BCP B;  2RA4 A;  1JT8 A;  1KD1 C;  2Z8L A;  1QZG A;  2NVQ H;  4GNX C;  3HOV B;  2F0N A;  1TS4 A;  3A7A B;  3C1F A;  1UEA B;  4RWS C;  3HKS A;  1SXT A;  3L0O A;  1S40 A;  2F4V L;  3RZD B;  1EL0 A;  4YCU A;  4QQB X;  3BVZ A;  4BXX H;  1WD0 A;  1C48 A;  2E76 C;  2EYO A;  5C3W A;  2DNE A;  3L3O C;  2WB1 G;  4IJH A;  1EQV A;  3T1H Q;  4DUZ L;  2RF4 A;  1QG7 A;  2J0T D;  1TKW B;  1JE5 A;  4J1M A;  2OTL A;  4QY7 A;  5IWA Q;  1YHA A;  2ZXP A;  1A3V A;  2PQA A;  1BXT A;  4ZUJ A;  4QGU A;  2V1C C;  1RF2 D;  1PRT B;  1FR3 A;  1DYQ A;  2VQE Q;  3J7A F;  2X6L A;  1SNC A;  4P2C B;  5GAE C;  4YHH Q;  2R93 B;  3OMG A;  4X3S A;  5M3F G;  2Z0S A;  1E2W A;  5KNB A;  1EIG A;  3K59 A;  1IBL L;  2QGQ A;  2JN4 A;  4K2L A;  4BS9 A;  3BDL A;  1U4R A;  3GTP B;  2DJG C;  3CQZ B;  1KLU D;  4CBV A;  1YNJ C;  1CSP A;  2VL6 A;  3CAM A;  1YZ6 A;  1SEB D;  1PTO H;  2VY3 A;  2O5J C;  2PI2 E;  4HSV A;  4K8I A;  4XDX A;  1B3Q A;  4Q5V A;  4X62 L;  1I94 L;  2B2Y A;  4HIO A;  1WCM B;  1EIH A;  4I7Z C;  1AE3 A;  1SJH D;  3GP7 A;  1CKN B;  3RLN A;  4DV7 L;  4HR7 B;  4Y52 H;  2NYZ D;  1XNQ Q;  4DR1 Q;  1TWC B;  4NXM L;  1V8Q A;  2FXQ A;  1CTM A;  3EVQ A;  5C3E H;  4LUO A;  3J7Y W;  1ICW A;  2FFK B;  1WTV A;  5IGE A;  4LK1 C;  4GLV B;  1E1T A;  2MFI A;  1HNZ Q;  4BY1 G;  1U5K A;  3LWE A;  4KJN A;  3SDZ A;  2F0J A;  4C2M B;  4L6T B;  3U4V A;  2HD3 A;  1PH3 A;  4DV3 Q;  4EQP A;  4BBR B;  1LTS D;  1OXV A;  1KRT A;  1YVC A;  2EOT A;  2DGY A;  4G4K A;  3NTI A;  2E2I B;  1C8C A;  3S1Q H;  3DXJ C;  4JYA L;  3KF8 A;  1QUQ B;  4FF2 A;  1EY5 A;  2MQH A;  4LF9 Q;  1MSH A;  3CKI B;  3F1Z A;  3QOL A;  4ALP A;  1RIP A;  1GUW A;  1KAB A;  1K0R A;  5JPN C;  1I4Q A;  3W2D A;  4AH6 A;  1ESR A;  4EX5 A;  3FMC A;  1EZ8 A;  2IJ0 A;  2Q2H A;  1HHV A;  2OWO A;  1STB A;  1I4H A;  4TKO B;  3OOC A;  5LMN L;  4DK1 A;  5GAH C;  2JSO A;  4K8J A;  5I4D A;  1N33 L;  2WII B;  4OIK A;  1TXY A;  4H13 C;  3PUW A;  4DV6 L;  3PUZ A;  5FK9 C;  1QE6 A;  5EKI A;  4DV5 Q;  3W3A A;  4DAY B;  3LWU A;  1PZI D;  1SYB A;  1QCB D;  4HED A;  2XWB B;  2WIN B;  2K32 A;  1TWH H;  2MP1 A;  4JI7 Q;  3AYH B;  3J7Z C;  2A6E C;  1DM0 B;  3G6E A;  3G6J B;  1S5B D;  3HGB A;  4O2D A;  1A8V A;  3M3Y B;  1FGB D;  3A74 A;  2PMZ B;  2F3V A;  4GOP B;  1YBY A;  3CCU A;  1D5X C;  2V4D A;  3T53 B;  1QOH A;  2NN6 H;  4L8J A;  4G7O C;  1C4Q A;  5CV8 A;  2RSO A;  4DF7 A;  3ULL A;  1U0L A;  4XT1 B;  4XTC S;  3I4M H;  4IQZ A;  1CKM A;  5I2Y A;  3OTO Q;  1E2Z A;  5JVH 3;  1X65 A;  3D6C A;  1DOM A;  3M9B A;  2AQ3 B;  3GTQ B;  2PZT A;  4ZRZ A;  4JI1 Q;  4BA2 I;  5J22 A;  1BR9 A;  3AB9 A;  3K57 A;  2VS1 A;  3W1G A;  4DR4 L;  1BVS A;  2NB0 A;  2BCO A;  3M85 A;  4LF8 Q;  5C0X I;  4DR3 Q;  5A2Q E;  2JQO A;  4RGM A;  4IUT A;  1B7Y B;  1ZEQ X;  4AQY L;  1IZ6 A;  1BCP C;  3JC6 6;  2M9V A;  3ER0 A;  1VS0 A;  2RCF A;  2N88 A;  4NKL A;  3VYR A;  3ZJY C;  1HTP A;  2IX1 A;  4A3L H;  1HUN A;  2EYM A;  3K5N A;  3S1M H;  2WFW A;  5CBA E;  2M2L A;  3CF5 A;  3JAM c;  1TS2 A;  1A63 A;  5IGB A;  4Y7N B;  3WOF A;  4KMU C;  4AYB B;  4JI0 L;  2A19 A;  2BE5 D;  4C3H B;  1YJW A;  1Q8I A;  2K01 A;  3MXP A;  3QG1 A;  4R9W A;  3PO3 B;  4ME5 A;  1MIU A;  1XXG A;  2L15 A;  2X69 A;  5I6Y A;  1U4P A;  4A3K B;  4DV2 Q;  4B3R L;  4KKT A;  5ELO A;  1K73 C;  2E5L Q;  4DR5 L;  4C3H G;  1HNX L;  3EFX D;  5ELF A;  5I9P A;  1EOT A;  1Y1V H;  3P1H A;  4A3K G;  4KKU A;  3CCQ A;  3JAM E;  2XTI A;  4IFD I;  1X9N A;  2CW0 D;  1O7L A;  1PRT C;  1JE4 A;  3M4O H;  5COY A;  2BDN A;  3NE5 B;  2A1A A;  2DY7 A;  1GOZ A;  4EGV A;  1C9O A;  2O4X A;  4JC0 A;  5DM7 3;  2OQ0 A;  1YHQ A;  4IAL A;  4TQU S;  1G2S A;  4PMW A;  1UNS A;  2ICI A;  2CQA A;  5C5M A;  1JJ2 A;  3HEJ A;  1UAP A;  1I4P A;  2HQL A;  3ERQ A;  1S4Z A;  1PDQ A;  4DNR B;  2PMZ E;  5E4W C;  3PUY A;  1TII D;  1YJ9 A;  2LS0 1;  3IKJ A;  3PF5 A;  1EWI A;  1VCI A;  2R7Z G;  2A6H D;  1N32 L;  1MHW C;  3GV3 A;  4RGN A;  4N9T A;  3FHW A;  2F3I A;  3CME A;  3TDQ A;  1HQM C;  4F88 A;  4B9X A;  2HT1 A;  2JA6 B;  2J4X A;  3E0E A;  4HCE A;  3S14 H;  3LNN A;  1VQN A;  1HFG A;  1ET9 A;  4CDE C;  2XGT A;  1K9M C;  1EY0 A;  1STH A;  2WAQ G;  3QO2 A;  4BBS B;  2JA6 G;  1F2M A;  4XQQ A;  3S2D H;  4P75 A;  2EVB A;  3V96 A;  1KC8 C;  2E74 C;  3AMU A;  1WOC A;  1D5Z C;  1KAA A;  3NK9 A;  2OF1 A;  1DZ1 A;  1N36 L;  2E2J H;  1EIY B;  5IYB H;  2N78 A;  3J81 c;  4BBS G;  1V9P A;  1VMP A;  3KYH C;  2EJG C;  5M5W B;  1QVC A;  1AFP A;  1F9P A;  2O5I C;  4HID A;  2L11 A;  1MBY A;  3WWV A;  1EYD A;  4JCV E;  2K4K A;  2BH2 A;  3HOZ H;  4GZY C;  2OT2 A;  3FDT A;  5IYD H;  1LTR D;  3ND9 A;  4B3M Q;  1F9S A;  2ES2 A;  2EDG A;  2GVB A;  1R9T H;  5D14 A;  2FMM A;  3DHQ A;  5ELC A;  1HZC A;  1OXU A;  2B2W A;  1IHZ A;  1M8A A;  1IKM A;  2Q8T A;  3J81 E;  1GUT A;  4GLX A;  4AYB E;  4JV5 L;  4GNX B;  4FF3 A;  1VMC A;  2KHI A;  1EY4 A;  5FKA C;  1ROD A;  1PH2 A;  4LFB L;  2CFM A;  2FIN B;  2Z6K C;  1HH2 P;  5CR3 A;  2RKS A;  2JP1 A;  3GD7 A;  4A3M B;  4OL7 A;  3NPP A;  3UE1 A;  1I6V C;  2Y0S B;  4DR7 L;  2EY2 A;  1T5X D;  3O13 A;  3NEM A;  3I3C A;  3VR3 A;  4A3M G;  4JI8 Q;  1ENF A;  4UAI A;  4DUY L;  1EY7 A;  5C4Z A;  2HHH L;  1Q1B A;  2K03 A;  3BVM A;  3CCL A;  1XWE A;  4GN4 B;  1WTH A;  1EWH A;  2E2H H;  4LFA L;  1PH5 A;  2XWJ B;  3PUX A;  3I7F A;  4GOP C;  3RLF A;  1Q3L A;  4K6L A;  3K0Y A;  3LX0 A;  3HOY G;  1EUJ A;  5JJZ A;  3MXN B;  1Y1W G;  3GQB A;  4ULL A;  5FOB B;  1KAW A;  4CDF C;  2FHT A;  1KDB A;  1FNV A;  2RBM A;  2Q8R E;  2KUM A;  3ONA B;  2ZJQ A;  3V2T A;  2ICE C;  4RG1 A;  4MN3 A;  4P73 A;  4MTK A;  4NPS A;  2EYJ A;  3S17 B;  3GTL H;  1EWC A;  4LF6 L;  5CBE E;  2CCZ A;  1K8A C;  1S5F D;  5FLX c;  3AQQ A;  3W1B A;  2Z1C A;  2RQX A;  1PLF A;  2KEE A;  3CCJ A;  1SJE D;  2A74 C;  4A3F B;  1VQD A;  1HXY D;  3CXC A;  4OEL B;  4C3I B;  3OMC A;  1W6J A;  4PQX A;  2KJX A;  1PH8 A;  1IKL A;  1Y8O B;  4YWL A;  4B3S L;  2OEO A;  3S16 B;  3H94 A;  1XJV A;  1TWH B;  3A0J A;  4A3F G;  1PH9 A;  3Q24 A;  1HRJ A;  2VXW A;  4C3I G;  3VYU A;  2GN5 A;  3U58 A;  1SN8 A;  3R2I A;  5FLX E;  4OO1 I;  1IYV A;  3FEW X;  1D5M C;  1LUZ A;  1ENC A;  2LXK A;  3ULJ A;  5IT9 E;  2LFN A;  4Z9C B;  4DR2 Q;  5AJ3 Q;  3M4Q A;  5KRU A;  2UUC Q;  4JK1 C;  1J9O A;  2NTT A;  2Z9H A;  2NZ1 D;  3I56 A;  1EY9 A;  3OYY A;  4LF5 L;  2EE1 A;  4TVA B;  4OEM B;  1HNW L;  1ESF A;  1YNJ D;  4A3C G;  3ERO A;  3JAM L;  5M5X B;  1KRS A;  4JBM A;  1HZA A;  4A4I A;  4NP5 A;  1DD2 A;  4R8N A;  1F2L A;  4DFA A;  2CWA A;  2KEN A;  5CYU A;  2PQA B;  3NWS A;  3A54 A;  2JA8 G;  3SR1 A;  5IE8 A;  2AUK A;  4A3D B;  2LKV A;  3WDN A;  4A76 A;  1EOV A;  1O7I A;  1NMG A;  5DAU A;  2MPM A;  2RHS B;  2Y0S E;  4K2K A;  4XYO A;  3SK4 A;  2JA7 G;  4PMC A;  2K28 A;  2F0G A;  1E7Z A;  4A3D G;  1UWV A;  1JB7 A;  1QIL A;  1PFS A;  4ID6 A;  2B2T A;  3NQI A;  3DEP A;  3H3V H;  1OXX K;  1VQJ A;  2PNR C;  1NR4 A;  4HN7 A;  3S1M B;  1LAC A;  1SSO A;  2F0E A;  4DV4 Q;  5IP9 G;  2YV5 A;  1TWF H;  1W6K A;  1D7Q A;  3D6W A;  3GTK H;  3K7A H;  4R4C A;  4ZCK A;  4KD4 A;  5T1G A;  5C5L A;  1T9H A;  1K83 H;  1IYJ B;  1RTN A;  1YIT A;  1XPU A;  1WTQ A;  1HR0 W;  4L63 B;  2YTX A;  1Q82 C;  4CJ1 B;  1SYE A;  4JI6 L;  4HSP A;  1Y1V B;  3P20 A;  2EYF A;  2B39 A;  4YY3 L;  2EY5 A;  4Q0F A;  2JK8 A;  2UXD Q;  2HCC A;  1JWM D;  4K0K Q;  2EYL A;  3HKZ B;  1CT1 D;  2VZA A;  1WYD A;  5KND A;  2EXZ A;  3RN2 A;  1XNR Q;  3PCO B;  2D9U A;  3BDO A;  1VDZ A;  5JPM C;  4JI2 L;  1LM0 A;  4EQ5 A;  1I50 H;  4DXG A;  4XIG S;  3TP5 A;  2E75 C;  3A8K E;  3C2P A;  2XN9 C;  3HKZ G;  1SYF A;  3TZD A;  1FL0 A;  4BWG B;  3SK6 A;  4A3G B;  1B4O A;  4CDD C;  5COR A;  3E6Z X;  5NUC A;  3CHB D;  1TY0 A;  4V19 0;  2K50 A;  5E1F A;  5F2D A;  4YWM A;  1XMO Q;  4JI4 Q;  4C3J H;  3J81 L;  1SMY C;  4KV6 A;  2NWG A;  4A3G G;  4BY7 H;  3K5O A;  3KF8 B;  2R7F A;  1VQ5 A;  4HJA A;  1PTO C;  2PPB C;  1AH9 A;  2A6E D;  4GKJ L;  2OCE A;  1CZW A;  3VR2 A;  1K0S A;  1I3Q H;  3S14 B;  2K33 A;  1EFI D;  3RNU A;  1ASY A;  2DUD A;  4R8I A;  5CV9 A;  3HOV G;  1E0B A;  1ZYR C;  1Q81 C;  2Z6B A;  2NVX B;  4LF7 Q;  1I5F A;  5BR8 L;  3F2C A;  3T1Y Q;  3NP8 A;  3IRB A;  2KCC A;  4A93 B;  1CA5 A;  1A15 A;  5J3B A;  2QEX A;  5KGU A;  4OO1 H;  4ZKC B;  2DY8 A;  3VYT A;  2NN6 I;  4IN3 A;  1Z7T A;  2HUG A;  4JI5 Q;  4X64 L;  3NQT A;  3S1N H;  1VQI A;  1TWG H;  4A93 G;  4RHR A;  4KN7 C;  2F0D A;  5C4J H;  2K05 A;  4O1N A;  4WFN 3;  4X3U A;  1R9T B;  3MEF A;  2K6A A;  3NSW A;  4LF4 Q;  2EZV A;  1D1K A;  3BZD B;  3MWY W;  4FXK C;  1BCP D;  3R93 A;  3NTK A;  1LT4 D;  5M3M H;  5M5Y H;  1Q46 A;  4A3E H;  3PIP 3;  2SOB A;  4K14 A;  1TR5 A;  4C1N I;  1VQA A;  2NVY H;  1RL2 A;  5JAV A;  3K58 A;  5K36 H;  1DOK A;  1LO5 D;  3HRZ C;  2R93 G;  3G71 A;  1HJP A;  1I4G A;  1CQV A;  4RKL A;  1JWU D;  4K5V A;  3TQY A;  3Q8D A;  5FLM G;  3GO5 A;  4C1N K;  1GJX A;  3BG3 A;  5EJW A;  3VDY A;  5C0X G;  4A3B B;  1V1P A;  2RDF A;  1JJC B;  2JA5 H;  1IL8 A;  1FVI A;  2B2V C;  3HKZ E;  2L55 A;  1BUV T;  3D4W A;  3SE0 A;  4ME3 A;  3FP9 A;  5EAY A;  4HCS A;  2KHS A;  2DN8 A;  4F8M A;  3UE0 A;  3RR5 A;  1FD7 D;  1O7Y A;  2G5D A;  3HOW B;  5KIX A;  1D1I A;  4A75 A;  2OXP A;  4CJ2 C;  2GA4 B;  5KYL A;  4HJ5 A;  2ZT9 C;  1JR0 D;  2F0L A;  1B44 D;  1WCM G;  1WTO A;  2F0P A;  3HOW G;  1X3P A;  4GN3 B;  4KN4 C;  1RTO A;  5C44 H;  4XXE A;  2UUB Q;  1SR3 A;  2ZTC A;  1A2T A;  1VQG A;  2PZU A;  2B8G A;  3A8J E;  4P71 A;  3HOX H;  1BNZ A;  1VF7 A;  4IUQ A;  4GN5 A;  3A5U A;  5ELN A;  3MXU A;  2WAC A;  3CW2 C;  1GUG A;  2J7Z A;  2SNM A;  5A35 A;  2CVR A;  3KDF A;  1IBM Q;  1NSN S;  3W5O A;  1LTI D;  4KY7 A;  1RCV D;  5JEA G;  4IFD G;  3Q23 A;  1J5E Q;  4MHE A;  2VB3 X;  2R92 H;  2HIX A;  3U9O A; 
#chains in the Genus database with same CATH homology
 3AFQ A;  4BBR G;  4DR4 Q;  3M4O H;  4O0A A;  5FJ8 H;  3CP0 A;  2AWN A;  4IJL A;  4C3H H;  2A1A A;  2F52 A;  2UXB L;  3UDI A;  5IYC G;  3I4O A;  1C9O A;  2NVT H;  1L1O C;  2D62 A;  3KF6 A;  4A3K H;  2PNH A;  4JC0 A;  4C2M H;  4AQY Q;  2OQ0 A;  1YHQ A;  3FKI G;  2WAQ E;  2IY5 B;  4TQU S;  1M90 C;  3KF6 B;  4PMW A;  1PH1 A;  3PSI A;  4BBR H;  3CC4 A;  4LFC L;  1JJ2 A;  3TS0 A;  4B3M L;  2UXC L;  3NBH B;  2HQL A;  4L5Q A;  5E7N A;  2PMZ E;  5IYC H;  1CUK A;  3CCS A;  1PV4 A;  1OXS C;  1G6P A;  3PUY A;  1G29 1;  3FKI H;  2B63 G;  2ID0 A;  3L2P A;  1YJ9 A;  3PF5 A;  2ZTE A;  1EWI A;  1GKH A;  1VCI A;  2R7Z G;  1N32 L;  4H02 A;  3K0X A;  4A3I G;  2OTJ A;  3FHW A;  2F3I A;  3I4N G;  3CME A;  4DPG A;  2C35 B;  4IFD I;  2VNU D;  2Q2T A;  1Z47 A;  3HOU G;  4B3R Q;  2HT1 A;  4PZ6 A;  1X3G A;  3E0E A;  3J80 c;  4DV0 L;  1UE1 A;  2B63 H;  4DR5 Q;  1HNX Q;  3S14 H;  5IYB G;  1VQN A;  3UDG A;  3RLO A;  1HZB A;  1K9M C;  2XGT A;  2R7Z H;  2KCT A;  1N34 Q;  2WAQ G;  4IPC A;  4A3I H;  3SGI A;  3I4N H;  3U4Z A;  5C4X G;  4DV4 L;  3KJO A;  2UUA Q;  2JA6 G;  1K8G A;  3HOU H;  2VW9 A;  3S2D H;  4P75 A;  1KC8 C;  4HJ7 A;  1KXL A;  1YEZ A;  1WOC A;  2YTY A;  3HOZ G;  3RN5 A;  1N36 L;  5IYD G;  4X65 L;  1VQF A;  2E2J H;  1EIY B;  5IYB H;  2N78 A;  1OXT A;  3J81 c;  4BBS G;  4IPG A;  1V9P A;  3D0F A;  3BZK A;  4JBW A;  2UXB Q;  4JI8 L;  3KYH C;  2VQF L;  5C4X H;  3L7Z C;  1QVC A;  3B6Y A;  4OXP A;  2JA6 H;  2UU9 L;  4HID A;  3S1R H;  3WWV A;  1YNX A;  4JCV E;  2K4K A;  4LFC Q;  1FGU A;  2BH2 A;  3HOZ H;  5IYD H;  1PYS B;  4B3M Q;  2ALY B;  4NXN L;  2AMC B;  2ASB A;  2ES2 A;  2UXC Q;  4BBS H;  2GVB A;  1GM5 A;  1R9T H;  4DV1 L;  3CCM A;  4GKK L;  1VQ9 A;  1DGS A;  2JE6 I;  5LMU L;  1EIF A;  4JBJ A;  3TRZ A;  4LW1 A;  1HZC A;  1OXU A;  1GVP A;  4PZ8 A;  4GNX A;  3GTJ H;  3H0G G;  1ASZ A;  1XNR L;  1IBK L;  4JI3 L;  4GLX A;  1N32 Q;  4AYB E;  4YWK A;  1VQ7 A;  3CCV A;  4JV5 L;  2MO0 A;  4GNX B;  2BA1 A;  2CKZ B;  3GTO H;  2ZM6 L;  1X9N A;  1Q12 A;  1NY4 A;  5M5W H;  4APV A;  1CKO A;  3UDX A;  4WJ4 A;  4FDB A;  2KHI A;  3PO2 G;  4A3B G;  1PH2 A;  3EBE A;  4LFB L;  3BU2 A;  3H0G H;  4LWC A;  4DV0 Q;  3AFP A;  3EN2 A;  3ICE A;  2CFM A;  3NEN A;  2Z6K C;  3S2H H;  2NZO A;  1A62 A;  1HH2 P;  1X6O A;  4L5S A;  4MZ9 A;  3TRE A;  1KHI A;  2Q2I A;  3GD7 A;  3ULP A;  1XMO L;  1M1K C;  5HY6 A;  4DK3 C;  1B8A A;  1D8L A;  4A3J G;  4DR6 Q;  4KHP L;  1N9W A;  1SRO A;  3UE1 A;  1VQP A;  3PO2 H;  4UPA A;  4DR7 L;  4LF7 Q;  2N8N A;  1N36 Q;  2B29 A;  4X65 Q;  4QJF A;  1NMF A;  1HR0 L;  3NEM A;  1VQH A;  4A3M G;  3A5Z B;  4JI8 Q;  2VQF Q;  4AIM A;  4DUY L;  4AYB G;  1NE3 A;  5GAG C;  1Q1B A;  2HHH L;  2UU9 Q;  3CCL A;  4A3J H;  1MJC A;  4GN4 B;  2LXJ A;  1EFW A;  1C7Y A;  3PO3 G;  4K0K L;  1Y14 B;  2E2H H;  1GD7 A;  4DK6 C;  1VQO A;  4LFA L;  1VQE A;  4NXN Q;  2PI2 A;  1SFO H;  1PH5 A;  1I6H H;  3PUX A;  3I7F A;  4GOP C;  3RLF A;  4A3M H;  4RMF A;  4DV1 Q;  4GKK Q;  1PVO A;  3GTG H;  4X66 Q;  5LMU Q;  1VQ8 A;  1V43 A;  4R1J A;  3HOY G;  1EUJ A;  3MXN B;  1SRU A;  1WFQ A;  4L5T A;  5GQO A;  4DR2 L;  1Y1W G;  1KAW A;  2ATW A;  3E9I A;  4NB3 A;  5AJ3 L;  4JI3 Q;  1CSQ A;  5JJI A;  2UUC L;  3PO3 H;  1XPR A;  2I0Q A;  4JV5 Q;  5IP7 G;  2ZM6 Q;  4YCW A;  4IO9 A;  3KLW A;  3T1H L;  1XMQ L;  2BA0 A;  2JA9 A;  2K5H A;  2ZJQ A;  2GVA A;  4B3T L;  4RG1 A;  5JJL A;  4P73 A;  1NJI C;  4YCV A;  1VQC A;  2B3G A;  4NPS A;  1WI5 A;  5IWA L;  2OQK A;  1SMX A;  1YIJ A;  1Y1W H;  2CCZ A;  4LF6 L;  2VUM G;  1NBW A;  1K8A C;  3GTL H;  4LNQ A;  4LFB Q;  2CQO A;  4KLK A;  3K81 C;  5IP7 H;  5FLX c;  3AQQ A;  3W1B A;  1OTC A;  3CCJ A;  4OX9 L;  2VQE L;  5JJK A;  4JOI A;  1VQD A;  2WB1 E;  1X3F A;  2KHJ A;  3F2D A;  3F2B A;  3CC2 A;  4KHP Q;  1X55 A;  3CXC A;  4OWW B;  3G48 A;  1C0A A;  5LMN W;  2NZH A;  4JI0 Q;  2ZTD A;  1EQR A;  1AE2 A;  3E9H A;  1VQ6 A;  4YHH L;  2VUM H;  4DR7 Q;  1PH8 A;  1YJN A;  4YWL A;  1HR0 Q;  1KD1 C;  1QZG A;  1XJV A;  4B3S L;  4GNX C;  2NVQ H;  3A0J A;  1JT8 A;  1BBW A;  4A3F G;  1PH9 A;  4DUY Q;  2AWO A;  1L0W A;  4BXX G;  4R4O A;  2HHH Q;  3S17 H;  2GN5 A;  1Z9F A;  3U58 A;  1SN8 A;  2D0O A;  5HGQ A;  1NTG A;  3M7N A;  3HKS A;  4OO1 I;  3L0O A;  3STB D;  3TEH B;  3GTM H;  4LFA Q;  1LUZ A;  4WJ3 M;  1S40 A;  2F4V L;  2IHE A;  5C0X J;  4MNO A;  4A3F H;  3S15 H;  3M4P A;  5H1S E;  2LXK A;  4YCU A;  2WP8 J;  3ULJ A;  2RHQ B;  3EIV A;  4QQB X;  4BXX H;  4DR2 Q;  1KQS A;  4C3I H;  4X6A H;  3PV0 A;  5AJ3 Q;  3M4Q A;  4GLA C;  2UUC Q;  1QZH A;  3S16 H;  1YHB A;  2WB1 G;  4IJH A;  2AHO B;  4IPD A;  3T1H Q;  2A8V A;  4DUZ L;  1XMQ Q;  2RF4 A;  3I56 A;  3JAM i;  1H95 A;  3OYY A;  4B3T Q;  1JE5 A;  4LF5 L;  4HJ9 A;  4TVA B;  2OTL A;  1XNQ L;  1S72 A;  4DR1 L;  4QY7 A;  5IWA Q;  1HNW L;  1YHA A;  2KCM A;  4MTN A;  4LF6 Q;  1EYG A;  4A3C G;  1Q86 C;  1KRS A;  4JBM A;  2PQA A;  4QGU A;  3PUV A;  2V1C C;  1E1O A;  1HZA A;  4A4I A;  3NEL A;  1JJG A;  2UXD L;  5GRO A;  2CWA A;  2KEN A;  1P8L A;  1L1O A;  2QA4 A;  2PQA B;  1UE6 A;  2R6G A;  4BA1 I;  2VQE Q;  4OX9 Q;  2JA8 G;  4UP7 A;  3STB C;  5IE8 A;  4A76 A;  1EOV A;  1O7I A;  1L1O B;  1NMG A;  1HNZ L;  3H3V I;  2I5M X;  5GAE C;  4YHH Q;  2RHS B;  4A3C H;  2Y0S E;  3BZC A;  2Z0S A;  1J6Q A;  5M3F G;  1VQ4 A;  4B3S Q;  1PHJ A;  2BH8 A;  2JA7 G;  1PA6 A;  1IBL L;  1QVG A;  1FJG L;  4DV3 L;  2QGQ A;  1E7Z A;  4A3D G;  1UWV A;  2JA8 H;  1JB7 A;  2CWP A;  2N49 A;  4HIM A;  1PFS A;  1L2F A;  5M5X H;  3H3V H;  1OXX K;  1VQJ A;  3DM3 A;  5M3F H;  5JEA J;  4IFD J;  3CCE A;  1LYL A;  1CSP A;  2JA7 H;  4L5R C;  2VL6 A;  3CAM A;  1YZ6 A;  5IP9 G;  4DV4 Q;  2YV5 A;  1VQM A;  1TWF H;  4JI4 L;  2F4V Q;  4LF9 L;  1IL2 A;  1D7Q A;  4A3D H;  1W2B A;  3GTK H;  2VY3 A;  3K7A H;  4PZ7 A;  4R4C A;  2PI2 E;  1X54 A;  2K52 A;  2YYZ A;  5C3E G;  1T9H A;  1PYB A;  4JOI C;  2RCN A;  4KHZ A;  1CKN A;  1K83 H;  3K7U C;  1IYJ B;  4QIW E;  4X62 L;  1I94 L;  4HIO A;  1YIT A;  1XPU A;  3F8T A;  4DUZ Q;  1AE3 A;  3RLN A;  5IP9 H;  1CKN B;  4DV7 L;  1HR0 W;  2Q2U A;  2Y0S G;  2YTX A;  4LF5 Q;  3PF4 A;  3PIO A;  1Q82 C;  1XPO A;  1XNQ Q;  4Y52 H;  4DR1 Q;  1HNW Q;  4JI6 L;  4NXM L;  3CQZ H;  3PIP A;  2FXQ A;  2N3S A;  4R4I A;  3PGZ A;  5C3E H;  3D31 A;  4LUO A;  4UY8 C;  4YY3 L;  3CPF A;  2E8G A;  2JK8 A;  2UXD Q;  4P72 A;  4LF7 L;  3T1Y L;  4IOA A;  4K0K Q;  1Q8K A;  2YTV A;  4LUV A;  3S24 A;  2VZA A;  1WYD A;  2ZJR A;  4GLV B;  1MKH A;  3RN2 A;  4DV5 L;  1XNR Q;  3KOJ A;  1E1T A;  2MFI A;  2K75 A;  3PCO B;  1IBK Q;  4BY1 G;  1U5K A;  1HNZ Q;  1YI2 A;  4JI2 L;  1LM0 A;  2IX0 A;  2I5H A;  4EQ5 A;  1I50 H;  4JI7 L;  4XIG S;  3G4S A;  3AEV A;  3U4V A;  4JI5 L;  1PH3 A;  3K8A A;  1IBL Q;  3HKZ G;  4DV3 Q;  4POG A;  4BY7 G;  1FL0 A;  1OXV A;  1KRT A;  2YU9 H;  1YVC A;  1E22 A;  3J7A 5;  4KI0 A;  1QUQ A;  4GS3 A;  2DGY A;  4OWT B;  3J81 i;  4BY1 H;  1G51 A;  3S1Q H;  3UDF A;  1SE8 A;  2K50 A;  4YWM A;  3CC7 A;  1XMO Q;  4JYA L;  1QUQ B;  3HFZ B;  4LF4 L;  4J15 A;  4JI4 Q;  2MQH A;  4C3J H;  4A3G G;  4LF9 Q;  4BY7 H;  3KF8 B;  2R7F A;  4DKA C;  5IT9 c;  4HJA A;  1VQ5 A;  3F1Z A;  1AH9 A;  1SLJ A;  3GDE A;  3OTO L;  3CPW A;  2HIV A;  2OCE A;  4ALP A;  2JEA I;  4GKJ L;  1PH7 A;  2Z6K A;  1RIP A;  3K80 C;  1K0R A;  1TWA H;  2AKW B;  1PH4 A;  4X62 Q;  1I94 Q;  1VQK A;  1I3Q H;  1BBU A;  1HZ9 A;  4AH6 A;  4IPH A;  4DV7 Q;  4EX5 A;  4R4T A;  4JI1 L;  4A3G H;  3RNU A;  2Q2H A;  2EIF A;  2OWO A;  1ASY A;  2DUD A;  4JI6 Q;  4NXM Q;  5LMN L;  4OO1 G;  5GAH C;  2ZJP A;  1Q7Y C;  2E2I H;  3HOV G;  1EQQ A;  1N33 L;  1X56 A;  4YY3 Q;  4LF8 L;  1TXY A;  3TS2 A;  1Q81 C;  4UP8 A;  1XTD A;  3PUW A;  1S3O A;  4DR3 L;  1I5F A;  5BR8 L;  1UEB A;  3F2C A;  3T1Y Q;  2LSS A;  3PUZ A;  4DV6 L;  3IRB A;  1BKB A;  1MJE A;  4DV5 Q;  4DAY B;  5J3B A;  2QEX A;  3I2Z A;  4R4Q A;  2IT1 A;  4JI2 Q;  3OW2 A;  4Y7N H;  2NN6 G;  1TWH H;  4JI7 Q;  2NN6 I;  3AYH B;  4P74 A;  3J7Z C;  4JI5 Q;  3HOV H;  4X64 L;  4GOP A;  3G6E A;  3S1N H;  4O2D A;  1V1Q A;  1VQI A;  1A8V A;  1TWG H;  3ERS X;  3A74 A;  4POF A;  4HJ8 A;  5M3M G;  3I4M G;  4A93 G;  1VQL A;  5C4J H;  3HOY H;  4GOP B;  1YBY A;  4A3E G;  3CCU A;  4DR6 L;  3MEF A;  4JG2 A;  2NVX H;  4JYA Q;  3RZD H;  1P16 A;  3I55 A;  4LF4 Q;  1UE7 A;  3KJP A;  2KBN A;  3ULL A;  5K36 G;  1U0L A;  2UUB L;  4A93 H;  2IHF A;  4XTC S;  5M3M H;  5M5Y H;  3I4M H;  3RZO H;  1CKM A;  1Q46 A;  5IY0 A;  3BJU A;  4QL5 A;  3OTO Q;  2JJQ A;  4A3E H;  4DV2 L;  1KIX A;  3KFU A;  4GKJ Q;  1X65 A;  1VQA A;  3M9B A;  2E5L L;  5GAD C;  1A0I A;  2JEB I;  3CD6 A;  3M3Y H;  2NVY H;  1RL2 A;  2JA5 G;  3U50 C;  4JI1 Q;  1IBM L;  4JBK A;  4BA2 I;  2R93 G;  5DLQ E;  1HJP A;  3G71 A;  3TQY A;  5FLM G;  3CMA A;  3Q8D A;  5LMN Q;  4LUZ A;  3GO5 A;  1J5E L;  1QVF A;  4X66 L;  2VS1 A;  3W1G A;  1N33 Q;  4DR4 L;  1BVS A;  4UP9 A;  1W3S A;  3VDY A;  2EQS A;  5C0X G;  3M85 A;  4LF8 Q;  5C0X I;  1VQB A;  4DR3 Q;  5BR8 Q;  1JJC B;  1GO3 E;  4DV6 Q;  2JA5 H;  1FVI A;  4A3L G;  3HKZ E;  4DAM A;  2JQO A;  2MO1 A;  2D0P A;  1B7Y B;  4ME3 A;  2R93 H;  3FP9 A;  5EAY A;  1IZ6 A;  4AQY L;  5FLM H;  1KL9 A;  3JC6 6;  2MNA A;  1IXR A;  3ER0 A;  2R7D A;  3UE0 A;  1VS0 A;  4X64 Q;  3RR5 A;  3GTQ H;  5C44 G;  3ZJY C;  4A75 A;  1JMC A;  2I5L X;  2IX1 A;  3GTP H;  2K14 A;  4A3L H;  2K5N A;  1N8R C;  4OON A;  3HOX G;  4HJ5 A;  2WFW A;  3S1M H;  3CF5 A;  1WCM G;  1Q1E A;  3JAM c;  1A63 A;  4IOC A;  3HOW G;  3CCR A;  4A3B H;  4JI0 L;  1X3E A;  4GN3 B;  2A19 A;  2K5V A;  1YJW A;  3DLL A;  3J80 i;  5C44 H;  2UUB Q;  1MIU A;  1Y1V G;  3H15 A;  1SR3 A;  2L15 A;  2ZTC A;  2EXD A;  4DNI A;  1VQG A;  4DV2 Q;  2R92 G;  4P71 A;  3HOX H;  4B3R L;  1UE5 A;  4GN5 A;  3A5U A;  3LGJ A;  1E24 A;  1LTL A;  5ELN A;  1WCM H;  5ELO A;  5FJ8 G;  3CW2 C;  4HIK A;  1K73 C;  2E5L Q;  1FJG Q;  4DR5 L;  1HNX L;  1E3P A;  4PG3 A;  3HOW H;  4OWX B;  1K3R A;  3KDF A;  1N34 L;  1TWC H;  1IBM Q;  1Y1V H;  4A3K G;  2H5X A;  1PH6 A;  3W5O A;  3CCQ A;  2UUA L;  3J81 j;  5JEA G;  2XTI A;  3KDF B;  1J5E Q;  4IFD G;  2R92 H;  1WJJ A;  1B70 B;  2HIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...