1S4EA

Pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
347
structure length
337
Chain Sequence
TVKSPGRVNLIGEHTDYTYGYVMPMAIDLYTIITDKVQLYSEHFNEKLDLTKEGSWIDYVKGVLWVLIQEGYKIGGLKKITGDLPLGAGLSSSASFEVGILEVLNQLYNLNIDPLKKALLAKKAENEFVGVPCGILDQFAVVFGKKDNVIFLDTQTLQYEYIPFPKDVSVLVFYTGVKRELASSEYAERKRIAEESLRILGKESSKEVTEKDLGKLPPLHRKFFSYIVRENARVLEVRDALKEGDIEKVGKILTTAHWDLAENYRVSCEELDFFVKKAMELGAYGARLTGAGFGGSAIALVDKDKAKTIGDAILREYLAKFSWKAKYFVVKPSDGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate specificity and mechanism from the structure of Pyrococcus furiosus galactokinase
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
molecule keywords Galactokinase
total genus 115
structure length 337
sequence length 347
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 2.7.1.6: Galactokinase.
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
A PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1s4eA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1s4eA01
4DV1E 1N0UA 1RREA 1N34I 3J81Q 4DR2E 1FNMA 1N36I 1I94E 4JV5I 1B63A 4JI6I 4DV0I 4AQYI 4DV2E 4LFAI 4MYTA 3PYEA 3T1HI 5A2QQ 4DPWA 4NXNI 4DV4E 1HNWE 1MU5A 2ZM6I 3ZKDA 1D6TA 4JI2E 1EI1A 3GONA 1Z0BA 4DV1I 4X65I 4DU8A 4UT4A 4NXMI 2A2DA 2VQFE 1NHIA 2UUBE 1DARA 4DV6I 2OI2A 3PYDA 4DV7I 1BKNA 4M1KA 3K17A 2R42A 3QT7A 3ZZUA 4B3TI 2F4VE 2UXBI 3J81C 2EFGA 4DV3E 4DPTA 5L3JA 3WU5A 2V8PA 4DV5E 1Z0GA 1IBKE 4NXME 1J5EE 3B82A 4FWGA 2GS8A 4USKA 4DPUA 4B3RI 1KTVA 4FWDA 1H74A 3H4LA 4HXZA 4MYUA 1FI4A 4X64E 4JG4A 2VF3A 3T1YI 4JI7E 4DV2I 2R3VA 4FW9A 2V2VA 1OJ4A 4JI3E 4LF5E 1XMQI 4DPYA 5FLXC 1Z5BA 4JI6E 1N36E 4ED4A 4JV5E 2ZBKB 1Z5AA 5LMNI 2UU9E 3J7AM 1XMQE 1WUUA 1HR0E 4B3SE 4JI1E 4WUBA 1PVGA 1XNQI 1XNQE 5IT9Q 1EA6A 2UUCI 3PYGA 1IBLI 4DUZI 2UXDE 4LF6E 4RPFA 4UTGA 1Z0WA 2HKJA 2E5LE 4GKJI 3JAMC 4JI3I 1J5EI 3ZKBA 4DV7E 2VQEE 1KVKA 1N32I 1Z0TA 5BR8E 4LF7E 1XNRE 2HKEA 2UUAE 4B3MI 4DR6I 4DPXA 4DV3I 2F4VI 4JYAI 1PKPA 2UXBE 3V2UC 3V5RA 1ZM3A 4JI2I 2BM1A 4PU9A 1S16A 1VISA 4LF6I 4ZVIA 2UUBI 4DR4I 4DV4I 4Z7YA 4DV5I 2XEXA 3WU6A 4B3SI 4LFAE 3J80C 4DUYI 4YHHE 4B3TE 1H72C 1NHHA 5GMEA 2UXDI 4LF5I 1IBLE 1ZM9A 2HFUA 5LMUE 4P52A 4DR1I 2NPFA 4JI7I 4FWHA 4JI5I 4LFCI 3M6AA 4LFCE 2VQEI 4JI5E 4KHPI 2E1RA 4HACA 1N33I 4GKJE 2UU9I 1RR9A 4LFBI 5LMNE 4LFBE 4YY3I 1FKAE 1MG7A 1NHJA 2WW4A 3B78A 4PRVA 3B8HA 1KKHA 3T1YE 2DEJA 1U2RA 4X64I 3HULA 2HHHI 3LPSA 1IBKI 4DR1E 4WUDA 2X7IA 4DR4E 3OTOE 4AQYE 3J80Q 2CZ9A 4OX9E 4DV0E 1ELOA 3JAMQ 2J7KA 3Q1QA 4LF4E 1Z0VA 1N33E 1A6FA 4DUYE 1Z5CA 4X62I 1FWKA 1IBMI 2Q2EB 4K0KI 1N0VC 5IWAI 5LMUI 4DR5E 1ZM4A 1K47A 4GKKE 4PRXA 1H7UA 1QZRA 4WUCA 2V2ZA 4LF8I 1ZM2A 4R1FA 4X66I 4DR6E 4I3HA 1N32E 4X62E 4P7AA 4JI8I 3ZZ0A 4USMA 1KIJA 3QT6A 2E5LI 3F0NA 4HYMA 3WU4A 3J7AG 4LF4I 3D4JA 3QT8A 1UEKA 4DUZE 4DR5I 4DV6E 4OX9I 2UXCE 4DR7E 5BR8I 4LF7I 1XNRI 2VQFI 4KHPE 1FJGE 2A2CA 1Z0EA 5LL6R 1XMOE 3T1HE 1PIEA 4HACB 4DU7A 4JI1I 1NZ0A 3LTOA 4LF9E 4YY3E 1ZXNA 5IT9C 1I94I 4DR2I 4LF9I 4XTJA 3OTOI 3ZM7A 1HNZI 2BV3A 1MX0A 1XHKA 2HK2A 1FJGI 2UXCI 1B62A 3LNUA 1HR0I 4JI0I 5GMDA 4URLA 4B3RE 2HK3A 4YHHI 1N34E 4GKKI 2AJ4A 1Z0CA 3PYFA 1HNXE 4DR3E 4K0KE 5A2QC 4DR7I 4X66E 4LF8E 3ZZTA 4X65E 2ZITA 3QT5A 4EMDA 2BM0A 1Z59A 2V2QA 4DXLA 4JYAE 4JI8E 1H73A 4Z7CA 2ZM6E 2UUCE 5IWAE 4KQVA 3WU3A 2V34A 1S4EA 1IBME 2HHHE 4DR3I 2LJPA 1HNZE 1HNXI 1H7SA 2X36A 2HFSA 1FWLA 4FN5A 4HY1A 4JI0E 2UUAI 4B3ME 2DEIA 1HNWI 4JI4E 4NXNE 1XMOI 1ZXMA 3CWVA 3K1JA 4JI4I 5FLXQ
chains in the Genus database with same CATH superfamily
3CSKA 3GFYA 2BA0D 4ER8A 1JLEA 2HWIA 1S9GB 2DPIA 3CDAA 1RREA 2J5AA 4KO0A 4CNYA 1KVIA 3J81Q 4DR2E 1V5VA 3JXOA 1UVIA 4LF4F 5DGBA 3K57A 3UNYA 1C0UB 1I94E 3RRHA 4C11B 1M90T 1UDNA 2Z5CB 2B8QA 1Q8LA 5DQHA 2XQCA 5C24B 2XMAA 3G82B 2YKMB 2RU9A 5FIIA 4RX6A 5A8WA 5BR8F 2ASDA 2AQ4A 4MYTA 1QLNA 2CZVC 3VAMA 5A8WB 2HFNA 2V8VA 3OXGA 3PDNA 2VICA 1RTJA 1BMQB 3GU0A 3AT1B 2HZVA 1UWAA 2DHGA 5L9XA 4LF7J 4TN2A 4DV6F 4DWIA 4PCQA 3H25A 4NXNI 4DV4E 5ETQA 3KJNB 3B54A 1PYOB 3BGLA 4CLSA 3LUYA 4F7VA 2WTFA 2BQRA 1MU5A 1F2HA 1S72S 1WEZA 3VGUA 1YQHA 2GO8A 2KVIA 3AOBA 3GFXA 3PIOQ 1T11A 3EWGA 3R1HA 1GAOA 1D6TA 1IJFB 2NXUA 3H42A 4K0KF 2KJVA 1MN7A 1MW7A 2RS8A 1NPRA 5KTQA 2XS2A 1HQEA 2W24A 2XGQA 1EI1A 1RTIA 2ZD1B 3TX0A 3BSCA 1UDOA 3R9LA 4ANEA 1UMJA 2DO4A 4IZJD 2IERA 4DV1I 1MNEA 4JI8J 4X65I 4UT4A 2HBRB 5JXSA 1RT7A 4HI1A 1H0HB 3I55S 1FJCA 2CPYA 2V4QA 4LF6F 2CADA 3PKMA 4IFVA 2MKIA 3A8KA 3JTOA 4NCGB 3WDOA 1DQAA 1Q86T 1RTHA 3BREA 4NLWA 3VR1A 2VFUA 1P9QC 3BYPA 3H2UB 1I6JA 4ED5A 4P2SA 4WU2A 1DARA 2NXNA 5J2NB 1VMBA 4BDPA 5DDQC 3RB6A 2N3LA 3DYAA 2GGPA 2ZUGA 2AF6A 2ZOMA 4LFAJ 5T41A 5KG5A 3DYAB 3OW2R 1FDAA 3VAJA 2CWKA 3QBCA 2K7KA 4ID8A 1RWKB 2AEMA 2KM8B 2DH7A 4PG4A 1NAQA 2ASJA 3AQOA 3MD3A 2AV5A 2IPOB 2R42A 1EETB 1NO8A 1EZZB 1SJ1A 2CYYA 2VC0A 4OV1A 2PMHA 3VWSA 4BS2A 1BE4A 4IRCA 2DNNA 1USVA 4IQMA 2EFGA 3MEEA 3UFCX 1JLGA 4I6YA 2MPUA 2LA4A 3TW0A 3OUYA 4JI5F 3H0PA 5HMYA 3M32B 1IBMF 4DL7A 1N32J 1NU4A 3LAKA 2MKKA 2V8HA 2XMJA 1SCJB 1LW2A 3R3TA 2W8LA 4ZIVA 2KFYA 4IOCQ 2EFNA 2U1AA 1RISA 4JI4J 1M0SA 3QPIA 2OFHX 3KLEA 2UUAJ 1B0PA 4MFBA 4Q8EA 1U6BA 3DU6A 2L9WA 2NQPA 3CVKA 2EBGA 2HQCA 4ECRA 1J5EE 1SKWA 4IR1A 3MTJA 4Q44A 4DN9A 4MIBA 2QG9B 3MEDB 4K5RA 3OL6A 1IBCB 5LJ3Y 2KG0A 3JS9A 3VGTA 3QLHA 1FEHA 4I6AA 1BY9A 3K5LA 3ZTQA 1NDPA 4B3RI 2DGUA 3EE3A 1CSJA 4OZNA 5G4DA 1WKKA 1NHKL 1YJ9S 1H74A 1YBTA 1ZS6A 2JT2A 4HXZA 1RI7A 5C42B 3MOJB 2CJAA 4DSIA 1WEYA 1TR0A 4RUBA 4URSA 1AFJA 2GO3A 1Q0NA 4M5KA 2H4WB 3PEHA 4I7FB 2B56A 3ET6B 4X64E 4JG4A 2VF3A 5EDWA 2BX6A 5F8NA 3ETMA 1TL4A 2XO6A 3QLHB 2C22A 2ZZMA 1HBOB 2M4MA 3AOCA 1NJYA 4NYZA 3W2WB 1RBLA 1WC5A 3T5KA 2J0WA 2VUGA 3KLHB 2BEFA 3BB5A 1DAXA 2BJ1A 3HCXA 1NK9A 3GMEA 3G8SA 3CJ2A 3PG9A 3THVA 1KNZA 1TVRA 1F9FA 2OPSA 2YX7A 4ED4A 2CQDA 4F4AA 1H7WA 3MM7A 4KBIA 1XMQJ 4FBUA 1U47A 1DLOA 3GYGA 2MYFA 4K4SA 1XMQE 2HRYA 3J80Y 3AA9A 1T9UA 4DL3A 1X4DA 3RTVA 1DTTA 2G0CA 3FBCA 4OX8A 1IM6A 4LBIA 5F3TA 3S8SA 2MQPA 4NWBA 5KFJA 3SXLA 4FF1A 3LPYA 1QSYA 1T9XA 2EFPA 4NMLA 4NLRA 2Y3YA 2Z56B 2QLXA 4HL9A 2XGPA 2V9WA 4WUBA 4D3GA 2YNFB 4OZEA 5C0XA 4OYAA 1RABB 1ULRA 4ILRA 4UOFA 4C98A 2ACYA 4W90B 4M5IA 1X4AA 1TKXA 3PYGA 5KFSA 1Y5YA 4QR2A 4FKYA 1O5JA 1SIWB 1UWBA 2DNPA 2XSJB 2ZHAA 2RILA 2XYPB 1RKJA 3BDPA 1B0VA 4GO7X 1WF0A 1CEZA 3PW7A 5KFBA 1IKXB 4DV2E 3DDNA 1TKXB 3K0JA 2VPYB 1TL7B 1ZTWA 1Z0WA 2HKJA 2OGUA 4C8LA 3WHIA 5IC4B 3TAPA 2CJKA 2H5IB 3JTPA 4HHHA 3QMQA 1FD2A 2HHXA 2VOOA 2CQ2A 3UDEA 1OO0B 3CCSS 2D9PA 2IOQA 2AMCB 4OLOA 4F26A 2W7AA 3CGIA 1XWLA 4QW8A 3ZZRA 4JI0J 4OO1D 3M2VB 1SV5B 2PFFB 3KLGA 1FERA 3HHLA 3VAFA 2BRKA 2IRXA 4L75A 4A4JA 1DLOB 3QQCD 1VIOA 2EKYA 4LIWA 3GV8B 2B7CB 3I0SA 2VIHA 1JX4A 2CNLB 2NN6B 1XNRE 1HQEB 4DFMA 2UUAE 4UUXA 4DR4J 1WOPA 1X9SA 3KUGA 2ILZA 1JLFA 3V81B 1UVMA 3RU0A 3TZZA 1RCOB 3HVRA 4CQ1A 3VALA 4I1TA 1JXEA 3RB3A 4JYAI 1F6TA 4I0WA 4I4BA 1P6TA 2R2TA 1Q8KA 2LVWA 2YNFA 4F0MA 5EL9A 2AZ3A 2GW8A 1UJ4A 2GVZA 2WVCA 4CLPA 5M2UA 4WKYA 4CLKA 2CQCA 3VGSA 4NLOA 4CO3A 4K4TA 4RR5A 4NCBA 2PMWA 5DQGA 5A8RA 3FEZA 3KJQB 2XS5A 3JSMA 1MU2A 1H98A 1VISA 4LF6I 3MMJA 2F1FA 1IR2A 1ZBTA 2G13A 1F9EB 4ED1A 2C2DA 1TK0A 1YJTA 2W7OA 1ICEB 3TOQA 2AEJA 1RT5B 1VRTA 3HSGA 2VBXA 2ASLA 1KFSA 3BF4A 1UCNA 3RW7A 4DN0A 3WC2A 2VG5B 4CT8A 2RUGA 5FD1A 2XEXA 1D9DA 4GKJF 2B9EA 5E3RA 1J5EF 4IRKA 4CCHA 1ITPA 2AJFE 3WU6A 4NYOA 4ANDA 4X2BA 2LU1A 2NPIA 4Y3CA 4JI7J 1NK5A 4PUOA 1UVLA 3CD7A 1CQMA 4ZDNA 4PUOB 4KO0B 4ZPAA 3PO5A 2CJXB 3RRKA 2OIHA 2MZSA 1LWFA 1R8BA 3IR5B 1NHHA 4DR6F 4AFFA 4CRJA 1DHMA 1RT5A 1D09B 2HNDB 1QAJA 3QGHA 4B9SA 2A10A 2ATCB 4I56A 1B70B 3DHWC 4LRCA 2R7XA 5A6PA 3M32A 3ZC4A 1VFJA 5LMUE 3H2VE 3CDBA 2F8EX 2XI2A 1S7HA 3PHTA 4K7QA 3OXLA 3UDVA 5CYQA 1U45A 4IG0B 4FWHA 5J2QB 3OT9A 1C0TA 1CJKB 4LFCE 2WVDA 3V6DB 5JUMA 3C46A 3BQ0A 1X60A 2E1RA 4P2MA 5KT5A 1YI2S 3QRPA 4GKJE 1RAGB 1YBUA 2QSFA 3PW4A 4N3OA 1WC0A 4KV8B 2UU9I 5J2NA 1ZZFA 3GV7B 1HK7A 1GT8A 4LFBI 2XC9A 2QT7A 2V63A 1LFPA 3HHLB 1RACB 4IH7A 3OLAA 1T05B 3C16A 2J6TA 3CC4S 4KTQA 1URNA 3UI3A 2VZ9A 3OUYB 1FNOA 2CPXA 4DCOB 4G1PA 4IS9A 3W65A 1H6KX 1FKOB 2XZTB 1EETA 1OPIA 3FK4A 1KKHA 3R5AA 1U0SA 4U95A 1BWVA 4DV1F 2J6SA 4O3SA 2DEJA 1U2RA 3C8YA 3I0RA 4KPCA 3RAQA 1OMSA 1VJQA 4X64I 2MLYA 1OWXA 1RDRA 3BS9A 3LPSA 1JJCB 4M63A 1IBKI 5HBMA 4OX9F 1LWEB 2P9GA 1WI6A 1Z2ZA 4OJ3A 4J9QA 1JK9B 1HNWJ 2KXNB 3DRRB 3LP1A 4I2PB 4LMZA 3J80Q 2CZ9A 2GV1A 2CPFA 2A6MA 3NS6A 4LF4E 4OO1C 3FSIA 3OD2A 5ETOA 4OZLA 4YR2A 4MK7A 3RBDA 1Z0VA 4ECUA 4ECVA 3MAAB 1SVDA 5HP1B 2KL8A 1DBDA 2VU5A 1U1QA 3GR0A 4RL1A 4N5SA 4WUDA 3CIMA 3VAKA 4EO6A 1HYSA 3M8QA 2C37B 2CPEA 2FQQB 3VZHA 2W2NP 2DGOA 1SH3A 2C3YA 5DS7A 3TVKA 3G71S 1VQOS 4BA1B 2MQMA 2OPSB 3IXQA 3GR1A 4DMZA 1SPBP 4LF9F 4AD6A 1FWKA 2O67A 4MKYA 2CPZA 2JLFA 2M5YA 2RVJA 5D4OA 2PDAA 3M30B 5ETLA 3WIUA 3NGDA 4RJVA 4DQRA 1ZTTA 2M2BA 4QPXA 4OO1A 5IWAI 4K0KI 2H4YB 5LMUI 3CJ4A 2AX0A 3CD5A 3HD1A 1VQ7S 2Y1IA 4QU6A 1JJHA 1TU0B 4MK9A 2PA3A 2LQ5A 1Y7PA 1NHUA 2AYBA 1N5QA 1EHWA 2QMUB 1KQSR 2XS7A 2RAQA 2O1UA 1QAYA 2W9BB 1Y3JA 2MDAA 1D1UA 1QZRA 1WACA 2FPHX 4O44B 4M95A 4BA1A 3CCTA 3NZKA 4EK2A 4J9UE 3W9IA 3QJLA 4G1IA 2IJNA 2M0GB 3AHPA 4DV7J 2GMJA 3N79A 1HI1A 4AXJA 5K8OA 2UU9J 1KSPA 1S77D 4NA2A 1V3RA 5K8NA 3TZYA 2ZBRA 3ZFVA 1VQ6S 1AYEA 5HP1A 1U1PA 2JEGA 2VB6A 3PO4A 2YWGA 3CB4A 4YB5A 2IA0A 3OVBA 3H90A 2J8SA 5IV3A 2GHWA 4P7AA 1RAIB 3V81A 4KFBA 3KWMA 2FJBB 1I94F 4USMA 4E8UA 5ETRA 2FDNA 4WP3A 1WORA 1UFLA 1KIJA 1I3OB 5DETA 2GHPA 1S1UB 3F0NA 4NMXA 2D9OA 4NZ7A 5C2GA 4HYMA 5B08A 1WC1A 2RF2B 3M6UA 1SJQA 3WBZA 1SV5A 4FZVA 3UR0A 5M2PA 3MUMP 2BQUA 1LWCA 4ILMA 3I96A 4LF5I 2FHJD 3RR8A 1CJTB 1UEKA 1JIHA 2DYAA 2MSTA 5F9NA 4DV6E 1VJWA 2QJ3A 4FP9A 3OVAA 4DV4F 4YR0A 2L08A 2D3ZA 1K1QA 1HLWA 2Z2LA 3RBXA 1QJHA 1FFGB 4M5JA 4V1Ak 2FJXA 1XNRI 2VFTA 4KHPE 4PWUA 3T1HJ 2O5DA 1X31C 1T02A 2MTLA 4K4XA 3NGUA 3V4IA 3NL0A 1SXLA 1P27B 3LO3A 4ZLLA 2HWHA 3OTOJ 1BQNA 2EKNA 1F5CA 3QFWA 4H4OB 3TJ9A 2W9CA 3DLKA 3NY0A 4DU7A 1HNZJ 2FIUA 2AW0A 2WOMA 1R0AA 4R5PA 1YWXA 3BGFA 4YHHF 2HFVA 2C2MB 4UW2A 4DV0J 2E9RX 3EVWA 4K4YA 2JVOA 2KB2A 3PW0A 2UXDF 3Q6NA 3TO8A 2W4PA 4DL0C 4OI2A 3W61A 1UP1A 5IT9C 4C2MA 3RUBL 4ZVUB 4ZJOA 1FFSB 3E51A 2IM0A 3J7AG 4MT1A 3MZIA 3DI6A 3OTDA 4DR2I 1SH0A 3SCKE 5MAOA 3R5GA 1K0TA 3HHDA 3PW5A 2I2YA 3QJPA 4WKRA 4NEYA 2BR2A 3H40A 5A0YB 3KYLA 2ZH4A 1SB6A 1S6QB 2QLBB 4R8UB 4MKBA 3U1NA 3GCWP 3Q8PB 4Y2IA 1HNZI 4X62J 1NK4A 1NXIA 1TELA 2BV3A 3P49B 2QYCA 4Q45A 1FJGI 2DNQA 3M2RA 1N33F 1HMVB 2ROGA 3W2WA 3CCUS 2GQCA 1M5KC 1TV6B 5DGAA 1B62A 3CXCR 1HBOA 2CJ9A 2QSWA 1O0PA 3D1OA 2IRUA 5GMDA 2V2KA 3W2VB 4KHMA 3W62A 4YB1P 1JJ4A 2LQ8A 3FCWA 4ICLB 3THPA 2FLNA 3KLIB 3EUNA 4HDGA 1F9HA 3BQ1A 4QIGA 5F41A 1K9MT 5D78A 2HFOA 4ZJLA 3CDWA 3TUZC 2E5LJ 1UPMB 2GIQA 2XMWA 1N34E 4JI2F 5L1LA 3M7ND 4OJ1A 4GKKI 3W8PA 3G87A 4DR3F 4KGKA 3RG6A 2UXBF 1RJJA 5LXRA 2XB2D 1HNXE 3U1KA 1KBRA 4JUZA 5B09A 1VK3A 4X64J 4C48A 3R2CJ 2LA6A 2V94A 4O4GB 4HYKA 2C3PA 2WSFC 4AQYF 2A0FB 4DR7I 4F3MA 4LF8J 2KO1A 2PT0A 3DFEA 1I5OB 1L3KA 5C0XC 4NL5A 4QWAA 3AQPA 4GC6A 2QMXA 4X65E 3I0SB 3GFHA 4NE9C 2ZH1A 1GEHA 2KT5A 5KFDA 4Q8FA 3HPOA 3DXBA 3W1YC 6AT1B 2PO0B 3KJFB 3LWMA 1U09A 3HSZA 1ZAXA 1Y4SA 2LECA 1KWMA 3C19A 3A8IA 2VQFF 3G6ES 2W01A 4DOZA 4EMDA 2QA4S 3MEEB 2KYXA 2CPDA 4DXLA 3DN9A 5A6WA 4ZLPA 3Q8QB 2ZJRQ 3VF0B 1S99A 1JWWA 4A8QA 4JYAE 4WFBQ 1F0XA 2VESA 3MFHA 4Z7CA 4YEAA 1HL6A 3U1YA 2JHEA 1R6LA 2WAQD 4H54A 1WHXA 4X4OA 4IZJA 2QA1A 3AAWB 3WU3A 1IQZA 4AXIA 1OYSA 2RIJA 3QATA 2MKYA 2HHHE 1WOSA 2W1BA 1OY6A 2I5JB 3MR2A 2LJPA 4IFDC 1HNWE 4DV2F 4DFPA 4GKKJ 2X36A 2JC1A 5JVHQ 2GJFA 3NNCA 4HH1A 5JEAD 4DR7F 2Y9HA 1FTCA 4XDCA 3CPWR 1CJUB 1TL3B 2FVPA 1AROP 2DH9A 1TKZA 1RTHB 1CQNA 1X4CA 3LGMA 4AT1B 4UOGA 5HQ8A 1VQMS 4CLWA 1Z4UA 3CW2C 5JEAA 4O3OA 1FKPB 4FN5A 4HY1A 2KU7A 2ROPA 2B6AB 1HR0J 2IESA 4F3OA 4DV1E 4LSNB 1O6XA 3SQGB 2F4FA 4N76A 2VASA 4RNNA 3G6XA 2E7XA 2EFQA 5KFVA 2DY1A 5ELWA 3M8ZA 2OHDA 3MM5B 1HNWI 4B3TF 1N5VA 3RGIA 2QEXS 2KI2A 3EPGA 1XMOI 2C2OB 3BYRA 4HTIA 3IBFB 5C0XE 4PQUB 1IBKJ 3CWVA 4U3DA 2XCAA 4DX7A 4ED3A 3IWXA 4LR7A 2VG6A 1NPPA 3ICLA 1SC1B 3NOGA 4J91A 4WYWA 4JV5J 4DL2A 1REVA 4RW8A 1OQ3A 4TXSA 3M9MB 1V3ZA 4I7FA 4F25A 1N36I 4QIWD 4DZDA 4TU8A 4LCFA 3OV7A 4WIQA 4TU9A 2X51A 4JYAJ 3ZXWA 1Q5VA 4DV0I 1LQ9A 2YKMA 4NI2A 4W92B 4LFBJ 1S9EA 4HH0A 1XNRF 4FYYB 4L76A 2CA9A 3AB4B 3FSXA 4LFAI 1HKAA 2IVFB 2VQEJ 3IBWA 2BR0A 3TA2A 1PJ5A 3RW6A 1JQGA 1R6YA 2AZ1A 3UHMA 4J5OA 2J7UA 2E5GA 2J9EA 2VQEF 1QUVA 3T1HI 2YNIB 1ZA2B 4ZVPB 4ID5A 2YQ0A 1T3OA 4DPWA 3GYNA 3BQ2A 4CH7A 4U8VA 3FUYA 1FNXH 1R0BG 5KFXA 2KDOA 4ITSA 4Q43A 4PXEA 3CMES 2CQ3A 4LF5J 2I1RA 3W8GA 3VQTA 4NXMJ 2NYHA 3GSDA 3H20A 2MHEA 1U1OA 2IJRA 5HN0A 1Q7LB 3IP0A 2HW3A 4JI2E 4FKXA 3NAIA 5G0RA 3M9NB 4HT5A 2ZNZA 3BH6B 5DM6Q 4DUYJ 1X8DA 4ETXA 4PWDB 4WTYA 1DTQA 2DR7A 4OHZA 1I1GA 2HIQA 3PHEA 3CJKA 3FZBA 1IBKF 4RU2A 1CLFA 1Z0BA 2AE8A 2B9YA 4ZKAA 2VONA 1OSDA 1S6PA 1UZHA 2N4DA 2YKNA 3KUHA 2V5HG 4LBPA 3N6LA 4X4UA 2HNZB 4MAKA 2A2DA 1T9TA 2ZDPA 5FLXU 2CZ4A 4WFXA 2WRMA 3DDIA 3PJWA 3CJSA 5EX0A 4F0KA 5CHCB 4QJVA 4ED0A 2UUBE 3CCZA 1NDKA 4GVBA 1SUQA 2BKOA 2RQMA 3EVMA 3PYDA 4XO0A 1JNZB 3O44A 2KJWA 3M8RA 3A8JA 4DV7I 5IM0B 1L3TA 3HKZD 1S0MA 1NZ0A 1HBNA 2WVEA 1ZH5A 5D4NA 4RNHA 2IFXA 5KFIA 4NCGA 4B17A 2XWXA 3HZGA 4IFVB 5KFPA 3J7A1 1AT1B 5KFUA 2VKRA 3QT7A 4QYZK 1B4SA 2GIFA 4B3TI 1UVNA 1CJVB 4OX9I 3D6HB 1C4AA 4WK1A 4LOMA 2UXBI 4WP8A 1QDUB 2BUNA 4J90A 4DV3J 5K14B 3GIIA 3E01A 5C7PA 3KMSA 4AL6A 3IRXA 3T1YJ 2WNRA 1FRJA 5LXYA 2QGFB 2OMOA 2Z4PA 4F50A 4DV5E 3O2IA 2O3DA 2B8PA 2E66A 5K20B 2CIMA 5EWEA 3BO2A 4ZPCA 1TK8A 1R6VA 4O3RA 1Z0GA 3PY8A 1WELA 3SZ2A 4NXME 3IBCB 5JEAF 2VQFJ 1XJWB 3HHEA 4H4MB 3JQJA 3DKDA 3MAHA 5KFOA 5D3GB 1CS4A 1YJUA 4NEZA 4KJIA 1E6YB 3I31A 2E1CA 4FVMA 2PGCA 4OL8A 2DT9A 2W2QP 1LFWA 1HWKA 4EWTA 2GS8A 2J8AA 4J9VA 4ID5B 1KHWA 2YNIA 3RZAA 1NB7A 1KTVA 4LF8F 3P6YC 2JE6A 1EARA 4IYQA 4FWDA 1PJ6A 2OLWA 2JEAA 3LANA 2X3DA 4MYUA 2MQ8A 3BPDA 3SCIE 1ZYQA 4P9SA 1S7IA 4WTOB 1B7FA 2Z5CA 1S1XB 5CAAA 4X64F 2IA6A 1U25A 1DFDA 2DITA 2XLJA 4WFZA 2VD3A 4R25A 2IOPA 3IG1A 3C15B 3V6HA 4QWCA 2BA0G 5D4PA 4DR3J 3DM2B 1T03A 1RWXB 4Q0BA 1B64A 2PNMA 3H5XA 2CJBA 4TU7A 3GILA 4OIXA 1AUDA 3KG1A 1WDTA 4LBHA 1REVB 4WXOA 4CLFA 2BQ3A 3EGNA 3K8VA 4DV5F 5KFKA 2E5LF 2DHAA 2HHWA 2CNKB 4DPYA 2HG4A 2DHHA 4DCPB 1Z5BA 2FTRA 2QL9B 5LSRA 3G6VA 4IRDA 5KFQA 3UD3P 4JV5E 3DLGA 1NRKA 1X4GA 1VQKS 1X4HA 1Z5AA 2ZBKB 3AD7C 2UU9E 2OEJA 2FYXA 2OPPA 3AXMA 2YNGB 1N33J 3ZZPA 1S1TB 4K4UA 4OKGA 1XMBA 4J9OA 1HR0E 1XEZA 4WYLA 4UQGA 4Y2KA 1KP6A 1A6LA 1FEEA 3Q2SC 2LXUA 2M52A 2V4JA 2AT1B 4HTJA 3M4XA 1WTBA 2R7UA 4B3SE 3RB0A 4DX5A 3RAXA 3ZNJ1 1UJ5A 2ASYA 5HSPA 1XNQE 3ONQA 2UVRA 4S0MA 3NMAA 3D5MA 3MPWA 1XTZA 2PEHA 2UUCI 4DSLA 1TFWA 3GWCA 4PXCA 2HQGA 2RD5C 3C14B 3KG0A 2IBKA 5DLFA 2UXDE 2DD8S 4I67A 3T41A 2P5VA 3KMQA 2UXDJ 5LSLA 3KNGA 4I68A 2I5JA 4KGZB 4UTGA 1YSJA 3QIPB 4MKAA 3W7BA 5J2MB 4YHHJ 4DV0F 2E9TA 2E5LE 4URGA 3DC2A 3O8WA 1JLQB 2HNZA 1GTHA 2FC8A 3OFFA 4GKJI 3OTOF 3H4BA 4JI3I 1J5EI 3JSBA 2BOPA 1IQTA 4DX8H 4DV7E 2WONB 4QYZJ 2FB0A 3ZTOA 5GAEU 2GHVC 2H48B 4KH1B 3OL8A 4LSZB 2KM8C 1VC5A 4KPYA 1S1TA 2GCFA 1T0TV 4J9PA 2VHGA 1WG5A 4DV4J 1U4BA 4Y2CA 5L1KA 4NCAA 4DJBA 2W7PA 1QVFR 4LF7E 4C9DA 2HKEA 4B3MI 4QOTA 1IKYA 1FT8A 2E7VA 1QSLA 3HHLD 1TZ0A 3SDEA 4P7TA 3CJ8A 3W9HA 2WP8B 2A18A 2H9ZA 4YOEA 1S79A 2J0XA 3DGPA 3LGHA 2VL1A 3OR1A 1ZM3A 1B0TA 3D1QA 3GE9A 5E2QA 1RT4A 2XMUA 3V5RA 3FQKA 1RAEB 3TRGA 4ZCLA 4P7VA 4EI2A 5CXTA 3PRYA 1YVFA 1HNIA 1RHJB 2BM1A 2E44A 3P5BP 2DGSA 4O4RA 1T03B 1I94J 1WHYA 3D68A 1S16A 4DUTA 3CJ0A 2YBVA 1J5OA 4NA3A 4Y0FA 2XZDB 2CJYB 1FRIA 1S1XA 2WB4A 4PXDA 2DO0A 4DR5F 4KIAA 3DLLQ 4ZVIA 3VVTA 1SL1A 1S9EB 5H9FJ 3ZZYA 2L9DA 2DR8A 1HYSB 2ZH2A 2QL5B 4DV5I 1MSWD 2C2NA 4OZ0A 4QW9A 3M6VA 1PKUA 1UDQA 4KB7A 5KOXA 3A13A 4KGXB 1FRHA 5U47A 2GVDA 5CABA 3DRXA 4DV7F 3RRGA 3CDJA 5K36F 3OXFA 3D6TB 3MXHP 1RWVB 1N88A 2LXFA 4U7UK 4LRFA 3PFOA 5L39A 3GZ7A 2W8KA 3QSYB 5KG2A 3J80C 2WCXA 3LAMA 2QLJB 1REGX 2HNYA 2CPJA 2XYGB 2RKIB 4LRBA 1TV6A 2XO7A 5DO2A 3CJQA 5M2RA 1DRZA 3LPEA 2OEMA 4K4VA 3CO0P 2ZC4A 2DNZA 4CT9A 4UOHA 4KR0B 3GCMA 4ES2A 2P6TA 1M5SA 2N4CA 3SI8A 3CMAS 1VBKA 2E7WA 1IVZA 1KQKA 1TL1B 5C0XD 3IRXB 2R7TA 2BJ7A 2IAJA 1A0OB 3ZNUA 2AGQA 4QU7A 2C1EB 3PJXA 3KHGA 4LSNA 4P52A 1M5PC 1U0HA 3LP0A 5THWA 2BA1D 2XHWA 3TA0A 4ANCA 2HVHA 4JI5I 4LFCI 3G4SS 1Z0CA 3M6AA 2BBEA 3DI6B 3CCJS 3D0GE 3J7Z5 3MAAA 4B3OA 4IZKB 3SCLE 4G1QB 4N7TA 1H38A 4NLXA 4O3PA 3EX7B 4C8YA 2KFZA 3EGZA 2VV5A 4C8MA 2RDIA 4HACA 3V6KA 2LDYA 4PEOA 1Q82T 4DR4I 4IFDA 4R5PB 1C2PA 1LWXA 1DQ9A 5ADZA 3KJVB 1RR9A 2X3GA 4A47A 5LMNE 3NOCA 2Z8QA 1HBUA 1X9WA 4OQJA 4YY3I 1T94A 1HNWF 1PSDA 5K14A 3TQEA 3VHQA 4K59A 4PZVA 1FKAE 1WHVA 1NHJA 1WSVA 2F5GA 2WW4A 4HHJA 1KQFB 1Q7YT 3H98A 3NNAA 1JLQA 5KT7A 5IWAJ 5JEAC 3FCHA 3W64A 5HJYA 3B8HA 3J81j 3E2EA 1RHQB 4OZ2A 3R5CA 3D0IE 1N32I 2HS3A 2E1PA 1NZAA 3HULA 4W98A 1BD6A 4X65F 4P75A 4ZVRB 4CLZA 1R89A 2B5JB 4PAAA 5HQMA 3BGOP 1W2BR 2N82B 1G4CA 3N01A 4NRTA 1JB0C 1SUQB 1OYDA 2A3JA 2LKZA 3UN3A 3D7SB 4KV8A 4J9RA 4DR1F 1EQMA 4JV1A 3FMWA 2EFVA 5KFRA 3C3LA 4DV0E 1SQFA 1ELOA 2J7KA 3Q1QA 4IG3B 2YWWA 3KNAA 1Y10A 1OPZA 3OL7A 3T5JA 1HBMA 4LF1A 3TAQA 2YH1A 1DY3A 2MJNA 3D6FB 4ELUA 3HHNB 2RH3A 2AYMA 1HWIA 3AOAA 4QNKA 3GJSB 3BV8A 3N4WA 9RUBA 1GMVA 4A8MP 2BXJA 2YTCA 4DUYE 1FE0A 2BJEA 3IAM9 4QIFA 4DUZJ 3BKUA 3PKYA 1IKWA 1Z5CA 2CXEA 3G8QA 4A8FA 2ZEJA 3C6UA 3HF5A 4PG6A 4TY9A 4UOCA 3Q8SB 2M8DB 1Y6ZA 4PR6A 2ZOGA 3HFZB 3CTRA 4ILLA 4O23A 3MUTP 1N0VC 4Z2XA 1WDDA 5JJBA 2GNKA 2ZVIA 3IGNA 3MMBB 3BBFA 2Z5BB 2ZNYA 2WP8A 1ZM4A 5LJ5Y 1K47A 2BE9B 3BN4A 2DRDA 2CFXA 1XR7A 1X7VA 3DM2A 3PR4A 1RQ0A 1H2VZ 1UETA 2BABA 3MR5A 1HPZB 4LSLA 2XM3A 3IG1B 4CZCA 3PR5B 1S12A 2DKOB 2HVEA 1YG0A 3RBEA 1VLOA 1Q81T 1N5SA 1W2IA 2NXCA 2WHOA 1I51B 2H5JB 1J5OB 2WBRA 4DCJB 4LF8I 2ZHOA 5IQ6A 1P1TA 3L09A 5DRPA 3P76A 4X66I 1HNIB 2ADCA 2VA2A 3I9ZA 2G2YA 2V69A 3C2PA 1B99A 3CE8A 4L3KA 4I69A 3NP5A 4Y6IA 3SFUA 4DR1J 1G1XA 4KKOA 1S6OA 2OPQB 8RUCA 1N32E 2H51B 2VPWB 2ZVSA 3I4HX 1NHVA 2AWZA 1NCLA 1W25A 1Y5NB 4MH8A 4NZ6A 3ZZ0A 4X65J 2K2PA 4FWGA 4JI8I 1JKHB 1ZOTA 2B4UA 4LPFA 2OD4A 3SEOA 3KK3B 1LV5A 1IKVB 1XERA 1VQ8S 3TUPA 2K06A 3GJQB 5CZXA 1LWEA 2HAFA 1EKRA 4C3KA 4DDFA 6FD1A 5ETSA 5IWAF 1U49A 4X4NA 3HKMA 3WU4A 3DHXA 2WONA 3DRSB 5CD4H 3M1VA 3SYZA 2Y8WA 3JQMA 3SQGA 3MMAA 1U48A 4DUZE 2JEAB 3CDUA 1GNKA 4ZJQA 1RBAA 2Y1LB 1Q4RA 2D3O1 2HMIB 1RA7A 1SI9A 4DL5A 1NSKL 2DNGA 5C0XF 4HEA9 3G9CA 2D41A 5BR8I 4JI0F 4PPZA 2Q1LA 2AU0A 2GMHA 1SC4B 1RWWB 5E3CA 2IM3A 3K5OA 3Q6MA 3BGUA 3N5FA 1MLAA 3MCMA 1XMOE 1PIEA 2RF2A 2FJEB 2NYIA 5BYQA 4OZ3A 3SV3A 2DR9A 4HACB 1WTFA 1Z2LA 3C14A 4ZN1A 5GADI 5CYJA 2R8HA 1NH7A 4F4ZA 2CWXA 4FVCA 2C28A 4FF3A 2Q6BA 3LTOA 4P2FA 5B0EA 1YX2A 1URRA 4WE1A 2Z2ZA 1RWNB 4LF9J 1U0HB 3FCVA 4L3NA 3O6QA 4ZN3A 2NLWA 3M85G 4BCAA 1KFDA 1UPPA 4LF9I 3N6MA 4WJBA 4A8YA 4X84A 1FRLA 4B3OB 3F56A 4ECXA 2I6WA 2F63A 4ZMMA 1F2GA 4CLLA 1R8AA 4IFDF 1RTZA 2XSFA 3ZM7A 1P42A 3MPUB 4OX7A 4RWWA 1XIQA 1MX0A 4N56A 1TMJA 3RYLA 1YHCA 1EX8A 2RKIA 1JXLA 2PO2A 4OYZA 4O44A 2MXYA 3J7ZT 2CKWA 1WEXA 4ZCMA 5K8PA 3P3CA 1F1BB 4YS2A 4OJGA 1QD1A 3Q89A 5F9LA 2KFNA 1OYPA 1HW9A 1PYTA 3BEGB 3KLIA 3HXMA 3LNUA 4XK8C 4CO5A 5ETVA 4TY8B 3BSOA 2PI5A 1N5TA 2OH2A 4DR5J 4KRWA 2Q3PA 5EKWA 4DI6A 3J7YI 1C1CA 4B3RE 2JVRA 3KHHA 5H9FK 2KRRA 3I5CA 1PC4A 2Q6CA 5IQQA 2PD1A 4YR3A 3ISND 3CCMS 2E9ZA 3SSRA 1X5TA 2R2RA 2PC6A 2RHQB 2HAIA 2AJ4A 3DLHA 3GPAA 4IH5A 4F4YA 1UL3A 1XQIA 1YITS 2FJVA 3W60A 5H9EK 4KT0C 5FDLB 3OQ2A 5A8KA 4K0KE 2QL7B 1HI8A 4Q2MA 2CVIA 2IVMA 3A8EA 2YNHA 4B08A 3W2VA 3KG4A 1BLUA 1OY9A 2D3UA 3KTQA 2ZUAA 1VC6A 2VOPA 3Q83A 4CO1A 5F8MA 1YJNS 3MECA 4LF8E 4O3NA 1JLFB 3JAMY 3OJSA 2JEFA 2RNEA 4WK3A 2ZITA 2E1MC 1VGYA 2CNOB 5HBMB 1FX2A 2QLFB 2KKHA 4G3IA 3E01B 5DZ7A 1W26A 3IN5A 3N28A 2BM0A 2MSSA 1Z59A 4Y65A 4WXWA 1HFEL 4M5NA 2DGXA 4RBUA 4UQTA 1KS2A 5IT4A 3NGTA 4JI8E 3NWRA 3DDKA 3KDNA 5KFTA 1N34J 2RU3A 1T9VA 2GX8A 3TUIC 1N32F 1CULB 4PYDA 5J2MA 4LUBA 2GIRA 3WC0A 3OLBA 1IBMJ 1CPZA 4KQVA 1FVQA 4JI5J 2EPIA 2FC9A 3J7AN 4QNJA 1IWGA 1CG2A 1S4EA 3R2DJ 1IM4A 1CJUA 1TL3A 4RW4A 4U6PA 4ECQA 5CYMA 1NSAA 4DQPA 1HNXI 1HNZE 2HGLA 2M70A 3BO4A 2F4VF 4YDXA 4JV5F 2JRSA 2M88A 1C1BB 1RT2B 3PX4A 1PC5A 3NBPB 1SQGA 2KYZA 1PGZA 2P8IA 4B9UA 2HHTA 2HHVA 2NN6F 5IC6B 4FW5A 2X1BA 3ADAC 1N4LA 4ZLJA 1FX4A 2VBYA 1K1SA 3HI9A 4C0BA 2ZH8A 1RP5A 2CJQA 4EFAC 1WG1A 2HBQB 1SKUB 5C0XB 3TP2A 1S6PB 2YKNB 2YPYA 2Z2MA 3PX0A 1A9NB 3HFVA 1ROFA 1RE1B 3EGWB 3SBMA 2R9LA 4KH0B 4WFAQ 4JI0E 2O1TA 2WVBA 2LEBA 5K36B 1LK7A 2GZOA 2O1PA 3SFGA 4NASA 2H1YA 4DV5J 1VDHA 4NXNE 3BZQA 3M2UB 3OFEA 2K3IA 2DB1A 1RTDA 3GJRB 4USHA 4JI8F 1ZXMA 4YP3A 2OEKA 3K1JA 3W66A 3BJYA 3PS1A 1RHMB 1C4CA 2IRYA 1UVJA 2BJDA 5GMKa 2JZ5A 3HVTB 3UD4P 2ADBA 1KOHA 3A3NB 4P2XA 1N0UA 4L72B 3ZZUA 4L74A 3LH2S 4O4GA 4ERDA 1N34I 5DROA 4FDFA 2R7RA 2HBYB 2KRBA 3HKWA 2PIIA 3DOLB 3FEYB 4DHVA 4IFYA 4BA2A 1FNMA 2XMVA 1KEKA 1R8PA 3TAMA 2G4BA 4ECWA 2HGMA 3ET6A 5LM7E 5I3QA 4JI6I 1RWOB 4ES1A 2YKAA 4X4PA 2HQIA 5AXKA 2JEBA 2ALZA 1S1VB 1VRTB 4DV6J 2GO4A 4DL6A 1AW0A 4CLTA 4LF7F 1GMWD 4CH0S 1KD1T 4G6VB 4KC5A 4AE5A 4LQ3A 3MEGA 3G82A 3PYEA 1MU2B 2LMIA 1X5PA 3UCUP 1VLYA 4ZVSB 2YX4A 2KXHA 3IS9A 4IO9Q 2JEBB 1WKLA 5I42B 1PYSB 5BR8J 1FXRA 4N77A 1YBAA 2UV8G 5CCLA 3NCRA 3ISNC 4N8OA 1NNDA 3KK1B 3NG8A 4LR8A 3ZKDA 1HMVA 5K36D 4AIDA 4USWA 4LF4J 2PNLA 4TYBA 3CD0A 4NZ0A 3Q22A 3T1YF 1WJ9A 4DV3F 2ROEA 1RAOA 4WWSA 1YIJS 1DURA 3MM5A 4J9SA 1E6VB 3H4DA 3MM6B 1RYSA 1NB2A 1VQ4S 4ZHRB 4WBFA 4DU8A 2FZGB 1QSSA 3FC9A 3AFGA 2JLEA 5ETPA 4NXMI 4KAIA 2BJ9A 5HATA 1K0VA 1IXKA 4B3SJ 5JEAB 2I38A 4L6V3 5JMNA 4WZQA 3HVWA 5AT1B 4ED7A 4EUVA 3TZWA 1KQGB 3W9JA 3MUVP 3R8YA 6FDRA 4B9TA 3MAQA 3HLUA 5IM0A 2B7BB 4ED2A 1HHTP 2LFVA 1TL7A 2MKCA 2CQ0A 4EYIB 2CDQA 1HHQA 3LQVA 3TYTA 3DRRA 1JLAA 1UKUA 2OI2A 3LP1B 5L46A 4RW9B 3KHLA 1QM9A 4DV6I 5HK4A 4H4OA 4TQSA 1BQNB 4N41A 1KR4A 4URQU 3A1YG 5H1SV 2OSRA 2BW7A 2C2KB 1WSRA 3MM8A 4M1KA 3NS7B 5LSOA 2UVVA 1WNEA 3L7ZB 3QNWB 3GIMA 4ZVEA 4OO1F 4J9KA 1O51A 4MKVA 1N36J 1FKOA 4DUYF 3IC1A 1VQPS 3J81C 3CJKB 1LK5A 4DV3E 1FRMA 3H2LA 1RT7B 2F3JA 2XTJP 1CBKA 4J7CA 5HI7A 5SZTA 4DPTA 3VTIA 3K85A 5BYRA 1BQMB 2GAGC 5LMUJ 4CP5A 4NXMF 5L3JA 1IJEB 4M5HA 1YJRA 1HW8A 5KFZA 1E6VA 1YGYA 2EWHA 4OI4A 2HNDA 4LF5F 3SQOP 1RK8A 4F4WA 4RUHA 2YQ3A 2LYVA 3GB0A 4U96A 1HD0A 3IGVA 3TUJC 2PN6A 5E41A 5DG7A 5D0EA 4UY8T 3KLHA 2VPZB 4ZPVR 1AB8A 3P5TL 1F3VA 1VQSA 3PRBA 1CJKA 1S49A 2DH8A 5HO4A 1VQYA 4Y2MA 4ALZA 3FBEA 3L9ZA 4YY3F 5L1JA 2MZQA 3JQKA 3NMRA 2FVSA 2MJUA 4X66F 4IQXA 3HJVA 5B0DA 3IM9A 4A8WA 1MWQA 4LFBF 2W4CA 1Q16B 1RLDA 4JYAF 3IS9B 3PTWA 3H4LA 1IUJA 2FHKA 4WF9Q 2R7SA 1NPKA 2EC2A 4NXNF 4Z37A 4C4WA 3DOKB 3DOMB 5C42A 2MGZA 3G96A 3O1LA 2DY9A 4ZCIA 1EP4B 5LL6d 2L48A 4C11A 3TJAA 4ES3A 3UW1A 1WHWA 4MU4A 1S76D 4YDDB 4ICLA 3T1YI 1RA6A 4JI7E 4IFYB 3MR3A 1T3NA 2V2VA 4ZK7M 1OJ4A 3MFIA 3LALA 4RW6B 4B3TJ 1F3FA 2B3TB 4J9LA 2Q66A 1Y4UA 1XMQI 3LA0A 3MPDA 4OZ5A 3TANA 5FLXC 2F9DA 2X1AA 4OYWA 2NR0A 2M8HA 1TQLA 1RWMB 3MCSA 3N6NA 2HEKA 4CO2A 3MHYA 1HR0F 4DX6A 3J7AM 2HLUA 1X4FA 5LMNI 3M2UA 1LW2B 5D15A 3HHKA 4LREA 1D3WA 3L3CA 2ZHBA 2BZ2A 2FD2A 3GP9A 2E5HA 2NS1B 3OFHA 1X4EA 4AL7A 2V67A 4A8XA 3FEXB 5EWGA 2XY5A 1JXVA 1MMLA 4NX9A 3D54A 4IOBA 4DLGA 1PVGA 4DR7J 1XNQI 2QC3A 1WF2A 2R7QA 1TKZB 4GKKF 3OPKA 4JI1F 1B3TA 2JC0A 3F73A 1MN9A 2YWFA 3HM9A 4B9NA 4LQ9A 4ENOA 2VODA 2R7VA 4ISAA 4ZVQB 5HMXA 1U7LA 1AZSB 4MTPA 3QGPA 2DNLA 5E7OB 4DG1B 2KZMA 2O1WA 4DUZI 5F0WA 1IBLI 4LF6E 1WC6A 3M7VA 4ZP9A 3P4UB 2AP6A 2EK6A 4DG1A 2W9CB 1XR5A 4QWBA 1PAEX 4JV2A 3B4MA 4M8LA 2B4VA 4DSEA 4ED6A 1LKZA 4RPFA 2AJ1A 2XCPA 4B9LA 2J9CA 4ZVTB 3UWTA 3KOAA 2RDDA 2HHUA 3PCOB 1F60B 1TFYA 3THTA 3EM1A 4USIA 2MZ1A 1HQUA 2V9KA 5DLGA 5B0CA 2CPHA 4OI3A 1GH8A 4BHQA 3G8TA 1VRUA 3PACA 5F8LA 3ZKBA 3X3UA 2FLPA 2DCLA 1H2TZ 3BR9A 3MR7A 4MU1A 2GQQA 2HQFA 3QO9B 2DIVA 2ZM6F 4HKQA 1KVKA 2C2EA 3NNHA 1FWPA 2VQEE 1TMMA 5FWKA 1TUVA 1Z0TA 1IKXA 3IA0A 2RT3A 3R27A 2DGQA 3Q86A 2YH0A 1V5IB 3MPYA 2EBEA 3R5BA 1FF2A 3K89A 4OYXA 4DPXA 5IV4A 2XZWA 5AE3A 2H65B 1QE1A 2D1CA 3ITHA 4C97A 3AA8A 2XY6A 1NJWA 2KT2A 4DV3I 2F4VI 1PKPA 4DZ6A 4C8NA 1C0TB 2ZFHA 4J37A 2F4VJ 2UXBJ 1R6MA 1S0VA 3NCQA 4Q7AA 4QPTA 3OR2B 2C2RA 2ZJQQ 4FW7A 2OPQA 4JI2J 1JLBA 3K8WA 2MZTA 3K5PA 4K4ZA 4JI2I 3EDQB 3QIDA 3QGIA 4PU9A 3O3LA 4PABA 4CTAA 1EP4A 4FS2A 1WWHA 2HVDA 2F40A 4ED8A 1UW4A 2PEBA 2NXJA 3CULA 3FDSA 3SSSA 1MMDA 2JEIA 1TL5A 3MM7B 3EXCX 5C24A 2UUBI 2AKWB 4DV4I 1D9FA 3A12A 2CQHA 4HI2A 2ZBCA 3FBFA 3U7JA 1XNRJ 2DXDA 2QA2A 1OSCA 3UDCA 3ELHA 2JWNA 5CD4A 3DU5A 5GAEI 3FRZA 1K8AT 3SIPB 4X62F 3M2RB 1RBOB 3PS3A 4LFAE 3HVTA 4B3TE 1H72C 1U6FA 2XMKA 5EN1A 1EQ0A 1RXOB 3D6MB 1K44A 3HD2A 2YKQA 4P73A 2W2PP 1S1WB 4OFZA 2QIFA 4TVAB 3DOMA 3DOKA 2MGZB 3V6JA 1HARA 1DZ5A 5C5JA 5AE1A 3EJMA 2MHNA 4NA1A 1YHQS 1BHNA 2LQBA 1H7XA 3R5JB 1IKWB 3JSMB 3TQ1A 1YJ7A 1TAQA 2IIHA 5IT0A 1R0CB 2RQCA 1N6QB 4K8RA 4LVNP 1KC8T 2DTJA 3J7YU 2BRLA 3NKYA 1EKSA 1VHFA 4FXDA 2NPFA 4DR1I 4P10A 1KOOA 3PEJA 4DSKA 3SSQA 3UD5A 3CMQA 3IR7B 4U3BA 1NDLA 1HNZF 2MB0B 2I0XA 1M1KT 1FTRA 8ATCB 3D3CJ 1M5OC 1PILA 4JOUA 1R0AB 1XNQJ 1HI0P 4I2PA 5EX3A 1BC6A 4A48A 2DVIA 1PCAA 5DRQA 5F0UA 2FVQA 2BA9A 3DLEA 5KG7A 3A3OB 4P74A 4Q2LA 4WFYA 3T1HF 1N33I 3KLEB 2LDIA 4PKDB 1L3SA 3FQLA 5HMZA 1RHYA 3P3GA 2BKPA 1N52B 4JB8B 1S10A 2F8MA 1BQMA 1R27B 4IFDD 2L9NA 2FLOA 3TNVA 1OS5A 1LEOA 1EB0A 2NUUG 2Y1RI 2VBWA 2HVIA 1CJTA 2IM2A 2ZWOA 3LW5C 4DV2J 2ABYA 1LW0B 1YJVA 3HJFA 5BJRA 2CGEA 4OI6A 4OZJA 3QAUA 1MROB 2CQ4A 5AXLA 1E3PA 2HHHI 4B3MJ 5KFHA 1N54B 4DR1E 3F44A 3QRRA 2OP5A 4PRFA 2RMLA 2X7IA 1XMOJ 5KFFA 1YZ6A 4BWMA 4CO0A 4CDIA 1A7GE 5DDOC 2EI5A 2FZCB 3KK3A 3LF0A 1VIXA 4P6QA 2YWKA 4LR9A 1WD6A 4ZPTR 1FRKA 2MQNA 3VCDA 4I6WA 5KG1A 4IH6A 2J76E 2DNOA 4ZP7A 4OYIA 4E2FB 3JB9k 1Q5YA 2YNHB 8AT1B 1S6UA 3Q8RB 2UU9F 2DCUB 2OUGA 1NM2A 4KE5A 2FY1A 2UUBF 2HS4A 2LQ9A 4P71A 3R7SB 3HZEA 3LP0B 4NYPA 1N33E 1A6FA 2C38A 3MEGB 4JBCA 2QV6A 4C0OC 4F4XA 2AJQA 2IDEA 4OHYA 3PW2A 1NJXA 5KT4A 1TUWA 3VZIA 3MCNA 2UUCJ 1MMNA 1DQ8A 3I4PA 3MD1A 2R7WA 4X62I 3UCZP 5CQGA 3KK2B 1S9FA 4F8RA 4F67A 2Q2EB 4RW6A 2IC3B 1GFWB 2IYGA 4LRDA 2FHMA 2RRNA 1M5VC 1G3OA 1NDCA 1WC3A 4OZ1A 2HHHJ 2FLLA 3K5MA 1QTMA 3KK1A 4B9MA 2ZOFA 3I82A 3WZ0A 3E8OA 5J2PA 3CDIA 4DR2J 1HNVA 3M30A 3QSIA 1BQXA 4OYOA 2DHSA 4RWXA 5E3QA 3P96A 4PRXA 1XBWA 5I42A 2VG5A 1H7UA 2VDIA 3GSIA 3SMZA 3ZTSA 2MLXA 2O01C 3N5BA 4HT7A 1U1MA 2KTQA 4WUCA 2UV8A 2L3MA 5SUHA 4USUA 1XK8A 3AJDA 3OJUA 2B4PA 2OAUA 2NUHA 4DFJA 2C37A 4X4SA 4ZS6A 4EBDA 3V4MA 1KN6A 5GAHU 4CIOA 2LLZA 4GO5X 5A8RB 4KHPJ 4ZITA 4EGLA 2HZCA 3CJ5A 2HHSA 3B4TA 4R1FA 1JLBB 3R6LB 3CD6S 1C0UA 5DRKA 3T6BA 3CNQP 2OMLA 4DR6E 4FYXB 3QYYA 2OJ3A 3DOLA 4AIMA 2DGWA 4BA2B 4L73A 3NGRA 3MCOA 1RWPB 3MEDA 4X62E 1RT1B 4GC7A 3PM9A 4OX9J 1QE1B 1JLCA 1RAFB 5T14A 1JLEB 3E3XA 4IG3A 4DLEA 2AJ2A 4OO1B 4DF4A 2ZBQA 3VVUA 3EZOA 5IT9Y 5IXUA 1HD1A 2NN6A 1RT2A 2HHPA 1RTDB 3DRYA 2YPZA 3AD8C 3QT6A 4DV1J 1KDNA 4C8ZA 3W5XA 2O66A 2B5JA 4JI6F 1MROA 1PG5B 1NEEA 1YKWA 3MWBA 2BE2B 3QO9A 3X1LB 5I4MA 1LW0A 2CNNB 2CQBA 2G2ZA 2G9OA 3D4JA 4HVZA 3CF5Q 2DNMA 3QT8A 1FXDA 4J9NA 3T9NA 2BA1G 3UDLA 2K1RA 3DRPA 2IMWP 3KDOA 4V19J 3Q2TC 1BGXT 1ZPVA 3TX8A 3TVYA 4DR7E 2KHDA 3TZXA 1GXTA 2JNJA 4GKKE 2VQFI 1RAHB 3MM8B 4DS5A 1D0EA 2WB1D 2AD9A 2A2CA 4Y00A 4B3RJ 2UXCF 1FJGE 3OSPA 3EYZA 4E98A 4YMEA 5LL6R 3OHAA 2LEPA 3T1HE 4OLPA 2GGPB 3DLEB 2AHOB 3IMQJ 4ZVGA 1AZSA 1QAXA 4CLYA 1PJ7A 3PFEA 3ILLA 3RJMB 5EGYA 1ACMB 2QFIA 4CO4A 5EUHA 2YXLA 4RO0A 1JKHA 1UW9A 2EG1A 4RW4B 4C6AA 5F8GA 4UZBA 4F2SA 4YY3E 4TLQA 1N48A 1KLNA 1ZXNA 1TKTB 2XYHB 1M1HA 1SQEA 5IFMA 3VAHA 3PJ9A 1KVJA 5T7LA 3KLFB 1L5UA 2Z30B 4HR2A 2IVYA 3ILIA 2IJFA 4RBTA 4LCGA 2W4DA 3NCPA 2EW9A 2RJZA 5CZVA 1N6QA 1VRQC 4W4MA 2NREA 5KG3A 2V4JB 4DR6J 4DQIA 2IAJB 1X0FA 1KLMB 1FD8A 2FHOB 2GO9A 4PG7A 4U67Q 3CCRS 2AX1A 3GG0A 4QQBA 5J1EB 2QFJA 5I3UA 1K73T 1TVRB 1S97A 2GQ2A 3IRWP 2VJUA 3RB4A 4JI7F 1AA1B 3UPFA 2HK2A 1JMTA 2OSQA 2JX2A 3VQSA 1OYEA 4OI0A 2UXCI 1R3NA 4YN3B 1J5EJ 3PS2A 1ZA1B 4DQSA 4JI0I 3JYTA 2MMYA 3FVYA 3P45B 4GKJJ 3UQSA 4M5LA 1Y9OA 5B7WA 4KQZA 4NBQA 5KT3A 1NSPA 3I9V9 4CNZA 3AXKA 3M8SA 1CC8A 2WVFA 1T95A 3EDRB 3J81U 1RTJB 1MWYA 2DNYA 3DMJB 2Q43A 4U9RA 1FKAF 2PFDA 2PO2B 4NLUA 4TNOA 1PO6A 2IMOA 2JFKA 3DCAA 3GJTB 2ZKUA 3C6UB 2BYCA 3NAHA 3FFIA 3ENVA 3L95X 1S1VA 1VCTA 1Y3KA 2V8DA 5B0GA 3JAMU 3OFGA 1NKEA 3PRDA 1D8YA 2ACMA 5HMWA 4ZP6A 2WSEC 3G2XA 2YWHA 3U1MA 3KLVA 4M5GA 5ETTA 3AY0A 3OR2A 3TAMB 1X9MA 1IBLJ 4AL5A 2GVZB 1C1CB 2A1BA 2G2OA 2W25A 3R7BB 4FXVA 4ZPDA 4CI0B 2PI4A 4DR4F 4PPDA 4XTTA 2WBMA 2Q79A 3ITHB 4WE1B 4X66E 3RBZA 1RB0A 3FNNA 4KY3A 2IHR1 4HLBA 4NLGA 3ZZTA 5D3GA 3MDFA 2ZE2A 2PMZD 4AUKA 2VFVA 1VS3A 2R2SA 2MQOA 3T9ZA 3T5LA 1VC0A 1DJ0A 3WIVA 2F1DA 3US5A 2C3UA 1FDDA 2IDLA 2ZC3A 3ENWA 5IS2A 5KT6A 2XLKA 4TLRA 3QT5A 3PIPQ 4K4WA 3ULHA 1JLGB 1VRUB 3ZZZA 2V2QA 2Z57B 1WF1A 3H5UA 1LXNA 4D3HA 3EZ5A 1HWJA 1HQUB 5K36A 1RT6B 1VOMA 3MURP 2DBBA 2B43A 1XXEA 3TARA 2ZM6E 3MOZA 3SV4A 2FVRA 2MY8A 2UUCE 1FDBA 2LU2A 2RUSA 2QE5A 3F41A 3GIKA 4CM2A 3DRSA 4CM0A 1H3DA 3IFEA 2OKQA 2FZKB 3HK2A 1USUA 1PBUA 1UWBB 2XSJA 3NBPA 3PRVA 1CVJA 1C1BA 4YB6A 4AQYJ 2GFFA 1JLAB 2C3MA 4HDHA 3IAS9 7FDRA 2BANB 2W9AA 4N8NA 2F8HA 3S1TA 1UEUA 2FGOA 3K5NA 3RR7A 5GAGU 1E3HA 1UFKA 4AM3A 2JLGA 1LXJA 4PG5A 1L3VA 3EMTA 1CULA 4UUWA 5ETMA 3ILJA 1UVKA 2DXEA 5E5NA 2XHCA 5C25A 5KFWA 4EYHB 4E0DA 3S01A 5F3ZA 1XMQF 2NZCA 1S59A 1DTTB 3NLCA 4DEZA 5ETNA 5B0AA 1RHKB 3CUNA 3BSNA 1FJGF 3C6TB 1RU1A 4F04B 4ZOSA 5GVQA 4B3ME 1RTIB 2ZD1A 2E1AA 2Z58B 3CCVS 4JI4E 2V8GA 1KONA 1IWAA 2UZAA 3OSNA 1NK0A 4J9MA 4OYMA 2M3DA 3VGVA 3MECB 2F65A 1YTYA 4JI4I 2CVEA 4F36A 5FLXQ 2HHQA 1WI8A 3KXDA 2VG7B 1TP7A 3BDEA 1RT3B 3VV2B 2BDPA 3P3EA 1EAYC 4TKTA 2DJWA 1YZ7A 2Z5BA 3FSYA 2R4FA 3HVAA 3SCJE 5KFCA 4DFKA 2XG8A 1Q8BA 5FDLA 5A8KB 4QWEA 4NLTA 3IM8A 4UF4A 4JV5I 1TK5A 1B63A 4QIVA 1UDSA 2B4OA 4RUCA 4KGVB 2OTLS 1RWUA 2JL9A 3IWNC 3L4BC 1VBZA 4OX6A 4RW7A 4ZLNA 2AYGA 3DNCA 1NJIT 4XTJA 3W5YA 4AQYI 1KRPA 3EPIA 2YY3A 1Q53A 2GAHC 4QCLA 3P06A 4NI2B 3AODA 3LP2A 5DZ6A 5A2QQ 2N7CA 1AXQA 3QGGA 3Q0AA 4TY8A 1IBKE 4RLEA 2RQKA 4RKUC 4ECZA 1WOOA 2BW2A 1JJ2R 2UUAF 1E6YA 2AJ0A 2ZM6I 3D67A 5E3AA 2MEWA 4JI4F 2GMLA 4OI1A 4MFBB 2FHJA 3D3BJ 3UN2A 1RAJA 4R0EA 1FCAA 3VAIA 1IKYB 2MKSA 1MWZA 1SJ3P 4C8KA 1Q95G 3QZ7A 2KT3A 2OD6A 5L1IA 2MZRA 3GONA 5D77A 1YJWS 2NXEA 4FF2A 2EXUA 3N0VA 4EZ6A 1S5ZA 1NSQA 1SBRA 2JJ4D 4C3LA 2WSCC 3ZTPA 2L41A 3Q23A 1XN9A 3MPVA 4AYBD 2QMWA 2XULA 5E0OA 4X4QA 3B4DA 2BVZA 3W63A 4LFAF 2X1GA 3CEDA 4IUFA 3HMJG 5HQLA 2FJWA 1VQNS 3NXZA 1FJGJ 3R97A 2VQFE 3O5TB 4PWWA 5B0FA 3K59A 1NHIA 4BLGA 2VA3A 4RW9A 4C7QA 3BGRB 2HRTA 4QBUA 1TUGB 5C2CA 5L9NA 1UEVA 5LOQA 4EEYA 4F2RA 2QTWA 2R8GA 4LF6J 3D66A 3GTYX 4EO8A 2OPRA 2QX0A 3AJ1A 1FFWB 1BKNA 3H59A 2WZ1A 3UVJA 2Y1JA 2AIRB 2Z2YB 3K17A 1HIYA 3S6EA 3UNGC 4CLUA 5KFMA 3I5BA 3DLBA 2J0SD 4ZHRA 1OY8A 3GLLA 3EICA 2UVWA 1KTQA 1U2CA 3CCQS 2QA4G 4K0KJ 2DK2A 3TJ8A 4ZIWA 2HIYA 1O8BA 3Q8VA 3WU5A 3R1LA 2V8PA 2OPPB 1U1NA 3KJVA 1NH8A 3MR6A 5AXNA 4BC9A 3DLGB 2QO3A 2OELA 2RSQA 3EZUA 1NMEB 1U02A 2E29A 5IT9U 2M7SA 2ZBPA 1YLXA 2HNYB 4K2XA 2HSEB 5D8HB 5E33A 3B82A 5GAHI 4M5DA 3D28A 4JI3E 1HHSA 4TQRA 1NUEA 2J7WA 1SC3B 2DHXA 2MQQA 5HROB 2V68A 2YKOA 2EVZA 1SJRA 1IR0A 1ZPWX 3UE2A 3C66A 5DDPC 2HBZB 3H8YA 4USKA 4DPUA 4O3QA 1TKDA 3POTA 2XNQA 2FUG9 5L38A 1Y00A 2CQGA 1BUXA 2PNZA 3HJCA 3OHBA 5D6GA 4UY85 2HQ3A 2FGCA 3DD6A 4ZP8A 2CQPA 2XNRA 4RW7B 5DRRA 2HWTA 4WCEQ 2Y0SD 2LXIA 4QZVB 3TR5A 1IBLF 2HYIB 2VH7A 3CJ3A 1Z1ZA 3R7NB 4IKAA 3M7NG 1FI4A 3CIZA 3M8PB 5JEAE 3DMJA 4RZRA 1RHRB 3T19A 4ZPBA 1S9GA 2J65A 2R3VA 4DV2I 4FW9A 3DGPB 4LF5E 4XPCA 3BKTA 1LOUA 2B51A 5AJ3F 3QAEA 1CS4B 2NN6E 3EGVA 4IFDE 2DIUA 4PYAA 1VR6A 3JYTB 3L7UA 2EK1A 4H4KC 3L7OA 3LWLA 1N34F 4USTA 4JI6E 1G2EA 2DR6A 1N36E 4OHWA 3P8BB 5ETKA 2NN6C 5DJBA 2BJ3A 2ZDOA 1Y5LB 2HLTA 5DNXA 3ISZA 3AH6A 3NRBA 5FJ4A 4NLSA 1WUUA 2BOAA 5J1EA 2O1VA 4FYVB 2JEJA 2B9XA 4MU0A 5K36C 2B9WA 1APSA 2QN6B 5A0YA 3D1HA 3CCLS 4JI1E 2NCKL 2YVSA 4I2QB 1UJ6A 1XR6A 4B3RF 2B6AA 4JP8A 1J27A 4USJC 3NWGA 3BPSP 1CJVA 3UCGA 1FK9B 5GAGI 5IT9Q 1EA6A 1RYRA 2R8KA 2HGNA 1ZAWA 4LFCJ 1T9WA 1V6HA 4FNHA 4K5SA 1BWEA 3M6WA 1SJFA 2F9JA 1B7YB 1RU2A 2ZH3A 5CYMB 2QRRA 4LIRA 1RSCA 2VFRA 3MMCA 5DQIA 3FMBA 1N5YB 1FO1A 3H7HB 4NLQA 4EZ9A 1SKRA 3G6YA 5CA5A 2GQ0A 2NZ4A 2K7JA 2HMIA 2PA8D 3Q8YA 4KSEB 3A4TA 4LF2A 4IZJB 4Q5VA 4DSFA 3B6BA 3WX4A 3KHRA 3JAMC 2UXCJ 3M1VB 4NPOA 2M9KA 3KFWX 2VJVA 2AYEA 1RT6A 4YHHE 2NSCA 2K1RB 3DRPB 5A76A 4NLDA 4ECYA 4IDKA 2UUTA 1VK8A 1GQEA 4NOHA 5HLFA 1N5YA 1FJ7A 1IKVA 3W3SA 2KVQE 5G0RB 5KG4A 3M9OB 5BR8E 3M8YA 4LVOP 4O0NA 1SL0A 2R8IA 4IFDB 4DR6I 2ZWPA 2PO1B 2N7YA 5BYSA 2CRLA 4CWBA 2HRUA 3NGSA 3U1LA 4MIWA 4OMFG 4CYUA 1SH2A 5LT5A 3TI0A 4JI6J 3CT9A 3GMGA 4EU0A 2XWYA 4KKOB 1M1GA 4WFNQ 3V2UC 4MDTA 1FK9A 3M85D 2UXBE 2MQLA 1HNXF 2P2CB 1IR1A 1RT1A 1X4BA 3DGVA 3M05A 1ZAVA 1AFIA 2RRAA 4O0IA 2CG8A 1YRUA 1GMUA 3MM9B 3TWZA 3ZO7A 1SJ4P 2F4VE 1KHVA 4WU3A 3D9BA 1D8ZA 2Y0BB 4DQQA 3K2YA 3ZTRA 1X5OA 5EWFA 3HP6A 3D2WA 1WC4A 2QYGA 1XC9A 4QYRA 1Y11A 3K58A 1NJZA 1GX5A 2B0GA 4MQYA 4GRSA 5BXIA 1FDNA 4F4KA 4C3MA 2G0JA 3QWPA 4Z7YA 1HPZA 2FY8A 4LSLB 4X4TA 4KHPF 1QUPA 1VYAA 5HAOA 4N47A 4DPOA 2J0QD 2DGVA 1R43A 4BC7A 4XPEA 4WZMA 2W9BA 4WP9A 4KGMA 2YQ1A 2UP1A 4J3DA 5HROA 1VBXA 3MMBA 3MEKA 2XLIA 2VDHA 4TYAA 4DUYI 2CG9A 1RT3A 3NS5A 2H5EA 4MMOA 4OHXA 5D0GA 3OTEA 4JI3J 3WQPA 3BM7A 1Y4ZB 1IN0A 2OFGX 3C15A 2PO4A 3NGKA 3PXGa 4DR2F 4K50A 4K2JA 5GMEA 5FLXY 1NKBA 4PQUA 2CPIA 2JE6B 2CAJA 4M5MA 2DNHA 1S0OA 2HHHF 2EG2A 4RNMA 3FZ2A 2UXDI 1L3UA 1Q79A 2HURA 1FE4A 3HSJA 1Y5IB 1NLKL 1ZM9A 2HFUA 5B0BA 2R2UA 1UA0A 1IBLE 1S6QA 2ZJPQ 4FW4A 4FPRA 3MM9A 4YFUA 2UUCF 1AUSL 2POKA 3HT3A 1HBMB 1FA0A 3T3FA 2JOQA 1T8EA 1R7IA 2COLA 4JI7I 2KH9A 3GFZA 4RBVA 2RB7A 1HWLA 4EBEA 4ZVOB 1FKPA 2OO4A 4NRUA 4USVA 1EJ7L 2DRBA 2VQEI 4JI5E 4KHPI 3HFKA 3I87A 5RUBA 1TKTA 2RQ4A 2AEFA 3DXSX 2UUBJ 1HBNB 4B3SI 3BH7B 4F02A 2BANA 2FJAB 2J9DA 5LMNJ 4FS1A 3FRYA 5KFAA 3BGRA 5J1NA 1Y60A 7AT1B 2P9CA 3A3PB 2V0NA 3DLKB 4IDKB 1RUSA 3AD9C 3I56S 5HLFB 2C39A 4LFBE 4IO1A 3WX8A 1CC7A 3M6XA 1XMOF 2I8EA 3FGVA 1MG7A 2IYIA 3TEGA 4F3QA 4X4RA 2KG1A 3MMAB 3MGJA 2A6OA 1T9YA 3B78A 3UN5A 4IR9A 4B3MF 4PRVA 1RLCL 3OVSA 2YKPA 3T1YE 5EHHA 3PNIA 3QIPA 3J80U 1HA1A 2BMBA 1DTQB 2OPRB 2C39B 5DG9A 2QLWA 2GJIA 4OHVA 4ZVHA 3U02A 3MMCB 5K9FA 3PX6A 3IO1A 2PSZA 1D9AA 2ERRA 4YUDA 4FW6A 3OTOE 2HZAA 2KHCA 1FXLA 2DNRA 4DS4A 5HL7Q 4AQYE 1S1UA 4UZCA 4GVBB 2RDJA 1YRTA 2ZKTA 1G6BA 2GJ2A 4OX9E 3GLJA 2W2OP 1VQ5S 3JTNA 1U24A 3JAMQ 2J9DE 4QWDA 1VHIA 2PE8A 4NLVA 4ZPWR 3S7RA 2VPXB 2G0IA 2ALYB 5AE2A 3V6DA 3ILOA 4I2QA 2QZ8A 4FYWB 2RRBA 2CDRB 3H5YA 1H2UX 4FF4A 4FW3A 3ENAA 3P3DA 1U2FA 4HHUA 3BBCA 5D0HA 1YRXA 2CQIA 2DISA 3IR6B 2E5IA 1FJEB 2BACA 2V4RA 4U7UD 1TAUA 1P1LA 1V3SA 3I5AA 4X4VA 4NLPA 3FFIB 4XIUA 3W5ZA 4ECSA 3CDEA 3LGNA 2H54B 7FD1A 1SKSA 1SIZA 2V6AA 4MK8A 4RU9A 1S1WA 4C8OA 1BXNA 2G1DA 2WW8A 1V9OA 3GIJA 3R5DA 1QY7A 1UZDA 3L7PA 4XDDA 1LWFB 4BBYA 3VAGA 1ZZNA 1NBEB 3PZPA 5F8IA 1N56A 1HNVB 4DR5E 4LRAA 2VG7A 3GCXP 3M8PA 3ZZOA 2WK4A 2IM1A 3CWJA 3EVOA 3LP2B 4ECTA 3OL9A 1UA1A 2DXFA 2KXFA 3TA1A 5K36E 5ITHA 3KK2A 2GC8A 2V2ZA 3BN7A 2ZH5A 2ZH7A 3H5SA 1GX6A 2D3OR 4QIEA 1QTNB 2PNZB 5I3UB 4V19X 2D7SA 2DRAA 1ZM2A 2HPUA 3ENQA 3T6JA 4WIIA 1R31A 5J1PA 5A2QY 1ZETA 4CTAB 1UTAA 1RCXB 1Q1KA 3OR1B 5C25B 1GMWA 2MLZA 3KLFA 4ETZA 2C42A 2NN6D 2V50A 4ELTA 4RUAA 4I3HA 2VFSA 1OYRA 4CYUB 1VBYA 4U7CA 2VG6B 3QFHA 3SDEB 5KFEA 2PO1A 3BO3A 4KHRA 5DNLA 4PXBA 2VBZA 3JSRA 2E5LI 2C2ZB 3NEKA 2VC1A 4R0JA 5HJXA 4IOAQ 4PQAA 3GV5B 2WNRB 5HVHA 3J81Y 5GADU 2P9EA 1HQ2A 2XMTA 5D0RA 3T5HA 3PV8A 4YB7A 4P72A 4LF4I 2YWEA 3I0RB 4KYZA 1GK8A 1W7WA 3KLGB 4JI1I 3M2VA 4DR5I 1IBMI 1PBAA 1S57A 3D0HE 3KUEA 5F8JA 4M94A 4DR4E 3T1AA 2UXCE 4WPAA 1U26A 3KRNA 1HBUB 3HX9A 2ZM6J 4LF7I 5LMNF 3UVJB 1QVGR 4YQWA 2RE1A 5KG0A 2DR5A 4GMKA 1NK7A 3OTBA 2UUWA 2BJ8A 2NSBA 4RNFA 4FXWA 1U8SA 3CO9A 1U6ZA 2BE2A 4JV0A 2IY5B 1Z0EA 1NK8A 1NZ8A 2PO0A 2P6SA 4MIAA 1SL2A 2U2FA 3CJTA 1GXUA 3CC2S 1P8GA 2FVCA 2RHSB 3CCWA 4G1QA 1WKJA 3N9UC 1TTHB 4OYPA 4BWJA 1U8WA 2VKZG 2LEAA 3FJ2A 4OYBA 2D69A 2RS2A 4Q0BB 1YH8A 4IZKA 4LF9E 4KFBB 1VQLS 3FBBA 1YK9A 3MF5A 4XAKA 2EFOA 1I94I 4GVLA 3K7RA 1R8HA 3LOUA 3TVZA 1RKIA 2EEYA 4DBQA 5E3PA 2CUYA 1TL1A 3HHLC 1RGVA 1OIAA 2J6UA 4JI1J 2HS0A 2XBPA 2ZBIA 4DL4A 2X1FA 1FVSA 4JI3F 3OTOI 2JFDA 2MZJA 1JNRB 4A46A 3GYXB 2XI3A 2DPJA 2O3ZA 4MU3A 3MTKA 3KKFA 3BSAA 4QR1A 1XHKA 5HVFA 5IOLA 2ILYA 2ZE2B 4C0HA 1RZMA 3MI7X 2HVZA 3M8WA 4ATNA 2KZZA 5L8RC 2D74B 5HANA 3FKBA 2GVDB 5J2PB 2ZH6A 4FBTA 5DDRC 2EC0A 3HO1A 5KG6A 4URLA 2E5JA 3QRQA 1J2VA 1NKCA 5CH7B 4FPIA 3RAMA 1YDLA 2HK3A 1FESA 2IC3A 5MLCV 2K3KA 2Z5EA 4LT6A 4H4KA 2XMMA 3EXYA 3I6PA 1HWUA 2XY7A 2KN4A 1X0PA 4A8KA 4YHHI 1X5SA 1PAUB 2MKHA 5H9EJ 3GG1A 1HNXJ 9ATCB 4CH1A 3POTB 1U1RA 3JSYA 3Q24A 3M8QB 5KAKA 3PYFA 2C38B 4RNOA 1QAIA 2BR2B 1RT4B 1UAWA 4DR3E 3PVXA 4LJMA 2JH3A 4NXNJ 4RW8B 3GQCA 5A2QC 4M5DB 5AXMA 1RADB 5KOWA 4DUZF 5DG8A 2G1HA 4FNIA 4GQUA 4H4MA 1FRXA 2K8GA 1N8RT 4X66J 1S4FA 4MJKA 5I3PA 3OTCA 3GIRA 5KT2A 1S48A 4YY3J 2AGOA 3CCES 2WOMB 3AJ2A 1VQ9S 5K8MA 4LCHA 2MKJA 4PG8A 2LQJA 3BR8A 5KFNA 4DSJA 3DLJA 1G7CB 1UFWA 3C6TA 1KLMA 1WG4A 4A8OA 4R8UA 2UVUA 1M5HA 2MY7A 2W2MP 3QJJA 2N3OA 3IWLA 1Q78A 2Z0GA 1S0NA 2CQ1A 1NK6A 1H73A 4ZA1A 3I32A 5LMUF 4Y2AA 2LP4A 1SC6A 2Y8YA 5T7LB 5KFYA 5IWAE 1T7PA 1F5AA 1GXLA 3ETOA 5D4LA 1Q8IA 2IBOA 2V34A 4G65A 2HFZA 1IBME 3C16B 2F7VA 4DR3I 3L7ZA 4Y34A 4LFCF 4OO1E 2GA7A 5A2QU 2OTJS 1N36F 1FHTA 3QZ8A 1H7SA 1VI7A 2ZZTA 3HSDA 4B02A 3HDSA 1EIYB 1F5BA 2HQDA 1P9YA 4DF8A 2LCWA 2R7OA 4A8SA 3G86A 3CC7S 3BBBA 4NLYA 1RAAB 2DGTA 2JSXA 3V4IB 3H1CA 4OV6A 1Y0HA 3R6GB 1JLCB 5KFLA 1R8CA 1OQ6A 2CG4A 2ATLA 4U8YA 2HFSA 3UO0A 1FWLA 5CCMA 1LNQA 4ZCKA 3Q8UA 4Y28C 4B9VA 4QR0A 4FYDA 5K5MA 4ZVFA 3CJRA 3UR3C 4IG0A 1GTEA 5F8HA 5J2QA 5DM7Q 1T05A 4F0HA 2DNKA 4OJHA 3HT0A 5CYQB 2YNGA 3QWUA 4EBCA 2I9SA 3AB2B 4PWDA 2FJDB 1LWCB 2YX1A 4ELVA 1U1KA 2UUAI 2R8JA 2DEIA 2C3OA 3U27A 5HVGA 5JVGQ 4B3SF 5KFGA 2APOA 1HR0I 2BKNA 5AJ3J 2ZH9A 3MM6A 2SXLA 4I64A 3OBIA 3BKFA 5IZHA 2BE7D 1RHUB 2JDJA 3TEHB 1U1LA 2ZZNA 2AGPA 1XNQF 2H3EB
chains in the Genus database with same CATH topology
4DV1E 1N0UA 1RREA 1N34I 3J81Q 2Z5BA 4DR2E 1FNMA 1N36I 1I94E 4JV5I 1B63A 4JI6I 4DV0I 2Z5CB 4AQYI 4DV2E 4LFAI 4MYTA 3PYEA 3P06A 3T1HI 5A2QQ 4DPWA 4NXNI 4DV4E 1HNWE 1MU5A 2ZM6I 3ZKDA 2PNLA 1D6TA 4JI2E 1EI1A 3GONA 4IZJD 1Z0BA 4DV1I 4X65I 4DU8A 4UT4A 4NXMI 2A2DA 2VQFE 1NHIA 2UUBE 1DARA 4DV6I 2OI2A 3PYDA 4DV7I 1BKNA 4M1KA 3K17A 2R42A 3QT7A 3ZZUA 4B3TI 2F4VE 2UXBI 1USVA 3J81C 2EFGA 4DV3E 3K85A 4DPTA 5L3JA 3WU5A 2V8PA 4DV5E 1Z0GA 1IBKE 4NXME 1J5EE 3B82A 4FWGA 2GS8A 4USKA 4DPUA 4B3RI 1KTVA 4FWDA 1H74A 3H4LA 4HXZA 4MYUA 3HJCA 2Z5CA 2IOPA 1FI4A 4X64E 4JG4A 2VF3A 3T1YI 4JI7E 4DV2I 2R3VA 4FW9A 2V2VA 1OJ4A 4JI3E 4LF5E 1XMQI 4DPYA 5FLXC 1Z5BA 4JI6E 1N36E 4ED4A 4JV5E 2ZBKB 1Z5AA 5LMNI 2UU9E 3J7AM 1XMQE 1WUUA 1HR0E 2O1VA 4B3SE 4JI1E 4WUBA 1PVGA 1XNQI 1XNQE 5IT9Q 1EA6A 2UUCI 3PYGA 1IBLI 4DUZI 2O1WA 2UXDE 4LF6E 4RPFA 4UTGA 1Z0WA 2HKJA 2E5LE 4GKJI 4IZJB 3JAMC 2IOQA 4JI3I 1J5EI 3ZKBA 4DV7E 2VQEE 1KVKA 5FWKA 1N32I 1Z0TA 5BR8E 4LF7E 1XNRE 2HKEA 2UUAE 4B3MI 4DR6I 4DPXA 4DV3I 2F4VI 4JYAI 1PKPA 2UXBE 3V2UC 3V5RA 1ZM3A 4JI2I 2BM1A 4PU9A 1S16A 1VISA 4LF6I 4ZVIA 2UUBI 4DR4I 4DV4I 4Z7YA 4DV5I 2XEXA 3WU6A 4B3SI 4LFAE 3J80C 4DUYI 2CG9A 4YHHE 4B3TE 1H72C 1NHHA 5GMEA 2UXDI 4LF5I 1IBLE 1ZM9A 2HFUA 5LMUE 4P52A 4DR1I 2NPFA 4JI7I 4FWHA 4JI5I 4LFCI 3M6AA 4LFCE 2VQEI 4IZKB 4JI5E 4KHPI 2E1RA 4HACA 1N33I 4GKJE 4N3OA 2UU9I 1RR9A 1HK7A 4LFBI 5LMNE 4LFBE 4YY3I 1FKAE 1MG7A 1NHJA 2WW4A 3B78A 4PRVA 3B8HA 1KKHA 3T1YE 2CGEA 2DEJA 1U2RA 4X64I 3HULA 2HHHI 3LPSA 1IBKI 4DR1E 4WUDA 2X7IA 4DR4E 3OTOE 4AQYE 3J80Q 2CZ9A 4OX9E 4DV0E 1ELOA 3JAMQ 2J7KA 3Q1QA 4LF4E 1Z0VA 1N33E 1A6FA 4DUYE 1Z5CA 4X62I 1FWKA 1IBMI 1Y6ZA 2Q2EB 4K0KI 1N0VC 5IWAI 5LMUI 2Z5BB 4DR5E 1ZM4A 1K47A 4GKKE 4PRXA 1H7UA 2O1UA 1QZRA 4WUCA 2V2ZA 4LF8I 1ZM2A 4R1FA 4X66I 4DR6E 4I3HA 1N32E 4X62E 4P7AA 4JI8I 3ZZ0A 4USMA 1KIJA 3QT6A 2E5LI 3F0NA 4HYMA 3WU4A 3J7AG 3PRYA 4LF4I 3D4JA 3QT8A 1UEKA 4DUZE 4DR5I 4DV6E 4OX9I 2UXCE 4DR7E 5BR8I 4LF7I 1XNRI 2VQFI 4KHPE 1FJGE 2A2CA 1Z0EA 2PNMA 5LL6R 1XMOE 3T1HE 1PIEA 4HACB 4DU7A 4JI1I 1NZ0A 4IZKA 3LTOA 3Q6NA 4LF9E 4YY3E 1ZXNA 5IT9C 1I94I 4DR2I 4LF9I 4XTJA 3OTOI 3ZM7A 1HNZI 2BV3A 1MX0A 1XHKA 2HK2A 1FJGI 2UXCI 1B62A 3LNUA 1HR0I 4JI0I 5GMDA 4URLA 1Y4UA 4B3RE 2HK3A 2Z5EA 4YHHI 1N34E 4GKKI 2AJ4A 1Z0CA 3Q6MA 3PYFA 1HNXE 4DR3E 4K0KE 5A2QC 4DR7I 4X66E 4LF8E 3ZZTA 4X65E 2ZITA 1Y4SA 3QT5A 4EMDA 2BM0A 1Z59A 2V2QA 4DXLA 4JYAE 4JI8E 1H73A 4Z7CA 2ZM6E 2UUCE 5IWAE 4IZJA 4KQVA 3WU3A 2V34A 1S4EA 1USUA 1IBME 2HHHE 4DR3I 2LJPA 1HNZE 1HNXI 1H7SA 2X36A 2HFSA 1FWLA 4FN5A 4HY1A 2GQ0A 4JI0E 2O1TA 2UUAI 4B3ME 2DEIA 1HNWI 4JI4E 4NXNE 1XMOI 1ZXMA 3CWVA 3K1JA 4JI4I 5FLXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 E;  1N0U A;  1RRE A;  1N34 I;  3J81 Q;  4DR2 E;  1FNM A;  1N36 I;  1I94 E;  4JV5 I;  1B63 A;  4JI6 I;  4DV0 I;  4AQY I;  4DV2 E;  4LFA I;  4MYT A;  3PYE A;  3T1H I;  5A2Q Q;  4DPW A;  4NXN I;  4DV4 E;  1HNW E;  1MU5 A;  2ZM6 I;  3ZKD A;  1D6T A;  4JI2 E;  1EI1 A;  3GON A;  1Z0B A;  4DV1 I;  4X65 I;  4DU8 A;  4UT4 A;  4NXM I;  2A2D A;  2VQF E;  1NHI A;  2UUB E;  1DAR A;  4DV6 I;  2OI2 A;  3PYD A;  4DV7 I;  1BKN A;  4M1K A;  3K17 A;  2R42 A;  3QT7 A;  3ZZU A;  4B3T I;  2F4V E;  2UXB I;  3J81 C;  2EFG A;  4DV3 E;  4DPT A;  5L3J A;  3WU5 A;  2V8P A;  4DV5 E;  1Z0G A;  1IBK E;  4NXM E;  1J5E E;  3B82 A;  4FWG A;  2GS8 A;  4USK A;  4DPU A;  4B3R I;  1KTV A;  4FWD A;  1H74 A;  3H4L A;  4HXZ A;  4MYU A;  1FI4 A;  4X64 E;  4JG4 A;  2VF3 A;  3T1Y I;  4JI7 E;  4DV2 I;  2R3V A;  4FW9 A;  2V2V A;  1OJ4 A;  4JI3 E;  4LF5 E;  1XMQ I;  4DPY A;  5FLX C;  1Z5B A;  4JI6 E;  1N36 E;  4ED4 A;  4JV5 E;  2ZBK B;  1Z5A A;  5LMN I;  2UU9 E;  3J7A M;  1XMQ E;  1WUU A;  1HR0 E;  4B3S E;  4JI1 E;  4WUB A;  1PVG A;  1XNQ I;  1XNQ E;  5IT9 Q;  1EA6 A;  2UUC I;  3PYG A;  1IBL I;  4DUZ I;  2UXD E;  4LF6 E;  4RPF A;  4UTG A;  1Z0W A;  2HKJ A;  2E5L E;  4GKJ I;  3JAM C;  4JI3 I;  1J5E I;  3ZKB A;  4DV7 E;  2VQE E;  1KVK A;  1N32 I;  1Z0T A;  5BR8 E;  4LF7 E;  1XNR E;  2HKE A;  2UUA E;  4B3M I;  4DR6 I;  4DPX A;  4DV3 I;  2F4V I;  4JYA I;  1PKP A;  2UXB E;  3V2U C;  3V5R A;  1ZM3 A;  4JI2 I;  2BM1 A;  4PU9 A;  1S16 A;  1VIS A;  4LF6 I;  4ZVI A;  2UUB I;  4DR4 I;  4DV4 I;  4Z7Y A;  4DV5 I;  2XEX A;  3WU6 A;  4B3S I;  4LFA E;  3J80 C;  4DUY I;  4YHH E;  4B3T E;  1H72 C;  1NHH A;  5GME A;  2UXD I;  4LF5 I;  1IBL E;  1ZM9 A;  2HFU A;  5LMU E;  4P52 A;  4DR1 I;  2NPF A;  4JI7 I;  4FWH A;  4JI5 I;  4LFC I;  3M6A A;  4LFC E;  2VQE I;  4JI5 E;  4KHP I;  2E1R A;  4HAC A;  1N33 I;  4GKJ E;  2UU9 I;  1RR9 A;  4LFB I;  5LMN E;  4LFB E;  4YY3 I;  1FKA E;  1MG7 A;  1NHJ A;  2WW4 A;  3B78 A;  4PRV A;  3B8H A;  1KKH A;  3T1Y E;  2DEJ A;  1U2R A;  4X64 I;  3HUL A;  2HHH I;  3LPS A;  1IBK I;  4DR1 E;  4WUD A;  2X7I A;  4DR4 E;  3OTO E;  4AQY E;  3J80 Q;  2CZ9 A;  4OX9 E;  4DV0 E;  1ELO A;  3JAM Q;  2J7K A;  3Q1Q A;  4LF4 E;  1Z0V A;  1N33 E;  1A6F A;  4DUY E;  1Z5C A;  4X62 I;  1FWK A;  1IBM I;  2Q2E B;  4K0K I;  1N0V C;  5IWA I;  5LMU I;  4DR5 E;  1ZM4 A;  1K47 A;  4GKK E;  4PRX A;  1H7U A;  1QZR A;  4WUC A;  2V2Z A;  4LF8 I;  1ZM2 A;  4R1F A;  4X66 I;  4DR6 E;  4I3H A;  1N32 E;  4X62 E;  4P7A A;  4JI8 I;  3ZZ0 A;  4USM A;  1KIJ A;  3QT6 A;  2E5L I;  3F0N A;  4HYM A;  3WU4 A;  3J7A G;  4LF4 I;  3D4J A;  3QT8 A;  1UEK A;  4DUZ E;  4DR5 I;  4DV6 E;  4OX9 I;  2UXC E;  4DR7 E;  5BR8 I;  4LF7 I;  1XNR I;  2VQF I;  4KHP E;  1FJG E;  2A2C A;  1Z0E A;  5LL6 R;  1XMO E;  3T1H E;  1PIE A;  4HAC B;  4DU7 A;  4JI1 I;  1NZ0 A;  3LTO A;  4LF9 E;  4YY3 E;  1ZXN A;  5IT9 C;  1I94 I;  4DR2 I;  4LF9 I;  4XTJ A;  3OTO I;  3ZM7 A;  1HNZ I;  2BV3 A;  1MX0 A;  1XHK A;  2HK2 A;  1FJG I;  2UXC I;  1B62 A;  3LNU A;  1HR0 I;  4JI0 I;  5GMD A;  4URL A;  4B3R E;  2HK3 A;  4YHH I;  1N34 E;  4GKK I;  2AJ4 A;  1Z0C A;  3PYF A;  1HNX E;  4DR3 E;  4K0K E;  5A2Q C;  4DR7 I;  4X66 E;  4LF8 E;  3ZZT A;  4X65 E;  2ZIT A;  3QT5 A;  4EMD A;  2BM0 A;  1Z59 A;  2V2Q A;  4DXL A;  4JYA E;  4JI8 E;  1H73 A;  4Z7C A;  2ZM6 E;  2UUC E;  5IWA E;  4KQV A;  3WU3 A;  2V34 A;  1S4E A;  1IBM E;  2HHH E;  4DR3 I;  2LJP A;  1HNZ E;  1HNX I;  1H7S A;  2X36 A;  2HFS A;  1FWL A;  4FN5 A;  4HY1 A;  4JI0 E;  2UUA I;  4B3M E;  2DEI A;  1HNW I;  4JI4 E;  4NXN E;  1XMO I;  1ZXM A;  3CWV A;  3K1J A;  4JI4 I;  5FLX Q; 
#chains in the Genus database with same CATH topology
 3CSK A;  3GFY A;  2BA0 D;  4ER8 A;  1JLE A;  2HWI A;  1S9G B;  2DPI A;  3CDA A;  1RRE A;  2J5A A;  4KO0 A;  4CNY A;  1KVI A;  3J81 Q;  4DR2 E;  1V5V A;  3JXO A;  1UVI A;  4LF4 F;  5DGB A;  3K57 A;  3UNY A;  1C0U B;  1I94 E;  3RRH A;  4C11 B;  1M90 T;  1UDN A;  2Z5C B;  2B8Q A;  1Q8L A;  5DQH A;  2XQC A;  5C24 B;  2XMA A;  3G82 B;  2YKM B;  2RU9 A;  5FII A;  4RX6 A;  5A8W A;  5BR8 F;  2ASD A;  2AQ4 A;  4MYT A;  1QLN A;  2CZV C;  3VAM A;  5A8W B;  2HFN A;  2V8V A;  3OXG A;  3PDN A;  2VIC A;  1RTJ A;  1BMQ B;  3GU0 A;  3AT1 B;  2HZV A;  1UWA A;  2DHG A;  5L9X A;  4LF7 J;  4TN2 A;  4DV6 F;  4DWI A;  4PCQ A;  3H25 A;  4NXN I;  4DV4 E;  5ETQ A;  3KJN B;  3B54 A;  1PYO B;  3BGL A;  4CLS A;  3LUY A;  4F7V A;  2WTF A;  2BQR A;  1MU5 A;  1F2H A;  1S72 S;  1WEZ A;  3VGU A;  1YQH A;  2GO8 A;  2KVI A;  3AOB A;  3GFX A;  3PIO Q;  1T11 A;  3EWG A;  3R1H A;  1GAO A;  1D6T A;  1IJF B;  2NXU A;  3H42 A;  4K0K F;  2KJV A;  1MN7 A;  1MW7 A;  2RS8 A;  1NPR A;  5KTQ A;  2XS2 A;  1HQE A;  2W24 A;  2XGQ A;  1EI1 A;  1RTI A;  2ZD1 B;  3TX0 A;  3BSC A;  1UDO A;  3R9L A;  4ANE A;  1UMJ A;  2DO4 A;  4IZJ D;  2IER A;  4DV1 I;  1MNE A;  4JI8 J;  4X65 I;  4UT4 A;  2HBR B;  5JXS A;  1RT7 A;  4HI1 A;  1H0H B;  3I55 S;  1FJC A;  2CPY A;  2V4Q A;  4LF6 F;  2CAD A;  3PKM A;  4IFV A;  2MKI A;  3A8K A;  3JTO A;  4NCG B;  3WDO A;  1DQA A;  1Q86 T;  1RTH A;  3BRE A;  4NLW A;  3VR1 A;  2VFU A;  1P9Q C;  3BYP A;  3H2U B;  1I6J A;  4ED5 A;  4P2S A;  4WU2 A;  1DAR A;  2NXN A;  5J2N B;  1VMB A;  4BDP A;  5DDQ C;  3RB6 A;  2N3L A;  3DYA A;  2GGP A;  2ZUG A;  2AF6 A;  2ZOM A;  4LFA J;  5T41 A;  5KG5 A;  3DYA B;  3OW2 R;  1FDA A;  3VAJ A;  2CWK A;  3QBC A;  2K7K A;  4ID8 A;  1RWK B;  2AEM A;  2KM8 B;  2DH7 A;  4PG4 A;  1NAQ A;  2ASJ A;  3AQO A;  3MD3 A;  2AV5 A;  2IPO B;  2R42 A;  1EET B;  1NO8 A;  1EZZ B;  1SJ1 A;  2CYY A;  2VC0 A;  4OV1 A;  2PMH A;  3VWS A;  4BS2 A;  1BE4 A;  4IRC A;  2DNN A;  1USV A;  4IQM A;  2EFG A;  3MEE A;  3UFC X;  1JLG A;  4I6Y A;  2MPU A;  2LA4 A;  3TW0 A;  3OUY A;  4JI5 F;  3H0P A;  5HMY A;  3M32 B;  1IBM F;  4DL7 A;  1N32 J;  1NU4 A;  3LAK A;  2MKK A;  2V8H A;  2XMJ A;  1SCJ B;  1LW2 A;  3R3T A;  2W8L A;  4ZIV A;  2KFY A;  4IOC Q;  2EFN A;  2U1A A;  1RIS A;  4JI4 J;  1M0S A;  3QPI A;  2OFH X;  3KLE A;  2UUA J;  1B0P A;  4MFB A;  4Q8E A;  1U6B A;  3DU6 A;  2L9W A;  2NQP A;  3CVK A;  2EBG A;  2HQC A;  4ECR A;  1J5E E;  1SKW A;  4IR1 A;  3MTJ A;  4Q44 A;  4DN9 A;  4MIB A;  2QG9 B;  3MED B;  4K5R A;  3OL6 A;  1IBC B;  5LJ3 Y;  2KG0 A;  3JS9 A;  3VGT A;  3QLH A;  1FEH A;  4I6A A;  1BY9 A;  3K5L A;  3ZTQ A;  1NDP A;  4B3R I;  2DGU A;  3EE3 A;  1CSJ A;  4OZN A;  5G4D A;  1WKK A;  1NHK L;  1YJ9 S;  1H74 A;  1YBT A;  1ZS6 A;  2JT2 A;  4HXZ A;  1RI7 A;  5C42 B;  3MOJ B;  2CJA A;  4DSI A;  1WEY A;  1TR0 A;  4RUB A;  4URS A;  1AFJ A;  2GO3 A;  1Q0N A;  4M5K A;  2H4W B;  3PEH A;  4I7F B;  2B56 A;  3ET6 B;  4X64 E;  4JG4 A;  2VF3 A;  5EDW A;  2BX6 A;  5F8N A;  3ETM A;  1TL4 A;  2XO6 A;  3QLH B;  2C22 A;  2ZZM A;  1HBO B;  2M4M A;  3AOC A;  1NJY A;  4NYZ A;  3W2W B;  1RBL A;  1WC5 A;  3T5K A;  2J0W A;  2VUG A;  3KLH B;  2BEF A;  3BB5 A;  1DAX A;  2BJ1 A;  3HCX A;  1NK9 A;  3GME A;  3G8S A;  3CJ2 A;  3PG9 A;  3THV A;  1KNZ A;  1TVR A;  1F9F A;  2OPS A;  2YX7 A;  4ED4 A;  2CQD A;  4F4A A;  1H7W A;  3MM7 A;  4KBI A;  1XMQ J;  4FBU A;  1U47 A;  1DLO A;  3GYG A;  2MYF A;  4K4S A;  1XMQ E;  2HRY A;  3J80 Y;  3AA9 A;  1T9U A;  4DL3 A;  1X4D A;  3RTV A;  1DTT A;  2G0C A;  3FBC A;  4OX8 A;  1IM6 A;  4LBI A;  5F3T A;  3S8S A;  2MQP A;  4NWB A;  5KFJ A;  3SXL A;  4FF1 A;  3LPY A;  1QSY A;  1T9X A;  2EFP A;  4NML A;  4NLR A;  2Y3Y A;  2Z56 B;  2QLX A;  4HL9 A;  2XGP A;  2V9W A;  4WUB A;  4D3G A;  2YNF B;  4OZE A;  5C0X A;  4OYA A;  1RAB B;  1ULR A;  4ILR A;  4UOF A;  4C98 A;  2ACY A;  4W90 B;  4M5I A;  1X4A A;  1TKX A;  3PYG A;  5KFS A;  1Y5Y A;  4QR2 A;  4FKY A;  1O5J A;  1SIW B;  1UWB A;  2DNP A;  2XSJ B;  2ZHA A;  2RIL A;  2XYP B;  1RKJ A;  3BDP A;  1B0V A;  4GO7 X;  1WF0 A;  1CEZ A;  3PW7 A;  5KFB A;  1IKX B;  4DV2 E;  3DDN A;  1TKX B;  3K0J A;  2VPY B;  1TL7 B;  1ZTW A;  1Z0W A;  2HKJ A;  2OGU A;  4C8L A;  3WHI A;  5IC4 B;  3TAP A;  2CJK A;  2H5I B;  3JTP A;  4HHH A;  3QMQ A;  1FD2 A;  2HHX A;  2VOO A;  2CQ2 A;  3UDE A;  1OO0 B;  3CCS S;  2D9P A;  2IOQ A;  2AMC B;  4OLO A;  4F26 A;  2W7A A;  3CGI A;  1XWL A;  4QW8 A;  3ZZR A;  4JI0 J;  4OO1 D;  3M2V B;  1SV5 B;  2PFF B;  3KLG A;  1FER A;  3HHL A;  3VAF A;  2BRK A;  2IRX A;  4L75 A;  4A4J A;  1DLO B;  3QQC D;  1VIO A;  2EKY A;  4LIW A;  3GV8 B;  2B7C B;  3I0S A;  2VIH A;  1JX4 A;  2CNL B;  2NN6 B;  1XNR E;  1HQE B;  4DFM A;  2UUA E;  4UUX A;  4DR4 J;  1WOP A;  1X9S A;  3KUG A;  2ILZ A;  1JLF A;  3V81 B;  1UVM A;  3RU0 A;  3TZZ A;  1RCO B;  3HVR A;  4CQ1 A;  3VAL A;  4I1T A;  1JXE A;  3RB3 A;  4JYA I;  1F6T A;  4I0W A;  4I4B A;  1P6T A;  2R2T A;  1Q8K A;  2LVW A;  2YNF A;  4F0M A;  5EL9 A;  2AZ3 A;  2GW8 A;  1UJ4 A;  2GVZ A;  2WVC A;  4CLP A;  5M2U A;  4WKY A;  4CLK A;  2CQC A;  3VGS A;  4NLO A;  4CO3 A;  4K4T A;  4RR5 A;  4NCB A;  2PMW A;  5DQG A;  5A8R A;  3FEZ A;  3KJQ B;  2XS5 A;  3JSM A;  1MU2 A;  1H98 A;  1VIS A;  4LF6 I;  3MMJ A;  2F1F A;  1IR2 A;  1ZBT A;  2G13 A;  1F9E B;  4ED1 A;  2C2D A;  1TK0 A;  1YJT A;  2W7O A;  1ICE B;  3TOQ A;  2AEJ A;  1RT5 B;  1VRT A;  3HSG A;  2VBX A;  2ASL A;  1KFS A;  3BF4 A;  1UCN A;  3RW7 A;  4DN0 A;  3WC2 A;  2VG5 B;  4CT8 A;  2RUG A;  5FD1 A;  2XEX A;  1D9D A;  4GKJ F;  2B9E A;  5E3R A;  1J5E F;  4IRK A;  4CCH A;  1ITP A;  2AJF E;  3WU6 A;  4NYO A;  4AND A;  4X2B A;  2LU1 A;  2NPI A;  4Y3C A;  4JI7 J;  1NK5 A;  4PUO A;  1UVL A;  3CD7 A;  1CQM A;  4ZDN A;  4PUO B;  4KO0 B;  4ZPA A;  3PO5 A;  2CJX B;  3RRK A;  2OIH A;  2MZS A;  1LWF A;  1R8B A;  3IR5 B;  1NHH A;  4DR6 F;  4AFF A;  4CRJ A;  1DHM A;  1RT5 A;  1D09 B;  2HND B;  1QAJ A;  3QGH A;  4B9S A;  2A10 A;  2ATC B;  4I56 A;  1B70 B;  3DHW C;  4LRC A;  2R7X A;  5A6P A;  3M32 A;  3ZC4 A;  1VFJ A;  5LMU E;  3H2V E;  3CDB A;  2F8E X;  2XI2 A;  1S7H A;  3PHT A;  4K7Q A;  3OXL A;  3UDV A;  5CYQ A;  1U45 A;  4IG0 B;  4FWH A;  5J2Q B;  3OT9 A;  1C0T A;  1CJK B;  4LFC E;  2WVD A;  3V6D B;  5JUM A;  3C46 A;  3BQ0 A;  1X60 A;  2E1R A;  4P2M A;  5KT5 A;  1YI2 S;  3QRP A;  4GKJ E;  1RAG B;  1YBU A;  2QSF A;  3PW4 A;  4N3O A;  1WC0 A;  4KV8 B;  2UU9 I;  5J2N A;  1ZZF A;  3GV7 B;  1HK7 A;  1GT8 A;  4LFB I;  2XC9 A;  2QT7 A;  2V63 A;  1LFP A;  3HHL B;  1RAC B;  4IH7 A;  3OLA A;  1T05 B;  3C16 A;  2J6T A;  3CC4 S;  4KTQ A;  1URN A;  3UI3 A;  2VZ9 A;  3OUY B;  1FNO A;  2CPX A;  4DCO B;  4G1P A;  4IS9 A;  3W65 A;  1H6K X;  1FKO B;  2XZT B;  1EET A;  1OPI A;  3FK4 A;  1KKH A;  3R5A A;  1U0S A;  4U95 A;  1BWV A;  4DV1 F;  2J6S A;  4O3S A;  2DEJ A;  1U2R A;  3C8Y A;  3I0R A;  4KPC A;  3RAQ A;  1OMS A;  1VJQ A;  4X64 I;  2MLY A;  1OWX A;  1RDR A;  3BS9 A;  3LPS A;  1JJC B;  4M63 A;  1IBK I;  5HBM A;  4OX9 F;  1LWE B;  2P9G A;  1WI6 A;  1Z2Z A;  4OJ3 A;  4J9Q A;  1JK9 B;  1HNW J;  2KXN B;  3DRR B;  3LP1 A;  4I2P B;  4LMZ A;  3J80 Q;  2CZ9 A;  2GV1 A;  2CPF A;  2A6M A;  3NS6 A;  4LF4 E;  4OO1 C;  3FSI A;  3OD2 A;  5ETO A;  4OZL A;  4YR2 A;  4MK7 A;  3RBD A;  1Z0V A;  4ECU A;  4ECV A;  3MAA B;  1SVD A;  5HP1 B;  2KL8 A;  1DBD A;  2VU5 A;  1U1Q A;  3GR0 A;  4RL1 A;  4N5S A;  4WUD A;  3CIM A;  3VAK A;  4EO6 A;  1HYS A;  3M8Q A;  2C37 B;  2CPE A;  2FQQ B;  3VZH A;  2W2N P;  2DGO A;  1SH3 A;  2C3Y A;  5DS7 A;  3TVK A;  3G71 S;  1VQO S;  4BA1 B;  2MQM A;  2OPS B;  3IXQ A;  3GR1 A;  4DMZ A;  1SPB P;  4LF9 F;  4AD6 A;  1FWK A;  2O67 A;  4MKY A;  2CPZ A;  2JLF A;  2M5Y A;  2RVJ A;  5D4O A;  2PDA A;  3M30 B;  5ETL A;  3WIU A;  3NGD A;  4RJV A;  4DQR A;  1ZTT A;  2M2B A;  4QPX A;  4OO1 A;  5IWA I;  4K0K I;  2H4Y B;  5LMU I;  3CJ4 A;  2AX0 A;  3CD5 A;  3HD1 A;  1VQ7 S;  2Y1I A;  4QU6 A;  1JJH A;  1TU0 B;  4MK9 A;  2PA3 A;  2LQ5 A;  1Y7P A;  1NHU A;  2AYB A;  1N5Q A;  1EHW A;  2QMU B;  1KQS R;  2XS7 A;  2RAQ A;  2O1U A;  1QAY A;  2W9B B;  1Y3J A;  2MDA A;  1D1U A;  1QZR A;  1WAC A;  2FPH X;  4O44 B;  4M95 A;  4BA1 A;  3CCT A;  3NZK A;  4EK2 A;  4J9U E;  3W9I A;  3QJL A;  4G1I A;  2IJN A;  2M0G B;  3AHP A;  4DV7 J;  2GMJ A;  3N79 A;  1HI1 A;  4AXJ A;  5K8O A;  2UU9 J;  1KSP A;  1S77 D;  4NA2 A;  1V3R A;  5K8N A;  3TZY A;  2ZBR A;  3ZFV A;  1VQ6 S;  1AYE A;  5HP1 A;  1U1P A;  2JEG A;  2VB6 A;  3PO4 A;  2YWG A;  3CB4 A;  4YB5 A;  2IA0 A;  3OVB A;  3H90 A;  2J8S A;  5IV3 A;  2GHW A;  4P7A A;  1RAI B;  3V81 A;  4KFB A;  3KWM A;  2FJB B;  1I94 F;  4USM A;  4E8U A;  5ETR A;  2FDN A;  4WP3 A;  1WOR A;  1UFL A;  1KIJ A;  1I3O B;  5DET A;  2GHP A;  1S1U B;  3F0N A;  4NMX A;  2D9O A;  4NZ7 A;  5C2G A;  4HYM A;  5B08 A;  1WC1 A;  2RF2 B;  3M6U A;