1S4EA

Pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
347
structure length
337
Chain Sequence
b'TVKSPGRVNLIGEHTDYTYGYVMPMAIDLYTIITDKVQLYSEHFNEKLDLTKEGSWIDYVKGVLWVLIQEGYKIGGLKKITGDLPLGAGLSSSASFEVGILEVLNQLYNLNIDPLKKALLAKKAENEFVGVPCGILDQFAVVFGKKDNVIFLDTQTLQYEYIPFPKDVSVLVFYTGVKRELASSEYAERKRIAEESLRILGKESSKEVTEKDLGKLPPLHRKFFSYIVRENARVLEVRDALKEGDIEKVGKILTTAHWDLAENYRVSCEELDFFVKKAMELGAYGARLTGAGFGGSAIALVDKDKAKTIGDAILREYLAKFSWKAKYFVVKPSDGVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactokinase
publication title Substrate specificity and mechanism from the structure of Pyrococcus furiosus galactokinase
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 115
structure length 337
sequence length 347
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 2.7.1.6: Galactokinase.
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
A PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1s4eA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1s4eA01
1EI1A 4LF4E 2ZBKB 2HK2A 4K0KE 4JV5I 3JAMC 2X36A 5LMNE 3B78A 1XNRE 3QT6A 4GKJI 4USKA 4JI1E 2EFGA 3K1JA 3LTOA 2UXCE 1XNQE 3ZKBA 2HK3A 3PYEA 4JYAI 4LF7I 4DR7E 1OJ4A 4DV0E 4GKKE 4LFCI 4KQVA 2A2CA 4I3HA 1KVKA 3J80Q 1B62A 5BR8E 4PRVA 2V8PA 3Q1QA 3T1HI 2GS8A 1KIJA 4JV5E 3J80C 2VQEE 3QT5A 4HY1A 4GKJE 2HFSA 4KHPE 1H74A 3QT7A 4HXZA 4JI5E 4JYAE 4LF7E 4UTGA 1HR0E 4JI3E 4B3RE 1N32I 4DR2I 2UU9I 1Z0WA 4MYUA 1N36I 1UEKA 1XMQI 2NPFA 4DR1I 2HKEA 5IWAE 4FWGA 4JI8I 4DUZI 4FWDA 4JI4E 3ZZTA 1H73A 1FWLA 1ZM3A 1VISA 4DV6I 3LPSA 4URLA 2VF3A 5L3JA 4DV3E 2E1RA 3HULA 4DR5I 3B82A 1FJGI 3CWVA 2UU9E 2UUCI 5FLXQ 1N36E 4LF4I 3WU6A 1B63A 4K0KI 4WUBA 4B3MI 1H72C 4X66I 4JI8E 4DUZE 3PYGA 2BM1A 4NXNI 1H7SA 2F4VI 1IBMI 2UXCI 1QZRA 3ZM7A 2CZ9A 4UT4A 4DV0I 4GKKI 4X64I 4DR6E 2J7KA 3JAMQ 1HNXI 1PKPA 4LF8E 1U2RA 2V2ZA 3QT8A 1PVGA 4B3ME 4JI7I 4DPXA 4X66E 2VQEI 1ZXMA 4DXLA 4LFBE 4PU9A 4DU8A 4NXNE 2F4VE 4KHPI 1IBME 2R3VA 1FWKA 1FKAE 4JI5I 2ZITA 1Z0BA 4Z7YA 1HR0I 4JI3I 4B3RI 4R1FA 4X64E 1XMOI 4ED4A 3D4JA 2UXDE 2R42A 5IT9C 2UXBE 3ZZUA 1HNXE 1PIEA 4WUDA 4JI2I 2OI2A 5IWAI 1MU5A 4JI4I 4B3SI 4JI7E 4DV4E 1WUUA 3J81C 3OTOI 1MG7A 1N33I 4DV3I 4PRXA 3LNUA 4AQYE 1S4EA 4NXMI 4M1KA 2WW4A 1NHIA 4DUYI 1MX0A 1XMOE 2V2QA 4LFAI 1Z5CA 1HNWE 2UUAE 2UUBI 4JI2E 1NHJA 4B3SE 1IBKE 3T1YI 4DV7I 2LJPA 4ZVIA 3OTOE 4LF9I 1N33E 3PYFA 2DEJA 1N34E 4YHHI 4LF5I 5LL6R 4NXME 4DR6I 4DUYE 3F0NA 4HACA 4HYMA 2BM0A 4LFAE 2ZM6I 4LF8I 4USMA 4OX9E 2UUBE 2V2VA 1J5EI 4FWHA 4DR3I 3T1YE 4X62E 3J7AG 4LFBI 4DV7E 1H7UA 4LF9E 1D6TA 4YHHE 4LF5E 2AJ4A 4DPUA 5LMUI 3B8HA 1A6FA 1FNMA 4LF6E 2UXDI 2UXBI 2ZM6E 1ZXNA 2HFUA 3GONA 3WU4A 3V5RA 4DV4I 1J5EE 4DR3E 4JI6E 3M6AA 1EA6A 4HACB 2V34A 5GMDA 4AQYI 4DPYA 1Z59A 1Z0VA 4DV1E 5IT9Q 3ZKDA 5LMUE 1IBLI 4DPWA 3PYDA 2BV3A 2E5LE 3J81Q 4P52A 1HNWI 1FI4A 1N0VC 2UUAI 4JI0E 4XTJA 1Z0GA 1HNZE 3K17A 4MYTA 1IBKI 4B3TE 1Z5BA 3ZZ0A 1N34I 4DV2E 1NZ0A 1Z0TA 2Q2EB 4JG4A 3H4LA 4FN5A 1KTVA 1IBLE 2VQFI 4OX9I 4X65I 2HHHI 1DARA 4X62I 4DR4I 1K47A 2A2DA 1ZM9A 4LFCE 1N0UA 4Z7CA 4LF6I 3T1HE 1ZM2A 4YY3I 4EMDA 2DEIA 2XEXA 2VQFE 4X65E 2HHHE 3WU3A 1Z0CA 4DR4E 4JI6I 4DPTA 1N32E 3J7AM 4DR2E 4DV5I 1I94I 4DV1I 2X7IA 3V2UC 1NHHA 1XMQE 1ELOA 1Z0EA 4DR1E 5LMNI 4YY3E 1XNRI 1KKHA 2E5LI 1RR9A 5GMEA 5FLXC 4FW9A 5A2QQ 1S16A 1Z5AA 1RREA 4JI1I 4JI0I 2HKJA 1HNZI 1XNQI 4DV6E 1XHKA 3WU5A 1BKNA 4DR7I 4B3TI 5A2QC 1ZM4A 4RPFA 4DR5E 1FJGE 4WUCA 4DV2I 5BR8I 2UUCE 4DV5E 1I94E 4P7AA 4DU7A
chains in the Genus database with same CATH superfamily
4ED6A 1K9MT 4RUAA 3UPFA 1QVGR 4IO9Q 1P42A 4AIDA 3OD2A 4JV2A 1KLMB 2WOMA 3L95X 5T7LA 3M05A 1HD1A 4K0KF 4KIAA 4LCGA 5KG4A 1CLFA 1R0AA 3JTNA 4CQ1A 3GFZA 2QSWA 1IBMF 3G71S 4URQU 2I1RA 2NYHA 4X64F 1VQNS 1KQGB 3GJQB 4A8SA 2HYIB 4BC7A 3A8EA 1WC4A 2W2QP 1HNXF 1N34J 3K7RA 1FRHA 4L3KA 4JI3E 3G8SA 1VQMS 3ZTQA 4H4MB 5DG9A 1JLGA 4KHMA 2PMHA 5KT2A 4LCFA 1RTDA 4QWEA 4TKTA 5SUHA 2E1RA 1KQFB 2FZCB 1B7YB 2LECA 4Q2LA 2J0XA 1TKDA 2DK2A 3BQ0A 4LSNB 1EETB 3WU6A 1C1BB 4CO5A 1C1CA 4JV0A 4WUBA 5G0RB 1YG0A 2L48A 4DUYF 4OL8A 1H7SA 1RT5B 3TAQA 4DL3A 1VC0A 3V6DB 4OX9F 2PO1A 4HTIA 2YH0A 4ECYA 4DV5J 5DQGA 2VA3A 2J7KA 2RQ4A 4X62F 4DL5A 1H3DA 3KLIA 1AZSB 1FVQA 4LBHA 4M5DA 2DCLA 2VQEI 3OBIA 5KFAA 1SQGA 1IBME 2WP8B 4A46A 4X64E 2G9OA 2WBMA 1J5EF 5KG3A 3PIPQ 3BYPA 4XPCA 3DDKA 5IQQA 1HNXE 2AEFA 4RW9B 2ZH1A 3DRPA 3HFZB 3Q6NA 2U1AA 1CC8A 3SCLE 3QMQA 3RYLA 3LNUA 2RJZA 5CXTA 1X0PA 1WACA 1PJ5A 2DO4A 4DCOB 4ITSA 3H5XA 1O0PA 4QBUA 3BBBA 1U1QA 2GVZB 1HNVA 1T3OA 4B9UA 5IT9U 2UUBI 3GFYA 5CYMB 5DLGA 1F0XA 3OXLA 2MKCA 4F4ZA 4DV7I 2GFFA 1PILA 1HPZA 2C2ZB 2ZBPA 5JEAA 3PDNA 2BEFA 4DX6A 4DUYE 1B0VA 3F0NA 2J0QD 2PI4A 1IKYB 3OV7A 1LW2A 4OX9E 2DHXA 4GC6A 2ZBRA 3FC9A 3HD1A 3I56S 2OSQA 3OFFA 4X62E 2F65A 3P3DA 2AJ4A 2W8KA 1TTHB 2HNYA 4C97A 2XWXA 5DS7A 3B8HA 1M5PC 5ETMA 4DUTA 1RAGB 3ETOA 4ZVRB 4PKDB 1RBAA 3FUYA 1K1QA 1J5EE 3G8TA 3RU0A 1UFKA 1VRUA 1S0MA 2AYMA 4ZVOB 4I6WA 5IFMA 2BR2B 2DIVA 1A0OB 4I2PA 2NXCA 2Y1LB 2I8EA 3MCOA 3OT9A 2A18A 4MT1A 1HIYA 2VH7A 3BBFA 2VDHA 3M8QA 2ZE2B 4KHPJ 2IVFB 2KT3A 4C2MA 4H4KC 4NWBA 1I3OB 2FHKA 4LCHA 4G65A 3TA2A 2LA4A 3GPAA 5H9FK 4FF2A 4K4SA 4KO0A 1K1SA 2YWWA 1KR4A 1NU4A 3M1VB 3MPYA 1SV5B 4QW9A 1VYAA 1U24A 2L9NA 5BR8F 2XI2A 4HDGA 1ZOTA 5IM0B 3ENAA 2W9BA 2KKHA 3MDFA 2RKIB 4ID5A 2K7KA 1S9GA 1RDRA 1U6ZA 2OD4A 5GMKa 1BWEA 4FPIA 2Z5BB 2XEXA 1W7WA 3DLGB 3MR3A 2G2ZA 3K5PA 4OO1C 2LKZA 1SL0A 3NCPA 2LQ9A 1VI7A 4JI4F 1Y11A 4DR6J 3DOKA 4I2QA 3N5BA 1R6YA 1MW7A 1MU2A 3M6WA 3C16B 1Y4UA 5CYQA 4ECVA 5A2QY 2UU9F 1NDCA 4XPEA 3QO9A 4UOGA 2KO1A 3GIJA 4QYRA 4RPFA 1OYRA 1DTTB 1JLCA 3CJQA 1OY6A 3W8GA 4ECSA 3VVTA 3O2IA 1RYRA 2C2OB 5JJBA 2ZBKB 4Y65A 1VK8A 3CF5Q 1O51A 2X36A 3B78A 4DR5F 2CQIA 5I42A 2R7SA 3W63A 3N9UC 3DFEA 4YB5A 2AW0A 2ZKUA 5DGAA 1OJ4A 4NEYA 3E01A 4CZCA 2G2OA 4KQVA 5ETNA 5BR8E 1SC6A 3EVWA 1NK8A 4C9DA 1TAQA 2HWTA 3Q1QA 2I9SA 1Y3KA 3KK3B 1GMWA 4GO5X 1KIJA 4ERDA 2CDQA 2G1DA 3Q24A 3SEOA 3PACA 3J7YI 2VDIA 4YEAA 2DB1A 3CCZA 2ZHBA 3PZPA 1JLFB 1FVSA 3OVAA 4OX6A 2ZH6A 5B0EA 4BWJA 1OYSA 5T7LB 3FDSA 4TU8A 5HVGA 3R7NB 1HQEB 2HHHJ 4JI4E 3POTA 4A8YA 1FD2A 2YKMB 5J2QA 1R0AB 1TMMA 2GIRA 3RB4A 3NRBA 3L4BC 3W2VA 4B3SF 1IBKF 1KOOA 3FJ2A 2UU9E 4KHRA 5JVHQ 1T95A 4K0KI 1PJ6A 3F56A 4F4KA 4DV6J 4FW7A 2C2DA 2CQCA 1IKVA 2H9ZA 1HFEL 1IBMI 4P75A 1YBTA 2Q1LA 1XK8A 3LQVA 4P2XA 3TQ1A 2CZ9A 4DL4A 4X64I 4XIUA 4L76A 3JAMQ 4QR2A 1YHCA 1HNXI 2C39B 1JMTA 4RBTA 1PVGA 2XYPB 2IM1A 3PHEA 4LF6F 2XB2D 5DRRA 3V81B 4IFDD 2IYIA 2E1PA 1CQNA 4JI5I 3BBCA 1Q4RA 3LOUA 3VAMA 1NBEB 2YKOA 3DLLQ 3B6BA 1LWXA 4ZJQA 2CPXA 4GKJJ 4F2SA 1SKSA 3T1AA 3ILJA 4U67Q 2PO1B 4I64A 3J81C 2ZEJA 2E9TA 2HHXA 3A1YG 2CPEA 3L7UA 2RD5C 4LFCJ 3TUIC 4IRKA 3KK2A 4DUYI 4ZPAA 1RSCA 4UY8T 2BW2A 5GAGU 1MWQA 1FWPA 2AJ2A 1KFSA 3CJ4A 2RMLA 2ROEA 3SSQA 1TVRA 4B3SE 2G0JA 1IBKE 3W61A 3L7OA 4HVZA 5D78A 3HVTB 3Q8VA 2A0FB 1FRLA 2BR0A 5E3AA 2CPHA 4PABA 4TVAB 1DQ8A 3N0VA 3M7VA 1J5EI 2J0SD 2MSSA 3RB6A 2IDEA 2KJVA 3VALA 5CD4H 2U2FA 5CCMA 2ALZA 4M5HA 4ZVFA 2DGSA 4ZPWR 5E7OB 4RUCA 2DNPA 4J90A 4USUA 4LF6E 2CJ9A 4NA3A 1RAAB 5ETQA 1I6JA 1YRUA 3D54A 2CDRB 3AJ2A 1CJKA 4J3DA 1IKXA 1YZ6A 3TYTA 4U8YA 1UWBB 5GMDA 4NLDA 3UCUP 1NMEB 2FC9A 1DZ5A 2DR6A 4C3KA 3SDEA 2J6SA 2I0XA 1N0VC 2XQCA 4IO1A 1LQ9A 4N3OA 2B6AB 2HHWA 2HNYB 3ZZ0A 5LMNF 1WDDA 1XNRF 3RRGA 1M5SA 2Z57B 1X5TA 1RWOB 5J2NB 2R2TA 3UW1A 4NLRA 1JIHA 4F26A 1FESA 1KTVA 2AD9A 1NPRA 5HLFA 2FQQB 1VRUB 1H38A 1FJ7A 3EWGA 1ROFA 1UDOA 2CPIA 1ZAVA 3NS7B 1VJQA 1Y5LB 1P1LA 3CE8A 2XLKA 2ACYA 2F9JA 1RACB 4KFBA 4PEOA 1PO6A 2RNEA 3T9ZA 4HH0A 4ECRA 2QT7A 3ADAC 4FW4A 4ZA1A 4LF5J 2IOQA 2FHMA 1S4FA 3CMQA 4WYLA 4QIEA 2HNZA 1RZMA 1R8AA 1NHHA 1PC4A 4Q43A 3PRBA 1W2BR 1FDAA 1WG4A 2IAJB 2E5IA 2MXYA 2UVWA 2W9BB 2BE2A 1Y3JA 5I3QA 4ID5B 1Y00A 1JXLA 3GLLA 1RXOB 4IOCQ 4IQMA 4R0EA 5BR8I 2GHWA 3C19A 2AJ0A 1HW9A 4XAKA 1L3UA 5A8WA 3X3UA 1Q53A 5LMNE 3JQKA 2AJQA 5HL7Q 1XNRE 4CLKA 4J91A 2RUSA 2VFTA 3CDEA 4ZMMA 3K1JA 4TQRA 3LTOA 3FBBA 3K85A 2HK3A 1F9FA 4I2QB 4MKAA 3GG1A 4DG1A 1S59A 1MU2B 5CYQB 1SJRA 2BJ1A 3MR5A 2EWHA 5B08A 4F0KA 3QO9B 2POKA 4OZJA 2F8MA 4BBYA 2O1PA 1CULA 2GZOA 2DXEA 1APSA 4OYIA 1L3KA 5I3UA 2MHEA 3H5SA 1SH0A 2EK1A 2OEMA 2QMUB 2IRUA 1FJEB 1QDUB 5AJ3J 1WG1A 2UU9I 2GV1A 2IJFA 5I42B 3U27A 1YHQS 4YP3A 5HQ8A 1SIZA 4AQYF 3BGOP 2HKEA 2ZH2A 4KGZB 3PY8A 1S1XA 4U7CA 2FVCA 1HWKA 3MD1A 1H2VZ 5F3TA 5L3JA 1JXEA 2ASDA 4DR5I 3W65A 2OPPA 4N8NA 4R0JA 2UUCI 1EX8A 4WIIA 3LPEA 2RU9A 1SQFA 3ZZZA 4J9NA 3FBEA 1O6XA 5C0XF 4R25A 3DU6A 2Z2LA 2QFIA 1FX2A 3ZNJ1 1R8BA 2F63A 5LJ3Y 3CC7S 4CLFA 3FEZA 2WAQD 4LPFA 1I94J 3NMRA 2V50A 2BA9A 3JAMY 2XMVA 3R5JB 5L9XA 5J2QB 2E5LJ 1HWIA 2DCUB 3DM2A 3GE9A 3QJJA 3I0RB 4X4OA 5AXMA 3W2VB 4KJIA 5ETVA 4EK2A 4F25A 3ZZPA 2MJUA 5KFIA 1TL1B 3GV8B 4B3RI 4R1FA 2WSFC 3NNCA 2D9PA 2M0GB 1V3RA 5KFNA 3CT9A 4JV5J 4JBCA 4A8KA 3M8RA 3HT0A 4B3SI 3KLGA 3OL7A 3D3CJ 5LMUF 1T9WA 5KT5A 1MNEA 3SQGA 4F67A 4AQYE 2J76E 4UOHA 1S4EA 1SPBP 4M1KA 4F36A 2DR5A 3KDOA 4K2JA 3T1HJ 5J2PB 2LQ5A 3GR1A 3IWNC 1TL7A 3VCDA 4ZJOA 4HEA9 1CC7A 4ED2A 2Z4PA 3TQEA 2ERRA 5C0XE 4UZCA 1K73T 3W1YC 2OPQB 1N36J 1W2IA 2PO2A 1SKWA 3UNGC 4LF8I 1HWUA 1AFIA 2OFGX 4ZHRA 4ISAA 3DRXA 1RHRB 3KK2B 3K58A 1VBXA 1VK3A 2R8HA 4RWXA 2VQFF 5A8KA 1HKAA 1YTYA 2DNMA 2L3MA 2V8DA 3GCWP 1Q95G 1WORA 4ILLA 2BX6A 4OZLA 3MTKA 2HLUA 2VBZA 2O66A 3R6GB 2FLLA 2JVRA 1I5OB 2J8AA 3BN7A 1SL2A 3KLEA 4AFFA 3RBXA 1U1KA 2GGPA 2RSQA 5LMUE 3FRYA 3FK4A 4DLGA 2BV3A 4USVA 4CDIA 3BF4A 3EMTA 2DRDA 3M6VA 1S1UA 1AA1B 2PFDA 4PWUA 2QEXS 2DGQA 2NXUA 1X4CA 1X31C 2ZUGA 3OXFA 4ED7A 1F2HA 5C25B 3R97A 4CWBA 4YB7A 1CBKA 3T5KA 3M9MB 2K06A 4NCGA 1U7LA 5SZTA 3KJNB 3GMGA 4CNZA 1M1KT 4WU3A 2AGQA 1RB0A 1UVMA 2NYIA 3K8VA 4ZVGA 3C2PA 4PXDA 3GIMA 2ZHAA 2YKNA 1XMBA 3NGKA 2Y1JA 4KYZA 4IOAQ 1FTCA 1S57A 2VQFE 2NS1B 4LOMA 1OPZA 4ED1A 5F8JA 3DLEB 1Z0CA 4JI6I 3HT3A 1QY7A 1WELA 2PNZA 2VONA 1Y4ZB 1UJ4A 1HHSA 1V3SA 2FJVA 1WG5A 3GU0A 2ZM6J 5LMNI 3M8YA 5HQLA 3TARA 1XNRI 3M2RA 3MAHA 3MOZA 1S16A 4JI0I 4PYAA 4AL6A 5AE3A 3QFWA 5DO2A 4LFBJ 3W64A 1S10A 4IFVA 4K4VA 2C22A 1R31A 3D0GE 3IBCB 1B70B 1N4LA 4IZKA 2UXDJ 5E5NA 3DDNA 1FDBA 2X3GA 2HNZB 2DHGA 5K20B 4FW6A 4JV1A 5LT5A 3CDAA 1LWFA 1WOPA 4C8KA 4Q5VA 2JEIA 1FEHA 4DFMA 2O1WA 1QAJA 3BYRA 2FYXA 3TRGA 4NLTA 4IRDA 1F3FA 1TMJA 3AQOA 4Q44A 2C2MB 4P2SA 1FE4A 1HBOA 4WCEQ 2DD8S 4DZ6A 5EDWA 1B4SA 3CJ8A 3T5LA 2X1BA 1DHMA 4N76A 5KG7A 3BH7B 2OJ3A 3O3LA 2W25A 3NBPA 1U25A 4ECQA 5DDQC 3D28A 4DG1B 4KGXB 3GV7B 3H20A 5FJ4A 2JLEA 3NWRA 2AJFE 2Z8QA 4AXJA 3BV8A 1CULB 1KN6A 1YJUA 2WVFA 1URRA 1NJZA 1QUPA 3WC2A 2FIUA 2N3OA 4FF3A 5KFUA 3NGTA 2UXCI 2JH3A 1SIWB 4A8FA 1RT7A 2Q43A 2KRBA 3DI6A 3SZ2A 1BUXA 1LKZA 2H51B 4LR7A 4DL6A 2HRUA 2PC6A 3IBFB 4G3IA 1GXLA 3L3CA 4B9LA 4MFBA 3S7RA 2HURA 1B99A 1DTQA 4FBUA 3CIMA 1FRXA 3ZZRA 1FEEA 2OPPB 3GG0A 5F8LA 1FWKA 1X5OA 3I32A 4Z7YA 3OVSA 4DL0C 2QYCA 4DR3F 2O1VA 4JUZA 4WUDA 3MM8A 4U3BA 4F0MA 1RT6A 1YH8A 3FFIA 4X4QA 4JI5J 1MMLA 2XWYA 4HI2A 5FDLA 4C8NA 4AXIA 2BJEA 1NHIA 1JLEB 3PR4A 3HFVA 3DM2B 1RWWB 4PUOA 3LP1B 2HBQB 1C2PA 3LALA 4C4WA 5AXNA 1RQ0A 5K36F 4K5RA 4ZP9A 1QTMA 4KQZA 1N32J 2CG8A 1IR0A 1D8ZA 1Z1ZA 1WI8A 3LP0A 2XLJA 4U9RA 3KLGB 5HN0A 2R2SA 1IJFB 5C0XA 1RADB 3KLVA 4DUZJ 1R8PA 3T3FA 1FCAA 1WF0A 1KWMA 2KZZA 3QZ8A 3H42A 3BGFA 2CQPA 3S01A 3NXZA 4AYBD 4X4TA 2HQ3A 2YX4A 1H6KX 4QYZJ 5LMUI 4DFJA 1X9WA 3QJLA 3CB4A 3BR8A 4B3MJ 2UXBI 5HANA 3D3BJ 2IPOB 4HDHA 3N4WA 3M30B 1M1GA 3WU4A 3O1LA 4DR3E 3D66A 4CLPA 2PO2B 2BMBA 3KG4A 4XDDA 1Z0VA 2V6AA 2CQDA 5KFTA 4OO1D 2PDAA 4ZHRB 3MF5A 5CA5A 3HSGA 2MGZA 1HNZE 4DV5F 3C14A 4ILMA 2DXFA 2Z5EA 4F4XA 5IXUA 4M94A 2I2YA 3Q0AA 1HR0J 2YWHA 3ZTSA 1L5UA 1XMOJ 3AA9A 1U47A 3RG6A 3T5JA 5K36E 2FB0A 2JEFA 2VQFI 3W9IA 2CVIA 1UW4A 4NASA 4URSA 3W7BA 2L08A 1DARA 2PMWA 4TY8A 1HBUA 2QLJB 3UN5A 1OPIA 2A6MA 3IO1A 2D3OR 3HD2A 3IR5B 2C2KB 4OJ3A 2CJXB 2ZWOA 5GAEU 3U1MA 3BSNA 3C6TB 2CUYA 1VOMA 4TLRA 3PO5A 1YJ9S 1XR7A 4CH0S 4I4BA 1GQEA 5DRQA 4Y2AA 4YHHJ 2R2RA 1LK5A 3QLHA 3NAHA 3G6ES 2KFZA 3THTA 4NCGB 3CCLS 3DLBA 1NK0A 4ELTA 4RW7B 1Z0EA 2JJ4D 3IWLA 3CCSS 4OHVA 3G8QA 3MPVA 1VRTB 4B08A 4B3TI 1RU1A 2LXUA 4OYMA 1V9OA 2YKNB 3WHIA 3GWCA 4OI2A 4C8YA 2JL9A 1ZTWA 5B0AA 1GK8A 4N41A 4DV5E 4DU7A 4F2RA 2D1CA 2KJWA 3HJCA 1LEOA 4OZEA 2EI5A 2ZC3A 4CLZA 3RGIA 3EGZA 1SH2A 3D5MA 2PNZB 4DHVA 2N4CA 2BZ2A 2MQ8A 4GKKE 3PKYA 2NQPA 4Z37A 4J37A 1HBMA 4PRVA 1X60A 3M2RB 1XJWB 3DYAA 1N5TA 4OI1A 1BQNB 2JT2A 2F8HA 2CA9A 4TU9A 5IS2A 1YLXA 4O44A 3KHLA 1XERA 3MUVP 2KYXA 3SCJE 1T03A 1NJXA 2MKSA 4IZJD 4CO0A 5IV4A 3HLUA 3M2UB 1UEKA 1J5OA 1XMQI 3KXDA 1ZPWX 2M2BA 4X65J 2UV8G 3OPKA 3OFGA 4ECXA 1Q86T 4F8RA 5EKWA 1RTHB 4FW3A 4DF4A 3D1HA 2GW8A 4N56A 3NGUA 2XHCA 4WZQA 2LXIA 3SXLA 2AEMA 1Q8IA 2E5GA 3KNAA 5HMXA 1NKCA 4RW6B 2DBBA 3MMCA 3ENQA 3TA0A 1H72C 2FHJA 1U1NA 1GX5A 1HBOB 4ICLA 1N5SA 2BM1A 3SQOP 1UDNA 3MEEA 2MLYA 2JX2A 1KHVA 4QWBA 4A8XA 1NCLA 3BGRA 3I31A 2XMKA 3NBPB 4E2FB 2DNQA 2OGUA 2MPUA 1Y9OA 2FTRA 3M7ND 1PKPA 3EYZA 4JI1J 4LSLB 1WHWA 2HGMA 3MOJB 5E3PA 1S7HA 2EG1A 2XY6A 2LQ8A 1E3HA 4J5OA 1Q7LB 1CS4B 2R7WA 4B9NA 3OVBA 2RT3A 4LRBA 3AT1B 3GLJA 2J0WA 4DV1F 3D6FB 1RT7B 4LVNP 2HVEA 1ACMB 3MR2A 2AP6A 1MG7A 3Q2SC 2K1RA 4CIOA 3UHMA 2GQ2A 3DOLA 2MDAA 4DSIA 1B0PA 5C42A 1KLNA 2E9ZA 4MFBB 2J8SA 1DTQB 3CD5A 2WONA 2WRMA 3H7HB 4K8RA 2FPHX 3A3OB 2V0NA 2XMJA 3HFKA 4NE9C 3M2VA 1S6PA 3WZ0A 2FHJD 3AQPA 3IXQA 2MTLA 4DBQA 2DGXA 2OEJA 5GADU 3NAIA 4TNOA 4DR1J 3SMZA 3FFIB 2JHEA 4JI8J 1B64A 1KONA 4DR3I 2HVHA 4CO4A 4OI6A 3I4PA 2C28A 2HHHF 1KQKA 3PS2A 4DX5A 1A6FA 3F41A 4K50A 4J9UE 3NLCA 2BKPA 2HFVA 3M8ZA 2J9EA 2BANA 1OYEA 4N47A 4KSEB 1F3VA 2HNDA 5CHCB 3DHXA 1UTAA 3AB2B 2FHOB 2IM0A 2V34A 3VAIA 4U6PA 3ITHA 4DPYA 1Z59A 2HGLA 4DV1E 2JSXA 4DV6F 5IT9Q 2NN6F 3P3CA 4DQQA 1T94A 3D9BA 2XZTB 1F60B 5D77A 4JI7J 4Y2CA 2MZQA 4OHXA 1Z0GA 4LF4F 3W5ZA 4LRDA 4RJVA 1Z5BA 2CJYB 3KJQB 3WQPA 4IH7A 1N34I 1NZ0A 4FS1A 4PPZA 2FVQA 3GCMA 3VVUA 2HPUA 2HZAA 2BJ3A 1YITS 3O44A 4JI2J 5HO4A 1FRKA 5I3PA 3UVJA 2VOPA 4S0MA 2VG7A 5K36A 4QZVB 3DKDA 1R6VA 3CDWA 3CCTA 5F0UA 4GKJF 4NMXA 2BW7A 2WNRB 1UW9A 3KFWX 3MAAB 3C14B 2IVYA 4OHZA 3T1YJ 2HHHE 2R7VA 5E3RA 4WJBA 3OJSA 3B4DA 2BJ8A 4KB7A 4DPTA 1YIJS 2AWZA 2QN6B 4DV5I 4LUBA 1S6QA 5GAEI 3IM9A 4KKOB 2P9EA 3BO3A 5D0RA 3G82A 1SJ3P 4TY8B 4FZVA 1XC9A 4WWSA 3BSOA 2RDIA 4KPYA 4O3RA 2IC3A 4DV6E 1YJRA 2D74B 2NN6E 2KB2A 3WU5A 2F4FA 2OO4A 4CLUA 2H65B 4C0BA 2WZ1A 2Z30B 3D6MB 4LF4E 2IMOA 2XTJP 2HK2A 1R6MA 3JAMC 4JI0J 4FNIA 3G2XA 3OQ2A 4DV4J 3ZKBA 4FVMA 3EM1A 5A2QU 3UI3A 4RBUA 1KVKA 3PO4A 2QYGA 1MSWD 2YWGA 2LU1A 2ZBIA 2UZAA 4IG3B 3J80C 1UVLA 2CPYA 1IWAA 1RUSA 4GKJE 3FVYA 3PS3A 4HXZA 1FDDA 2BA0D 1Q16B 1MMNA 2HSEB 5DG8A 5CH7B 1RT4B 4EO8A 3OR1A 5IWAE 3BSAA 2V8HA 2PMZD 2VICA 1RA6A 1W26A 4QWDA 2EC0A 2FZKB 2N82B 5GVQA 3OFEA 5J1EB 1S97A 4EWTA 2B56A 1NAQA 4GO7X 2ZD1A 3DYAB 2B4PA 3H8YA 1Q0NA 3TVKA 1IM4A 5KFZA 3PX6A 2YWFA 3K89A 4WBFA 4O44B 4ED5A 1IVZA 3R6LB 1VDHA 2KFYA 4J9PA 1LWEA 4FKXA 4Q45A 1E6YB 5F9NA 4OZ3A 1U1LA 2XULA 1J5OB 1IKWB 2LU2A 1QE1B 3TAMA 1Q7YT 4DSKA 4WYWA 4QPXA 1RTJB 2QA4S 3QATA 1U1MA 4TYBA 3R5CA 4P73A 1D0EA 4LF5F 4CM2A 4OYBA 2UXCJ 1XNQJ 1NK9A 2ZJRQ 2C2RA 2V69A 4KHPI 1G3OA 2ZH4A 1X7VA 4DLEA 1BQXA 3BZQA 1UEVA 3HKMA 3D4JA 2R42A 1TU0B 2VV5A 3EZOA 4C3LA 4RZRA 3BGRB 1S76D 3EGNA 4JYAJ 4LF7J 5G4DA 2QC3A 4WP9A 1F6TA 2WW4A 4Y2KA 1TK5A 5H9EK 2YNIB 2CYYA 4OX7A 8RUCA 1LFPA 3UDVA 2K8GA 2LQJA 3AOCA 1VQ5S 3N6MA 1RAHB 5L1IA 1OMSA 4CYUA 1VR6A 5K9FA 1TV6B 4E0DA 4O4GA 4PG5A 4PWDB 3SFUA 2LEPA 4DR6I 1LXJA 4M5NA 2ASLA 4N5SA 1KDNA 1NJIT 2QE5A 5AJ3F 4MU4A 4CLSA 4EYHB 2JRSA 4DSJA 2IFXA 1FJGJ 7FD1A 1VRQC 4LF5E 4DPUA 1PG5B 5D4NA 1N5YA 4YDXA 4DDFA 2V2KA 3M2VB 3RB3A 5AE2A 4X66J 2BKNA 2CZVC 2LDIA 4USIA 2JZ5A 2GQQA 4PAAA 3VGVA 4ENOA 2CQ3A 1Z4UA 1IM6A 4XTTA 1EA6A 2AZ1A 1YRTA 7FDRA 4B3OB 3TNVA 2NCKL 1AYEA 3GMEA 2WCXA 1S0OA 1B7FA 3PYDA 2BJ7A 1EZZB 4H4MA 1T7PA 4P52A 5L1KA 1I94F 4FXDA 4HKQA 1PBUA 1WOOA 2V5HG 1WC6A 2E5LF 4DV2E 4JI3J 1Z0TA 3N01A 3MFIA 4RKUC 2BANB 4FN5A 2V8VA 3K2YA 1AW0A 4WKRA 4LSNA 1WI6A 1C1BA 2HHHI 2Y8WA 2DXDA 3NCRA 2WB1D 2Z56B 5KFMA 2OELA 3ITHB 1XBWA 1GXTA 4PQUA 4JV5F 3FMBA 4ZCKA 1FJCA 1RT5A 2VQEF 4FVCA 3HHLC 1HA1A 1Y5IB 5HMZA 2QLWA 3MM9A 3VQSA 3BPSP 4X4VA 2PEBA 3CJTA 2DEIA 1PKUA 1UVNA 1BQMA 2EK6A 3EE3A 5KOWA 3HKWA 2UUWA 4ZVTB 1BLUA 1AZSA 3I4HX 1AXQA 2XMUA 3T1HF 4OV1A 2QMXA 3MM6A 2XBPA 4O23A 2BJDA 5CAAA 3TJ8A 5DG7A 2M4MA 2WP8A 1LNQA 4ZVHA 3MEDB 2EKYA 3UVJB 2UVUA 2CJAA 5K36B 4FW9A 2YTCA 2DHAA 3DRRA 3QGIA 4V19J 1XHKA 1N36F 3N5FA 2OPRA 4WP8A 3NGSA 1NB7A 1VFJA 3NKYA 3IR7B 2NN6A 1D1UA 2UV8A 1I94E 3VGSA 2AGPA 2GNKA 3BEGB 1VLOA 2CQHA 1ICEB 2RUGA 3NWGA 1CEZA 4GKJI 4WPAA 2GVZA 3ISNC 5D0EA 4ZVSB 5CYMA 4ZPVR 1S6QB 4LFCI 1RK8A 4MIAA 3EPIA 1V5IB 3UDCA 4I3HA 3G82B 1HHTP 4ZPTR 4EZ9A 3HDSA 4X4SA 2KHDA 1V6HA 2IC3B 3X1LB 2ZJQQ 4JV5E 2VQEE 2VKRA 2N3LA 4ZPBA 4OLOA 1Y0HA 4FNHA 4EBEA 2WTFA 3UQSA 1X0FA 4UTGA 5LSOA 4BA2A 2RHQB 3KJVB 2Q3PA 1RWPB 3CNQP 3VR1A 2ILZA 4OYPA 3O5TB 4OX9J 2Q79A 4ZCIA 2MSTA 5BXIA 1Q8LA 5E3CA 4X62J 1EKRA 1S1TB 2FVRA 3R5DA 2VF3A 2WK4A 1PAUB 2GHVC 1XMQJ 2IBOA 2WBRA 2BR2A 3H2LA 5IC6B 4YY3J 1VCTA 1N36E 4IFYB 1SC3B 3TI0A 4F0HA 2GC8A 1Q5VA 2LQBA 3UCZP 4QWAA 1UEUA 5KFXA 4M5GA 3G87A 3D1OA 4OKGA 2ZE2A 1VJWA 4PG4A 5LXRA 1VLYA 2MQOA 4DV0I 2GO4A 1U09A 2V68A 5EN1A 3L7PA 3IP0A 3L7ZB 2H48B 4LQ9A 2LLZA 2BQUA 2XMWA 3QT8A 2NZ4A 1D8YA 3CCVS 3M1VA 4RBVA 2ZD1B 1SV5A 3NNHA 1FK9A 2BYCA 2VFRA 4DL2A 2ZM6F 2OP5A 3CD0A 2FD2A 5AXKA 2RKIA 4KTQA 4MK9A 1LWEB 3KHHA 4LFBF 3C15B 4NLQA 2CJKA 4ELVA 3JSMB 1WWHA 2VBWA 2Z5BA 3JAMU 1UP1A 1H0HB 2QIFA 3HSJA 4UUXA 3OHBA 4PR6A 5B09A 3PFEA 2AYGA 2J5AA 4DSFA 4NLUA 5F8MA 3P49B 3Q23A 3BH6B 3C16A 4IFDF 4YS2A 3MR6A 2W9CB 2CPJA 4Y34A 2H5IB 3CWJA 5M2PA 4LF5I 3P06A 2P5VA 3I0SA 1RHUB 3U7JA 1DTTA 5KFQA 3R2DJ 3U1NA 4USMA 3WDOA 4NCBA 4DX8H 3JSYA 3ZZOA 3J7AG 3KG0A 1L3SA 1H7UA 3M8PA 1D6TA 2F1FA 2HBRB 2SXLA 1S49A 3WC0A 1HI0P 2VESA 4FYVB 1LK7A 5H9FJ 1NKBA 4CYUB 4RWWA 4MDTA 4O4GB 2ZM6E 3K0JA 1RT2B 1YDLA 2IOPA 2PN6A 2BVZA 3QGPA 1U48A 1P8GA 2HS4A 1KVIA 4XO0A 2HFZA 3DC2A 2KRRA 1JLFA 2ZH5A 3JS9A 3D67A 1NK6A 1FRIA 4GQUA 5KFFA 5MAOA 1HQEA 5CQGA 1T05A 5KFGA 3J7YU 2FC8A 2YKMA 2B5JA 2YX1A 3B4MA 1WD6A 1N5YB 2LEBA 3HHEA 1FFWB 1N54B 1HQUA 2B4VA 1URNA 4IFDE 2PD1A 5ETSA 4QR1A 3HJVA 4FF1A 5M2UA 2ZWPA 2QA4G 4JI4J 3D1QA 1UAWA 4WP3A 4J9SA 4Q8EA 2GJFA 2A2DA 1B0TA 2W24A 3FEXB 4FF4A 6FD1A 2CQ1A 3DMJA 3D6TB 1PAEX 2OTLS 4ES3A 3T5HA 2DNGA 4Z7CA 2W7AA 2RHSB 4JI5F 3D7SB 4EMDA 2MKKA 1I51B 1T02A 2AYEA 3TX8A 4NLPA 2DH9A 4KPCA 4MKYA 2C39A 1EARA 1E6VB 2V67A 4TLQA 3TA1A 3Q86A 2GHPA 2XMMA 3EXCX 5CCLA 4ZCMA 3V81A 1I94I 4D3HA 3IA0A 2V4JA 3AY0A 2QJ3A 3EGVA 2BRKA 2NUUG 4KRWA 5KG0A 1KKHA 2E5LI 2HMIB 3KNGA 2CQBA 4PQUB 3VQTA 2K3IA 3EVOA 3P5BP 5HJYA 3OSNA 3CMES 1VC5A 2HAIA 3MM9B 4FYDA 1P27B 4ZCLA 1FRJA 4DUZF 2EEYA 1DAXA 1BQMB 2MLXA 3CTRA 5B0DA 1Z2ZA 1Y6ZA 4ZK7M 4UZBA 5E3QA 2Q6CA 4DFKA 4K0KE 4JV5I 1NPPA 2IJNA 3HX9A 3I96A 2YPYA 1S99A 3R7BB 4ZLNA 1RWXB 1TL5A 3MM6B 4MU3A 4ANEA 2FJDB 4CRJA 1U8SA 4B3MF 1U0SA 2W2NP 2CPDA 4K59A 3HVTA 3TX0A 4M5LA 2O01C 4KY3A 3DRRB 3T1HI 3HVWA 3BB5A 1SB6A 3NMAA 3QT5A 2OPRB 3Q6MA 2BABA 1BGXT 1S48A 1JLBA 4ZS6A 2H3EB 1TL3A 1H74A 2NN6B 4ZVUB 4JI5E 2EPIA 3CJ3A 1TAUA 4DN0A 4MYUA 3TZYA 2YNHA 1N36I 2PA3A 3H98A 2JE6A 3FRZA 4FWGA 3EDRB 3QGHA 1HR0F 1X4GA 1RWNB 1VQ7S 1XMOF 2CWXA 9ATCB 3F73A 2GVDB 2IM2A 1UWBA 4C48A 1TFYA 2IY5B 4LF6J 2ZH8A 3OTBA 4DUZE 3MGJA 3PYGA 4NX9A 4R5PB 3E3XA 3QSIA 2PO0A 2CQGA 2QZ8A 3A8KA 5JEAC 3EZ5A 1QZRA 4BA2B 1PC5A 4OIXA 2B6AA 2RVJA 5HI7A 3H59A 4PRFA 3OFHA 4P72A 5J2NA 4YHHF 5KFYA 3B4TA 2D7SA 4B3ME 1ZXMA 4EYIB 3EZUA 1OY9A 2RF2A 5FIIA 3UDEA 4DR7J 4OI0A 1T9VA 2R3VA 3VGUA 4UUWA 2R7UA 3IAS9 2DGWA 1RLDA 2IA0A 3SIPB 3FBFA 3PXGa 1PIEA 1IQZA 4NI2B 2YPZA 1F2GA 1WUUA 2W4DA 3UE2A 2F7VA 2VBXA 3MWBA 4K4UA 4EZ6A 3KLHB 2RRAA 1RWVB 4JB8B 3ULHA 2XS7A 4HTJA 2MB0B 1EJ7L 3G6YA 1OS5A 1XMOE 2V2QA 4BC9A 2CGEA 5DRKA 2FZGB 4YR2A 4WE1B 3QPIA 1FK9B 2CIMA 1DQAA 2E7VA 3FCWA 3O6QA 2IAJA 2B9YA 2DNYA 3IGNA 2LJPA 4ZVIA 2CWKA 2AHOB 3MMJA 2YBVA 1WDTA 4GVBB 1OYDA 3TVZA 2ZM6I 5EWEA 2C1EB 1NUEA 2RRBA 2J65A 2R7XA 4LRFA 2YXLA 3IBWA 4LFBI 2J6TA 4YHHE 4X65F 3RTVA 3KOAA 1J2VA 3UDLA 2AJ1A 2L9WA 3KHGA 4LMZA 2VHGA 2UXDI 1SKUB 1X8DA 4F3QA 1OSCA 3Q89A 3CUNA 2VUGA 3I0SB 4K4YA 2CNLB 1GFWB 4NA2A 1RTIB 4BCAA 2DNKA 3IAM9 1UA1A 1CJTB 4ID8A 2VJVA 3KRNA 4V1Ak 2UP1A 4USHA 2AE8A 2UUCF 4XTJA 4QOTA 3M8PB 1ZZNA 1ZA2B 4Y28C 1TKXB 2P6TA 3M6XA 3PW7A 4ZP8A 4OI4A 1VHIA 4JI1F 4CTAB 4RW4B 4V19X 3GP9A 1UVKA 3KUEA 2LA6A 3W5XA 3ISZA 5ADZA 3RBEA 4IFDA 4F50A 2JC0A 4ETXA 3OTOJ 4M95A 2XI3A 2ZH7A 5E41A 1Q78A 1YVFA 2V4QA 3LPYA 3DNCA 4DSEA 1F9HA 4LFAJ 1N52B 3HHDA 4LBIA 4PQAA 4B9SA 5E33A 4B3RF 1T05B 5DROA 3P3GA 4HHUA 2FJEB 4DPOA 2XZWA 4X65E 2B5JB 2G2YA 5AE1A 1YJNS 1HQUB 3BKFA 3I0RA 4Q7AA 5KG6A 3OW2R 1RAIB 1TL1A 3GR0A 3KK1A 2P8IA 3FKBA 1S79A 3Q22A 2NXJA 3WX8A 1RREA 4LRAA 2W2OP 3DMJB 1HYSB 3CXCR 4HLBA 4DR1F 2AZ3A 4DR5E 4PPDA 2DITA 4JI8F 1VC6A 4NEZA 1U02A 2UUCE 1R43A 4FPRA 5IZHA 3UD4P 1JNRB 4HYKA 3DRYA 1R6LA 2KG1A 5J2PA 1BMQB 4HR2A 5FLXU 4JI1E 2N4DA 3UWTA 4PWWA 4LF8F 1UZDA 4CO3A 2V4JB 4BA1A 4AQYJ 2HFNA 5DDRC 3J80Q 3Q2TC 3E2EA 2E1AA 2OPQA 1Q82T 3PCOB 5AXLA 3RB0A 1CJVA 1HD0A 4AL7A 2OD6A 2KTQA 5E0OA 2K3KA 4K5SA 4EUVA 2PFFB 1X4HA 4LF1A 2CPFA 5L39A 4B3RE 1N32I 4JI7F 4DR2I 5KOXA 2V9KA 4ETZA 4C8ZA 4IS9A 1SC1B 3M85D 4W4MA 4DUZI 2ASYA 4G6VB 3ICLA 3SYZA 2H4YB 1TL4A 4U3DA 2W7PA 1HI1A 4DR4J 2OFHX 2J9CA 5ELWA 4JI2F 3B82A 8ATCB 3C66A 1W25A 5ETOA 3BJYA 3RAMA 4U8VA 3MUMP 1S1VB 2DPIA 1JLBB 4OJ1A 1UMJA 2XYHB 4B3MI 2W2MP 1TL3B 1NJWA 2W7OA 4IYQA 4JI8E 2MKYA 2BACA 5A6PA 1T9UA 1K44A 1Q1KA 5F8GA 2YNHB 2PA8D 4C6AA 1XIQA 2IERA 2JE6B 3T1YF 4FYYB 4OMFG 3QFHA 1ZETA 1S72S 3ETMA 4LF8E 5C25A 2KT5A 4IG0B 1OIAA 3CC2S 4DV0J 1MWYA 1JLAB 1HR0I 2I5JB 4NZ0A 1S0VA 2GX8A 3HZGA 1XMOI 1FF2A 3JQMA 4JI6F 2PO0B 4P2MA 3CC4S 5IT9C 4ILRA 4HT5A 2OI2A 3OR2A 1GX6A 4FS2A 5M2RA 4NZ6A 4JI7E 1Q8BA 3W9JA 4JI0F 4X4NA 1VGYA 3DLEA 2GO9A 4CI0B 3FNNA 4DV4F 1MX0A 2OMLA 3PVXA 4ED3A 1VMBA 1FKOB 1SJ1A 2GCFA 2RF2B 4JI2E 1IJEB 3IMQJ 3LF0A 2R8IA 2RRNA 2CQ0A 1SH3A 4NLVA 1UA0A 2KVQE 4YHHI 4F4WA 1CG2A 3MEGB 2ZBQA 4IDKB 2N7YA 4BDPA 2VD3A 4TN2A 5D3GB 2OPSA 3RW6A 5KFBA 1VQLS 2YKQA 4U7UK 4FWHA 3T1YE 3CCWA 4ECTA 4NMLA 5THWA 5DNLA 4ANCA 2B7CB 4BS2A 1TUVA 2QL7B 2QLBB 4M5IA 3VZIA 1QTNB 4Y6IA 5B7WA 3ZC4A 1ZXNA 4G1QB 1AUSL 3HHLD 1M0SA 3NL0A 4JI6E 1EKSA 3M32A 2YKPA 1QUVA 3P3EA 2MQMA 4RX6A 1QJHA 1C4AA 4F4AA 4ZLLA 4O3SA 4MMOA 2J6UA 1J27A 3AB4B 2IBKA 1HNWI 2HLTA 4JI0E 4LREA 4RUHA 2AEJA 3H25A 2BRLA 2Y9HA 5KT4A 4J9LA 2VFSA 3FZ2A 2DTJA 3OLAA 4LRCA 1RCOB 5D8HB 2UXCF 1XNQF 2FGOA 2RQCA 3A4TA 3R2CJ 3KHRA 2VG6B 2PGCA 3AH6A 3ZZYA 3HSDA 5T41A 4X65I 3HM9A 3CIZA 4L73A 3S1TA 4KBIA 3UN3A 4C0OC 1R0BG 4QWCA 2E1CA 2EXUA 2IJRA 2FDNA 2ILYA 4MIBA 4OO1F 4NXMJ 1S6UA 1KQSR 2C2NA 2XG8A 1NSKL 1SI9A 1VHFA 5A6WA 4HH1A 4H4OA 3P4UB 4JYAF 4LF7F 3ISND 1SUQB 3MECA 4DS4A 4KH0B 3ZFVA 2QG9B 3AA8A 2C42A 2X7IA 1LV5A 4IFDB 1K0VA 2CG9A 4P7TA 4MJKA 3M7NG 1Y4SA 3P45B 4JI1I 3M6UA 2DGOA 2OUGA 3HVAA 3VAHA 2WVDA 4UF4A 1GXUA 3ZTOA 3CDBA 1ZM4A 1VQKS 3CCMS 1BXNA 1EI1A 4RO0A 6AT1B 1JLEA 3BSCA 4NPOA 4RLEA 5HROA 5KAKA 1UL3A 3SI8A 3LP1A 2UXCE 5BYRA 1XNQE 1HBNB 2DH8A 3KK1B 5K5MA 4X66F 2A2CA 3J80Y 3ILIA 1B62A 3RW7A 2V8PA 2JEAB 4ELUA 5CZVA 2KVIA 3V6HA 3GFXA 4MU1A 3I6PA 4OO1E 3J7A1 2VKZG 3PKMA 1EP4A 3QT7A 4F04B 2UXBF 4JYAE 4LF7E 1HMVA 2QV6A 5EWFA 2XSJB 4LBPA 2GMHA 1R89A 3CULA 3SSRA 4DR1I 4NLYA 4JI8I 3CDIA 4BA1B 4J9MA 1VISA 4GRSA 2DRAA 3CMAS 2CNOB 4DWIA 3M30A 1QD1A 1CJVB 2DYAA 2X1GA 5KFPA 3M8WA 4KE5A 1Q79A 5CD4A 1UVJA 3R1LA 2GAHC 3VF0B 2YNGB 4IKAA 3CJKA 1FRMA 3NS6A 3TEGA 3OL6A 1NB2A 3IG1B 2G4BA 2V4RA 3HO1A 2EC2A 2APOA 1EIYB 5KFKA 2ATLA 3JSBA 3RR7A 2XLIA 1I1GA 2KXFA 3CJ0A 2CQ2A 3VGTA 1SL1A 4JI7I 1HNZJ 4DPXA 4X66E 4Y3CA 4EU0A 5ITHA 4A8MP 3W60A 2HHTA 2ZITA 2EFVA 4IOBA 1R3NA 1D3WA 2B43A 2IESA 4CP5A 5KFHA 3HMJG 2UXBE 4JI2I 3CDUA 3CPWR 3KWMA 1K8AT 3C6TA 5C24B 2ZOMA 1R27B 4LIWA 4CLTA 4Y0FA 1TKZA 4DV3I 4PRXA 2ZZNA 1XXEA 4WTOB 5EX0A 3MFHA 4C8MA 1REVB 2RH3A 4B3TF 3FSXA 3KYLA 2OHDA 1TELA 4RW7A 1V5VA 5A8RB 2FJWA 3T1YI 4NLOA 1YQHA 5CYJA 3J81U 4P2FA 1NDLA 4MH8A 1VRTA 2OLWA 1ZS6A 1H2UX 3HHLB 3OR2B 4HACA 3QBCA 5KFCA 1O5JA 4M5MA 3NZKA 5KFSA 4F02A 2AMCB 1KTQA 2QRRA 1SVDA 5B0CA 2MLZA 2E7XA 2OMOA 2XY7A 4X4UA 2RU3A 1U4BA 1IR2A 2HS0A 4IR1A 1AFJA 4I69A 1VBKA 3MD3A 1BQNA 2QX0A 1XMQF 2HS3A 4DV4I 3B54A 1XWLA 4YY3F 4GKKJ 1QSYA 2F9DA 4IH5A 3U02A 2OPSB 1C0TB 4DPWA 2X1AA 3M2UA 2ZDOA 3V4IB 4F3MA 2UUAI 2C38A 1UJ5A 1WC0A 4RU2A 2IDLA 4B3TE 3DLKA 2ADBA 1RTHA 1YI2S 3H4LA 3V6KA 4WXWA 3KJFB 3WX4A 4IRCA 2GO8A 2BA0G 3TZZA 4USJC 3C46A 5RUBA 1UFLA 3M32B 4RW6A 1G7CB 2PEHA 4FXVA 1RAEB 4OZNA 2UVRA 4N7TA 1ZM9A 4I6AA 2P9CA 1SQEA 2CJBA 2IVMA 3D6HB 3EUNA 1RBLA 3I87A 4URGA 2H4WB 4M5JA 2VB6A 3O8WA 3SCIE 4YMEA 4LQ3A 4K4XA 3H1CA 2VC1A 5J2MA 2CNKB 2BA1D 4LSLA 3LGMA 4G1PA 4F7VA 3ILLA 3SCKE 2VU5A 3AODA 3GJRB 3CJSA 2CRLA 4ECWA 4DZDA 5LL6d 1X4FA 1RJJA 1RCXB 1XMQE 3CCUS 4DF8A 4YY3E 1X5SA 1CS4A 4YN3B 4Y2MA 1Z5AA 1RAOA 1UWAA 3DRSA 1XNQI 2Z58B 5HK4A 5HMYA 5ETTA 1M5OC 4H4OB 4USWA 1TUGB 5A0YB 1OYPA 1D09B 4H4KA 3MECB 5KT3A 1VBYA 4IH6A 1F5CA 5C2CA 5KFLA 2KI2A 4OYXA 4P6QA 5HBMA 1S1WB 4RNFA 1H7XA 1HQ2A 1VBZA 3J81j 5KFVA 1RHQB 1U2FA 2M52A 2RB7A 4JYAI 1JJ4A 4LF7I 3NP5A 3PRYA 3PW4A 4MTPA 3TW0A 2P2CB 1YK9A 4DL7A 3CDJA 3M9NB 2K2PA 1IBLJ 2E29A 5JEAD 3TP2A 3W2WB 4FYWB 2R8GA 1VQYA 1VQ9S 4G1IA 1YBUA 1RI7A 3BGLA 4OO1A 4KGKA 3HXMA 1FTRA 5HROB 3MTJA 4QIWD 2RIJA 1YJVA 1A6LA 2XO6A 2JFKA 8AT1B 4WTYA 1FWLA 2ZUAA 2O5DA 4FYXB 3UD3P 4URLA 4DR2J 2M7SA 2KM8C 2L41A 3HULA 1QSLA 3NY0A 1FJGI 4ZIVA 2Y0SD 2Z2MA 2YQ3A 4EBCA 1HARA 4J9KA 1KD1T 1N34F 5L8RC 1N5VA 1TFWA 5CZXA 1EP4B 4X66I 4OX8A 1HMVB 5KFJA 1HWLA 4I0WA 1DJ0A 4Z2XA 4ZPDA 4RU9A 5C0XC 1YJWS 3J7Z5 4DV1J 4JOUA 4EEYA 2QO3A 2XNRA 2O1UA 4P10A 3CD7A 2JEGA 4DCPB 2R7TA 2IRYA 3QGGA 3MCSA 3G4SS 1SXLA 4HHHA 2D9OA 3TJ9A 2V8GA 4OHWA 4CO2A 3VHQA 4DSLA 4ER8A 2ZNZA 1WKJA 4FBTA 4A8QA 4JI3I 3U1LA 3KLFB 2IRXA 4AD6A 2M8DB 2IIHA 2RAQA 1QM9A 1JK9B 2WNRA 4ZJLA 3CJKB 3Q8RB 2BE7D 3VWSA 3MAAA 2M9KA 5BYSA 1C0UB 1RWKB 2ROGA 2GIQA 1FFSB 5E2QA 3IC1A 2IA6A 2EW9A 1TQLA 4WFZA 1JJ2R 1S0NA 1GNKA 2WOMB 2DHHA 2EFNA 2LYVA 4KKOA 1SC4B 5D4LA 3RZAA 2ZKTA 2D69A 3CW2C 1NXIA 3PYFA 1N34E 2MQQA 1X9SA 2F8EX 2ZC4A 5EL9A 4X4RA 3J7AN 4A4JA 2NXNA 1TKZB 1WSRA 4LF2A 3BQ2A 4IZJA 1AUDA 4FP9A 3NG8A 3MM7A 1T9TA 2Y1RI 3QYYA 1SCJB 1U0HA 3PRVA 2GO3A 1P6TA 3DDIA 2H5JB 1JLGB 3JYTA 4X4PA 2VPWB 4LF4J 2DO0A 1RTDB 2CPZA 4M63A 2HFUA 4IG3A 3IFEA 4NXNJ 2F4VJ 2M5YA 3PEHA 3V5RA 1GMWD 4MKBA 1WSVA 2AGOA 4HACB 3R8YA 1U6BA 3K5MA 4K2XA 4DQPA 2JC1A 3TUZC 5DQHA 4OZ2A 3QRPA 2CVEA 2PNMA 3P8BB 1C1CB 5HVHA 2DGVA 1FHTA 2R7QA 2HWHA 1UCNA 1RT4A 2Z2ZA 2BXJA 2F5GA 2JDJA 2ZFHA 2CFXA 3JTOA 2MMYA 5HP1A 4YB6A 2CZ4A 3C3LA 1EQ0A 1JB0C 5J1EA 3WIVA 2IMWP 3M9OB 3QWPA 3MHYA 2F3JA 3CVKA 2YNFA 3KLIB 4TY9A 2KL8A 4DR7F 3H4BA 1TP7A 1UPPA 1HNWJ 4LIRA 4M5DB 5IWAJ 2H1YA 2Y8YA 4OX9I 4OYOA 2KG0A 2ZOGA 1TR0A 4C11A 4EO6A 1N33J 4X62I 2KFNA 1NH7A 1E6YA 3M8SA 4KHPF 3K5OA 3LAKA 1IKWA 3R5GA 2C38B 1QE1A 1ZM2A 2B8PA 3KUHA 4YY3I 2XCPA 4PZVA 3P6YC 4LVOP 3DRPB 1RTJA 1M1HA 5DLFA 4DFPA 4W90B 3DLKB 3I82A 3UO0A 1ZZFA 4LF9J 3J7AM 3FMWA 2COLA 1HNVB 1UFWA 5DETA 2QA1A 2H54B 1RKJA 4J9VA 4LSZB 1HPZB 3LWMA 2R2UA 3LH2S 4KGMA 5JEAB 5LSRA 4ZIWA 4WUCA 4HL9A 1FFGB 3V6JA 1NHVA 1LW2B 3TVYA 5I4MA 5J2MB 2YNIA 1ZAXA 1AT1B 2EFOA 4DR6F 2G0CA 2C37A 3C8YA 1WKKA 1IXKA 1GH8A 1NDPA 2ZH9A 1Q5YA 5KG5A 4DR7E 4NYPA 1TV6A 3KKFA 4ALZA 1MWZA 2RE1A 2B9EA 4L75A 4PWDA 2XMAA 1F9EB 2YQ0A 4O3QA 3DRSB 3ZXWA 1JQGA 3Q8UA 5L1JA 4AT1B 4CNYA 5D15A 1AB8A 4DQRA 4KHPE 2O67A 4OYZA 4USTA 2XNQA 4I2PB 2G13A 5BJRA 1QLNA 4A47A 5HBMB 2VOOA 2Y3YA 2JLGA 3MPWA 3M8QB 4I68A 2Y0BB 1GAOA 1H73A 1ZM3A 1RHMB 3MM5A 3OLBA 2HIYA 2G0IA 5ETKA 4KO0B 2C3YA 4ZVQB 4Q8FA 5FD1A 3QRRA 4B3OA 4MU0A 4BLGA 3OTOF 4ED8A 5LJ5Y 1B63A 1NZ8A 3AD9C 1ZAWA 2J7WA 3LP2A 1XN9A 3A3PB 3R27A 4OO1B 4P9SA 4LFAF 1QAYA 3LA0A 1S9GB 3KMSA 3IM8A 4DR6E 4ZKAA 2B3TB 5H9EJ 2E1MC 2QTWA 1S9FA 1AROP 4DEZA 4NBQA 3FSIA 4DI6A 3H5YA 2DH7A 3EPGA 4DU8A 2VZ9A 3DOKB 1T9XA 4DV2J 1DQ9A 1GTEA 2XY5A 3BKTA 2YWEA 4RL1A 2OTJS 2MZSA 1LW0A 3DXSX 4JI4I 4NYOA 2OKQA 1JLCB 4GMKA 2BQRA 1UDSA 2JVOA 3MEDA 4RNNA 2UUTA 3N28A 2XGPA 2HVIA 4L6V3 3HHNB 4M8LA 2DY1A 1H7WA 1DLOA 3UN2A 1FXDA 2DIUA 5DGBA 4DV3J 2NLWA 2KXHA 2E66A 1X4DA 3E01B 1WHYA 3H4DA 3SV3A 3OTOE 3A3NB 2CKWA 2PI5A 1RP5A 3IRXA 4UQTA 5LL6R 3MEKA 2FLOA 2B4UA 3FZBA 5K8OA 3BS9A 1PSDA 5K36C 4D3GA 4LFAE 4LFCF 1KOHA 5L9NA 1NSPA 3TEHB 5F0WA 2Z0GA 1BC6A 2DISA 4PCQA 3LO3A 4QIFA 5IV3A 1RWUA 4DR4F 4MQYA 4JP8A 3POTB 3P5TL 5J1PA 3US5A 5D6GA 1T8EA 1USUA 4OV6A 3RBDA 1LFWA 2OH2A 1S6OA 2BKOA 1UVIA 2M88A 1NO8A 2Q66A 3KJVA 4IZJB 4QCLA 3Q83A 2PE8A 1IKVB 3W3SA 2VQEJ 3MM7B 3CJRA 1IBKI 1U0HB 3JYTB 4WK3A 4RNOA 1S1TA 4NLXA 3OTDA 2Q2EB 4JG4A 3PJXA 1ULRA 3E51A 2E5JA 4DV0F 2UUAJ 4IFYA 2KYZA 5KG1A 1JKHA 3MMAA 2OAUA 5HQMA 5JXSA 5ETLA 4LFCE 3OUYA 4WFAQ 3BDEA 2VL1A 3VAFA 4CH1A 5GAGI 4LF6I 2WVCA 3L7ZA 3ZO7A 2UUBJ 1HK7A 2MYFA 1OSDA 1VQPS 5HP1B 5MLCV 5HATA 1BWVA 4DV7J 4DQIA 4KC5A 5HJXA 4O4RA 2MZ1A 4DR4E 2DNOA 1MMDA 2XO7A 2YNFB 4J9RA 1HI8A 3PM9A 3ZNUA 3I5AA 3VAKA 4J7CA 3ILOA 4YUDA 3DOMA 2D3O1 1ELOA 2XGQA 2JLFA 4C11B 2HG4A 1TVRB 3C15A 1FDNA 2LP4A 2NZCA 4ES1A 1GEHA 3JSMA 5L46A 4DR7I 2J7UA 1LWCA 2XYGB 3FCHA 3DGVA 5IQ6A 1FXRA 3ENVA 1UKUA 3GSDA 2M70A 4L72B 4QJVA 2FJBB 4C8OA 2CJQA 2EG2A 1M5VC 4KT0C 4K4WA 3K5NA 3MXHP 3FQLA 3TR5A 1GT8A 2JFDA 3QIPA 4ZVPB 4DV0E 2CXEA 2XC9A 3PTWA 2W9CA 2IHR1 4WFNQ 3CCQS 2ALYB 3NGDA 1YRXA 4ECZA 1QSSA 1CJKB 4OLPA 2D41A 1IKXB 2HFSA 2HWIA 1QAIA 3RRKA 3K57A 3SDEB 1Z0WA 1TK8A 2M8HA 4KR0B 2C37B 3D68A 1RU2A 1RT1A 1SJQA 2YY3A 2NSCA 4CH7A 1R7IA 3H2VE 1NK5A 3LPSA 1RT2A 2XMTA 3QZ7A 2LVWA 2DNHA 5K8MA 2HZCA 2BE9B 1EB0A 2YQ1A 3CWVA 1GMVA 5FLXQ 5HLFB 1RKIA 3UR3C 2B0GA 4NXMF 1ZBTA 2QA2A 4AIMA 2DJWA 3PNIA 1G2EA 3PX4A 2DNLA 4MK8A 4OFZA 3AD8C 3S8SA 3OTCA 3K5LA 3FCVA 5F8HA 3CO9A 1NH8A 3LANA 4FW5A 1L3VA 2RS8A 1KRPA 3MM5B 4KFBB 4RW8A 3W9HA 2XSFA 3T6JA 1A9NB 1WF2A 3QJPA 3IS9A 5IT9Y 1Z0BA 1WKLA 3LP2B 3BDPA 1CSJA 1FXLA 3PW5A 3MMBA 2AQ4A 4EFAC 4U95A 4L74A 1BE4A 2KN4A 2QLFB 3EVMA 5L38A 5HVFA 3TUPA 1EHWA 2G1HA 2BE2B 2HZVA 4B17A 3RRHA 3GTYX 2C3PA 1E6VA 5DNXA 3JTPA 3OTOI 4O0NA 4E98A 1VQSA 5F9LA 5KFDA 2DGUA 4LR8A 5A8WB 2W9AA 2IYGA 2F1DA 4OZ5A 3BPDA 4LFAI 1EAYC 1Z5CA 4TQSA 3LGNA 4RNHA 2BDPA 4ZP6A 2JOQA 1XQIA 2HMIA 2MJNA 5DDOC 1S77D 2B4OA 1U49A 3OXGA 3GFHA 3PX0A 3QQCD 5KT6A 4H54A 3GYGA 4NXME 4P74A 1JWWA 2WVEA 4QIVA 5GAHU 1LW0B 1QVFR 4N8OA 2AIRB 4DN9A 5I3UB 1UETA 2QLXA 4RUBA 2HBZB 1WEZA 1DRZA 4RR5A 4YB1P 3RR8A 3BREA 3NOGA 2M3DA 3R5BA 1RAJA 3Q8PB 1QAXA 3RUBL 3EICA 3ZTRA 4IR9A 2B7BB 4QR0A 2WB4A 1RYSA 1DLOB 4K0KJ 5KTQA 1S1XB 1R8CA 2WSEC 4NCAA 1PYTA 5LSLA 2R9LA 1FE0A 3VZHA 3IRXB 3AXKA 3VTIA 1IBMJ 2DGTA 2ZNYA 4DMZA 3T19A 4TYAA 1Y10A 2WSCC 4X64J 4AQYI 3CSKA 3BGUA 4ZP7A 1HNXJ 1SBRA 1S12A 2ZZTA 3N79A 4CLWA 2E5LE 2VPZB 4U7UD 1MN9A 3PW0A 2NN6C 2QGFB 1M90T 4OZ0A 1PBAA 1HL6A 1HNZF 2VIHA 2VASA 4TU7A 2GVDA 3R9LA 1YGYA 3CGIA 1F5AA 4F4YA 1T3NA 5A76A 2DVIA 4R8UA 2AX0A 3M85G 4Q2MA 1F1BB 3PHTA 1D9FA 1VQ6S 3OL8A 4R5PA 3THVA 4DR4I 4A8WA 4CCHA 3CD6S 2JEJA 4Q0BA 2GAGC 4DUYJ 3LGHA 1RHYA 1N0UA 3V4MA 2V94A 1VS3A 3PG9A 4WU2A 3T1HE 2WHOA 3T6BA 2HQCA 3LW5C 3DD6A 3SQGB 3S6EA 1Y7PA 4TXSA 2CAJA 5B0BA 3Q8SB 4DCJB 4MAKA 4QIGA 2FJXA 3PJ9A 1D9DA 3FQKA 4CT8A 1JKHB 4GC7A 3MMAB 1TL7B 4EGLA 4NA1A 1RR9A 4ATNA 1J5EJ 2DNZA 4NI2A 1XEZA 3OUYB 1RTZA 3CO0P 1BKNA 2CADA 5A2QC 4K4TA 2ASJA 1DURA 1RABB 3KLHA 4P7AA 1NEEA 1PCAA 4ZITA 3MPUB 2Y1IA 2HQIA 3QT6A 4AL5A 2XCAA 4WE1A 2HQFA 4USKA 3IRWP 2EFGA 5EWGA 5A8KB 2MHNA 2VPYB 2MEWA 1VIXA 3DOMB 1DY3A 3UD5A 4HHJA 4F3OA 1LOUA 2GS8A 2HBYB 1CVJA 4GKKF 2I38A 4GVBA 2WW8A 1RE1B 4HY1A 1LWCB 3DLHA 1U1RA 5C0XD 2EBEA 3I5BA 3R7SB 3CCES 4QW8A 2UXDF 4B9TA 1KS2A 3KLEB 1U1OA 2ROPA 2ZVSA 1FD8A 2XHWA 3T41A 2GGPB 2BUNA 1HLWA 4C98A 1S1UB 3ONQA 4FWDA 4ZDNA 3J80U 1YSJA 3OJUA 2B8QA 3ZZTA 3QIPB 4I7FA 1SKRA 4FDFA 4CLLA 2CQ4A 1NSQA 4ED0A 1FNXH 4B9VA 1NNDA 3TZXA 3BO2A 4YOEA 5FLXY 2VFVA 1G1XA 1IR1A 1RTIA 4X2BA 2J9DE 1DFDA 2ACMA 4ZN1A 1CJTA 2FUG9 1UDQA 3CEDA 4UY85 2DNNA 2KU7A 2A10A 3SV4A 4UT4A 1TKXA 3EGWB 1RT1B 2E44A 3GILA 2HW3A 5D4PA 3WBZA 1NDKA 3UFCX 4CTAA 4RW4A 3GSIA 1JLQA 2DT9A 2QL9B 5KG2A 4I1TA 4OQJA 4DXLA 4X84A 4LFBE 2C3MA 1U1PA 1FT8A 1VQ8S 2ZVIA 3UCGA 1V3ZA 2DR8A 5BR8J 1JNZB 2R7OA 1UJ6A 9RUBA 4ED4A 1Y5NB 3R3TA 2UXDE 4BWMA 3HCXA 5L1LA 2C3OA 3QSYB 1X4EA 4KAIA 3M4XA 3EX7B 4IFVB 4CO1A 5C2GA 3RBZA 3LAMA 2RILA 3IR6B 3L09A 3R1HA 4NXMI 4IZKB 3WIUA 2JEBA 2OEKA 4OYAA 4RW8B 5JUMA 2I6WA 3MR7A 3LUYA 1XR6A 3VAJA 1BY9A 3IS9B 2HRYA 3EDQB 1DBDA 1N48A 2FJAB 4RNMA 1WHVA 2GQ0A 2HVZA 1Q8KA 1LWFB 1IBLF 3NEKA 1HYSA 3MMBB 3E8OA 1KFDA 5EHHA 2N7CA 1SJFA 2UU9J 2ATCB 3K8WA 1USVA 4E8UA 1Z2LA 4UW2A 3DLJA 2BM0A 3H5UA 1KHWA 3GJSB 2X3DA 5AT1B 1IUJA 1WF1A 3BM7A 2MY8A 2MZTA 2B51A 3SFGA 4GVLA 2WVBA 4DR5J 4EI2A 3I9ZA 1PGZA 1R8HA 5GAHI 5K14A 2UUCJ 1NJYA 1FNMA 1PYSB 1RT3A 1N32F 4DR2F 1ITPA 3IGVA 5K8PA 4NRUA 5IT0A 4DJBA 3UR0A 2AYBA 1M5KC 1N88A 5F8NA 3ZKDA 3SSSA 1A7GE 2EKNA 2MZRA 3J81Q 5J1NA 3D0IE 1JJCB 3HHKA 3DI6B 4A8OA 1ZA1B 2HHQA 5HMWA 1YJTA 4ZLJA 2HHSA 4B3RJ 4O0IA 2DR9A 4QYZK 3HKZD 2X51A 2MQNA 1FO1A 2A1BA 2MZJA 4PG6A 1IBLE 4QNKA 3PW2A 4BHQA 1S1VA 4B3SJ 1IBKJ 4ZLPA 4NRTA 1K47A 1NK4A 3W66A 2D3ZA 1PYOB 1U2CA 2V9WA 5D0HA 3IN5A 3MM8B 3HP6A 3OHAA 3QAUA 3PRDA 5K8NA 1WEXA 1RT6B 3GIRA 2ZDPA 5FDLB 4K7QA 3PFOA 4L3NA 3TWZA 4IG0A 1N32E 3AD7C 4DR2E 2KM8B 4AE5A 3OTEA 1JLAA 4PUOB 3MPDA 4KV8A 4R8UB 1WHXA 3F44A 2I5JA 2Q6BA 3VAGA 4LF8J 1REGX 2X1FA 2RS2A 1E3PA 2ZJPQ 1HNZI 2GA7A 4Q0BB 2DKOB 1RBOB 1FKPA 3LP0B 1S9EA 4I6YA 3IWXA 4N77A 5C0XB 4PG8A 4HI1A 1JXVA 1D9AA 3TO8A 2HRTA 5DM6Q 2AT1B 1U6FA 1FKOA 3ELHA 1U45A 1KSPA 5B0GA 2GQCA 1NHUA 1WOSA 2Z5CA 2GMJA 2EVZA 4B9MA 2GIFA 4ZPCA 4NXNF 2F4VF 5U47A 3MEGA 4WZMA 3H90A 1FKAF 4IDKA 1SJ4P 3DGPA 3D2WA 2ZZMA 1KEKA 2ZHOA 2JWNA 5D3GA 2AKWB 3PJWA 2DHSA 4K4ZA 2CNNB 1TK0A 1RHJB 1M5HA 1HR0E 1XTZA 3A12A 5C7PA 3NCQA 4NOHA 4CT9A 3MAQA 5IOLA 2MGZB 5DZ7A 2PO4A 3DU5A 3CCRS 1S7IA 3P76A 3FEYB 3W5YA 3PR5B 4G1QA 4B02A 1HNWF 3JB9k 5IWAF 2ABYA 3DHWC 4P7VA 1ZYQA 3THPA 4Y2IA 1N33F 3RAXA 2GJIA 3QRQA 4XDCA 2YVSA 1HBUB 2HHVA 1IWGA 5CABA 3HPOA 2J9DA 4JI6J 1WNEA 2AV5A 4NLWA 4XK8C 3GIIA 4GKKI 1P9QC 4ANDA 3GZ7A 2XS5A 1N6QA 5D4OA 4W92B 3EJMA 4I67A 1RAFB 2HFOA 3I55S 1IN0A 3NNAA 5LMNJ 1P9YA 4I7FB 1XNRJ 4LF9F 1U2RA 2VG6A 2NUHA 1NRKA 2CG4A 5ETRA 1VIOA 4NXNE 2F4VE 3QLHB 2HIQA 1FKAE 4MK7A 4OYWA 3HJFA 2NREA 5K36D 3KTQA 3D0HE 4WFYA 5IC4B 3AJ1A 3G86A 1FERA 3KUGA 2MY7A 1JJHA 2B9WA 3ZZUA 3N6NA 3C6UA 1MU5A 3AOAA 2H5EA 1SUQA 2W01A 4PXEA 3BR9A 2LCWA 3ENWA 5LM7E 2K7JA 4NYZA 1KBRA 1MROA 5B0FA 3MCNA 3KDNA 1JLQB 1N5QA 3MZIA 4C0HA 2R8JA 1HNWE 1LXNA 1R0CB 1NPKA 1CJUA 1NHJA 3QAEA 1CPZA 4DS5A 3J7ZT 2MKJA 3G96A 2W4CA 4QU7A 2BA1G 2D3UA 1N33E 1HBMB 1RGVA 2PNLA 3W62A 5LXYA 2KZMA 2YH1A 4IFDC 4MIWA 3QNWB 1NZAA 1HWJA 2VG5A 3NGRA 3VV2B 4QPTA 3RJMB 1K0TA 1YBAA 1T03B 3AXMA 2HEKA 4FKYA 2E7WA 2JEBB 4CLYA 2NXEA 4LF9E 1HBNA 2DRBA 1YJ7A 3BQ1A 1YZ7A 1ZH5A 3ET6A 1N8RT 5KFRA 2JEAA 2DNRA 1G6BA 2FY1A 1WC5A 2A6OA 3CJ5A 3GONA 3T9NA 3HK2A 2KDOA 2KHCA 4MKVA 1KNZA 4WKYA 4DOZA 2ZH3A 1ZPVA 5D0GA 5DRPA 4WF9Q 3R5AA 3SBMA 2GMLA 1OQ6A 2MKHA 3MMCB 2XSJA 3H2UB 3K59A 1IBLI 4WFBQ 1HNIA 2ADCA 3J81Y 4ICLB 1FI4A 1TKTA 3MEEB 3K17A 2LDYA 5K14B 1UPMB 2VPXB 1H98A 1RT3B 3RAQA 4AM3A 3CJ2A 4KGVB 1YKWA 5KFOA 3TUJC 1GMUA 3GB0A 2BJ9A 5F3ZA 4YR3A 4QQBA 4NLGA 2R4FA 4DV2F 1WTBA 5EUHA 1WC3A 1OO0B 2XZDB 2YNGA 2P6SA 2KT2A 3DXBA 4DX7A 1PJ7A 1MN7A 2PT0A 2Z2YB 3A8IA 4PXBA 2PIIA 3IG1A 4IQXA 2HVDA 2PSZA 2BBEA 2W1BA 1X9MA 4OI3A 5C5JA 3BKUA 2HGNA 3WU3A 3TZWA 1RLCL 2K1RB 5KFWA 2KH9A 3DOLB 5DDPC 1HHQA 2B9XA 1KLMA 2LMIA 2VBYA 1BD6A 5C42B 3HVRA 5BYQA 2GJ2A 5JMNA 1WEYA 2WONB 4DV1I 5GADI 1YX2A 3V2UC 4DV3F 4O3OA 3PV8A 4DR1E 2R7RA 1FA0A 4OZ1A 2RDDA 1RWMB 5GMEA 1S6PB 2LXFA 3OSPA 3GIKA 1F5BA 2HKJA 1WTFA 1U8WA 3FSYA 1HW8A 1OWXA 5C24A 3MCMA 2NR0A 2F40A 5LMUJ 2A3JA 1MLAA 2FLPA 4P71A 1L3TA 2UXBJ 1IQTA 1REVA 1FNOA 5EX3A 3EXYA 2DR7A 5ETPA 2W2PP 4WFXA 5EGYA 5HAOA 3PYEA 5A8RA 4KV8B 4UOCA 4KH1B 3PS1A 2XM3A 3GV5B 4AUKA 2EBGA 2VC0A 2HNDB 3HHLA 3UNYA 2AF6A 3DCAA 1VQOS 1FKPB 1U26A 1EETA 1KC8T 1S9EB 2V63A 5G0RA 3W8PA 2RDJA 2FGCA 3MI7X 2OSRA 4DQSA 4ZN3A 3GJTB 3V6DA 5JVGQ 3A13A 6FDRA 4OHYA 1NHKL 2LFVA 1O8BA 2NPFA 2VQFJ 4YDDB 3Q8QB 4OJHA 2Z5CB 1X4AA 3TOQA 4DV6I 2MKIA 1X5PA 3QWUA 1Q81T 4DV3E 1B3TA 2UUAF 2VODA 2EFQA 2EFPA 1TUWA 2HAFA 5JEAF 3G6VA 3DGPB 3FGVA 4LF4I 1NLKL 1C0TA 2VG7B 1WC1A 1TZ0A 3V4IA 3MUTP 4NXNI 2F4VI 4YFUA 2VFUA 1KP6A 4RW9A 2NSBA 4WK1A 3ZM7A 2MQPA 3G9CA 2BQ3A 1IBCB 3H40A 2UUBF 1YWXA 3LWLA 4DV7F 3U1YA 5FWKA 5DM7Q 2V2ZA 3TAPA 3JQJA 4IUFA 3PIOQ 1X4BA 2O1TA 2HHPA 3I9V9 4C7QA 2IM3A 4PU9A 4B3TJ 5F41A 1G4CA 3DN9A 1Y5YA 4NLSA 5KT7A 4UQGA 2HQGA 4C8LA 2FVPA 3U1KA 2FLNA 3GCXP 2E9RX 2QL5B 2QMWA 4FXWA 5IWAI 1IKYA 3JXOA 1OQ3A 4PG7A 4DV4E 3A8JA 1N6QB 1BHNA 1N33I 4PXCA 2KXNB 5H1SV 3GQCA 1P1TA 5DZ6A 1VQ4S 2R8KA 1RISA 4LR9A 1T11A 4CM0A 2UUAE 3AAWB 1EQMA 1WJ9A 5JEAE 5HSPA 1JX4A 2AX1A 2AU0A 4LF9I 2L9DA 2VA2A 2DEJA 1NKEA 2LEAA 4I56A 3C6UB 5A0YA 4LJMA 4HYMA 3P96A 4O3NA 2NN6D 2UVVA 3GYXB 4PYDA 4A48A 2UUBE 2QSFA 2V2VA 4YQWA 1MROB 1CQMA 1S1WA 4DV7E 1S5ZA 2DY9A 2P9GA 2RQKA 3KMQA 2DPJA 1CJUB 3AJDA 3OR1B 3Q8YA 3ZTPA 4Y00A 2YKAA 5F8IA 4O3PA 3KG1A 4LT6A 3NS5A 4U96A 2HHUA 2VJUA 3BN4A 3W2WA 3M6AA 1N56A 2C2EA 2W4PA 5IM0A 2FVSA 2VG5B 3JSRA 3MURP 1T9YA 1T0TV 3HSZA 1FJGF 7AT1B 3TANA 3N6LA 4M5KA 4MYTA 3PEJA 3DLGA 3G6XA 1NM2A 2XS2A 3HZEA 3H0PA 1UZHA 2BOAA 4YR0A 1OY8A 4NZ7A 3TAMB 5T14A 3ET6B 2YWKA 4ZVEA 2FY8A 4ZOSA 5DJBA 4WIQA 4J9QA 1C4CA 5IT4A 1RHKB 1NK7A 4NL5A 3FBCA 1Y60A 3GYNA 2OIHA 4C3MA 3AHPA 4QU6A 5KFEA 2YX7A 2BOPA 1FX4A 1HNIB 2O3ZA 1ZTTA 1NSAA 3BO4A 1TKTB 4ES2A 3AOBA 2QFJA 1XR5A 3HF5A 4JI3F 3I5CA 4EBDA 5LOQA 5DQIA 2MQLA 4W98A 1GTHA 3OL9A 1H2TZ 2ZBCA 2E5HA 2HQDA 3HI9A 2W8LA 3L9ZA 3KLFA 4QNJA 2O3DA 3TJAA 3QIDA 2ZOFA 5FLXC 5A2QQ 3CCJS 3NOCA 2NPIA 2JNJA 4DR3J 3KK3A 3AFGA 2RQMA 4WXOA 4HT7A 1KVJA 2C3UA 1C0UA 4OJGA 4ECUA 1FJGE 4DV2I 1RA7A 4UOFA 4J9OA
chains in the Genus database with same CATH topology
1EI1A 4LF4E 1Y6ZA 2ZBKB 4IZKA 3HJCA 2HK2A 4K0KE 4JV5I 3JAMC 2X36A 5LMNE 3B78A 1XNRE 3QT6A 4GKJI 4USKA 4JI1E 2EFGA 3K1JA 3LTOA 2UXCE 1XNQE 3K85A 3ZKBA 2HK3A 3PYEA 4JYAI 4LF7I 4DR7E 3PRYA 2Z5CA 1OJ4A 4DV0E 4GKKE 4LFCI 4KQVA 2A2CA 4I3HA 1KVKA 3J80Q 1B62A 5BR8E 4PRVA 2V8PA 3Q1QA 3T1HI 2GS8A 1KIJA 2O1WA 4JV5E 3J80C 2VQEE 3QT5A 3Q6MA 4HY1A 4GKJE 2HFSA 4KHPE 1H74A 3QT7A 4HXZA 4JI5E 4JYAE 4LF7E 4UTGA 1HR0E 4JI3E 4B3RE 1N32I 4DR2I 4IZJD 2UU9I 1Z0WA 4MYUA 1N36I 1UEKA 1XMQI 2NPFA 4DR1I 2HKEA 5IWAE 4FWGA 4JI8I 4DUZI 4FWDA 4JI4E 3ZZTA 2Z5CB 1H73A 1FWLA 1ZM3A 1VISA 4DV6I 3LPSA 4URLA 2VF3A 5L3JA 4DV3E 2E1RA 3HULA 4DR5I 3B82A 1FJGI 3CWVA 2UU9E 2UUCI 5FLXQ 1N36E 4LF4I 3WU6A 1B63A 4K0KI 4WUBA 4B3MI 1H72C 4X66I 4JI8E 4DUZE 3PYGA 2BM1A 4NXNI 1H7SA 2F4VI 1IBMI 2UXCI 1QZRA 3ZM7A 2CZ9A 4UT4A 4DV0I 4GKKI 4X64I 4DR6E 2J7KA 3JAMQ 2O1UA 5FWKA 1HNXI 1PKPA 4LF8E 1U2RA 2V2ZA 3QT8A 1PVGA 4B3ME 4JI7I 4DPXA 4X66E 2VQEI 1ZXMA 4DXLA 2O1TA 4LFBE 4PU9A 4DU8A 4NXNE 2F4VE 4KHPI 1IBME 2R3VA 1FWKA 1FKAE 4JI5I 2ZITA 1Z0BA 4Z7YA 1HR0I 4JI3I 4B3RI 4R1FA 4X64E 1XMOI 4ED4A 2O1VA 3D4JA 2UXDE 2R42A 5IT9C 2UXBE 3ZZUA 1HNXE 1PIEA 4WUDA 4JI2I 2OI2A 5IWAI 1MU5A 4JI4I 4B3SI 2Z5BA 4JI7E 3Q6NA 4DV4E 1WUUA 3J81C 3OTOI 1MG7A 1N33I 4DV3I 4PRXA 3LNUA 4AQYE 1S4EA 4NXMI 4M1KA 2WW4A 1NHIA 4IZKB 4DUYI 1MX0A 1XMOE 2V2QA 2CGEA 4LFAI 1Z5CA 1HNWE 2UUAE 2UUBI 4JI2E 1NHJA 4B3SE 1IBKE 3T1YI 4DV7I 2LJPA 2GQ0A 4ZVIA 3OTOE 4LF9I 1N33E 3PYFA 2DEJA 1N34E 4YHHI 2PNLA 4LF5I 5LL6R 1USVA 3P06A 4NXME 4DR6I 4DUYE 3F0NA 4HACA 4HYMA 2BM0A 4LFAE 2ZM6I 4LF8I 4USMA 4OX9E 2UUBE 2V2VA 1J5EI 4FWHA 4IZJA 4DR3I 3T1YE 4X62E 3J7AG 4LFBI 4DV7E 1H7UA 4LF9E 1D6TA 4YHHE 4LF5E 2AJ4A 4DPUA 5LMUI 3B8HA 1A6FA 1FNMA 4LF6E 2UXDI 2UXBI 2ZM6E 1USUA 1ZXNA 2HFUA 3GONA 2IOPA 3WU4A 3V5RA 4DV4I 1J5EE 4DR3E 4JI6E 3M6AA 1EA6A 4HACB 2V34A 5GMDA 4AQYI 4DPYA 1Z59A 1Z0VA 4DV1E 5IT9Q 2PNMA 3ZKDA 5LMUE 1IBLI 4IZJB 4DPWA 3PYDA 2BV3A 2E5LE 3J81Q 4P52A 1HNWI 1FI4A 1N0VC 2UUAI 4JI0E 4XTJA 1Z0GA 1HNZE 3K17A 4MYTA 1IBKI 4N3OA 2Z5EA 4B3TE 1Z5BA 3ZZ0A 1N34I 4DV2E 1NZ0A 1Z0TA 2Q2EB 4JG4A 3H4LA 4FN5A 1KTVA 1IBLE 2VQFI 4OX9I 4X65I 2HHHI 1DARA 4X62I 4DR4I 1K47A 2A2DA 1ZM9A 4LFCE 1N0UA 4Z7CA 4LF6I 3T1HE 1ZM2A 4YY3I 4EMDA 2DEIA 2Z5BB 2XEXA 1HK7A 2VQFE 4X65E 2HHHE 3WU3A 1Z0CA 4DR4E 4JI6I 4DPTA 1N32E 3J7AM 4DR2E 2IOQA 4DV5I 1I94I 4DV1I 2X7IA 3V2UC 1NHHA 1XMQE 2CG9A 1ELOA 4DR1E 1Z0EA 5LMNI 1Y4SA 4YY3E 1XNRI 1Y4UA 1KKHA 2E5LI 1RR9A 5GMEA 5FLXC 4FW9A 5A2QQ 1S16A 1Z5AA 1RREA 4JI1I 4JI0I 2HKJA 1HNZI 1XNQI 4DV6E 1XHKA 3WU5A 1BKNA 4DR7I 4B3TI 5A2QC 1ZM4A 4RPFA 4DR5E 1FJGE 4WUCA 4DV2I 5BR8I 2UUCE 4DV5E 1I94E 4P7AA 4DU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI1 A;  4LF4 E;  2ZBK B;  2HK2 A;  4K0K E;  4JV5 I;  3JAM C;  2X36 A;  5LMN E;  3B78 A;  1XNR E;  3QT6 A;  4GKJ I;  4USK A;  4JI1 E;  2EFG A;  3K1J A;  3LTO A;  2UXC E;  1XNQ E;  3ZKB A;  2HK3 A;  3PYE A;  4JYA I;  4LF7 I;  4DR7 E;  1OJ4 A;  4DV0 E;  4GKK E;  4LFC I;  4KQV A;  2A2C A;  4I3H A;  1KVK A;  3J80 Q;  1B62 A;  5BR8 E;  4PRV A;  2V8P A;  3Q1Q A;  3T1H I;  2GS8 A;  1KIJ A;  4JV5 E;  3J80 C;  2VQE E;  3QT5 A;  4HY1 A;  4GKJ E;  2HFS A;  4KHP E;  1H74 A;  3QT7 A;  4HXZ A;  4JI5 E;  4JYA E;  4LF7 E;  4UTG A;  1HR0 E;  4JI3 E;  4B3R E;  1N32 I;  4DR2 I;  2UU9 I;  1Z0W A;  4MYU A;  1N36 I;  1UEK A;  1XMQ I;  2NPF A;  4DR1 I;  2HKE A;  5IWA E;  4FWG A;  4JI8 I;  4DUZ I;  4FWD A;  4JI4 E;  3ZZT A;  1H73 A;  1FWL A;  1ZM3 A;  1VIS A;  4DV6 I;  3LPS A;  4URL A;  2VF3 A;  5L3J A;  4DV3 E;  2E1R A;  3HUL A;  4DR5 I;  3B82 A;  1FJG I;  3CWV A;  2UU9 E;  2UUC I;  5FLX Q;  1N36 E;  4LF4 I;  3WU6 A;  1B63 A;  4K0K I;  4WUB A;  4B3M I;  1H72 C;  4X66 I;  4JI8 E;  4DUZ E;  3PYG A;  2BM1 A;  4NXN I;  1H7S A;  2F4V I;  1IBM I;  2UXC I;  1QZR A;  3ZM7 A;  2CZ9 A;  4UT4 A;  4DV0 I;  4GKK I;  4X64 I;  4DR6 E;  2J7K A;  3JAM Q;  1HNX I;  1PKP A;  4LF8 E;  1U2R A;  2V2Z A;  3QT8 A;  1PVG A;  4B3M E;  4JI7 I;  4DPX A;  4X66 E;  2VQE I;  1ZXM A;  4DXL A;  4LFB E;  4PU9 A;  4DU8 A;  4NXN E;  2F4V E;  4KHP I;  1IBM E;  2R3V A;  1FWK A;  1FKA E;  4JI5 I;  2ZIT A;  1Z0B A;  4Z7Y A;  1HR0 I;  4JI3 I;  4B3R I;  4R1F A;  4X64 E;  1XMO I;  4ED4 A;  3D4J A;  2UXD E;  2R42 A;  5IT9 C;  2UXB E;  3ZZU A;  1HNX E;  1PIE A;  4WUD A;  4JI2 I;  2OI2 A;  5IWA I;  1MU5 A;  4JI4 I;  4B3S I;  4JI7 E;  4DV4 E;  1WUU A;  3J81 C;  3OTO I;  1MG7 A;  1N33 I;  4DV3 I;  4PRX A;  3LNU A;  4AQY E;  1S4E A;  4NXM I;  4M1K A;  2WW4 A;  1NHI A;  4DUY I;  1MX0 A;  1XMO E;  2V2Q A;  4LFA I;  1Z5C A;  1HNW E;  2UUA E;  2UUB I;  4JI2 E;  1NHJ A;  4B3S E;  1IBK E;  3T1Y I;  4DV7 I;  2LJP A;  4ZVI A;  3OTO E;  4LF9 I;  1N33 E;  3PYF A;  2DEJ A;  1N34 E;  4YHH I;  4LF5 I;  5LL6 R;  4NXM E;  4DR6 I;  4DUY E;  3F0N A;  4HAC A;  4HYM A;  2BM0 A;  4LFA E;  2ZM6 I;  4LF8 I;  4USM A;  4OX9 E;  2UUB E;  2V2V A;  1J5E I;  4FWH A;  4DR3 I;  3T1Y E;  4X62 E;  3J7A G;  4LFB I;  4DV7 E;  1H7U A;  4LF9 E;  1D6T A;  4YHH E;  4LF5 E;  2AJ4 A;  4DPU A;  5LMU I;  3B8H A;  1A6F A;  1FNM A;  4LF6 E;  2UXD I;  2UXB I;  2ZM6 E;  1ZXN A;  2HFU A;  3GON A;  3WU4 A;  3V5R A;  4DV4 I;  1J5E E;  4DR3 E;  4JI6 E;  3M6A A;  1EA6 A;  4HAC B;  2V34 A;  5GMD A;  4AQY I;  4DPY A;  1Z59 A;  1Z0V A;  4DV1 E;  5IT9 Q;  3ZKD A;  5LMU E;  1IBL I;  4DPW A;  3PYD A;  2BV3 A;  2E5L E;  3J81 Q;  4P52 A;  1HNW I;  1FI4 A;  1N0V C;  2UUA I;  4JI0 E;  4XTJ A;  1Z0G A;  1HNZ E;  3K17 A;  4MYT A;  1IBK I;  4B3T E;  1Z5B A;  3ZZ0 A;  1N34 I;  4DV2 E;  1NZ0 A;  1Z0T A;  2Q2E B;  4JG4 A;  3H4L A;  4FN5 A;  1KTV A;  1IBL E;  2VQF I;  4OX9 I;  4X65 I;  2HHH I;  1DAR A;  4X62 I;  4DR4 I;  1K47 A;  2A2D A;  1ZM9 A;  4LFC E;  1N0U A;  4Z7C A;  4LF6 I;  3T1H E;  1ZM2 A;  4YY3 I;  4EMD A;  2DEI A;  2XEX A;  2VQF E;  4X65 E;  2HHH E;  3WU3 A;  1Z0C A;  4DR4 E;  4JI6 I;  4DPT A;  1N32 E;  3J7A M;  4DR2 E;  4DV5 I;  1I94 I;  4DV1 I;  2X7I A;  3V2U C;  1NHH A;  1XMQ E;  1ELO A;  1Z0E A;  4DR1 E;  5LMN I;  4YY3 E;  1XNR I;  1KKH A;  2E5L I;  1RR9 A;  5GME A;  5FLX C;  4FW9 A;  5A2Q Q;  1S16 A;  1Z5A A;  1RRE A;  4JI1 I;  4JI0 I;  2HKJ A;  1HNZ I;  1XNQ I;  4DV6 E;  1XHK A;  3WU5 A;  1BKN A;  4DR7 I;  4B3T I;  5A2Q C;  1ZM4 A;  4RPF A;  4DR5 E;  1FJG E;  4WUC A;  4DV2 I;  5BR8 I;  2UUC E;  4DV5 E;  1I94 E;  4P7A A;  4DU7 A; 
#chains in the Genus database with same CATH topology
 4ED6 A;  1K9M T;  4RUA A;  3UPF A;  1QVG R;  4IO9 Q;  1P42 A;  4AID A;  3OD2 A;  4JV2 A;  1KLM B;  2WOM A;  3L95 X;  5T7L A;  3M05 A;  1HD1 A;  4K0K F;  4KIA A;  4LCG A;  5KG4 A;  1CLF A;  1R0A A;  3JTN A;  4CQ1 A;  3GFZ A;  2QSW A;  1IBM F;  3G71 S;  4URQ U;  2I1R A;  2NYH A;  4X64 F;  1VQN S;  1KQG B;  3GJQ B;  4A8S A;  2HYI B;  4BC7 A;  3A8E A;  1WC4 A;  2W2Q P;  1HNX F;  1N34 J;  3K7R A;  1FRH A;  4L3K A;  4JI3 E;  3G8S A;  1VQM S;  3ZTQ A;  4H4M B;  5DG9 A;  1JLG A;  4KHM A;  2PMH A;  5KT2 A;  4LCF A;  1RTD A;  4QWE A;  4TKT A;  5SUH A;  2E1R A;  1KQF B;  2FZC B;  1B7Y B;  2LEC A;  4Q2L A;  2J0X A;  1TKD A;  2DK2 A;  3BQ0 A;  4LSN B;  1EET B;  3WU6 A;  1C1B B;  4CO5 A;  1C1C A;  4JV0 A;  4WUB A;  5G0R B;  1YG0 A;  2L48 A;  4DUY F;  4OL8 A;  1H7S A;  1RT5 B;  3TAQ A;  4DL3 A;  1VC0 A;  3V6D B;  4OX9 F;  2PO1 A;  4HTI A;  2YH0 A;  4ECY A;  4DV5 J;  5DQG A;  2VA3 A;  2J7K A;  2RQ4 A;  4X62 F;  4DL5 A;  1H3D A;  3KLI A;  1AZS B;  1FVQ A;  4LBH A;  4M5D A;  2DCL A;  2VQE I;  3OBI A;  5KFA A;  1SQG A;  1IBM E;  2WP8 B;  4A46 A;  4X64 E;  2G9O A;  2WBM A;  1J5E F;  5KG3 A;  3PIP Q;  3BYP A;  4XPC A;  3DDK A;  5IQQ A;  1HNX E;  2AEF A;  4RW9 B;  2ZH1 A;  3DRP A;  3HFZ B;  3Q6N A;  2U1A A;  1CC8 A;  3SCL E;  3QMQ A;  3RYL A;  3LNU A;  2RJZ A;  5CXT A;  1X0P A;  1WAC A;  1PJ5 A;  2DO4 A;  4DCO B;  4ITS A;  3H5X A;  1O0P A;  4QBU A;  3BBB A;  1U1Q A;  2GVZ B;  1HNV A;  1T3O A;  4B9U A;  5IT9 U;  2UUB I;  3GFY A;  5CYM B;  5DLG A;  1F0X A;  3OXL A;  2MKC A;  4F4Z A;  4DV7 I;  2GFF A;  1PIL A;  1HPZ A;  2C2Z B;  2ZBP A;  5JEA A;  3PDN A;  2BEF A;  4DX6 A;  4DUY E;  1B0V A;  3F0N A;  2J0Q D;  2PI4 A;  1IKY B;  3OV7 A;  1LW2 A;  4OX9 E;  2DHX A;  4GC6 A;  2ZBR A;  3FC9 A;  3HD1 A;  3I56 S;  2OSQ A;  3OFF A;  4X62 E;  2F65 A;  3P3D A;  2AJ4 A;  2W8K A;  1TTH B;  2HNY A;  4C97 A;  2XWX A;  5DS7 A;  3B8H A;  1M5P C;  5ETM A;  4DUT A;  1RAG B;  3ETO A;  4ZVR B;  4PKD B;  1RBA A;  3FUY A;  1K1Q A;  1J5E E;  3G8T A;  3RU0 A;  1UFK A;  1VRU A;  1S0M A;  2AYM A;  4ZVO B;  4I6W A;  5IFM A;  2BR2 B;  2DIV A;  1A0O B;  4I2P A;  2NXC A;  2Y1L B;  2I8E A;  3MCO A;  3OT9 A;  2A18 A;  4MT1 A;  1HIY A;  2VH7 A;  3BBF A;  2VDH A;  3M8Q A;  2ZE2 B;  4KHP J;  2IVF B;  2KT3 A;  4C2M A;  4H4K C;  4NWB A;  1I3O B;  2FHK A;  4LCH A;  4G65 A;  3TA2 A;  2LA4 A;  3GPA A;  5H9F K;  4FF2 A;  4K4S A;  4KO0 A;  1K1S A;  2YWW A;  1KR4 A;  1NU4 A;  3M1V B;  3MPY A;  1SV5 B;  4QW9 A;  1VYA A;  1U24 A;  2L9N A;  5BR8 F;  2XI2 A;  4HDG A;  1ZOT A;  5IM0 B;  3ENA A;  2W9B A;  2KKH A;  3MDF A;  2RKI B;  4ID5 A;  2K7K A;  1S9G A;  1RDR A;  1U6Z A;  2OD4 A;  5GMK a;  1BWE A;  4FPI A;  2Z5B B;  2XEX A;  1W7W A;  3DLG B;  3MR3 A;  2G2Z A;  3K5P A;  4OO1 C;  2LKZ A;  1SL0 A;  3NCP A;  2LQ9 A;  1VI7 A;  4JI4 F;  1Y11 A;  4DR6 J;  3DOK A;  4I2Q A;  3N5B A;  1R6Y A;  1MW7 A;  1MU2 A;  3M6W A;  3C16 B;  1Y4U A;  5CYQ A;  4ECV A;  5A2Q Y;  2UU9 F;  1NDC A;  4XPE A;  3QO9 A;  4UOG A;  2KO1 A;  3GIJ A;  4QYR A;  4RPF A;  1OYR A;  1DTT B;  1JLC A;  3CJQ A;  1OY6 A;  3W8G A;  4ECS A;  3VVT A;  3O2I A;  1RYR A;  2C2O B;  5JJB A;  2ZBK B;  4Y65 A;  1VK8 A;  3CF5 Q;  1O51 A;  2X36 A;  3B78 A;  4DR5 F;  2CQI A;  5I42 A;  2R7S A;  3W63 A;  3N9U C;  3DFE A;  4YB5 A;  2AW0 A;  2ZKU A;  5DGA A;  1OJ4 A;  4NEY A;  3E01 A;  4CZC A;  2G2O A;  4KQV A;  5ETN A;  5BR8 E;  1SC6 A;  3EVW A;  1NK8 A;  4C9D A;  1TAQ A;  2HWT A;  3Q1Q A;  2I9S A;  1Y3K A;  3KK3 B;  1GMW A;  4GO5 X;  1KIJ A;  4ERD A;  2CDQ A;  2G1D A;  3Q24 A;  3SEO A;  3PAC A;  3J7Y I;  2VDI A;  4YEA A;  2DB1 A;  3CCZ A;  2ZHB A;  3PZP A;  1JLF B;  1FVS A;  3OVA A;  4OX6 A;  2ZH6 A;  5B0E A;  4BWJ A;  1OYS A;  5T7L B;  3FDS A;  4TU8 A;  5HVG A;  3R7N B;  1HQE B;  2HHH J;  4JI4 E;  3POT A;  4A8Y A;  1FD2 A;  2YKM B;  5J2Q A;  1R0A B;  1TMM A;  2GIR A;  3RB4 A;  3NRB A;  3L4B C;  3W2V A;  4B3S F;  1IBK F;  1KOO A;  3FJ2 A;  2UU9 E;  4KHR A;  5JVH Q;  1T95 A;  4K0K I;  1PJ6 A;  3F56 A;  4F4K A;  4DV6 J;  4FW7 A;  2C2D A;  2CQC A;  1IKV A;  2H9Z A;  1HFE L;  1IBM I;  4P75 A;  1YBT A;  2Q1L A;  1XK8 A;  3LQV A;  4P2X A;  3TQ1 A;  2CZ9 A;  4DL4 A;  4X64 I;  4XIU A;  4L76 A;  3JAM Q;  4QR2 A;  1YHC A;  1HNX I;  2C39 B;  1JMT A;  4RBT A;  1PVG A;  2XYP B;  2IM1 A;  3PHE A;  4LF6 F;  2XB2 D;  5DRR A;  3V81 B;  4IFD D;  2IYI A;  2E1P A;  1CQN A;  4JI5 I;  3BBC A;  1Q4R A;  3LOU A;  3VAM A;  1NBE B;  2YKO A;  3DLL Q;  3B6B A;  1LWX A;  4ZJQ A;  2CPX A;  4GKJ J;  4F2S A;  1SKS A;  3T1A A;  3ILJ A;  4U67 Q;  2PO1 B;  4I64 A;  3J81 C;  2ZEJ A;  2E9T A;  2HHX A;  3A1Y G;  2CPE A;  3L7U A;  2RD5 C;  4LFC J;  3TUI C;  4IRK A;  3KK2 A;  4DUY I;  4ZPA A;  1RSC A;  4UY8 T;  2BW2 A;  5GAG U;  1MWQ A;  1FWP A;  2AJ2 A;  1KFS A;  3CJ4 A;  2RML A;  2ROE A;  3SSQ A;  1TVR A;  4B3S E;  2G0J A;  1IBK E;  3W61 A;  3L7O A;  4HVZ A;  5D78 A;  3HVT B;  3Q8V A;  2A0F B;  1FRL A;  2BR0 A;  5E3A A;  2CPH A;  4PAB A;  4TVA B;  1DQ8 A;  3N0V A;  3M7V A;  1J5E I;  2J0S D;  2MSS A;  3RB6 A;  2IDE A;  2KJV A;  3VAL A;  5CD4 H;  2U2F A;  5CCM A;  2ALZ A;  4M5H A;  4ZVF A;  2DGS A;  4ZPW R;  5E7O B;  4RUC A;  2DNP A;  4J90 A;  4USU A;  4LF6 E;  2CJ9 A;  4NA3 A;  1RAA B;  5ETQ A;  1I6J A;  1YRU A;  3D54 A;  2CDR B;  3AJ2 A;  1CJK A;  4J3D A;  1IKX A;  1YZ6 A;  3TYT A;  4U8Y A;  1UWB B;  5GMD A;  4NLD A;  3UCU P;  1NME B;  2FC9 A;  1DZ5 A;  2DR6 A;  4C3K A;  3SDE A;  2J6S A;  2I0X A;  1N0V C;  2XQC A;  4IO1 A;  1LQ9 A;  4N3O A;  2B6A B;  2HHW A;  2HNY B;  3ZZ0 A;  5LMN F;  1WDD A;  1XNR F;  3RRG A;  1M5S A;  2Z57 B;  1X5T A;  1RWO B;  5J2N B;  2R2T A;  3UW1 A;  4NLR A;  1JIH A;  4F26 A;  1FES A;  1KTV A;  2AD9 A;  1NPR A;  5HLF A;  2FQQ B;  1VRU B;  1H38 A;  1FJ7 A;  3EWG A;  1ROF A;  1UDO A;  2CPI A;  1ZAV A;  3NS7 B;  1VJQ A;  1Y5L B;  1P1L A;  3CE8 A;  2XLK A;  2ACY A;  2F9J A;  1RAC B;  4KFB A;  4PEO A;  1PO6 A;  2RNE A;  3T9Z A;  4HH0 A;  4ECR A;  2QT7 A;  3ADA C;  4FW4 A;  4ZA1 A;  4LF5 J;  2IOQ A;  2FHM A;  1S4F A;  3CMQ A;  4WYL A;  4QIE A;  2HNZ A;  1RZM A;  1R8A A;  1NHH A;  1PC4 A;  4Q43 A;  3PRB A;  1W2B R;  1FDA A;  1WG4 A;  2IAJ B;  2E5I A;  2MXY A;  2UVW A;  2W9B B;  2BE2 A;  1Y3J A;  5I3Q A;  4ID5 B;  1Y00 A;  1JXL A;  3GLL A;  1RXO B;  4IOC Q;  4IQM A;  4R0E A;  5BR8 I;  2GHW A;  3C19 A;  2AJ0 A;  1HW9 A;  4XAK A;  1L3U A;  5A8W A;  3X3U A;  1Q53 A;  5LMN E;  3JQK A;  2AJQ A;  5HL7 Q;  1XNR E;  4CLK A;  4J91 A;  2RUS A;  2VFT A;  3CDE A;  4ZMM A;  3K1J A;  4TQR A;  3LTO A;  3FBB A;  3K85 A;  2HK3 A;  1F9F A;  4I2Q B;  4MKA A;  3GG1 A;  4DG1 A;  1S59 A;  1MU2 B;  5CYQ B;  1SJR A;  2BJ1 A;  3MR5 A;  2EWH A;  5B08 A;  4F0K A;  3QO9 B;  2POK A;  4OZJ A;  2F8M A;  4BBY A;  2O1P A;  1CUL A;  2GZO A;  2DXE A;  1APS A;  4OYI A;  1L3K A;  5I3U A;  2MHE A;  3H5S A;  1SH0 A;  2EK1 A;  2OEM A;  2QMU B;  2IRU A;  1FJE B;  1QDU B;  5AJ3 J;  1WG1 A;  2UU9 I;  2GV1 A;  2IJF A;  5I42 B;  3U27 A;  1YHQ S;  4YP3 A;  5HQ8 A;  1SIZ A;  4AQY F;  3BGO P;  2HKE A;  2ZH2 A;  4KGZ B;  3PY8 A;  1S1X A;  4U7C A;  2FVC A;  1HWK A;  3MD1 A;  1H2V Z;  5F3T A;  5L3J A;  1JXE A;  2ASD A;  4DR5 I;  3W65 A;  2OPP A;  4N8N A;  4R0J A;  2UUC I;  1EX8 A;  4WII A;  3LPE A;  2RU9 A;  1SQF A;  3ZZZ A;  4J9N A;  3FBE A;  1O6X A;  5C0X F;  4R25 A;  3DU6 A;  2Z2L A;  2QFI A;  1FX2 A;  3ZNJ 1;  1R8B A;  2F63 A;  5LJ3 Y;  3CC7 S;  4CLF A;  3FEZ A;  2WAQ D;  4LPF A;  1I94 J;  3NMR A;  2V50 A;  2BA9 A;  3JAM Y;  2XMV A;  3R5J B;  5L9X A;  5J2Q B;  2E5L J;  1HWI A;  2DCU B;  3DM2 A;  3GE9 A;  3QJJ A;  3I0R B;  4X4O A;  5AXM A;  3W2V B;  4KJI A;  5ETV A;  4EK2 A;  4F25 A;  3ZZP A;  2MJU A;  5KFI A;  1TL1 B;  3GV8 B;  4B3R I;  4R1F A;  2WSF C;  3NNC A;  2D9P A;  2M0G B;  1V3R A;  5KFN A;  3CT9 A;  4JV5 J;  4JBC A;  4A8K A;  3M8R A;  3HT0 A;  4B3S I;  3KLG A;  3OL7 A;  3D3C J;  5LMU F;  1T9W A;  5KT5 A;  1MNE A;  3SQG A;  4F67 A;  4AQY E;  2J76 E;  4UOH A;  1S4E A;  1SPB P;  4M1K A;  4F36 A;  2DR5 A;  3KDO A;  4K2J A;  3T1H J;  5J2P B;  2LQ5 A;  3GR1 A;  3IWN C;  1TL7 A;  3VCD A;  4ZJO A;  4HEA 9;  1CC7 A;  4ED2 A;  2Z4P A;  3TQE A;  2ERR A;  5C0X E;  4UZC A;  1K73 T;  3W1Y C;  2OPQ B;  1N36 J;  1W2I A;  2PO2 A;  1SKW A;  3UNG C;  4LF8 I;  1HWU A;  1AFI A;  2OFG X;  4ZHR A;  4ISA A;  3DRX A;  1RHR B;  3KK2 B;  3K58 A;  1VBX A;  1VK3 A;  2R8H A;  4RWX A;  2VQF F;  5A8K A;  1HKA A;  1YTY A;  2DNM A;  2L3M A;  2V8D A;  3GCW P;  1Q95 G;  1WOR A;  4ILL A;  2BX6 A;  4OZL A;  3MTK A;  2HLU A;  2VBZ A;  2O66 A;  3R6G B;  2FLL A;  2JVR A;  1I5O B;  2J8A A;  3BN7 A;  1SL2 A;  3KLE A;  4AFF A;  3RBX A;  1U1K A;  2GGP A;  2RSQ A;  5LMU E;  3FRY A;  3FK4 A;  4DLG A;  2BV3 A;  4USV A;  4CDI A;  3BF4 A;  3EMT A;  2DRD A;  3M6V A;  1S1U A;  1AA1 B;  2PFD A;  4PW