1S4EA

Pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
347
structure length
337
Chain Sequence
TVKSPGRVNLIGEHTDYTYGYVMPMAIDLYTIITDKVQLYSEHFNEKLDLTKEGSWIDYVKGVLWVLIQEGYKIGGLKKITGDLPLGAGLSSSASFEVGILEVLNQLYNLNIDPLKKALLAKKAENEFVGVPCGILDQFAVVFGKKDNVIFLDTQTLQYEYIPFPKDVSVLVFYTGVKRELASSEYAERKRIAEESLRILGKESSKEVTEKDLGKLPPLHRKFFSYIVRENARVLEVRDALKEGDIEKVGKILTTAHWDLAENYRVSCEELDFFVKKAMELGAYGARLTGAGFGGSAIALVDKDKAKTIGDAILREYLAKFSWKAKYFVVKPSDGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactokinase
publication title Substrate specificity and mechanism from the structure of Pyrococcus furiosus galactokinase
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 115
structure length 337
sequence length 347
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 2.7.1.6: Galactokinase.
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
A PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1s4eA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1s4eA01
4DPXA 2BM1A 2UXDE 3GONA 4LF5I 4KQVA 1ELOA 3J80Q 1H73A 1K47A 5A2QC 2UUCE 1Z0GA 4JI7E 2VQFE 4X66I 1PVGA 2V34A 2DEIA 4JV5E 4B3RE 2GS8A 2LJPA 4P7AA 3J80C 1Z5CA 4GKJE 4FW9A 4DUZI 4LF7E 3V5RA 4USMA 4YY3E 1IBME 1B63A 3H4LA 4DR2I 4DU7A 1XNQI 1N0UA 3LPSA 4DV3E 1J5EE 1ZM4A 3J7AM 4PRXA 1ZM2A 4DPWA 1Z0VA 4LF6I 1QZRA 4LF5E 3B82A 2NPFA 4PRVA 4WUCA 4NXMI 4X65I 1S4EA 1ZXNA 5LL6R 4X66E 1XHKA 4HACB 5L3JA 1IBKI 3WU5A 4FWDA 2UXCI 4FN5A 4B3TI 1KIJA 4DUZE 4DR1I 5IWAI 4LF8I 5GMDA 3PYFA 3LNUA 4DR2E 1XNQE 3B78A 4AQYI 1B62A 4LF4I 1EI1A 3PYGA 1XMQI 4JI3I 2OI2A 4JI5I 2HK2A 1HR0I 4JI7I 2HFSA 2HK3A 1A6FA 2V2VA 4NXNI 1HNZI 1KKHA 4WUBA 4NXME 4I3HA 2A2CA 5GMEA 4X65E 4GKJI 4M1KA 3PYEA 4DV5I 2VQEI 3LTOA 2Q2EB 4FWHA 4B3SI 1IBKE 2UXCE 4B3TE 5LMNI 4DR1E 5IWAE 4LF8E 3ZZTA 1FWKA 4AQYE 2HKEA 1EA6A 4LF4E 4JI6I 2UXBI 1XMQE 4DU8A 4DPYA 4JI3E 4JI5E 1HR0E 1OJ4A 2UUAI 2VF3A 2A2DA 1XMOI 4NXNE 3QT8A 1HNZE 4DXLA 1KVKA 4Z7YA 1ZXMA 4DV5E 2VQEE 1Z5AA 4X62I 2E1RA 4RPFA 4B3SE 2AJ4A 4JI4I 2R3VA 3J81Q 5LMNE 1NHHA 2ZBKB 1H72C 1N33I 4DV2I 2R42A 1FKAE 3K17A 1N34I 4URLA 2UXBE 1Z5BA 4JI6E 1XNRI 4LFAI 4Z7CA 1BKNA 1HNWI 3V2UC 3J81C 2DEJA 2UUAE 3F0NA 4DR7I 1XMOE 2EFGA 1N36I 4EMDA 1NHIA 3ZKBA 1S16A 4DPTA 1I94I 3PYDA 4P52A 2WW4A 4JG4A 3OTOI 1HNXI 3WU3A 4DV0I 2ZITA 4OX9I 4DV7I 1ZM9A 4X62E 3JAMQ 4HACA 2X7IA 4X64I 4JI0I 4JI4E 4DR4I 4ZVIA 3ZZUA 2F4VI 4JI8I 2UUBI 3QT7A 4KHPI 4YHHI 1N33E 4DV2E 1N32I 1N34E 4R1FA 4B3MI 3JAMC 1XNRE 4JI1I 4HXZA 4LFAE 3ZZ0A 1HNWE 2E5LI 4DR7E 4DR5I 1Z0WA 1N36E 1PIEA 2V2ZA 1I94E 1RREA 3OTOE 1HNXE 3B8HA 1Z0TA 2XEXA 4DV0E 1MG7A 3QT5A 1VISA 4LFCI 4OX9E 4DV7E 4DR6I 4PU9A 4DV6I 4X64E 4JI0E 4DR4E 3ZM7A 4XTJA 2F4VE 4JI8E 1KTVA 2UUBE 5FLXQ 4FWGA 4KHPE 4USKA 1WUUA 4YHHE 4DV1I 1N32E 4HYMA 4B3ME 4DR3I 4JI1E 1UEKA 1FNMA 2E5LE 1D6TA 5FLXC 4DR5E 4LFBI 1H7UA 2ZM6I 1Z0CA 4DUYI 1FJGI 2HFUA 4JI2I 4JYAI 3WU4A 4ED4A 3T1HI 1FWLA 4WUDA 4LFCE 2UU9I 1NHJA 4DR6E 4DV6E 1MU5A 2CZ9A 1H7SA 1PKPA 4DPUA 2HHHI 4MYTA 1FI4A 2HKJA 5LMUI 3T1YI 4DV1E 3D4JA 3ZKDA 4DR3E 4K0KI 3QT6A 1DARA 5IT9Q 5BR8I 1N0VC 4DV4I 4LFBE 2ZM6E 1IBLI 3J7AG 4LF9I 4UTGA 4DUYE 3HULA 1FJGE 2V2QA 1H74A 4JI2E 4JYAE 5IT9C 4MYUA 3T1HE 3Q1QA 4GKKI 2UXDI 2UU9E 3M6AA 2V8PA 1Z0BA 4HY1A 4UT4A 2UUCI 2J7KA 2VQFI 2HHHE 3CWVA 1Z0EA 5LMUE 3T1YE 1MX0A 4LF6E 3WU6A 4JV5I 4K0KE 4B3RI 2BM0A 1ZM3A 4LF7I 1RR9A 5BR8E 4YY3I 1IBMI 4DV4E 1NZ0A 1IBLE 4LF9E 2BV3A 4DV3I 1J5EI 5A2QQ 1Z59A 3K1JA 1U2RA 4GKKE 2X36A
chains in the Genus database with same CATH superfamily
3P3EA 1BD6A 1A7GE 2P6SA 2VBYA 2R8GA 5CCLA 4GO7X 4KRWA 3FKBA 3MM8A 1MMNA 2RJZA 1PJ6A 4DLGA 1PCAA 4JV5E 2OP5A 1NKBA 3E8OA 4EZ6A 5D0GA 2BKNA 3BSOA 4EWTA 2HVIA 2RE1A 4JI8J 3NMAA 1IM4A 1CJKA 2NN6D 2M8HA 4C11B 4TKTA 1TKXB 3RYLA 5JXSA 4ICLB 2MY8A 3D9BA 2RKIA 4C8KA 4NXMI 3QPIA 2JEGA 4Y3CA 3BM7A 1V3RA 2BANB 4N3OA 4CLLA 3H5SA 4X66E 4C8ZA 3M8PB 2WSEC 3DGVA 3UCUP 2UXCF 3MAAA 4BHQA 3J7YI 2P6TA 1X8DA 2WZ1A 2DNLA 1VQ5S 3DYAA 4CZCA 2ZH3A 1VBKA 1HL6A 1PBAA 3N6NA 2F8HA 3MECB 2OAUA 4OJGA 1SQFA 2C2MB 2HFSA 4CP5A 4EGLA 1H6KX 4EBCA 2CJAA 4X65E 5F41A 2FLPA 1R6YA 3BF4A 4DUYJ 2J0QD 2R7TA 1AUDA 5E0OA 3KG4A 4WP9A 3MGJA 4YOEA 3DRPA 3GMGA 3C3LA 2ALZA 1HI1A 3IS9A 2NN6A 4DX7A 1S0OA 4NXNE 4P2MA 4G1QB 3BREA 1M5OC 2B6AA 3ISNC 2CPYA 1IBLJ 1R0CB 4HEA9 5HN0A 2J9DE 5HK4A 8ATCB 2FVQA 1T8EA 4ZDNA 1F2GA 4XAKA 4JI6E 3R6GB 1ZYQA 5KOWA 5CHCB 3WQPA 2NYHA 3NGRA 3D2WA 1EIYB 3VZHA 2LFVA 2NSBA 4BCAA 2YWEA 1SJRA 1BHNA 3OTOI 1HNXI 5I42A 2EWHA 3RG6A 4RWWA 4ELUA 5DQHA 4DV3J 2YKQA 2RS2A 5K14A 4NZ6A 5K5MA 3T41A 1SBRA 2NYIA 3H2UB 3AXKA 2YQ0A 2O1TA 5ETQA 4JI1I 1NZ8A 3VAMA 4B3OA 3DDKA 1RHUB 1Z0WA 4IFDF 1LWEA 2BBEA 2YNHB 2M5YA 3J80Y 2W4CA 2IVMA 4YP3A 4DLEA 3VR1A 2VFUA 3CJ4A 3QRRA 3DOLB 2XS5A 2M52A 3QT5A 3Q6MA 1NSKL 1N4LA 4F26A 2Z5BA 5C42B 3NWRA 4DV6I 1S5ZA 4Q8FA 5E3AA 1X4HA 1WI6A 2RRAA 1YJUA 2DR5A 3ZTRA 3CCJS 3P6YC 1Q4RA 2XULA 2UUWA 3FBFA 4MT1A 2RUSA 5DDPC 2EFOA 4X62F 1UAWA 2N3LA 3ILOA 4DUYF 3PV8A 4ZVEA 2FGOA 4LF4J 3MPYA 3PKYA 1HQEA 4B9MA 3R7SB 1U1OA 4QQBA 5CD4A 2JJ4D 4DN9A 3GG1A 4XIUA 3KHGA 1MSWD 4IOBA 3H7HB 2HHHI 3UWTA 2Z0GA 2EEYA 1TK5A 1U25A 2QL7B 2FGCA 4HDGA 2C3YA 2F1DA 4KGZB 4R0EA 1JKHB 2E66A 3NS5A 1TTHB 3GR0A 4ECYA 1T9UA 1U02A 3GYGA 4Y00A 1PYOB 4L3NA 4BWMA 1VRUB 4ZP9A 3KK3A 1IBLF 1VQKS 2E29A 4J90A 4JI0F 2XLKA 2UVRA 3W2WB 1U0HB 3CDBA 2HRTA 5KFBA 3QQCD 2V8PA 1T7PA 4WK3A 4NA3A 3QLHB 3T9NA 3PIOQ 2UUCI 1RTIA 4I67A 1UJ4A 4E0DA 3ILIA 4BA1A 2Z5CB 3W65A 4Y0FA 4UUWA 3CC2S 1S6PB 1XXEA 2XQCA 4LF7I 1S9FA 4FS2A 1QD1A 4M5MA 2JEJA 1SKWA 2GVZB 3VWSA 3KRNA 1Y9OA 1ZOTA 4DV3F 1MWQA 1VQSA 3AQPA 4RUBA 3CCLS 1XJWB 2J6SA 1QLNA 6FDRA 1RI7A 1TV6B 4KO0B 4KQVA 1EZZB 1URRA 2CFXA 5MLCV 3MCOA 3LPYA 1Z0GA 4ZPVR 3H1CA 4Q44A 1CULB 2X51A 4NRTA 4RW6B 3D0IE 2ZC3A 4DUZI 2ATLA 2UU9F 2PO2B 1N0UA 2LP4A 4TU7A 2ERRA 1RISA 1KTQA 3CWJA 1PGZA 2VPZB 4LF6I 2XO7A 4A46A 3NL0A 4FF4A 4TXSA 1SJFA 5GADU 2HYIB 2WB4A 3MM5B 3NOCA 3GIJA 1RT2A 4F4KA 3UDVA 2ZUAA 3HHLD 2KZMA 1JJ2R 4IFDA 4N41A 4NLVA 5CQGA 2IVFB 5J2MA 1JLQB 1XNQE 3MMAA 3CJKB 2COLA 4LF4F 3KJFB 2WAQD 3GCMA 4UOFA 4IDKB 2XMWA 2D69A 3O44A 3QRQA 1S1WB 5E2QA 2V2VA 3Q8YA 2C42A 3OSNA 2DYAA 4GKJI 2W9AA 2OPPA 4XDDA 1SH3A 4Y2AA 3O3LA 4WJBA 1IR2A 3M85G 1F9HA 2GJFA 1RTDA 5HATA 2XY5A 1VOMA 2FY8A 3SQGB 3HFKA 2KJWA 2F9JA 1VQPS 2HLUA 2MQ8A 2LEAA 4DSIA 3H20A 3OFEA 1WKKA 1LK7A 1TVRB 2J0SD 1VQ8S 1ZTWA 2A2DA 1FJ7A 1Q8KA 2C2NA 2PO0B 2V9WA 2VQEE 1HHTP 5F8NA 3EXYA 4IFDE 3MCNA 4YB7A 2HHUA 1H2TZ 1WNEA 2O1VA 3C19A 3D6MB 5LMNE 1N54B 1NHHA 3HHLA 5KG3A 2QTWA 3O2IA 3EVOA 4DF8A 3GP9A 1FRLA 2JEFA 2Z8QA 4WIQA 3A3PB 4PWDB 1XNRI 1REGX 2M88A 1BKNA 2W7PA 3J81C 1ULRA 2VQFJ 3F0NA 2G2ZA 2RILA 5K36F 1XMOE 2IHR1 3M2RB 3L7UA 3OW2R 1OPZA 4PXBA 2XSFA 1K8AT 1DAXA 1GQEA 2AEFA 1ZM9A 4X62E 3E2EA 2XSJB 1ZA2B 4HACA 3CVKA 2ZOMA 1CLFA 4UZCA 5C0XC 2E5IA 4QWBA 4QPTA 1KOOA 4FDFA 1N32I 3EDQB 1NDKA 3BGUA 3FC9A 4AXJA 2W4DA 2NQPA 3DU5A 2CNKB 1YBTA 4GMKA 4Q0BB 2UVWA 4ZP8A 3KYLA 4LRAA 2LQ5A 2FTRA 2XCAA 2IBKA 2KHDA 3TI0A 2MJNA 4AL6A 4LFCI 2IC3B 2J8AA 1U2CA 3Q22A 2DGXA 2NCKL 4JI0E 4N8OA 4CWBA 5AT1B 4IR1A 5KT4A 2FC9A 4QIVA 2KM8C 4YHHE 2LXIA 5I4MA 4B3ME 4ERDA 1AZSB 4PG8A 4HH1A 1UEKA 2HIYA 1WDTA 2E5LE 4U7UD 1SKUB 2ZFHA 2KXNB 3D5MA 1E6VA 4LR7A 3TYTA 2MQQA 4UY8T 5J2PB 2VPXB 1FJGI 4NCBA 3THTA 1H38A 4TY9A 1UZDA 2RNEA 1NZAA 2JNJA 3ADAC 4ED4A 5IWAJ 2R7RA 3WU4A 2QJ3A 2H4WB 2VPYB 2WVFA 1NHJA 3DMJB 4FW6A 5KFKA 4CLSA 2AHOB 4JI3J 2IAJA 3IN5A 1DFDA 4JI7J 1ZZFA 1TP7A 2MKYA 2BRLA 4ITSA 2MMYA 3G6XA 5K36D 5F8JA 3IRXB 3D4JA 3OJUA 2QL5B 2I2YA 2AGQA 2IOPA 4ZVQB 4MH8A 1N5TA 2VOOA 1FXLA 2H3EB 1TUGB 4RNNA 1HPZB 4DI6A 1WI8A 3EWGA 3RAMA 1SKSA 3JSBA 4X4TA 2IESA 2VKZG 2O1UA 3EUNA 3JQKA 1RGVA 2UU9E 3IWNC 4IFYB 5DDQC 5JJBA 5EWGA 4Q5VA 4UOGA 2X1FA 2I6WA 2VQFF 4OHZA 4KV8A 1USUA 1IJFB 2PEBA 1VQOS 1LFPA 2HNDA 4KKOA 1TR0A 1H7WA 4KHRA 4ECQA 3PEHA 4RWXA 3TR5A 4NLDA 3HHNB 3MD1A 5G0RA 4QNJA 4DR6F 2W9BA 4TY8B 3M6VA 2M70A 3M6XA 1T3OA 3OTCA 3K1JA 4F4YA 2H65B 4DPXA 2N4DA 4GO5X 3C14A 2DXEA 1SXLA 3GYNA 3AA9A 5L9NA 3SMZA 1K47A 3EICA 5A2QC 2AQ4A 2XO6A 4LVOP 1NSAA 5CYQB 4KHMA 2V34A 4USWA 2MZJA 3DI6B 4P7VA 4R8UA 1FCAA 2PMHA 4CYUB 2RSQA 1UDNA 2MYFA 1S76D 4FBTA 1IKXB 1M90T 3TVKA 1HQEB 4DCOB 5IM0A 4AIMA 1RK8A 2LDIA 2YX7A 3DRSA 1BQMA 3J7AM 1EX8A 3QFWA 4DOZA 4LCGA 1P1LA 1NK6A 2IBOA 1WACA 3HI9A 2V6AA 5C7PA 2UP1A 4BDPA 2PNZA 1ZXNA 2BW7A 2HZVA 4OJHA 1V9OA 3KK3B 4OYOA 4FWDA 5GAEU 1HNVA 3UD4P 3MURP 1Q81T 1FFWB 3FEZA 3OV7A 3DLEB 1UVMA 3KLVA 1NU4A 4TQRA 4WZQA 4MMOA 4JI3F 1C0UA 4JI7F 3V81B 4DR3J 3VGUA 4J9RA 4B3RF 1SPBP 3PYEA 3TAQA 2Q2EB 2IPOB 2V4QA 2KB2A 2VDHA 1KBRA 3RGIA 4DR1E 1JJ4A 1UCNA 4GVBB 1R0BG 4ZN3A 2GJ2A 4NA1A 1X5TA 3D7SB 3RAQA 3KWMA 3ENVA 2HRYA 1AFIA 3JXOA 3SSQA 3OL9A 1MW7A 4LF2A 3HHDA 2UUTA 4XK8C 3G8QA 5HLFA 4IUFA 2YWWA 4ED0A 2OPRA 2PDAA 3F41A 2XI3A 1LW2B 2FVSA 3J81Q 2C3OA 3ISZA 4M94A 4DFPA 2B9WA 5CYMA 4DCPB 1VS3A 2QA4G 4PEOA 2QLXA 1N34I 2ZKUA 2FJDB 1YJRA 1NUEA 2J9EA 4Z7CA 1C1CB 5LXRA 1VFJA 2L08A 3UHMA 3Q83A 1XBWA 1UFLA 2VC0A 3CCSS 3S6EA 1IBMJ 1QY7A 1RWKB 1S1UB 3DRYA 1EETB 1J5EJ 4DR4I 2J9CA 1G7CB 1FKOA 2YKMA 2MGZB 2YXLA 1C1BA 5J2NB 4DUTA 2FHJD 3TEGA 4FS1A 4DR5I 3CDWA 1FVSA 5DRQA 2O1WA 1N36E 2CJXB 1DQ9A 3HM9A 4FKXA 2WNRB 4F3QA 5D0EA 5AE3A 5H1SV 2XMAA 4DDFA 5KFWA 4C4WA 2XTJP 3TAPA 4PPDA 3MR6A 5A6WA 2W8LA 2HFZA 3PVXA 2L3MA 1AB8A 4NCGA 2PE8A 1RT6B 3SCIE 3M8QA 3BGRB 2RT3A 5E3PA 4P2XA 4KHPE 2GFFA 4ZVUB 2ZH2A 3D1OA 4RO0A 2BQRA 3U7JA 4WF9Q 3BBFA 3BQ0A 1RKIA 1UA0A 1KONA 1JQGA 1RCXB 4LFBI 2ZM6I 5T7LB 3N28A 2DB1A 4F36A 5CABA 3OJSA 4I68A 4WUDA 4USVA 5GAHU 4GVLA 4DR6E 4KR0B 2HQFA 1K44A 1L3KA 4DPOA 3BPDA 4I6WA 1EKSA 4DBQA 3DFEA 2ZD1A 2BYCA 2W8KA 2PC6A 4I2PA 3VALA 3T1YI 4X4RA 2HQCA 3L95X 3VAIA 2HHTA 5KFSA 2HURA 2YWGA 5FLXU 2FHJA 3RB6A 4DSEA 2HG4A 2ROEA 3UO0A 1N0VC 5D78A 4U7UK 2P9GA 3PX4A 4DX6A 4X64F 3HVTA 4JYAE 1UVLA 4DMZA 4ZVPB 2UUBF 2PN6A 2RH3A 2C38A 1HFEL 3DM2A 4NX9A 1YVFA 1D9AA 4NZ7A 2IMOA 3BYRA 4P72A 4B17A 3K5LA 2CQ4A 4P75A 4CNYA 2FJWA 2HHVA 3FMBA 4HI2A 3IR5B 3QJLA 4ZP7A 1Y3KA 4OX7A 1WG5A 1IBMF 2D3UA 3I87A 5KFFA 1Z4UA 5IT9U 5A2QQ 2OPSA 3OR1B 1V5VA 1T9YA 1X9WA 2ZHAA 1J5EF 4DQPA 3HZGA 3LP2A 1N33J 2UXDE 4OZ5A 3TX0A 3L7OA 3T5KA 1Q7YT 2EKNA 4JI7E 1E6VB 5ETVA 2KXFA 1I94J 4B3RE 4USUA 3KLEB 5F9NA 2B5JB 3UNYA 4F3MA 1M5PC 1MN9A 2K2PA 2RMLA 4DU7A 4X4PA 5HJXA 2F1FA 5AXNA 1QAIA 2K3KA 3B4MA 1UZHA 5ETLA 5KG4A 2Q6BA 3GWCA 3ISND 3RW6A 4YDXA 2E9RX 3IO1A 3TX8A 1QZRA 2BJDA 5FDLB 1D09B 4C6AA 1F5CA 5I3QA 4J9MA 1PKUA 2ZWOA 3TZYA 4MJKA 3BGOP 5L3JA 1FE4A 4UY85 5KFUA 3R6LB 2UXCI 4ILMA 2CPZA 4HHHA 3IR7B 5GMDA 2UZAA 4J9UE 3D28A 3GFZA 5KFPA 2OI2A 3E01B 8AT1B 1I3OB 2I5JA 5IV3A 2B56A 2MPUA 4OV6A 1JX4A 4IZJA 3DLGB 3CW2C 4NE9C 2CQPA 1ZAWA 3NGTA 3CB4A 2B8PA 4AFFA 4WPAA 2YKNA 4P6QA 4IRCA 4JI2J 1XC9A 3MEGB 1Q95G 2NREA 1FEEA 5B7WA 1VQYA 3D3CJ 4DFKA 2MHEA 1LW0B 2P2CB 3ZZPA 3P96A 1IR0A 4R5PB 1JLBB 3HT3A 2ILYA 5A8RB 3SQOP 5B0BA 5KT7A 2CVEA 1HW9A 3K5NA 3RBEA 1PBUA 4CO1A 4DV4J 2BA0G 3SCJE 2BE9B 3IAM9 5EN1A 3WZ0A 3CDIA 2FHKA 2HNYA 1HD1A 2XB2D 4O3RA 1RABB 2DGTA 5ETPA 4FF3A 4CLPA 3P3CA 4OZ1A 5JEAC 1RBAA 1MROA 4URLA 4ES3A 3PJ9A 2RVJA 5HMZA 1HNIA 4DG1A 4BWJA 3C2PA 2FZKB 1S1TA 2LA6A 3BV8A 1NPKA 4RUHA 2WOMA 3LGHA 2EPIA 3DLJA 4B3TF 4ZMMA 3LP0B 5B0FA 4QR1A 1T3NA 2XLIA 1XMQF 4JI8I 2F3JA 4WKRA 1UVKA 4OJ3A 4ZVSB 4OYMA 4QIEA 4WWSA 1HQ2A 2R7QA 4WZMA 4ENOA 4QWDA 2ABYA 4A8FA 4AD6A 4JV2A 5D77A 3ZTPA 3B8HA 2XEXA 4DR2J 4M5LA 4X64E 1R0AA 3VV2B 2UUBE 1Y11A 2FZCB 1ZAVA 3CIMA 2BJ7A 3JQJA 4FPIA 4B9SA 2YPYA 3QSIA 2OPRB 1P9QC 2MZTA 1VQMS 4YS2A 2AYGA 3KLHB 1X4DA 1IBKJ 3DCAA 3I5BA 4MK9A 4DUYI 4CLUA 5GMKa 1U8SA 5GADI 4U96A 4QOTA 2DITA 2PGCA 3CCZA 4JI2F 4X4UA 4E98A 1O0PA 2C2EA 2J76E 4N5SA 3HFZB 3HX9A 5KFDA 2OUGA 4JI5J 3KUGA 3RB3A 2HBQB 4M8LA 2V8VA 1UDQA 4P2SA 4OQJA 1HNZJ 3TVYA 4DV1E 2C3PA 2XY6A 1T95A 1Y4SA 4Y2MA 4QJVA 4PKDB 2V8GA 3MXHP 1S57A 3BBBA 2DHXA 1OYSA 2HQIA 3AQOA 2O01C 1IBLI 4IOAQ 4FW4A 2PEHA 2RQ4A 4PQAA 1H74A 4L75A 3CIZA 4BA2B 1FDAA 4DSJA 3DOMA 3I0RA 1UDOA 2DNZA 1X4BA 3OUYB 2RU3A 2J7KA 2H5EA 2P9EA 1IUJA 1UTAA 4NRUA 3DLHA 5F3TA 1FF2A 3OL7A 5KT2A 5JUMA 1K73T 4XO0A 4ZCKA 1S1XA 1FRHA 4JI4J 1CJUB 4ZN1A 4G3IA 1IBCB 4DV3I 2Z56B 4GKKE 3VGVA 3OVAA 4J91A 3NCRA 2HZAA 4OZ0A 5KFLA 2RF2A 4RUCA 4H4MA 2K8GA 1REVA 2LJPA 3T6JA 1YJ9S 4OYXA 2J6TA 3HDSA 1N5QA 4DV7J 1X31C 2HFOA 4UF4A 3C8YA 3EZ5A 4DR2F 3KJVA 1XR7A 3Q86A 2EFQA 2ZD1B 3L7ZA 3GZ7A 3NMRA 1NPRA 4CTAA 5H9FJ 5GVQA 3I56S 5D8HB 5KG1A 2GHVC 4K2JA 2W7AA 4NBQA 5KG5A 4PYAA 3LF0A 1Q7LB 1IBKF 1GK8A 3G87A 4XTTA 4W92B 1H2VZ 5E3CA 1J2VA 2ADCA 3GCXP 4FBUA 1RTZA 4LF4I 2KZZA 3LAKA 2JH3A 2HK2A 5HL7Q 2KL8A 4DN0A 1GXTA 4JI5F 5A8KB 4I69A 4WU3A 3TA1A 3GILA 1A6FA 1KKHA 3MF5A 4M1KA 2WTFA 3SV3A 1XK8A 1LXNA 3BKUA 3UDEA 3ILLA 4MKBA 1HBNA 5IFMA 1RU1A 1EQ0A 1W2IA 5DDOC 2UV8A 4B3TE 3UPFA 3VGSA 1HQUA 4DFMA 3RRGA 4O3PA 3RZAA 4ECTA 4O44B 1XMQE 1RWPB 1A6LA 2KU7A 4ZPDA 4OHYA 2VDIA 5A0YA 3QZ7A 3A1YG 4K0KJ 1HHQA 1KVKA 2M9KA 5BR8J 4OYWA 2KT5A 1Z5AA 4A8WA 5CXTA 4H4OB 1KS2A 2VUGA 4AIDA 4RU2A 3TJAA 4OO1E 1RTJA 2Z2ZA 4CH7A 1HYSA 4JI4F 2VJUA 2DJWA 4K50A 4U3BA 3NEKA 2JDJA 4PQUA 1X4GA 3AJ2A 3RBXA 2HNZB 2GHPA 4K5SA 4FNHA 4LSLB 2WW4A 5F9LA 3MM6A 1T94A 5K8MA 5LJ5Y 4Z37A 1BMQB 4DV7F 4CO5A 1VBYA 2C2KB 3M6WA 4OL8A 4KGXB 5E3RA 3CJSA 2K1RA 1PG5B 5CD4H 2C22A 1OYDA 4TU8A 1EKRA 4M5HA 2M8DB 5D15A 2GQCA 2N4CA 3LP1A 2RRNA 3PFEA 1IN0A 3PX0A 1EP4A 2R8IA 1CJVB 4LMZA 3NNHA 2RS8A 3BR9A 4EYIB 2PNMA 4CLTA 3P76A 3C6UA 3T9ZA 5L1JA 1YK9A 4ZHRA 4K4XA 3DD6A 2O3ZA 3W66A 2DH7A 3V6DA 1K1SA 2PO4A 3ETMA 1OMSA 3EGWB 4MKVA 3G86A 5KFNA 3QGHA 1SC4B 4ZKAA 2D9OA 2R7VA 5KFTA 3SYZA 3PO4A 1V3ZA 5KFMA 2CG9A 1E3HA 1CQMA 1JLGA 2H4YB 4AQYJ 1N6QA 2VONA 2JL9A 1H7SA 5GAEI 3CDEA 1HR0J 4G1PA 3RB4A 4DG1B 4DL0C 3K8VA 1IKWB 1FI4A 4G6VB 3KDNA 3WIVA 5IC6B 4Q8EA 3NGKA 5A2QU 3CJ5A 4K0KF 4DV5J 3R2CJ 2DH8A 2AGPA 2QA2A 3AODA 3TW0A 3CNQP 1WF1A 2DCUB 3KLGA 2ZH7A 4NI2B 4NLYA 1L3SA 2CVIA 4GC7A 3K0JA 3UQSA 1ZZNA 3R5DA 1CC8A 4IFDC 2KXHA 2MLZA 1IVZA 3M6UA 4LREA 3KLFB 3BO2A 2VQFI 2HGMA 2YH1A 1XR6A 3CWVA 1U1PA 4ELTA 2CAJA 1RCOB 3N0VA 1F5AA 1C4AA 1TL3B 3G6ES 4RU9A 2YNIA 1FEHA 3OTEA 3TUZC 4IG3B 4ZCLA 3LQVA 4ZPCA 2CQDA 3V4IA 1E6YB 2IRYA 4QWAA 4HDHA 3DDNA 1NDPA 2GVDB 1GX6A 2I8EA 4O4GA 1SIZA 2C28A 1XWLA 4ZVFA 3J81Y 1HNWJ 4X4OA 4PWWA 1JJHA 3CE8A 2KKHA 3JB9k 1RYSA 1TL4A 2DEIA 2I0XA 1Q78A 4U3DA 1S9EA 3IGVA 4P7AA 1Q8LA 1SL1A 3DRRA 3DGPB 1GTHA 4YY3E 1J5OB 3TVZA 2OIHA 2LXFA 3A3OB 1WHYA 4ZVHA 2XI2A 4L3KA 2EFVA 4KPCA 2ZNZA 4J7CA 2DH9A 2RHSB 4QIWD 2V68A 1S7IA 1D9FA 2LU2A 3MMBA 4ZPTR 3A13A 5DRPA 4Y6IA 4WFZA 3QIPA 3UDLA 3FFIA 1JXLA 3R7BB 3NKYA 4ECRA 3GV5B 3LPEA 4FN5A 3IMQJ 2GX8A 5IWAI 5B09A 4PG7A 1SV5A 2MKSA 3OR2B 2BDPA 2L9DA 2W9CB 1B62A 3LH2S 4AQYF 4JI3I 3GYXB 3DOKB 3SDEB 3NNAA 4TQSA 5C25A 4JI7I 3ET6B 4ED3A 1HR0F 1DHMA 3C16A 2NXCA 3HK2A 1JK9B 2Y8WA 1VBXA 4UW2A 4DL7A 3KJNB 1RT1B 2YKPA 4M5DA 2XM3A 5L46A 1H3DA 1ITPA 2LMIA 1NK9A 1U26A 1T11A 4O4RA 2CQHA 2VL1A 2AW0A 4LF8E 3QGGA 3POTA 1HK7A 4OX8A 4OZNA 4DPYA 2NZ4A 1XMBA 1HIYA 3TUJC 1ZA1B 3OD2A 5GAHI 2J6UA 1WF2A 2DGSA 1NH8A 4DJBA 3Q0AA 2YWFA 3FBCA 4Z7YA 4OYPA 3FCHA 2O5DA 1SL0A 3O8WA 3WIUA 1E3PA 5LJ3Y 2CKWA 1NJXA 1L3UA 5EWEA 1SKRA 4C0OC 2GGPB 3ZZZA 3OBIA 4YN3B 1T9XA 3CD5A 3K58A 5LM7E 3VF0B 2XMMA 4J37A 3K17A 3KTQA 3F56A 2MEWA 1Z5BA 4ZS6A 3H5YA 4KY3A 2BR2B 1T9WA 4ELVA 3IRWP 1HNWF 1MLAA 4C11A 1TKXA 4NLWA 5IQ6A 1NHIA 4JV5J 2B4PA 1PJ7A 2A6MA 4WP8A 2CJQA 1P27B 2BANA 5DJBA 4OO1B 1M1KT 3KXDA 3M8PA 4K59A 4NYOA 4LR8A 2E7XA 4FNIA 3R1LA 2Q3PA 3J7ZT 1PAEX 4DV2E 2CQ0A 3FCVA 1GMUA 5A2QY 3H5UA 4MQYA 4LFAE 5I3PA 4DR7E 4X66J 3MECA 1XR5A 2ZC4A 2HZCA 3HLUA 3M9MB 2R7UA 3PW5A 5HANA 3TAMA 4C98A 2DGVA 3DHWC 1SQEA 4DV0E 4M5NA 1EB0A 2GIQA 4Y2IA 1NK4A 3PO5A 3N9UC 4HT5A 1FD8A 3EJMA 3BYPA 5M2RA 1VYAA 1DTTB 3A8EA 4DR3I 4X65J 1BQNB 1TU0B 1XERA 1NK7A 1RZMA 5B0DA 4PUOB 2LA4A 2YX4A 2ZH5A 4PCQA 4WFNQ 1HMVB 1KVJA 4G1QA 3NBPB 3A8JA 1LV5A 4NOHA 3IM8A 3G9CA 2LXUA 2EW9A 2X1BA 1RLCL 1RAOA 3U1MA 3GJTB 4NXNJ 1C0TB 2B4UA 2V8HA 2HFNA 3CTRA 3PXGa 4OLPA 3RTVA 5FWKA 4OX9F 3J7AG 2ZH8A 4UQGA 4HL9A 3W9JA 1NLKL 2F4VF 5SUHA 3T1HE 2OTLS 4EFAC 1RWVB 1QM9A 1RSCA 1GMWD 4JI6J 4ZOSA 2HBZB 4K8RA 4KH1B 5F8IA 4KGKA 1K1QA 3O5TB 4FF2A 3QIDA 3P3GA 1UJ6A 1WTBA 2IA6A 5K9FA 2NXJA 2RQMA 2HIQA 5EX0A 3D0HE 2XCPA 1IBMI 3PDNA 1CJTB 4P10A 1G6BA 4MFBB 3W5YA 4QZVB 3QJPA 4FXDA 1QE1B 1BWEA 2BV3A 1J5EI 4PPZA 3W2VB 2MXYA 3AAWB 3BR8A 3P45B 3DOLA 4F7VA 5HQMA 4F4ZA 5C42A 1T0TV 4TYBA 2C3MA 5B0AA 3GIIA 3ZTQA 4C3MA 4WBFA 3Q89A 4ED8A 4X66F 2HHXA 3MUMP 5H9FK 3VAHA 2RQKA 3R5JB 1JLGB 5K8NA 1U8WA 3P5BP 4USIA 2Y1JA 3IBWA 3CJ8A 3QAEA 1L3VA 4TYAA 1VLOA 2GAGC 5HVFA 3CGIA 3MM7B 3OL6A 4LF5E 3C66A 1IR1A 1JLCB 1Q1KA 4WUCA 2CDQA 5L1IA 2BA0D 4X65F 5LL6R 2FJVA 3Q8QB 2F8MA 4JBCA 3FQKA 1JKHA 4EYHB 1S9GB 1B7FA 1BWVA 5C2GA 1VRUA 3F73A 1FRIA 2RHQB 4I64A 1JLEB 3W2WA 3PG9A 2CZ4A 2RDDA 4LQ3A 4ZIVA 1USVA 3QLHA 3TA2A 1X4EA 2WK4A 3VQSA 4BC7A 1LWXA 5FIIA 4ED7A 4CM0A 2Z5CA 2R2RA 1NSQA 1S6PA 2CNOB 4OI6A 1C4CA 2GVZA 2PA3A 5ADZA 3KNGA 4MKAA 1XQIA 3H42A 4TNOA 5F0UA 2NXNA 5T41A 1TV6A 4KO0A 2DNHA 1ZXMA 2XMKA 3TOQA 1S0NA 1OYEA 4RW4B 3DRRB 3VTIA 3M2VB 3VVTA 2DNGA 3A8IA 4B3SE 1CULA 4RW6A 5U47A 1FNOA 1SIWB 1S10A 5CZXA 3NAIA 1N33I 3QYYA 3RBDA 5AXLA 2PO2A 1CG2A 2UXBE 1W7WA 4NXMF 2UUAE 1ZPVA 3NGSA 3IC1A 1TELA 3TUIC 5HP1B 2GV1A 1U1KA 1YRUA 2ZE2B 1I94I 1G2EA 3KUEA 3RRKA 2JLEA 2CQGA 5D0HA 3R7NB 3N5BA 5L38A 1JB0C 3MM5A 3EXCX 5F0WA 4DX8H 2GW8A 2KH9A 4P74A 4OZ2A 3C16B 2MLYA 2G9OA 1WHWA 1WORA 3CJKA 1FESA 4P71A 2MKCA 1QAYA 2JFKA 2HBRB 4IFVB 1S1WA 1HKAA 2E9ZA 1TMMA 1C2PA 4PXCA 2V4RA 5RUBA 3PS3A 4EUVA 1MG7A 1FJEB 4OX9E 2W2PP 1XNQJ 4NLTA 5BJRA 3W3SA 5KG0A 1Q53A 3ZM7A 2F4VE 4J9PA 3RBZA 2LKZA 3JAMU 3TEHB 2OEMA 3DLLQ 4NLQA 4Q2MA 1Y5IB 4IKAA 1TVRA 3CCUS 5FLXC 1TK8A 1B0PA 3JTOA 3MPWA 3KHHA 3NNCA 1MWYA 3ILJA 2HFUA 1WC3A 4JI2I 2GCFA 1X7VA 1R89A 3LUYA 2PO0A 4MDTA 2I9SA 1VHFA 2R8JA 3CDAA 4WYWA 4RL1A 2FJAB 3MHYA 4PYDA 3HKZD 2DISA 1OS5A 2BMBA 2HGLA 2KI2A 5CH7B 5DS7A 3WX4A 5DG8A 2XHWA 1UFKA 3EPGA 3ZKDA 1WC5A 3AY0A 3GB0A 4PWDA 4AL7A 2EI5A 4J9KA 1R6VA 2VQEJ 2RIJA 3OTOF 4A4JA 4DV4I 3D68A 3M2RA 2EG1A 3HULA 1WHXA 4RR5A 5AE1A 3DNCA 3BN7A 5LMNJ 5IT9C 1ZPWX 3Q1QA 4DQIA 3W61A 2YNFB 2E5GA 3IWXA 1JMTA 2J9DA 2XSJA 3TANA 3RW7A 2WW8A 3UNGC 2FDNA 4H4KA 2ZBIA 1XMOJ 2HVZA 5LMUE 3CC4S 1PJ5A 1VQLS 1MX0A 2KFNA 3NLCA 3TAMB 2BE2B 3MM9B 3DLBA 1Q79A 3A8KA 2BKOA 4X62J 3FMWA 4Q0BA 2GC8A 2CDRB 4LF9E 2J7UA 4ZP6A 2CPXA 2QN6B 3R1HA 5JMNA 3D0GE 1S6OA 3GG0A 1MMDA 4WTOB 2IC3A 2DR6A 1NJWA 1ELOA 1VRTB 2F9DA 1NJZA 3PACA 4KFBB 3SXLA 1P42A 2ZH4A 4FW5A 2JLFA 4N77A 2W2NP 4I2QA 1AZSA 1P6TA 2GS8A 4OYBA 4KYZA 2FC8A 1B4SA 4ILLA 3MOZA 5DG7A 2MTLA 2QMWA 2RDIA 4C97A 4DR2I 4L76A 1RHMB 3M1VB 3HXMA 1SCJB 4JI0J 5J2PA 1XNQF 4AE5A 5KT6A 2GAHC 4QIGA 2E9TA 5HROB 3HD1A 2ROPA 5A6PA 1BY9A 2VG5B 4YHHJ 2AZ1A 2HHHF 2ZEJA 4B3MJ 2DHHA 3DMJA 1S4EA 2E5LJ 2U1AA 1GX5A 4IR9A 1XHKA 1S97A 1IKVB 4OZLA 3IRXA 1IBKI 3CT9A 1ICEB 2FUG9 1KIJA 2HBYB 3BB5A 3UD3P 1HWLA 1XTZA 3PYGA 3AB4B 2YWKA 1HPZA 4JI5I 4I7FA 5J1NA 1SJQA 2YWHA 2CQBA 1Q82T 3CO9A 1I6JA 1HNZI 3S01A 4NXME 4IFYA 4KIAA 2DNRA 2KT2A 3G82A 2ILZA 2G1DA 5LOQA 2R9LA 2VQEF 3TA0A 2EKYA 2HS4A 4ER8A 2CG8A 4Q43A 2WBRA 2ZBRA 3W62A 1U6FA 4CO0A 3KG0A 1W25A 2YPZA 2ADBA 3MPDA 5ELWA 4M5GA 2UU9J 3SFGA 5LMNF 1O6XA 4TY8A 3KUHA 3CCES 2AIRB 5GAGU 1XMOF 5I3UB 1TZ0A 5C0XE 2FD2A 1RT3B 1RAIB 5CYQA 2BW2A 2VICA 4JI4I 3DI6A 2RRBA 3KHRA 4S0MA 4CYUA 2BR0A 5BYSA 1HW8A 2DNYA 3E51A 1SI9A 2R42A 1IKXA 2JE6B 2HQDA 2CQ3A 1N88A 3X1LB 4ZPAA 2QMUB 2DEJA 2KRRA 1JLFB 1VQ6S 2ZUGA 2LQ8A 4EMDA 2D3OR 4ED1A 1FTCA 3NS6A 1WD6A 4IH6A 2HPUA 1WJ9A 3GV7B 3GFYA 4DV7I 2IJRA 2Q43A 5EKWA 3HHKA 2QX0A 1JXVA 2DHAA 3UR3C 4FZVA 1N56A 2DRBA 4A8OA 3DRXA 3CEDA 3DLEA 4ES1A 4YHHF 4O3NA 3ZZ0A 3PHEA 4B3MF 5IT0A 3BZQA 2E5LF 4FYDA 2L9NA 3HFVA 1V3SA 3MTKA 2Z2LA 2MQNA 3V81A 2F5GA 3U1KA 5AJ3J 1NEEA 4PZVA 4IFDD 4U6PA 3PW2A 2AX0A 3OTOE 1HNXE 2NXEA 3UN5A 3C6TB 4I1TA 2HQGA 3HHEA 3GFXA 4C9DA 2B7BB 1LWCB 3KLIB 1U1MA 2BQ3A 1NH7A 2DR8A 3JTNA 5FLXQ 4QW9A 3PW7A 2CPFA 3C15B 4GVBA 4HYMA 2LLZA 2JEAB 4FYWB 4WU2A 4J9QA 3O1LA 4JI1E 1RDRA 3BJYA 4HI1A 1FNMA 1KD1T 2LDYA 3D1QA 2JX2A 1Z0CA 1AYEA 4DR1J 4V19X 2IJFA 2OH2A 4ECSA 4DV6E 4ID5A 2IFXA 3RR8A 3KNAA 3MEDB 2Z4PA 4Z2XA 1LW2A 4J9VA 2DPIA 1HD0A 4OYZA 3BQ2A 3DLKB 1SQGA 3TRGA 1OQ6A 3MCSA 4RJVA 1VK3A 4K0KI 3ELHA 5IT9Q 5C5JA 3GR1A 1SH0A 1C1CA 5BR8I 4BLGA 4DHVA 3SZ2A 3PR4A 2AZ3A 4UTGA 2VA3A 5B0EA 4PRFA 3Q6NA 2DNMA 3W9IA 1YH8A 4L6V3 1FWPA 4FW3A 1DLOB 2MZRA 3AHPA 1S1UA 4ECXA 1EETA 3QZ8A 2HS0A 1N5VA 3D6HB 4OZ3A 3CD6S 1YLXA 2HHHE 2MGZA 2QSWA 5J2NA 4FVMA 2DGUA 5B08A 2BM0A 2ACYA 3MMCB 3BH6B 3G96A 2IM2A 2JVOA 1FFGB 4C3KA 4LFCF 3LANA 3MEEB 3D6FB 1JNZB 5CYJA 2CPIA 4QWEA 2UV8G 2WNRA 3UDCA 3Q23A 2ZOGA 1OY9A 2F63A 1H73A 1TAUA 2VH7A 4EK2A 2WP8B 1RT6A 1KLMB 2UUCE 3GE9A 3BGRA 1W2BR 3M9OB 1N36J 4HYKA 2PI5A 1D9DA 3H2LA 4Y2KA 4PAAA 5D3GB 3M2UB 1Z1ZA 3NCPA 2B9YA 4FW9A 4F04B 4LF7E 5AJ3F 4USMA 2K7KA 4OI1A 4K4UA 4WFXA 1S7HA 5H9EJ 1QVFR 3MUVP 5T7LA 1RHRB 4DQRA 3KDOA 4NLXA 2HLTA 4KHPJ 3TARA 4YR2A 2VODA 1Z0VA 2XLJA 1S0MA 5D0RA 3NOGA 1RT5B 1LXJA 3D67A 4HLBA 2DNNA 3CDUA 4HTIA 3QRPA 1VIOA 3P8BB 4OYIA 1URNA 5L8RC 3Q8PB 3ZZOA 4ED6A 1FKPB 2KFYA 2MSTA 4PXDA 3P5TL 2Q66A 2FHOB 4DUZE 3F44A 5L39A 4DR6J 4DR1F 1X0PA 4USTA 2RAQA 4AQYI 1R6MA 3GJRB 1IM6A 3JYTB 4OHWA 2MKIA 1ZS6A 5KOXA 3X3UA 1HR0I 3Q24A 5HBMB 4W98A 3LW5C 2CJYB 1LOUA 2FJXA 2A2CA 5GMEA 4WE1B 4X4QA 3W5XA 2Q79A 1PYSB 4DV5I 3PCOB 4PXEA 3V6KA 1N8RT 1SL2A 4JYAJ 4OI3A 1WSRA 3TNVA 3VCDA 4ZJQA 1FWKA 2R8HA 3RU0A 1QDUB 2DD8S 3JTPA 1WG1A 1WEZA 3MZIA 4O23A 4AM3A 3OR1A 3PR5B 2BA1D 3GIMA 4I2QB 4DSKA 1LQ9A 5DROA 3WC2A 1D3WA 3EMTA 3PRDA 2ASDA 7AT1B 1N5YB 1TUWA 3PRVA 2DXFA 2DT9A 3IBFB 5DG9A 3KLEA 4QIFA 2LYVA 2AF6A 1FK9A 2UXDJ 2B5JA 2Z30B 1WC6A 4DL2A 1SUQB 4LRDA 3SI8A 3DXSX 3M30B 1FJCA 5D4PA 1HNWI 3ONQA 1BC6A 4DZDA 2C39B 5C0XB 3AJ1A 1NHUA 5LT5A 2ACMA 3ZKBA 2EG2A 1KFSA 3ZNJ1 2V4JB 1N36F 2U2FA 4B3RJ 2Y3YA 2PMWA 2ZWPA 5FDLA 2J65A 2CUYA 4F0MA 1YITS 3HKMA 1U1QA 1VDHA 1Y6ZA 4I7FB 1RWUA 4RNFA 2CGEA 2D9PA 1HWKA 4XPCA 4KHPF 3I31A 4NLSA 2E44A 4LT6A 4F4XA 2A3JA 1EARA 1XNRE 3PW4A 3G82B 2VHGA 5KFZA 2G0IA 2J5AA 3E01A 2IA0A 3QMQA 1B70B 3B54A 5B0CA 3DC2A 1FD2A 2KM8B 5J1EB 5KT3A 1FO1A 3DLGA 2OHDA 2CQ1A 3G8SA 2BZ2A 1U2FA 1R43A 2CJBA 4K4TA 5KFEA 3K5PA 3MR2A 4UOCA 3K7RA 2X3GA 4XTJA 3MEGA 1X60A 1YG0A 1N32E 4MTPA 2XNQA 5KFIA 1G1XA 1JIHA 5DLFA 2FJEB 3MI7X 3I6PA 1YBAA 1LW0A 2FLNA 2KT3A 1SC6A 2KJVA 1U47A 4R5PA 2IJNA 1JLBA 3H4BA 5A8RA 2QV6A 1SJ1A 2DHGA 3AOAA 4JYAF 5DGBA 4LFCE 1D1UA 4EI2A 5DQGA 1ROFA 2OPQB 1KC8T 2DNPA 3A12A 2YVSA 3RB0A 1Q8IA 2GMHA 1F6TA 2QE5A 4CRJA 4LRBA 1CEZA 2FLOA 4LVNP 1QUPA 3MR5A 2PFFB 2V0NA 1FJGE 2QZ8A 1PYTA 4HH0A 5IC4B 4M5IA 3TJ9A 3J81j 4ANCA 3U1LA 1TL7B 1CVJA 3LP0A 2UXDF 4O0IA 2QYGA 1GAOA 2M0GB 3BO3A 2JEIA 3J7AN 4OFZA 2FVCA 4H54A 4JV5I 3CCQS 1YDLA 3ITHB 1WF0A 2OTJS 1FX4A 4URSA 5F8HA 1RR9A 1RUSA 2GQ2A 1MN7A 5FJ4A 1FNXH 1YZ6A 4C48A 5CA5A 2XZTB 3FBBA 1CQNA 1Z59A 1RHQB 2BRKA 4CNZA 3SBMA 4RUAA 2B51A 2HVEA 4ZLPA 3CJQA 4ALZA 5BYRA 1RACB 2M3DA 2UVUA 3AOCA 2CNNB 4CLKA 1NDCA 2QA1A 4YR0A 4IRKA 4X66I 1OSDA 4WKYA 2RD5C 5LSLA 1FTRA 4LSNB 2MKJA 1Y5YA 2MDAA 5KFQA 3BSNA 4QYZJ 5EUHA 4QCLA 9RUBA 4J9OA 4ID5B 4X64J 3KLHA 2I1RA 1UMJA 2UUBJ 2XYGB 1Y4UA 1FXDA 5D6GA 4PG6A 2B43A 2D3ZA 2NPFA 4PRVA 5C24B 2D41A 3H59A 4X65I 4MAKA 3ZZYA 1ZBTA 1M0SA 3J80U 3WU5A 2CQ2A 1IQTA 1NMEB 3AJDA 3PYFA 1AXQA 4AYBD 3B78A 2EXUA 3MDFA 1JNRB 4XPEA 2FQQB 4BA2A 4DV1J 3R97A 2HK3A 4NXNI 1RKJA 2DBBA 2RB7A 3OUYA 1JWWA 2LEPA 3AFGA 2B9EA 3RR7A 4TLQA 4DEZA 1MMLA 4KGVB 4N76A 2CYYA 3KK2A 2DCLA 1G4CA 5L1LA 3UR0A 4UZBA 4C8OA 4CI0B 1GXUA 3AD9C 2HKEA 3AA8A 4JI6I 1CS4A 5DNXA 1CJUA 3PM9A 1RAAB 4M63A 2DRDA 2H5JB 3OXGA 2DGQA 3KJQB 3ENQA 2DTJA 3SSSA 2CRLA 1R7IA 1KP6A 2XGPA 3QT8A 2XYHB 4JP8A 3LAMA 2GO8A 3LGMA 4K4SA 1DTQB 2QA4S 3FJ2A 3FRZA 3G8TA 1JLAB 1NHVA 2AJ1A 1RWNB 4EU0A 4GKKJ 1S6QB 3BEGB 1RHKB 4IG0B 3MWBA 3CMES 2RUGA 3GLLA 2A10A 2E1MC 2X1AA 2VG6B 3KOAA 4CIOA 4OZEA 3GLJA 4F0KA 1ZAXA 2WBMA 2MB0B 4I0WA 1U6BA 4NMXA 3Q8RB 1MU2B 1NO8A 1QTNB 4IYQA 3PNIA 3QT7A 4BBYA 1BQXA 4KPYA 4DSLA 4TN2A 3BGFA 1TMJA 1F5BA 5K8PA 1N34E 1YRTA 1NHKL 2HGNA 4IS9A 4MU4A 3SCKE 3DHXA 3V4MA 1IKYB 2Y9HA 5A8KA 1WC4A 2Y8YA 3G71S 1KFDA 2Z58B 1T02A 3BS9A 2P9CA 1G3OA 2C37B 4OHXA 2GO4A 4PU9A 5KFCA 2LECA 1WOPA 2VD3A 1L3TA 4DR4E 3CO0P 2HRUA 2X3DA 5DZ7A 4IZJD 3I4HX 3VAGA 4ILRA 2VBXA 2JWNA 3H40A 4DV1F 1R8BA 4O44A 1KLNA 2IY5B 1VGYA 2MSSA 3BBCA 4DR5E 4RW7B 3EYZA 3M7NG 5G4DA 4LIRA 4B3TJ 1GMVA 1FK9B 4CH0S 3CJ3A 1TL1B 1T03A 3OT9A 4C7QA 4H4OA 5KG6A 3OTDA 1XMQJ 4RNMA 3M9NB 1Y5NB 1TUVA 1F3FA 4DL5A 5JVHQ 2YQ3A 2NLWA 4WCEQ 2HKJA 2QIFA 1K9MT 4KC5A 1A0OB 1XIQA 1NM2A 1UFWA 4LBIA 3JSYA 3FK4A 4LFBE 2HNZA 1T05B 2ZM6E 3THPA 5KG7A 1JXEA 2PMZD 5A8WA 4LSLA 4JI8F 3PS2A 4GKKF 2CADA 3M6AA 2P5VA 4YMEA 2AGOA 1UEUA 2MHNA 3OQ2A 2NN6E 4ANEA 3W1YC 1KSPA 2ZBQA 1HLWA 4PWUA 3TO8A 2HHWA 3T1YE 4P9SA 3G2XA 4F50A 4FYVB 2IYIA 2HVDA 3B4DA 4ZCMA 3LWMA 5GAGI 5KTQA 1X4AA 4ETXA 2H1YA 3PEJA 3GV8B 2DKOB 4IO9Q 1O8BA 1SC1B 1CJVA 2X36A 3OL8A 1RWXB 5H9EK 4WFYA 2XWXA 2W25A 3QO9B 1I1GA 1ACMB 3BGLA 4A8YA 5CZVA 1PVGA 3UD5A 2FB0A 3ZO7A 3EGNA 2EBEA 4LF1A 1S12A 1IWGA 3HVWA 2ATCB 4F4AA 3R5CA 1F9FA 3V5RA 3GSDA 2XMTA 4Y2CA 3TZZA 2D74B 5F8LA 1XNQI 1BUXA 1RT4B 1PO6A 2MQLA 3VVUA 4B08A 4DF4A 1TKTA 1S1VB 1H0HB 2J7WA 3IWLA 1TKZB 4DPWA 4ECVA 3GSIA 3EM1A 4W90B 4OIXA 4FXVA 1FRKA 2C2RA 1LKZA 2W1BA 4EZ9A 2W01A 1IKWA 4P2FA 4RKUC 2QYCA 1S79A 4CT8A 2JEBB 2MY7A 3UFCX 2BJ3A 3M05A 5KFXA 2JRSA 1Y00A 3MAHA 4NWBA 1VJQA 3CJRA 4FVCA 4NEZA 2VG7B 4FW7A 4NI2A 3TJ8A 4C3LA 2MQMA 3V6JA 2A0FB 2ASYA 3PFOA 3Q2TC 1KOHA 5FLXY 3QJJA 3T3FA 2VQEI 4CO2A 1HA1A 3KLFA 3CF5Q 4IQMA 2ALYB 5D4LA 4FWHA 4UUXA 3QAUA 2ZHBA 2UXCE 1U6ZA 4OO1F 3RAXA 5LMNI 2OKQA 1HBOB 1TL3A 2JZ5A 2YNGB 4IG3A 4NPOA 1EA6A 2PO1B 3CUNA 2MKKA 3CULA 5ETOA 2WONB 1E6YA 4E8UA 1RTHB 1RT7B 1XMOI 3HJFA 2XY7A 2GVDA 4DXLA 2O67A 2DNOA 5A76A 3EPIA 3UCGA 5JEAB 1DQ8A 4RW9A 4C0BA 3KMQA 2FZGB 1Z2ZA 4OLOA 3ETOA 1Q8BA 3WDOA 4X62I 3M32B 3BKFA 5LSOA 2KRBA 5IT9Y 2XC9A 4MK7A 3FDSA 3DGPA 1YIJS 1LK5A 2DNKA 2DR9A 1J5OA 3CCWA 1HBMB 2G13A 2XMUA 2QFJA 3V2UC 5DRKA 1F1BB 4U9RA 3EZOA 1SVDA 4MIAA 2PFDA 1BLUA 1S16A 2HMIB 2V94A 4YY3J 2BOAA 4OZJA 4OX6A 4NLOA 3K57A 5HJYA 1Y10A 4JI0I 1OIAA 3ZZUA 1VQNS 4YHHI 4WK1A 2W7OA 3OR2A 4ECZA 3VAJA 4R1FA 4B3MI 3JAMC 2W9CA 2W24A 1LWFB 1X4FA 2E5LI 3DOKA 3CJ2A 3JSMB 3SDEA 3IG1A 3ET6A 4IZKB 2WB1D 4UOHA 1P9YA 2V2ZA 4H4KC 2MQOA 4QYRA 3KK2B 1Z0TA 4OO1D 1RT1A 5ETKA 3PY8A 2AE8A 1CS4B 3MM8B 1OYRA 1WOSA 1DRZA 4JI8E 3NS7B 3VAFA 4YB6A 3HMJG 2VFSA 3RJMB 4EEYA 1ZTTA 1IQZA 4E2FB 3W9HA 2KFZA 3PRYA 4CLZA 4V19J 1H7UA 1V5IB 3LGNA 4ZIWA 1CJKB 1IWAA 4LF8J 1FWLA 2UU9I 6FD1A 2RKIB 1NBEB 3MCMA 2CZ9A 1RYRA 3UN2A 2GGPA 2IVYA 1PKPA 1DURA 5IOLA 4MIBA 5HMXA 4HT7A 2IOQA 3QT6A 2ASLA 3MAAB 2BR2A 1DJ0A 2V8DA 3QBCA 4HTJA 2O3DA 1X0FA 3DYAB 4DUYE 3HO1A 1YZ7A 4NLPA 2HAIA 2VESA 3Q2SC 4X4VA 2AJFE 1D0EA 2F7VA 4MYUA 4CO4A 1QVGR 1KHVA 1U7LA 2YQ1A 3HD2A 4OO1A 3N01A 2LVWA 2KG1A 1DY3A 1SH2A 4JV0A 2POKA 2NR0A 3H98A 4FF1A 3LO3A 4DFJA 4ZLJA 3FZ2A 3HT0A 4M95A 3OXLA 3DRPB 3JQMA 4YY3F 2FPHX 1Y7PA 1IBLE 2Z57B 3U1NA 2PD1A 3IS9B 4K4ZA 1TFYA 1AUSL 3KKFA 4NCAA 4ZVGA 4QYZK 1UWBA 1HARA 1YJ7A 2BM1A 2NN6B 4DV2J 2NZCA 3WC0A 4D3GA 1WHVA 4LFAJ 2XGQA 4DR7J 2B6AB 1HBUA 2WVDA 4TVAB 3OXFA 2MZ1A 2WVBA 4URQU 1DTTA 1LNQA 5HQLA 1BQNA 4DV0J 1T03B 1B63A 4OI4A 4NASA 2GIFA 3S8SA 4PUOA 3OHAA 4CLFA 3K5OA 1T9VA 4DV3E 2W2QP 3I5CA 5HVGA 1RA7A 3H0PA 1HMVA 3EDRB 1YQHA 1TL5A 4W4MA 2MZSA 3NBPA 4NLGA 3CD7A 4NMLA 5I42B 2A6OA 3CMQA 2IM0A 2BXJA 3MAQA 3BN4A 3HVAA 5K14B 1C0TA 2BX6A 5A8WB 2JOQA 1M5SA 3OFFA 4K5RA 4RLEA 4ZITA 3SSRA 3EE3A 4DR1I 2DIUA 2CA9A 3HCXA 4LF8F 3K5MA 2V67A 2FJBB 4B3OB 3IXQA 1NB7A 1CC7A 3AB2B 1LWEB 1UW4A 1OY6A 4RX6A 5JVGQ 3CMAS 7FDRA 1YJVA 1FHTA 2GO3A 2OSQA 3I0SA 4G65A 2Z5BB 2RDJA 3JS9A 1UEVA 3T1HJ 4DQSA 2GMJA 2WRMA 2CWKA 3GMEA 3NG8A 2SXLA 1R8HA 1CJTA 4MFBA 8RUCA 2DIVA 1U4BA 2H51B 3G6VA 1QE1A 4LOMA 4LF4E 2PIIA 2IDLA 3H2VE 3R5GA 3M8YA 2G1HA 3QATA 2WVEA 3W2VA 1GFWB 3GJSB 5DM7Q 5K36A 4OMFG 2K7JA 1HWUA 3HSZA 4CT9A 2WHOA 2BOPA 1QSSA 4ATNA 2R7OA 4N8NA 1I51B 1UKUA 2AJ4A 5DO2A 4Y28C 1TKTB 2F8EX 3KK1A 3FEYB 1FRMA 2MQPA 4IOCQ 2OD4A 4DV2F 1DZ5A 4CO3A 1R3NA 4LFAF 4G1IA 2CIMA 1RJJA 1VQ7S 4DR7F 1N36I 3BKTA 2R7SA 3MM7A 1JLCA 4JG4A 4RNOA 1RWOB 3A4TA 5IWAF 4DV0F 2Z2YB 3JAMQ 3UN3A 1SB6A 2X7IA 3R9LA 1QSYA 3NGUA 3OLBA 1RTIB 4KHPI 4BA1B 1S9GA 4LF5J 1R8CA 2NXUA 3PJWA 2X1GA 1BXNA 5K36E 1NK0A 2Y1IA 1JLEA 2G0CA 5DRRA 2AYEA 1A9NB 4C0HA 1Q0NA 3GFHA 1P1TA 1VISA 4B9NA 4DR6I 2OFGX 2YKOA 3I9ZA 2C2DA 4P7TA 4WXWA 1FDNA 3K2YA 4RBVA 1R8PA 3BO4A 4RW9B 1RBLA 2ZZTA 3DXBA 4AL5A 4QU6A 2GA7A 1U45A 4OJ1A 4JYAI 1WKLA 2XG8A 2VASA 4OI0A 4RW4A 3ZXWA 3T1HF 3M2VA 4ECUA 4ZJOA 2NSCA 4B02A 3R5AA 4ZCIA 2WSFC 1QTMA 5LSRA 3CCRS 3CJTA 2AWZA 1RT2B 3BDEA 4IFDB 5KFJA 1RADB 1WDDA 2OD6A 5J2MB 1VC0A 3W60A 2IRXA 3MMAB 4B3SJ 2W2OP 5DZ6A 1KR4A 5HP1A 2AMCB 2ZKTA 3R2DJ 2ZE2A 1MNEA 2LQJA 1RAGB 2UXDI 4F8RA 2E1CA 1OO0B 1UP1A 1B0TA 1OQ3A 2UXBJ 3MPVA 2OPPB 4L74A 2UUAJ 2MLXA 3RUBL 3IG1B 3CJ0A 4QU7A 4WFBQ 1RTDB 1WEXA 3WU6A 5DM6Q 4B3RI 1VQ9S 1ZM3A 1TKDA 1KDNA 2KO1A 1NZ0A 3PW0A 2YBVA 2XHCA 4IFVA 4RW8A 2E7VA 2VFTA 3U1YA 2GNKA 3IA0A 4U95A 3CCTA 2EFPA 4LF5F 1M5HA 4DR3F 3NAHA 3M7VA 1D8YA 1UPMB 5HVHA 2J8SA 2VQFE 3MR3A 1S99A 1FT8A 1FVQA 4OI2A 1NKEA 1UW9A 4TU9A 2N3OA 1KWMA 2QG9B 3KHLA 1RHJB 3HHLB 1NXIA 4JV1A 4OX9J 2OSRA 3H4LA 4CCHA 2LU1A 3UVJA 4CLYA 2F4VJ 3CPWR 4PRXA 3SFUA 4GC6A 4Q7AA 5DDRC 4X4SA 4ZLLA 2IMWP 4WIIA 3UE2A 4LCFA 3M8RA 2KG0A 1VMBA 4KB7A 2BVZA 3LALA 2IM3A 4HACB 3FEXB 3IAS9 2HFVA 3GJQB 2K06A 3K8WA 3MPUB 3AOBA 1TQLA 1F2HA 1EI1A 1VLYA 9ATCB 3OHBA 5IV4A 2YKAA 4OYAA 4Q2LA 2YNFA 2BA9A 2ZOFA 1R31A 2QLWA 2B4VA 1X9SA 1QUVA 4F0HA 1KN6A 4LCHA 4MKYA 2PNLA 2XMVA 5DGAA 4KAIA 2BA1G 4USHA 4B3SF 1YHCA 4Y34A 1UWBB 5IWAE 2BE2A 2O1PA 3MM9A 3B6BA 1SJ3P 4QR0A 2GQQA 3ZZTA 3OVSA 1FDBA 2QT7A 4JI3E 5ETSA 2UXBF 1R27B 4OKGA 1HBUB 5LMUJ 3DN9A 2UUAF 1XEZA 3W63A 4YEAA 4K4WA 4JB8B 1VRTA 2VPWB 3UW1A 1YTYA 1R6LA 5HI7A 4DL4A 4HKQA 3BPSP 2E1RA 4LF9J 4KFBA 4EO6A 2KN4A 5KG2A 3GIRA 2IAJB 2V63A 2A1BA 3FBEA 1WOOA 2B8QA 2JT2A 1YSJA 2ZVIA 4FP9A 4KT0C 5E41A 1WWHA 3OVBA 4ID8A 2KHCA 4I6YA 2GO9A 4F3OA 3M1VA 2ZJRQ 3FZBA 1AROP 2R7XA 2CQCA 4JUZA 2CZVC 5HROA 2XZDB 1WKJA 3M7ND 1B99A 3T5JA 2VG5A 1NNDA 3PZPA 4LR9A 1YGYA 3VQTA 3U02A 4P52A 1RQ0A 5THWA 1FX2A 2ZITA 4KGMA 5EWFA 4KH0B 1IKVA 4X64I 4CDIA 5KFVA 3ENAA 1B7YB 1HWIA 2B0GA 2UUBI 5ETTA 2HVHA 4R0JA 4ES2A 3UI3A 4ZPBA 5EGYA 2CJKA 5DNLA 4KV8B 3FUYA 2HNDB 4KKOB 2DK2A 3NRBA 5LXYA 3GPAA 4FYXB 3ZFVA 3PIPQ 5IS2A 1Y60A 3I0SB 5G0RB 4LIWA 1B64A 2W9BB 4LBPA 1PIEA 2EK1A 2RQCA 4X4NA 4B9LA 1RU2A 2R2TA 2C2ZB 1MWZA 2OGUA 3PX6A 2AKWB 3CSKA 4HHUA 1NSPA 3T6BA 2V69A 3C14B 4F4WA 2JHEA 4QBUA 2R7WA 4DSFA 1RB0A 4CLWA 2FVRA 2EK6A 3IBCB 5KFHA 4LBHA 2BKPA 1N52B 4P73A 1WUUA 4Q45A 5T14A 4DV1I 5K36B 2DHSA 4R8UB 4NXMJ 2LQ9A 1IXKA 4LPFA 2DXDA 2AEMA 1S77D 5IM0B 4N7TA 5I3UA 2OJ3A 3K85A 3AXMA 3DRSB 1BQMB 2EC2A 2ZDOA 3GCWP 3KK1B 3CDJA 2AEJA 1U0SA 4PR6A 1RT3A 1U1RA 1N33F 3ULHA 3I82A 2Y1LB 2PNZB 1FERA 4ECWA 2VB6A 3M8ZA 1KQFB 5EHHA 1VBZA 5LMUF 4DR3E 1DARA 1HNVB 2JE6A 1PC5A 1I94F 1S48A 4IQXA 1JLFA 2HHPA 3BQ1A 4YDDB 1HWJA 2F65A 2CJ9A 3W64A 2HHSA 4LF9F 1Q16B 2V2QA 1C0UB 4CQ1A 4GKKI 1KNZA 1EJ7L 4GQUA 3H5XA 2QLBB 1EAYC 5ETMA 2H48B 1UVNA 3CCVS 3P3DA 4U8VA 2H5IB 3CD0A 2IDEA 2DR7A 3ZTOA 2VFVA 4LUBA 4B9UA 4DX5A 2VZ9A 5L1KA 1NRKA 3R27A 3C6TA 3FSIA 2BEFA 1PSDA 2XS7A 1RAEB 4J9LA 1JJCB 5HLFB 3NGDA 2DGOA 1LWCA 3KLIA 3MFHA 2V9KA 5E7OB 4WTYA 3C15A 3Q8VA 1ZH5A 2BABA 2JEAA 3OTOJ 1HNXJ 3J80C 5CYMB 2Q1LA 4ZVTB 4DQQA 1IBME 3H4DA 1B0VA 3HSDA 4L73A 3L9ZA 1RXOB 3LPSA 1J5EE 3U27A 1HI8A 2VKRA 1ZM4A 3BSCA 3EX7B 2FIUA 4JI1J 4RBTA 3MFIA 3MEDA 4EBDA 4KTQA 4WXOA 4DV4F 3DLKA 2CQIA 1FKOB 2YKMB 4B3TI 1C1BB 2ZZMA 1CPZA 2JVRA 5J2QA 1NB2A 4DV6J 2PSZA 1NJYA 4N47A 1XMQI 1YI2S 2VIHA 2QFIA 5C2CA 5D4NA 4B9VA 4K4YA 1S59A 2VJVA 2DRAA 4RZRA 1DLOA 2HHQA 2F40A 3UCZP 4WUBA 4ZJLA 3FVYA 4I3HA 5M2UA 5C0XF 3N6LA 3VAKA 4QR2A 4OV1A 2VU5A 4NA2A 2IERA 4NLUA 4RW8B 1U1LA 4NLRA 2DO4A 4NCGB 1H7XA 3ENWA 3M8QB 2KDOA 3L09A 2D7SA 3D3BJ 3EVWA 3MMCA 3QWUA 2H9ZA 4AT1B 3C46A 2OEKA 3MEEA 4FPRA 4QWCA 4LQ9A 1OJ4A 3M85D 2HHHJ 1RLDA 1M1GA 1RAJA 5KFRA 3TZWA 3AH6A 4KJIA 3GQCA 2NN6C 4A8XA 2WP8A 1KLMA 1DQAA 1APSA 1U48A 1FRJA 2CWXA 4RPFA 3EGZA 3UVJB 1B3TA 2R3VA 3SV4A 1Y4ZB 5D3GA 3M2UA 1X5PA 2ZBKB 4I2PB 4EO8A 2JFDA 3VZIA 3PRBA 1VQ4S 1YRXA 4O0NA 2XS2A 4MK8A 5KFOA 1YJTA 2UUCJ 3P4UB 2KTQA 4U67Q 2LCWA 5AXMA 2EFGA 3QFHA 4O3SA 2OLWA 1KHWA 3MTJA 2JC0A 3HVTB 1RT5A 1KVIA 4LF7J 1LFWA 4C2MA 5IZHA 1HNXF 2NUUG 2F4FA 2C38B 3R8YA 2MKHA 4I6AA 2N7CA 3I96A 2OO4A 2HAFA 3DM2B 1X5SA 1FKPA 1UPPA 2R8KA 2BQUA 4A8MP 2J0XA 5D4OA 1N33E 3EZUA 2JSXA 4DS4A 2BJ9A 3IP0A 1VC6A 3J81U 1HNZF 4HXZA 3JYTA 1T9TA 5HMYA 4JI1F 1EQMA 5C0XD 2XZWA 3P49B 3J7YU 3NWGA 5HBMA 3AD7C 2OPSB 3TWZA 2DGWA 1I94E 2HW3A 4DUZJ 2D1CA 1IJEB 1QSLA 3LP2B 4WE1A 3P06A 3ZC4A 4M5KA 1FE0A 2XNRA 1S0VA 1S72S 4DV6F 2Y0BB 3TZXA 6AT1B 4LF6J 1N5SA 2Y0SD 3HVRA 3J7Z5 5KAKA 1D6TA 4IO1A 2QLFB 2AJ0A 2B3TB 2ROGA 2NUHA 1Y3JA 2UVVA 3SCLE 2QC3A 2AT1B 5HMWA 4PABA 1Q5YA 4NEYA 5M2PA 3TQEA 1N5YA 4AXIA 2ZBPA 5E5NA 1MU5A 1OYPA 3NXZA 3VHQA 2GQ0A 1UVIA 4FKYA 4DPUA 1F0XA 1M1HA 4LSZB 2R4FA 1YKWA 1SUQA 1F60B 4GKJJ 4AUKA 3M30A 3VGTA 3FSXA 1Y0HA 1O5JA 3M8SA 2CXEA 3US5A 4NYZA 2C39A 5C0XA 3I32A 3RRHA 3V6HA 2KYZA 1WELA 2V4JA 2ZDPA 2I5JB 4JI2E 3NP5A 1WSVA 2A18A 1UVJA 3QGIA 4IZJB 2V50A 1UDSA 1U24A 2ZZNA 2C3UA 4K7QA 1Z0BA 2VFRA 3A3NB 3BDPA 2UUCF 5ETRA 2IRUA 5IXUA 2YKNB 2QRRA 3NZKA 3IM9A 2GHWA 2E1PA 4LRCA 2APOA 1HI0P 2QEXS 2FY1A 2WSCC 4YY3I 5LL6d 2XYPB 4LF7F 4DV4E 3QSYB 3MUTP 1V6HA 3ZNUA 5J1EA 1Y5LB 1YJWS 4OHVA 2BUNA 1AW0A 4ZK7M 3IFEA 1U2RA 2FYXA 3WHIA 5IT4A 2HWHA 1AFJA 4YUDA 5ETNA 3CXCR 1XNRJ 3PKMA 3TP2A 3FGVA 1RHYA 3J80Q 1GEHA 3LOUA 4N56A 3MMJA 5K8OA 2AX1A 2VA2A 2QLJB 2HNYB 4DZ6A 1BE4A 2O66A 2IM1A 4DUZF 4DS5A 2ZH1A 4YB5A 1MROB 1WTFA 2YY3A 3ZTSA 1HNIB 1NCLA 5F8GA 1S1TB 1N32J 3R3TA 3OPKA 3JAMY 2WOMB 3M8WA 3B82A 4LF6F 5KFYA 4A47A 1WC1A 2E1AA 4X84A 4O3OA 2ZH6A 1UA1A 4QPXA 2GZOA 2OPQA 5BR8F 2CPJA 4YFUA 2CPEA 3K89A 2ASJA 3T5LA 4LFCJ 2V2KA 4LF8I 4TLRA 2ZHOA 2R2UA 4DR2E 1U49A 2AJQA 1U1NA 3FNNA 2BJEA 5HQ8A 3D1HA 4M5JA 1TL7A 4J3DA 5HSPA 4I4BA 3AT1B 4GKJF 4C8LA 3LTOA 1FJGJ 1QAJA 4I56A 1NKCA 4XDCA 1R0AB 1IBKE 4GRSA 4HVZA 4ZA1A 3ITHA 4V1Ak 3Q8SB 1VRQC 1XN9A 1VC5A 4A8KA 4C8MA 2IYGA 1AT1B 2HS3A 1H2UX 3R5BA 4DU8A 1FA0A 2Z5EA 4D3HA 1UJ5A 1S49A 4R25A 3N6MA 4JI5E 2XBPA 1YWXA 2KYXA 2DNQA 5CCMA 1HNZE 3IR6B 1O51A 2DY9A 5L9XA 2Q6CA 1VHIA 3L3CA 5EX3A 4L72B 2AU0A 2DY1A 4LSNA 2IIHA 2WCXA 1H72C 5KFAA 4DV2I 5CAAA 2ZJPQ 3HHLC 4LFAI 1KQSR 2LEBA 1XNRF 4DR7I 4J9SA 4DL6A 3LWLA 3BH7B 2AYMA 4DPTA 1KQGB 3PYDA 2QO3A 5C24A 5DLGA 3WU3A 4DV0I 4IH5A 2ZBCA 1GT8A 3DOMB 5J2QB 1RAHB 3I0RB 3MOJB 2DO0A 4JI4E 4ZVIA 3HZEA 2BE7D 4LJMA 3T5HA 4WP3A 1OWXA 2N82B 3N79A 3W7BA 3K59A 1J27A 1NDLA 1BGXT 1N32F 4ZVOB 4F25A 7FD1A 5HO4A 4OO1C 2FHMA 4DV5F 1TFWA 1S1XB 2OEJA 5E3QA 1WEYA 2KVQE 1RWWB 2ZVSA 3N5FA 5EDWA 1RREA 1Q5VA 4DWIA 2L41A 2ZJQQ 3W5ZA 4DV7E 2EBGA 3LA0A 1FKAF 4YQWA 1SJ4P 2CPHA 3G4SS 2RF2B 4FWGA 4H4MB 2R2SA 1REVB 2M2BA 3H90A 3GU0A 2PI4A 5K20B 1K0VA 1VR6A 1UWAA 4BC9A 4URGA 3KJVB 1SC3B 1FJGF 4UQTA 3ZZRA 3L7ZB 3T1HI 1GH8A 5HAOA 2YTCA 1U09A 3NCQA 1DTQA 3EVMA 3OFGA 2OMOA 4NYPA 2NS1B 1JLAA 3IGNA 2EVZA 4CTAB 1OY8A 1S6QA 1W26A 5B0GA 4HHJA 4IG0A 3QGPA 4MYTA 1GNKA 1RE1B 4ICLA 1EHWA 4A8SA 2VC1A 2M7SA 4ED2A 2VG6A 2KVIA 5BXIA 1CSJA 3SIPB 2JLGA 4USJC 5IQQA 4KBIA 1GTEA 4FXWA 3Q8UA 2G0JA 4F2RA 2GMLA 1MU2A 2EC0A 2LQBA 3B4TA 4HY1A 4UT4A 2GIRA 1HBNB 1Z0EA 4KE5A 1QJHA 3I55S 4LF6E 3QWPA 3KG1A 1PC4A 4K0KE 1KRPA 3ICLA 3S7RA 1CBKA 2HWTA 1N48A 1NJIT 5BR8E 1HQUB 3I5AA 1IKYA 2GJIA 3I4PA 2E5JA 3TUPA 2YH0A 1NK8A 3EGVA 4KSEB 1UL3A 2G2OA 5A0YB 2C37A 3GONA 1F3VA 1N34J 4LF5I 4BS2A 2L9WA 3WX8A 1VCTA 1I5OB 2AJ2A 4F2SA 1WG4A 3HP6A 3PS1A 3O6QA 1X4CA 1PILA 1RTJB 1HYSB 3HSJA 1Z5CA 4GKJE 2I38A 3WBZA 4PG5A 4YR3A 5K36C 1UETA 2B9XA 4RW7A 3D6TB 4PQUB 4DR4J 2ZH9A 3AD8C 2AP6A 3HPOA 3THVA 3OSPA 1ZM2A 4F02A 1TL1A 4MIWA 1X5OA 2EFNA 1M5KC 2HQ3A 3HKWA 3MM6B 4DR5J 2AV5A 2CPDA 3NY0A 5JEAF 2BJ1A 4CM2A 5KFGA 4EBEA 3E3XA 2K1RB 2CG4A 1X9MA 3LNUA 1YHQS 2OFHX 1T05A 1Q86T 2MJUA 3HF5A 3LP1B 1S6UA 3M4XA 4B9TA 1YJNS 4QNKA 4ISAA 4ETZA 2C2OB 1EP4B 4JV5F 2P8IA 1L5UA 4U7CA 3GIKA 4K4VA 1NK5A 4LFBJ 3J7A1 2ZM6J 1WC0A 2B4OA 3C6UB 3BSAA 4B3SI 2YNHA 3GTYX 3DU6A 1HHSA 3G6YA 2CNLB 3I9V9 4ZHRB 3TQ1A 2FLLA 1ZETA 4J9NA 4HR2A 4X2BA 2HSEB 2H54B 3V6DB 2V5HG 4AQYE 1P8GA 2UXBI 1HR0E 2UUAI 2VF3A 3MEKA 4IRDA 1D8ZA 3T1YJ 2G2YA 1RP5A 1YX2A 3PHTA 1RWMB 4IH7A 3L7PA 3QO9A 4DV5E 4MU3A 5BYQA 2HWIA 1N6QB 1R8AA 3PJXA 3CC7S 2MZQA 1TK0A 3L4BC 4WYLA 4MU1A 3T19A 2FVPA 3FRYA 2K3IA 4J5OA 1FXRA 2W4PA 4ED5A 1FKAE 5MAOA 1GMWA 4U8YA 1RT4A 1N34F 3KFWX 4C8NA 1YBUA 3D54A 1S1VA 4NL5A 1F9EB 1Z2LA 2Y1RI 1TKZA 2E7WA 3KLGB 1RA6A 3H8YA 5JEAD 2ZNYA 5EL9A 3CCMS 3DDIA 5AE2A 2NPIA 4DCJB 4OX9I 2W2MP 2BJ8A 2J0WA 2D3O1 1FRXA 1K0TA 1RAFB 2N7YA 2F4VI 4DR4F 2JEBA 2AYBA 1VI7A 2E5HA 1PAUB 1U0HA 4A48A 1AA1B 3FCWA 3FQLA 4NXNF 4WFAQ 2VG7A 4DL3A 2B7CB 1HNWE 4K2XA 2YNIB 1KQKA 2VBWA 1DBDA 4DR5F 4ZLNA 3V4IB 4JOUA 1LEOA 1NPPA 3OFHA 3FSYA 4O4GB 1VJWA 3JSRA 2HEKA 2QMXA 4JI6F 1KTVA 3MD3A 5J1PA 1S4FA 1HBOA 4USKA 5KT5A 2YNGA 4YB1P 2QL9B 1S9EB 2PO1A 2QGFB 5FD1A 2DVIA 4ZVRB 1M5VC 4O3QA 3N4WA 2WONA 1RTHA 1RT7A 1OSCA 2C1EB 3S1TA 1NAQA 4LFBF 2ZM6F 1TAQA 3MR7A 2UXCJ 4NZ0A 5F8MA 5JEAA 3HSGA 1VIXA 4RBUA 4ANDA 5DETA 5ITHA 3MMBB 3M32A 3SEOA 4MU0A 1FFSB 1GXLA 4PG4A 4QW8A 3DKDA 4FYYB 3QIPB 2NN6F 3FFIB 2AD9A 5LMUI 4KQZA 1OPIA 3T1YF 3PTWA 2OMLA 5E33A 2DPJA 5SZTA 1HBMA 2PT0A 2PA8D 1SV5B 2JC1A 2VBZA 3HJVA 2VOPA 5F3ZA 1QAXA 3D66A 1FDDA 2L48A 4LF9I 3H25A 2HMIA 5C25B 5AXKA 4C8YA 5DQIA 4F67A 1JLQA 1VK8A 2BACA 1H98A 2OELA 2Z2MA 3OLAA 2XWYA 2G4BA 4M5DB 4CH1A 3T1AA 2YX1A 3KMSA 4IDKA 4ZPWR 1KEKA 1LWFA 2WVCA 2VV5A 3HJCA 2XMJA 3OTBA 3W8PA 5JEAE 3POTB 3JSMA 4A8QA 2QSFA 3QNWB 4IZKA 4Y65A 3SQGA 4RNHA 1RBOB 3W8GA 2M4MA 4LRFA 2RU9A
chains in the Genus database with same CATH topology
4DPXA 2BM1A 2UXDE 3GONA 4LF5I 4KQVA 1ELOA 3J80Q 1H73A 1K47A 5A2QC 2UUCE 1Z0GA 4JI7E 2VQFE 4X66I 1PVGA 2V34A 2DEIA 4JV5E 4B3RE 2GS8A 2LJPA 4P7AA 3J80C 1Z5CA 4GKJE 4FW9A 4DUZI 4LF7E 3V5RA 4USMA 4YY3E 1IBME 1B63A 3H4LA 4DR2I 4DU7A 1XNQI 1N0UA 3LPSA 4DV3E 1J5EE 1ZM4A 3J7AM 4PRXA 1ZM2A 1Y4UA 4DPWA 1Z0VA 4LF6I 1QZRA 4LF5E 3B82A 2NPFA 4PRVA 4WUCA 4NXMI 4X65I 1S4EA 4N3OA 1ZXNA 5LL6R 4X66E 1XHKA 4HACB 5L3JA 1IBKI 3WU5A 4FWDA 2UXCI 4FN5A 4B3TI 1KIJA 4DUZE 4DR1I 5IWAI 4LF8I 5GMDA 3PYFA 3LNUA 4DR2E 1XNQE 3B78A 4AQYI 1B62A 4LF4I 1EI1A 3PYGA 1XMQI 4JI3I 2OI2A 4JI5I 2HK2A 1HR0I 4JI7I 2HFSA 4IZJA 2HK3A 1A6FA 2V2VA 4NXNI 1HNZI 1KKHA 4WUBA 4NXME 4I3HA 2A2CA 5GMEA 1USVA 4X65E 4GKJI 4M1KA 3PYEA 4DV5I 2VQEI 3LTOA 2Z5BB 2PNLA 2Q2EB 4FWHA 4B3SI 2Z5CA 1IBKE 2UXCE 4B3TE 5LMNI 4DR1E 5IWAE 4LF8E 1HK7A 3ZZTA 1FWKA 4AQYE 2HKEA 1EA6A 4LF4E 4JI6I 2UXBI 1XMQE 4DU8A 4DPYA 2Z5EA 4JI3E 4JI5E 1HR0E 1OJ4A 2UUAI 2VF3A 2A2DA 1XMOI 4NXNE 3QT8A 1HNZE 4DXLA 1KVKA 4Z7YA 1ZXMA 4DV5E 2VQEE 1Z5AA 4X62I 2E1RA 4RPFA 4B3SE 2AJ4A 4JI4I 2R3VA 2O1VA 3J81Q 5LMNE 1NHHA 2ZBKB 1H72C 1N33I 4DV2I 2R42A 1FKAE 3K17A 1N34I 4URLA 2UXBE 1Z5BA 4JI6E 1XNRI 4LFAI 4Z7CA 1BKNA 1HNWI 3V2UC 3J81C 2DEJA 2UUAE 3F0NA 4DR7I 1XMOE 2EFGA 1N36I 4EMDA 1NHIA 3ZKBA 1S16A 4DPTA 1I94I 3PYDA 4P52A 2WW4A 4JG4A 3OTOI 1HNXI 3WU3A 4DV0I 2ZITA 4OX9I 4DV7I 1ZM9A 4X62E 3JAMQ 4HACA 2X7IA 4X64I 4JI0I 4JI4E 4DR4I 4ZVIA 1Y6ZA 3ZZUA 2F4VI 4JI8I 2UUBI 3QT7A 2CGEA 4KHPI 2O1TA 4YHHI 1N33E 4DV2E 1N32I 1N34E 4R1FA 4B3MI 3JAMC 1XNRE 4JI1I 4HXZA 4LFAE 3ZZ0A 1HNWE 2E5LI 4DR7E 4DR5I 2O1WA 1Z0WA 1N36E 4IZKB 1PIEA 2V2ZA 1I94E 1RREA 3OTOE 1HNXE 3B8HA 1Z0TA 2XEXA 4DV0E 1MG7A 3P06A 3QT5A 1VISA 4LFCI 4OX9E 4DV7E 3Q6MA 2PNMA 4DR6I 2Z5BA 4PU9A 4DV6I 4X64E 4JI0E 4DR4E 3ZM7A 4XTJA 2F4VE 4JI8E 1KTVA 2UUBE 5FLXQ 4FWGA 4KHPE 4IZJD 4USKA 1WUUA 4YHHE 4DV1I 1N32E 4HYMA 4B3ME 4DR3I 4JI1E 1UEKA 1FNMA 2E5LE 3PRYA 1D6TA 5FLXC 4DR5E 4LFBI 1H7UA 2ZM6I 1Z0CA 4DUYI 1FJGI 3K85A 2HFUA 4JI2I 4JYAI 3WU4A 4ED4A 3T1HI 1FWLA 4WUDA 2CG9A 4LFCE 2UU9I 1NHJA 4DR6E 4DV6E 1MU5A 2CZ9A 1H7SA 2GQ0A 1PKPA 4DPUA 2HHHI 4MYTA 1FI4A 2HKJA 5LMUI 3T1YI 2IOQA 4DV1E 3D4JA 3ZKDA 1Y4SA 4DR3E 4K0KI 3QT6A 1DARA 5IT9Q 2IOPA 5BR8I 1N0VC 4DV4I 4LFBE 5FWKA 2ZM6E 1IBLI 3J7AG 4LF9I 4UTGA 4DUYE 3HULA 1FJGE 2V2QA 3Q6NA 1H74A 4JI2E 4JYAE 5IT9C 2O1UA 4MYUA 3T1HE 3Q1QA 4GKKI 4IZJB 2UXDI 2UU9E 3M6AA 2V8PA 1Z0BA 4HY1A 4UT4A 2UUCI 2J7KA 2VQFI 2HHHE 3CWVA 1Z0EA 5LMUE 3T1YE 1MX0A 2Z5CB 4LF6E 1USUA 3WU6A 4JV5I 4K0KE 4B3RI 2BM0A 3HJCA 1ZM3A 4LF7I 1RR9A 5BR8E 4YY3I 1IBMI 4DV4E 1NZ0A 1IBLE 4LF9E 4IZKA 2BV3A 4DV3I 1J5EI 5A2QQ 1Z59A 3K1JA 1U2RA 4GKKE 2X36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPX A;  2BM1 A;  2UXD E;  3GON A;  4LF5 I;  4KQV A;  1ELO A;  3J80 Q;  1H73 A;  1K47 A;  5A2Q C;  2UUC E;  1Z0G A;  4JI7 E;  2VQF E;  4X66 I;  1PVG A;  2V34 A;  2DEI A;  4JV5 E;  4B3R E;  2GS8 A;  2LJP A;  4P7A A;  3J80 C;  1Z5C A;  4GKJ E;  4FW9 A;  4DUZ I;  4LF7 E;  3V5R A;  4USM A;  4YY3 E;  1IBM E;  1B63 A;  3H4L A;  4DR2 I;  4DU7 A;  1XNQ I;  1N0U A;  3LPS A;  4DV3 E;  1J5E E;  1ZM4 A;  3J7A M;  4PRX A;  1ZM2 A;  4DPW A;  1Z0V A;  4LF6 I;  1QZR A;  4LF5 E;  3B82 A;  2NPF A;  4PRV A;  4WUC A;  4NXM I;  4X65 I;  1S4E A;  1ZXN A;  5LL6 R;  4X66 E;  1XHK A;  4HAC B;  5L3J A;  1IBK I;  3WU5 A;  4FWD A;  2UXC I;  4FN5 A;  4B3T I;  1KIJ A;  4DUZ E;  4DR1 I;  5IWA I;  4LF8 I;  5GMD A;  3PYF A;  3LNU A;  4DR2 E;  1XNQ E;  3B78 A;  4AQY I;  1B62 A;  4LF4 I;  1EI1 A;  3PYG A;  1XMQ I;  4JI3 I;  2OI2 A;  4JI5 I;  2HK2 A;  1HR0 I;  4JI7 I;  2HFS A;  2HK3 A;  1A6F A;  2V2V A;  4NXN I;  1HNZ I;  1KKH A;  4WUB A;  4NXM E;  4I3H A;  2A2C A;  5GME A;  4X65 E;  4GKJ I;  4M1K A;  3PYE A;  4DV5 I;  2VQE I;  3LTO A;  2Q2E B;  4FWH A;  4B3S I;  1IBK E;  2UXC E;  4B3T E;  5LMN I;  4DR1 E;  5IWA E;  4LF8 E;  3ZZT A;  1FWK A;  4AQY E;  2HKE A;  1EA6 A;  4LF4 E;  4JI6 I;  2UXB I;  1XMQ E;  4DU8 A;  4DPY A;  4JI3 E;  4JI5 E;  1HR0 E;  1OJ4 A;  2UUA I;  2VF3 A;  2A2D A;  1XMO I;  4NXN E;  3QT8 A;  1HNZ E;  4DXL A;  1KVK A;  4Z7Y A;  1ZXM A;  4DV5 E;  2VQE E;  1Z5A A;  4X62 I;  2E1R A;  4RPF A;  4B3S E;  2AJ4 A;  4JI4 I;  2R3V A;  3J81 Q;  5LMN E;  1NHH A;  2ZBK B;  1H72 C;  1N33 I;  4DV2 I;  2R42 A;  1FKA E;  3K17 A;  1N34 I;  4URL A;  2UXB E;  1Z5B A;  4JI6 E;  1XNR I;  4LFA I;  4Z7C A;  1BKN A;  1HNW I;  3V2U C;  3J81 C;  2DEJ A;  2UUA E;  3F0N A;  4DR7 I;  1XMO E;  2EFG A;  1N36 I;  4EMD A;  1NHI A;  3ZKB A;  1S16 A;  4DPT A;  1I94 I;  3PYD A;  4P52 A;  2WW4 A;  4JG4 A;  3OTO I;  1HNX I;  3WU3 A;  4DV0 I;  2ZIT A;  4OX9 I;  4DV7 I;  1ZM9 A;  4X62 E;  3JAM Q;  4HAC A;  2X7I A;  4X64 I;  4JI0 I;  4JI4 E;  4DR4 I;  4ZVI A;  3ZZU A;  2F4V I;  4JI8 I;  2UUB I;  3QT7 A;  4KHP I;  4YHH I;  1N33 E;  4DV2 E;  1N32 I;  1N34 E;  4R1F A;  4B3M I;  3JAM C;  1XNR E;  4JI1 I;  4HXZ A;  4LFA E;  3ZZ0 A;  1HNW E;  2E5L I;  4DR7 E;  4DR5 I;  1Z0W A;  1N36 E;  1PIE A;  2V2Z A;  1I94 E;  1RRE A;  3OTO E;  1HNX E;  3B8H A;  1Z0T A;  2XEX A;  4DV0 E;  1MG7 A;  3QT5 A;  1VIS A;  4LFC I;  4OX9 E;  4DV7 E;  4DR6 I;  4PU9 A;  4DV6 I;  4X64 E;  4JI0 E;  4DR4 E;  3ZM7 A;  4XTJ A;  2F4V E;  4JI8 E;  1KTV A;  2UUB E;  5FLX Q;  4FWG A;  4KHP E;  4USK A;  1WUU A;  4YHH E;  4DV1 I;  1N32 E;  4HYM A;  4B3M E;  4DR3 I;  4JI1 E;  1UEK A;  1FNM A;  2E5L E;  1D6T A;  5FLX C;  4DR5 E;  4LFB I;  1H7U A;  2ZM6 I;  1Z0C A;  4DUY I;  1FJG I;  2HFU A;  4JI2 I;  4JYA I;  3WU4 A;  4ED4 A;  3T1H I;  1FWL A;  4WUD A;  4LFC E;  2UU9 I;  1NHJ A;  4DR6 E;  4DV6 E;  1MU5 A;  2CZ9 A;  1H7S A;  1PKP A;  4DPU A;  2HHH I;  4MYT A;  1FI4 A;  2HKJ A;  5LMU I;  3T1Y I;  4DV1 E;  3D4J A;  3ZKD A;  4DR3 E;  4K0K I;  3QT6 A;  1DAR A;  5IT9 Q;  5BR8 I;  1N0V C;  4DV4 I;  4LFB E;  2ZM6 E;  1IBL I;  3J7A G;  4LF9 I;  4UTG A;  4DUY E;  3HUL A;  1FJG E;  2V2Q A;  1H74 A;  4JI2 E;  4JYA E;  5IT9 C;  4MYU A;  3T1H E;  3Q1Q A;  4GKK I;  2UXD I;  2UU9 E;  3M6A A;  2V8P A;  1Z0B A;  4HY1 A;  4UT4 A;  2UUC I;  2J7K A;  2VQF I;  2HHH E;  3CWV A;  1Z0E A;  5LMU E;  3T1Y E;  1MX0 A;  4LF6 E;  3WU6 A;  4JV5 I;  4K0K E;  4B3R I;  2BM0 A;  1ZM3 A;  4LF7 I;  1RR9 A;  5BR8 E;  4YY3 I;  1IBM I;  4DV4 E;  1NZ0 A;  1IBL E;  4LF9 E;  2BV3 A;  4DV3 I;  1J5E I;  5A2Q Q;  1Z59 A;  3K1J A;  1U2R A;  4GKK E;  2X36 A; 
#chains in the Genus database with same CATH topology
 3P3E A;  1BD6 A;  1A7G E;  2P6S A;  2VBY A;  2R8G A;  5CCL A;  4GO7 X;  4KRW A;  3FKB A;  3MM8 A;  1MMN A;  2RJZ A;  1PJ6 A;  4DLG A;  1PCA A;  4JV5 E;  2OP5 A;  1NKB A;  3E8O A;  4EZ6 A;  5D0G A;  2BKN A;  3BSO A;  4EWT A;  2HVI A;  2RE1 A;  4JI8 J;  3NMA A;  1IM4 A;  1CJK A;  2NN6 D;  2M8H A;  4C11 B;  4TKT A;  1TKX B;  3RYL A;  5JXS A;  4ICL B;  2MY8 A;  3D9B A;  2RKI A;  4C8K A;  4NXM I;  3QPI A;  2JEG A;  4Y3C A;  3BM7 A;  1V3R A;  2BAN B;  4N3O A;  4CLL A;  3H5S A;  4X66 E;  4C8Z A;  3M8P B;  2WSE C;  3DGV A;  3UCU P;  2UXC F;  3MAA A;  4BHQ A;  3J7Y I;  2P6T A;  1X8D A;  2WZ1 A;  2DNL A;  1VQ5 S;  3DYA A;  4CZC A;  2ZH3 A;  1VBK A;  1HL6 A;  1PBA A;  3N6N A;  2F8H A;  3MEC B;  2OAU A;  4OJG A;  1SQF A;  2C2M B;  2HFS A;  4CP5 A;  4EGL A;  1H6K X;  4EBC A;  2CJA A;  4X65 E;  5F41 A;  2FLP A;  1R6Y A;  3BF4 A;  4DUY J;  2J0Q D;  2R7T A;  1AUD A;  5E0O A;  3KG4 A;  4WP9 A;  3MGJ A;  4YOE A;  3DRP A;  3GMG A;  3C3L A;  2ALZ A;  1HI1 A;  3IS9 A;  2NN6 A;  4DX7 A;  1S0O A;  4NXN E;  4P2M A;  4G1Q B;  3BRE A;  1M5O C;  2B6A A;  3ISN C;  2CPY A;  1IBL J;  1R0C B;  4HEA 9;  5HN0 A;  2J9D E;  5HK4 A;  8ATC B;  2FVQ A;  1T8E A;  4ZDN A;  1F2G A;  4XAK A;  4JI6 E;  3R6G B;  1ZYQ A;  5KOW A;  5CHC B;  3WQP A;  2NYH A;  3NGR A;  3D2W A;  1EIY B;  3VZH A;  2LFV A;  2NSB A;  4BCA A;  2YWE A;  1SJR A;  1BHN A;  3OTO I;  1HNX I;  5I42 A;  2EWH A;  3RG6 A;  4RWW A;  4ELU A;  5DQH A;  4DV3 J;  2YKQ A;  2RS2 A;  5K14 A;  4NZ6 A;  5K5M A;  3T41 A;  1SBR A;  2NYI A;  3H2U B;  3AXK A;  2YQ0 A;  2O1T A;  5ETQ A;  4JI1 I;  1NZ8 A;  3VAM A;  4B3O A;  3DDK A;  1RHU B;  1Z0W A;  4IFD F;  1LWE A;  2BBE A;  2YNH B;  2M5Y A;  3J80 Y;  2W4C A;  2IVM A;  4YP3 A;  4DLE A;  3VR1 A;  2VFU A;  3CJ4 A;  3QRR A;  3DOL B;  2XS5 A;  2M52 A;  3QT5 A;  3Q6M A;  1NSK L;  1N4L A;  4F26 A;  2Z5B A;  5C42 B;  3NWR A;  4DV6 I;  1S5Z A;  4Q8F A;  5E3A A;  1X4H A;  1WI6 A;  2RRA A;  1YJU A;  2DR5 A;  3ZTR A;  3CCJ S;  3P6Y C;  1Q4R A;  2XUL A;  2UUW A;  3FBF A;  4MT1 A;  2RUS A;  5DDP C;  2EFO A;  4X62 F;  1UAW A;  2N3L A;  3ILO A;  4DUY F;  3PV8 A;  4ZVE A;  2FGO A;  4LF4 J;  3MPY A;  3PKY A;  1HQE A;  4B9M A;  3R7S B;  1U1O A;  4QQB A;  5CD4 A;  2JJ4 D;  4DN9 A;  3GG1 A;  4XIU A;  3KHG A;  1MSW D;  4IOB A;  3H7H B;  2HHH I;  3UWT A;  2Z0G A;  2EEY A;  1TK5 A;  1U25 A;  2QL7 B;  2FGC A;  4HDG A;  2C3Y A;  2F1D A;  4KGZ B;  4R0E A;  1JKH B;  2E66 A;  3NS5 A;  1TTH B;  3GR0 A;  4ECY A;  1T9U A;  1U02 A;  3GYG A;  4Y00 A;  1PYO B;  4L3N A;  4BWM A;  1VRU B;  4ZP9 A;  3KK3 A;  1IBL F;  1VQK S;  2E29 A;  4J90 A;  4JI0 F;  2XLK A;  2UVR A;  3W2W B;  1U0H B;  3CDB A;  2HRT A;  5KFB A;  3QQC D;  2V8P A;  1T7P A;  4WK3 A;  4NA3 A;  3QLH B;  3T9N A;  3PIO Q;  2UUC I;  1RTI A;  4I67 A;  1UJ4 A;  4E0D A;  3ILI A;  4BA1 A;  2Z5C B;  3W65 A;  4Y0F A;  4UUW A;  3CC2 S;  1S6P B;  1XXE A;  2XQC A;  4LF7 I;  1S9F A;  4FS2 A;  1QD1 A;  4M5M A;  2JEJ A;  1SKW A;  2GVZ B;  3VWS A;  3KRN A;  1Y9O A;  1ZOT A;  4DV3 F;  1MWQ A;  1VQS A;  3AQP A;  4RUB A;  3CCL S;  1XJW B;  2J6S A;  1QLN A;  6FDR A;  1RI7 A;  1TV6 B;  4KO0 B;  4KQV A;  1EZZ B;  1URR A;  2CFX A;  5MLC V;  3MCO A;  3LPY A;  1Z0G A;  4ZPV R;  3H1C A;  4Q44 A;  1CUL B;  2X51 A;  4NRT A;  4RW6 B;  3D0I E;  2ZC3 A;  4DUZ I;  2ATL A;  2UU9 F;  2PO2 B;  1N0U A;  2LP4 A;  4TU7 A;  2ERR A;  1RIS A;  1KTQ A;  3CWJ A;  1PGZ A;  2VPZ B;  4LF6 I;  2XO7 A;  4A46 A;  3NL0 A;  4FF4 A;  4TXS A;  1SJF A;  5GAD U;  2HYI B;  2WB4 A;  3MM5 B;  3NOC A;  3GIJ A;  1RT2 A;  4F4K A;  3UDV A;  2ZUA A;  3HHL D;  2KZM A;  1JJ2 R;  4IFD A;  4N41 A;  4NLV A;  5CQG A;  2IVF B;  5J2M A;  1JLQ B;  1XNQ E;  3MMA A;  3CJK B;  2COL A;  4LF4 F;  3KJF B;  2WAQ D;  3GCM A;  4UOF A;  4IDK B;  2XMW A;  2D69 A;  3O44 A;  3QRQ A;  1S1W B;  5E2Q A;  2V2V A;  3Q8Y A;  2C42 A;  3OSN A;  2DYA A;  4GKJ I;  2W9A A;  2OPP A;  4XDD A;  1SH3 A;  4Y2A A;  3O3L A;  4WJB A;  1IR2 A;  3M85 G;  1F9H A;  2GJF A;  1RTD A;  5HAT A;  2XY5 A;  1VOM A;  2FY8 A;  3SQG B;  3HFK A;  2KJW A;  2F9J A;  1VQP S;  2HLU A;  2MQ8 A;  2LEA A;  4DSI A;  3H20 A;  3OFE A;  1WKK A;  1LK7 A;  1TVR B;  2J0S D;  1VQ8 S;  1ZTW A;  2A2D A;  1FJ7 A;  1Q8K A;  2C2N A;  2PO0 B;  2V9W A;  2VQE E;  1HHT P;  5F8N A;  3EXY A;  4IFD E;  3MCN A;  4YB7 A;  2HHU A;  1H2T Z;  1WNE A;  2O1V A;  3C19 A;  3D6M B;  5LMN E;  1N54 B;  1NHH A;  3HHL A;  5KG3 A;  2QTW A;  3O2I A;  3EVO A;  4DF8 A;  3GP9 A;  1FRL A;  2JEF A;  2Z8Q A;  4WIQ A;  3A3P B;  4PWD B;  1XNR I;  1REG X;  2M88 A;  1BKN A;  2W7P A;  3J81 C;  1ULR A;  2VQF J;  3F0N A;  2G2Z A;  2RIL A;  5K36 F;  1XMO E;  2IHR 1;  3M2R B;  3L7U A;  3OW2 R;  1OPZ A;  4PXB A;  2XSF A;  1K8A T;  1DAX A;  1GQE A;  2AEF A;  1ZM9 A;  4X62 E;  3E2E A;  2XSJ B;  1ZA2 B;  4HAC A;  3CVK A;  2ZOM A;  1CLF A;  4UZC A;  5C0X C;  2E5I A;  4QWB A;  4QPT A;  1KOO A;  4FDF A;  1N32 I;  3EDQ B;  1NDK A;  3BGU A;  3FC9 A;  4AXJ A;  2W4D A;  2NQP A;  3DU5 A;  2CNK B;  1YBT A;  4GMK A;  4Q0B B;  2UVW A;  4ZP8 A;  3KYL A;  4LRA A;  2LQ5 A;  2FTR A;  2XCA A;  2IBK A;  2KHD A;  3TI0 A;  2MJN A;  4AL6 A;  4LFC I;  2IC3 B;  2J8A A;  1U2C A;  3Q22 A;  2DGX A;  2NCK L;  4JI0 E;  4N8O A;  4CWB A;  5AT1 B;  4IR1 A;  5KT4 A;  2FC9 A;  4QIV A;  2KM8 C;  4YHH E;  2LXI A;  5I4M A;  4B3M E;  4ERD A;  1AZS B;  4PG8 A;  4HH1 A;  1UEK A;  2HIY A;  1WDT A;  2E5L E;  4U7U D;  1SKU B;  2ZFH A;  2KXN B;  3D5M A;  1E6V A;  4LR7 A;  3TYT A;  2MQQ A;  4UY8 T;  5J2P B;  2VPX B;  1FJG I;  4NCB A;  3THT A;  1H38 A;  4TY9 A;  1UZD A;  2RNE A;  1NZA A;  2JNJ A;  3ADA C;  4ED4 A;  5IWA J;  2R7R A;  3WU4 A;  2QJ3 A;  2H4W B;  2VPY B;  2WVF A;  1NHJ A;  3DMJ B;  4FW6 A;  5KFK A;  4CLS A;  2AHO B;  4JI3 J;  2IAJ A;  3IN5 A;  1DFD A;  4JI7 J;  1ZZF A;  1TP7 A;  2MKY A;  2BRL A;  4ITS A;  2MMY A;  3G6X A;  5K36 D;  5F8J A;  3IRX B;  3D4J A;  3OJU A;  2QL5 B;  2I2Y A;  2AGQ A;  2IOP A;  4ZVQ B;  4MH8 A;  1N5T A;  2VOO A;  1FXL A;  2H3E B;  1TUG B;  4RNN A;  1HPZ B;  4DI6 A;  1WI8 A;  3EWG A;  3RAM A;  1SKS A;  3JSB A;  4X4T A;  2IES A;  2VKZ G;  2O1U A;  3EUN A;  3JQK A;  1RGV A;  2UU9 E;  3IWN C;  4IFY B;  5DDQ C;  5JJB A;  5EWG A;  4Q5V A;  4UOG A;  2X1F A;  2I6W A;  2VQF F;  4OHZ A;  4KV8 A;  1USU A;  1IJF B;  2PEB A;  1VQO S;  1LFP A;  2HND A;  4KKO A;  1TR0 A;  1H7W A;  4KHR A;  4ECQ A;  3PEH A;  4RWX A;  3TR5 A;  4NLD A;  3HHN B;  3MD1 A;  5G0R A;  4QNJ A;  4DR6 F;  2W9B A;  4TY8 B;  3M6V A;  2M70 A;  3M6X A;  1T3O A;  3OTC A;  3K1J A;  4F4Y A;  2H65 B;  4DPX A;  2N4D A;  4GO5 X;  3C14 A;  2DXE A;  1SXL A;  3GYN A;  3AA9 A;  5L9N A;  3SMZ A;  1K47 A;  3EIC A;  5A2Q C;  2AQ4 A;  2XO6 A;  4LVO P;  1NSA A;  5CYQ B;  4KHM A;  2V34 A;  4USW A;  2MZJ A;  3DI6 B;  4P7V A;  4R8U A;  1FCA A;  2PMH A;  4CYU B;  2RSQ A;  1UDN A;  2MYF A;  1S76 D;  4FBT A;  1IKX B;  1M90 T;  3TVK A;  1HQE B;  4DCO B;  5IM0 A;  4AIM A;  1RK8 A;  2LDI A;  2YX7 A;  3DRS A;  1BQM A;  3J7A M;  1EX8 A;  3QFW A;  4DOZ A;  4LCG A;  1P1L A;  1NK6 A;  2IBO A;  1WAC A;  3HI9 A;  2V6A A;  5C7P A;  2UP1 A;  4BDP A;  2PNZ A;  1ZXN A;  2BW7 A;  2HZV A;  4OJH A;  1V9O A;  3KK3 B;  4OYO A;  4FWD A;  5GAE U;  1HNV A;  3UD4 P;  3MUR P;  1Q81 T;  1FFW B;  3FEZ A;  3OV7 A;  3DLE B;  1UVM A;  3KLV A;  1NU4 A;  4TQR A;  4WZQ A;  4MMO A;  4JI3 F;  1C0U A;  4JI7 F;  3V81 B;  4DR3 J;  3VGU A;  4J9R A;  4B3R F;  1SPB P;  3PYE A;  3TAQ A;  2Q2E B;  2IPO B;  2V4Q A;  2KB2 A;  2VDH A;  1KBR A;  3RGI A;  4DR1 E;  1JJ4 A;  1UCN A;  4GVB B;  1R0B G;  4ZN3 A;  2GJ2 A;  4NA1 A;  1X5T A;  3D7S B;  3RAQ A;  3KWM A;  3ENV A;  2HRY A;  1AFI A;  3JXO A;  3SSQ A;  3OL9 A;  1MW7 A;  4LF2 A;  3HHD A;  2UUT A;  4XK8 C;  3G8Q A;  5HLF A;  4IUF A;  2YWW A;  4ED0 A;  2OPR A;  2PDA A;  3F41 A;  2XI3 A;  1LW2 B;  2FVS A;  3J81 Q;  2C3O A;  3ISZ A;  4M94 A;  4DFP A;  2B9W A;  5CYM A;  4DCP B;  1VS3 A;  2QA4 G;  4PEO A;  2QLX A;  1N34 I;  2ZKU A;  2FJD B;  1YJR A;  1NUE A;  2J9E A;  4Z7C A;  1C1C B;  5LXR A;  1VFJ A;  2L08 A;  3UHM A;  3Q83 A;  1XBW A;  1UFL A;  2VC0 A;  3CCS S;  3S6E A;  1IBM J;  1QY7 A;  1RWK B;  1S1U B;  3DRY A;  1EET B;  1J5E J;  4DR4 I;  2J9C A;  1G7C B;  1FKO A;  2YKM A;  2MGZ B;  2YXL A;  1C1B A;  5J2N B;  4DUT A;  2FHJ D;  3TEG A;  4FS1 A;  4DR5 I;  3CDW A;  1FVS A;  5DRQ A;  2O1W A;  1N36 E;  2CJX B;  1DQ9 A;  3HM9 A;  4FKX A;  2WNR B;  4F3Q A;  5D0E A;  5AE3 A;  5H1S V;  2XMA A;  4DDF A;  5KFW A;  4C4W A;  2XTJ P;  3TAP A;  4PPD A;  3MR6 A;  5A6W A;  2W8L A;  2HFZ A;  3PVX A;  2L3M A;  1AB8 A;  4NCG A;  2PE8 A;  1RT6 B;  3SCI E;  3M8Q A;  3BGR B;  2RT3 A;  5E3P A;  4P2X A;  4KHP E;  2GFF A;  4ZVU B;  2ZH2 A;  3D1O A;  4RO0 A;  2BQR A;  3U7J A;  4WF9 Q;  3BBF A;  3BQ0 A;  1RKI A;  1UA0 A;  1KON A;  1JQG A;  1RCX B;  4LFB