1S4EA

Pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
347
structure length
337
Chain Sequence
TVKSPGRVNLIGEHTDYTYGYVMPMAIDLYTIITDKVQLYSEHFNEKLDLTKEGSWIDYVKGVLWVLIQEGYKIGGLKKITGDLPLGAGLSSSASFEVGILEVLNQLYNLNIDPLKKALLAKKAENEFVGVPCGILDQFAVVFGKKDNVIFLDTQTLQYEYIPFPKDVSVLVFYTGVKRELASSEYAERKRIAEESLRILGKESSKEVTEKDLGKLPPLHRKFFSYIVRENARVLEVRDALKEGDIEKVGKILTTAHWDLAENYRVSCEELDFFVKKAMELGAYGARLTGAGFGGSAIALVDKDKAKTIGDAILREYLAKFSWKAKYFVVKPSDGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactokinase
publication title Substrate specificity and mechanism from the structure of Pyrococcus furiosus galactokinase
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 115
structure length 337
sequence length 347
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 2.7.1.6: Galactokinase.
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
A PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1s4eA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1s4eA01
2UUBI 3J81C 1XMOI 3J81Q 4LF7I 3D4JA 1U2RA 4JI4E 4ED4A 4YY3E 2E1RA 4JI5I 2AJ4A 3J7AG 2HKJA 4DPYA 1Z0WA 4DV4E 3LPSA 4LF8E 2VQFI 3Q1QA 2WW4A 4LF4E 3J80Q 4JV5I 4RPFA 1N36I 1HR0I 1HNXI 3CWVA 4OX9I 4LF6E 4GKKE 1ZM4A 1N33I 1FI4A 1FKAE 2V2VA 3B8HA 1MX0A 2J7KA 1XNRI 2VF3A 4DR7I 2UUAI 5IWAE 4DUZE 4LFBI 2F4VI 1WUUA 1FWLA 1BKNA 2UXDI 4DV7I 1J5EE 4MYUA 4USMA 4WUDA 4P52A 2HHHE 3GONA 4DR4E 4DV3I 2BM1A 2UXBE 1N32E 4FWDA 4Z7CA 1XMQE 4JI3I 1PVGA 4DV2E 1HNZE 4JI1I 4DV1E 1D6TA 1NHHA 2VQEI 4DUYI 3B78A 5FLXC 2Q2EB 4DR2E 5FLXQ 2UUCE 4B3TE 1N0VC 1Z0CA 4B3ME 2UXCE 1FWKA 4USKA 1NHIA 2ZITA 1FJGE 5LMUE 1VISA 3ZZTA 4DV6I 2R3VA 4YY3I 4P7AA 2OI2A 5BR8I 2V34A 4FN5A 5A2QQ 1ZM3A 4DV4I 4JI0E 4MYTA 4LF8I 4DR3E 4X62I 4LF4I 1PKPA 2UU9I 4GKJI 4K0KE 1UEKA 4DV5E 2HK2A 4HY1A 4KQVA 1Z0GA 2X36A 4LF6I 4NXME 1H73A 1ZM9A 4UTGA 3T1HE 5L3JA 4R1FA 3J80C 2A2DA 4DR5E 2A2CA 1MG7A 4PU9A 4DU8A 2GS8A 4DXLA 5IWAI 4HXZA 1IBKE 4HYMA 3QT5A 3V2UC 1J5EI 1IBME 1RR9A 1KVKA 1S16A 4JI8E 1KTVA 4DV0E 2ZBKB 1Z59A 4HACA 2UUBE 4B3RI 4JI6E 1OJ4A 1XMOE 4LF7E 1IBLI 4X64I 2XEXA 1XMQI 3ZM7A 4JI5E 2HKEA 1RREA 3QT6A 4DV1I 3WU5A 5GMDA 2R42A 4DR2I 4JI2I 1HR0E 3F0NA 2UUCI 4LF9E 1EA6A 4AQYI 4OX9E 2LJPA 2ZM6E 2DEJA 1FJGI 5LMUI 4X66E 4DPUA 4B3SE 2V2QA 4JI0I 1Z5CA 1A6FA 4EMDA 3ZKDA 1MU5A 4DR3I 1XNRE 2V2ZA 1S4EA 4DR7E 1EI1A 1I94E 4DR6E 4NXNE 1B62A 3PYGA 2CZ9A 4LF5E 4DU7A 2HFSA 4LFAE 4LFCE 4K0KI 4HACB 4JI4I 5IT9C 5A2QC 2X7IA 4FWGA 5IT9Q 1Z0TA 3HULA 3OTOE 1N0UA 4JYAE 1HNWE 4X65E 4DR5I 4DR1E 4DPWA 3M6AA 2BV3A 1NZ0A 2E5LE 1FNMA 4M1KA 3ZZUA 4JI1E 2VQEE 4FW9A 1IBMI 1PIEA 4GKKI 5GMEA 4JI8I 4DV0I 1K47A 3K1JA 1Z0BA 5LMNE 4YHHE 4KHPE 4JI6I 1XHKA 1H74A 2DEIA 4DUZI 4WUBA 4DV6E 3T1YE 1Z5AA 2EFGA 5BR8E 4X62E 4XTJA 4FWHA 1N34E 3J7AM 2UU9E 1XNQE 4JI7E 1Z0EA 2HHHI 2NPFA 4GKJE 4LF9I 4DR4I 2UXBI 1N32I 2V8PA 4DV2I 4I3HA 2ZM6I 4UT4A 1H7UA 1HNZI 4X66I 1B63A 2BM0A 4B3SI 2VQFE 3JAMC 3QT7A 4Z7YA 3JAMQ 3PYEA 3WU3A 4JV5E 1ZM2A 1N36E 3WU6A 3LTOA 1I94I 1HNXE 4DR6I 4NXNI 3ZKBA 4B3TI 4B3MI 2HK3A 1Z0VA 2UXCI 4LF5I 4WUCA 4LFAI 4LFCI 1QZRA 1N33E 1H72C 4ZVIA 1KIJA 1H7SA 3OTOI 4JYAI 1HNWI 4X65I 4B3RE 4PRVA 4DR1I 2HFUA 3PYFA 3ZZ0A 1IBLE 4X64E 2UUAE 2E5LI 4LFBE 2F4VE 5LL6R 4JG4A 2UXDE 4DV7E 1ZXMA 1ELOA 4DV5I 1ZXNA 4PRXA 1NHJA 1DARA 4NXMI 4JI2E 3T1HI 3K17A 5LMNI 4YHHI 3V5RA 4DV3E 4KHPI 4AQYE 3LNUA 3H4LA 3PYDA 4JI3E 4URLA 3QT8A 4DPTA 1Z5BA 1IBKI 3T1YI 4DUYE 4DPXA 1KKHA 3WU4A 1N34I 1XNQI 4JI7I 3B82A
chains in the Genus database with same CATH superfamily
4Z2XA 2IJRA 3GB0A 2Y0SD 2AV5A 3UVJA 3BM7A 3C6UB 3TAMA 4LT6A 3KJVB 2WTFA 3BEGB 3UNYA 3G6VA 2CADA 1WF0A 2H4YB 2N4DA 2J0SD 2MQMA 3R2DJ 4LF2A 3I6PA 1RAFB 5C25B 4J37A 1QJHA 2RRBA 2CDRB 3KK1B 1HNXI 1NO8A 4KFBB 5KFGA 3HO1A 4CT8A 5FLXY 4G1PA 2QA1A 1X31C 3B8HA 4A47A 1ULRA 2B0GA 2KXNB 1GX6A 3CD0A 3D6FB 4GVBB 3QRRA 5B09A 2D9OA 4JI5F 4JI4J 3AOBA 2W25A 4O3SA 1VRQC 5IT9U 2Q6BA 2QEXS 2VJVA 2V0NA 3TZXA 3EVWA 1YJ9S 2O3ZA 1VQSA 1RK8A 5KG7A 4FKXA 1IBMJ 3M32A 2AGPA 1XK8A 1HNZE 2WBRA 4DV1E 1RWMB 1C0UA 1E3PA 5E5NA 1Q78A 1XNRF 4DR7F 1NB2A 2DNQA 5FLXQ 1SKUB 4LF5F 4NX9A 2GQ2A 3ZZTA 2DCLA 1TVRA 4LSZB 3HLUA 3FCHA 4DV4I 1VBKA 1RWPB 4ES2A 3TUZC 5DQIA 1PKPA 1RJJA 4ZHRA 4TU8A 3ET6A 4JI1F 1RHKB 4GKJI 4ZIWA 5GAEI 3MR6A 4HHHA 4QWBA 2Y8YA 2OPRA 1VOMA 3I0SB 4MK7A 3PRYA 4NA2A 2VA3A 1ZS6A 3EUNA 3P5BP 4F4KA 4FYDA 1RAEB 1QE1A 2W8LA 1RTDB 1QAXA 4DXLA 3KG4A 5IWAI 3KNGA 3V2UC 2W9CA 3TEGA 5HLFA 5HQMA 1N34F 3OFGA 5DDQC 5KFFA 5FDLB 5T41A 1OMSA 2DGXA 1B0VA 4CH7A 1VRTB 3TI0A 4HACA 1U6BA 4PUOB 4B9UA 4PYDA 1PKUA 2QA4G 4NYOA 2W7AA 3ZZRA 2RF2B 2C3YA 1TL3A 3IAM9 4ALZA 2O1WA 1WG1A 4DUTA 1FX4A 3CJ0A 3MM7A 2R42A 1C1CB 2JSXA 3FBCA 4CIOA 1JLEB 1NJZA 4ICLA 4FF4A 4AQYI 3LP0B 1NK7A 2UVWA 4NEYA 1Q8BA 3OTEA 2DEJA 4X66E 3B6BA 2FZKB 1BWEA 2YKPA 2OIHA 4X4VA 4N76A 3U1MA 4NLTA 3F41A 1EI1A 5HJXA 1SC1B 1A6LA 3TX8A 3SCJE 2BW7A 4FBUA 1HQ2A 3SBMA 4LFAE 4M63A 2DNPA 2HS3A 3I55S 4ED6A 3RGIA 2BUNA 3R2CJ 1K9MT 1HNXJ 4TY8B 3CO0P 2FGCA 2YQ0A 4U3DA 1NSAA 1M5HA 4U8YA 1NZ0A 4ELTA 1KONA 5KFHA 3U1NA 4Y2IA 2YQ1A 3QBCA 4GKKI 1EARA 3JSYA 4B9SA 2J6TA 3K1JA 5KFKA 1HPZA 4L3NA 4JI6I 3GQCA 2HGLA 1UWBB 2IDEA 4IR1A 2N3OA 3J7YI 2IC3A 3EMTA 4Q8FA 4FF1A 4BC9A 2MQOA 3OXFA 3MTJA 3ZTRA 1H7XA 1SQGA 1MN9A 5KFSA 2JLFA 4Q2LA 2FHOB 1S12A 3E2EA 4K5RA 3W5XA 1K1SA 1MMDA 4L6V3 5C0XC 5I3UB 4N8OA 2XY5A 1FVQA 3I9ZA 3CJ2A 2R4FA 1R7IA 2XO7A 1VHIA 2YWGA 1HBOA 2FLLA 2DYAA 2ZOFA 3R97A 3LTOA 5HSPA 4B3TI 2WB1D 1EHWA 4DV4J 1SH0A 2DR7A 2KJWA 5C24A 2HHHF 3W66A 1U1RA 4C8NA 4YDDB 4GKJJ 1NHKL 2P6SA 2VC0A 1IBLE 4UOFA 4KJIA 4RW4A 1C0TB 4LVNP 5HN0A 1SBRA 5DRRA 3IXQA 1RT1B 4JV1A 1F2HA 4C0OC 2U1AA 4Y00A 3CDAA 4M8LA 2CPFA 4F3MA 3KLVA 4B3MF 5J2NA 1R31A 5IWAJ 4CLKA 3N5FA 2YX1A 2Z5BA 2DO4A 5LMUF 4L75A 4LSLB 2G0JA 3HHLA 1GX5A 2RE1A 2IDLA 2QL5B 3W60A 1KR4A 2EKNA 1JLFB 3WU4A 1D1UA 2HNYB 2WNRB 2BANA 5KFZA 4EBEA 3OR1A 4LBHA 1NNDA 5F8NA 2LDIA 4RBTA 4YY3E 2CPEA 2E1RA 4JI5I 3J7AG 3JAMU 2BR2A 3KLIA 1B0PA 4KHPF 2C3PA 3PDNA 4AQYJ 2P8IA 4Y28C 2DNOA 4FP9A 3X1LB 4WBFA 1VS3A 1KS2A 3CDWA 1S0VA 1SPBP 3CUNA 3CCLS 4DOZA 2NN6E 4P74A 1VQLS 4KTQA 2X1AA 3HSDA 3W8GA 2JH3A 4LF7F 1XNRI 4OYIA 4DR7I 5DDRC 4DL3A 3SV4A 4FYYB 2PD1A 2A1BA 2DVIA 5DLFA 3GFHA 3EXCX 2OHDA 1XR7A 4K4XA 2RRNA 3BPDA 4FNHA 3MMCA 2GO4A 2OPQB 5A6PA 3LO3A 3MM5B 3W2VB 4DV2E 4ZVOB 4GKKJ 4JI1I 3FCVA 1TUVA 3GSDA 2Z2MA 2YXLA 3QZ7A 2OPPB 4NOHA 4JI6J 2D3ZA 1BLUA 3BKFA 4J91A 3CCSS 4NXNF 2ZUAA 3M8SA 3V4IA 2PFDA 4O3OA 4CM0A 3PY8A 4LFCF 3A4TA 2ZITA 2D1CA 3R5AA 5C0XD 2HRUA 3D6TB 4X65F 1SC4B 1UDOA 1YJNS 4OYBA 1RXOB 2FY1A 1GMUA 4AM3A 4OV6A 1U1QA 2VQEF 3CEDA 2XO6A 1IM6A 2X36A 4WJBA 3O3LA 1Y6ZA 1TK5A 3THVA 1HA1A 2FVQA 2NN6B 2CPHA 3CJ4A 4GQUA 4RUBA 3MGJA 3PS1A 3JQMA 2VIHA 3RW7A 2ZNYA 4JI8E 2BMBA 3PW2A 4DV0E 3KNAA 2VOOA 2HMIB 2HNDB 4Q44A 3MCOA 4WKYA 2QL9B 3A3OB 1R3NA 2V63A 3QNWB 3GE9A 4LR9A 4QZVB 4DLGA 3IR5B 4ECYA 2LQJA 1K73T 1YX2A 1RT4A 2WONB 2FB0A 2PNZA 3PFEA 1P9QC 1UVJA 3SYZA 3JSRA 4OO1C 3W1YC 4E8UA 1GT8A 1USUA 2NPIA 1GXUA 4YOEA 5A8RA 4LSNB 4OYPA 2WBMA 4O4GB 2HHWA 1OYRA 3D28A 4OYZA 4E98A 1T05B 1NU4A 1CQMA 5CD4A 3JYTB 1OPZA 1A6FA 1TKDA 2HRYA 4K4VA 1S1UB 5CABA 1FFWB 2VZ9A 3VAFA 4QW9A 4JI5J 2CZ9A 4DU7A 1RT5B 2QFJA 3HHEA 3AJDA 2DNZA 1M0SA 3GIRA 4W90B 2H54B 1EKRA 3M8PA 1UP1A 2IRUA 2J9CA 3KWMA 3OJSA 3A3NB 4DZDA 1YIJS 1S76D 3IBWA 2CGEA 4GC6A 1FT8A 1HFEL 1AZSB 4QR0A 2FJBB 1RT7B 2CZVC 1RZMA 1XNRJ 3O2IA 2OEMA 4DR7J 4ZLJA 4NE9C 3UDLA 2K7JA 3QIPA 5CH7B 3UN2A 4CYUB 2RSQA 4UQGA 2JVRA 3VGTA 4KKOB 4CQ1A 2FHKA 1G7CB 5CQGA 2CQPA 3KDNA 3VF0B 2HHHI 2AW0A 1CJKB 3HD2A 5BYSA 2D69A 1RWWB 1OIAA 2BQRA 3UFCX 2EWHA 1KQKA 3Q8PB 3BYRA 2ZM6I 4ID8A 1M5OC 3M7VA 2GJIA 3SCKE 5D3GA 1W2IA 3HFVA 2XNQA 3E01A 4PEOA 5IM0B 4R0EA 1E3HA 4B3MI 2HK3A 2APOA 1JXLA 2ZFHA 2QLWA 3UNGC 5HROA 3VGSA 3LALA 4X4NA 4ZJOA 4C8OA 2YQ3A 5A0YB 4BCAA 1N32F 3K8WA 2PMHA 5HBMA 3RW6A 4F67A 3HF5A 3SQOP 3GJRB 1YRTA 3J80Y 3U1YA 1H0HB 1N5VA 4KYZA 3CCRS 2DXFA 3BH7B 4I4BA 1NJXA 2AU0A 4KHPI 4IZKA 3MMAA 2IJNA 4JI3E 2YKAA 4FW3A 1S6OA 3PKMA 2F65A 3CCJS 4KV8B 4FNIA 3S8SA 4MU3A 2XHCA 1VQNS 1L3SA 3Q6NA 2XHWA 4OO1D 3UD4P 3DLKA 1YBTA 1XJWB 3J81C 2ABYA 4LF7I 1U7LA 4DV5F 2DD8S 4JI4E 4NXMF 3IBCB 3D7SB 2ZKTA 4C6AA 3J80Q 3W62A 3MEGB 5FD1A 2CUYA 3R1LA 1YBAA 1T0TV 5D4LA 1HD0A 2F9JA 2HFOA 3ZZPA 5HVGA 1N33I 1NCLA 1LV5A 5K20B 4IFDF 1RUSA 1RT3A 3HT3A 2B9WA 2J7KA 4ZCIA 2WSFC 4FS2A 2JEBB 4HYKA 1NH8A 3QSYB 2ACMA 1PGZA 3GYNA 3TOQA 1A9NB 1G6BA 4B02A 3VAHA 4JV5F 2YKNA 3OLAA 2B5JA 1CJTB 2GC8A 2MKIA 2RH3A 2XI2A 5D4PA 3AB4B 2MSTA 4ED8A 3CJSA 1NHHA 3DI6B 2VQEI 1MWQA 1RE1B 2RDJA 4RO0A 1WHWA 1YITS 5EDWA 3L7ZB 2GO3A 3LANA 2BBEA 1IR2A 2V5HG 1FWKA 5ETOA 4RR5A 1D09B 1EETA 3Q2SC 4RW7A 2HHHJ 2VBYA 1JNRB 2NXUA 4KT0C 4QQBA 2DITA 1TL1B 2E5LF 1WACA 2ZM6J 2GHVC 3WIUA 1B64A 4F4XA 3OUYB 2NZCA 4KQVA 1JLGB 2Q79A 2XGPA 3QJLA 2DISA 3J80C 1KD1T 4B3MJ 3GMEA 1EKSA 1RBLA 4PU9A 2HAIA 4FS1A 4ANEA 4N41A 3VTIA 1FHTA 5KFOA 3C16B 2UU9F 2Y0BB 2V68A 1RTIA 1BQMB 4HH0A 5ETMA 1WSRA 4ZP6A 4F0MA 2GFFA 1VQ7S 2BABA 5ETSA 3FCWA 2OMOA 2NR0A 1PG5B 5K14B 1BQXA 3M4XA 2M9KA 4O23A 1Q8IA 4W92B 3S1TA 2C37B 1TUWA 1IKWB 4M5IA 4JUZA 5HMXA 4KHPJ 4NEZA 5KAKA 3X3UA 4QWCA 2NUHA 4DL4A 3R5BA 1VCTA 3FMWA 5CYQA 1U47A 2DXEA 2IRYA 4HHJA 2UP1A 3MUTP 4ZCLA 3PKYA 1EP4A 2RIJA 2NZ4A 2XCPA 4P72A 3ZKDA 3OTCA 4RBVA 3AOCA 3I0RB 4LF7J 1JLAB 2F4VF 1B0TA 1YQHA 5HP1A 1TTHB 3VAMA 1LKZA 4WIQA 2KVIA 2ALZA 1N0UA 4URSA 5KT7A 2ADBA 1F5BA 2GJ2A 2MZRA 1P9YA 5EWGA 1UA0A 5D0GA 4I69A 3CXCR 2NYHA 5CD4H 1N33J 2XB2D 3JTOA 3CGIA 3L09A 1BWVA 5A76A 4ELVA 3ENQA 2L3MA 1XHKA 1X0PA 2IMWP 3GLLA 3BQ2A 3NGUA 2VICA 4JI7E 4CO3A 2NPFA 4GKJE 4WP3A 2HPUA 4XPEA 1N32I 2HFZA 3PNIA 2VQEJ 2R2SA 5L1LA 2JEGA 4R5PA 2ILZA 1ZM2A 3R8YA 5IT0A 2CNLB 1I1GA 2GAHC 2OELA 2BA9A 4J3DA 4N56A 4K4WA 1Z0VA 3LQVA 2EKYA 1AFIA 2V67A 1PILA 4OHWA 1HD1A 3DU5A 1HI0P 1HW9A 2HZVA 1XMQF 1JLCB 1R6YA 3HMJG 2UUAE 5J2PB 1WTFA 2HZCA 2FJDB 4IZJD 2LKZA 3TUIC 2XCAA 4DV5I 4FYXB 2RU9A 2XMWA 4NXMI 1GAOA 4DR6F 3K17A 1YHCA 2PIIA 4WFBQ 1G4CA 2DB1A 2J9EA 3MM9B 4AQYE 3MCNA 3BSOA 5E3CA 3AD7C 1K0VA 2C39A 1XR5A 4I1TA 1RAJA 1QAYA 1B99A 2JFKA 2B4PA 1RA7A 4B08A 1RU1A 2W2PP 2V4RA 2KT3A 1FTCA 4EGLA 1SUQB 3FQKA 4HT5A 5JEAF 3A8JA 3CJKB 5CYMB 3BS9A 2WW4A 4QU7A 4ZPTR 3MOZA 2FLPA 4C3KA 2LQ5A 4JV5I 2ERRA 3DRSB 1RQ0A 2QN6B 3R6LB 3U7JA 3CWVA 4NLYA 2FQQB 3DRRB 3KK3B 3ITHB 1NSKL 4LF1A 4GKKE 2OPSB 4ZA1A 1X4CA 4G3IA 3QRPA 4KIAA 2DBBA 5E33A 1RT2B 4CNYA 2ZBCA 2EC0A 1I5OB 4K4YA 3I4PA 2J0QD 2AZ3A 1TKXA 3PX0A 4U6PA 3SSQA 3M1VB 4O3QA 3IRWP 3NMRA 7FDRA 3C6UA 4HL9A 3KJVA 1NPRA 2W4DA 1NBEB 2CFXA 4A8MP 4IZJA 2IYIA 3GONA 3DOMB 1JLBA 2JX2A 1MROB 2GNKA 1FK9B 1DTTB 2IHR1 4ZJLA 1PYSB 1HLWA 2FJVA 4KBIA 3D1OA 2KM8C 4DR2E 3FBEA 1GNKA 4PYAA 1R89A 2MHEA 4B3TE 4HTIA 2FLOA 1EJ7L 1WNEA 4DFPA 4JI0E 2DNLA 2XZDB 2PGCA 4DR3E 2UU9I 4EEYA 2KU7A 3PTWA 2IBKA 2VU5A 1H2UX 4GMKA 1RGVA 1KDNA 4PWWA 1PC4A 2BEFA 1RABB 1RHRB 1S6PB 1CS4B 3HJCA 4DL0C 2MGZB 1SL1A 5B7WA 4AFFA 3NNAA 1ZYQA 1NZ8A 3DFEA 3CMES 1NUEA 5I4MA 3T1YF 4HXZA 2XSJB 3QO9B 1PJ7A 4O44B 2MHNA 4Y2CA 2XLKA 3HZEA 3N0VA 3GIJA 4O3NA 3PR5B 1MLAA 3D54A 4M5LA 2AEJA 3IC1A 1T03B 1BGXT 2FVCA 4DV5J 1KHWA 2VHGA 1VC5A 2CQBA 4JI5E 3UHMA 4NXMJ 3NS6A 2VQFF 4EO8A 3M9NB 5HVHA 2VPYB 1RYSA 4FPIA 3NBPB 1ZAWA 3MM6B 4X4SA 4Y65A 3I0SA 4DX8H 4B3OB 1RWUA 4NZ6A 2POKA 2EBEA 2GMJA 2WCXA 1RTDA 1RSCA 4NLRA 3MPDA 2QG9B 4IDKB 4PG4A 4F3QA 2ZH1A 4DFMA 1XNRE 2XMTA 4DR7E 1T3NA 2DGQA 4RUAA 5FDLA 5E2QA 4LF5E 2UXDF 4DV1F 1WHXA 4UW2A 4PUOA 2R2TA 3U1LA 4JV5J 4JI2F 4I7FB 4EBDA 2L9DA 1SB6A 4YDXA 4DR5I 4K4TA 2RF2A 2MDAA 5K36B 4JI1E 3ZZYA 3HXMA 1C1CA 2Y3YA 1DJ0A 2HG4A 3LP0A 1UW4A 1K47A 1SJQA 2CQDA 3HKWA 3R3TA 3TQ1A 2HBYB 4ERDA 3HP6A 1CVJA 1GK8A 2U2FA 2D3OR 2CQ2A 4WUBA 1RHYA 3P4UB 3T5LA 1FE0A 2J76E 2VFVA 1N34E 1KOOA 1TZ0A 1PJ6A 4OI1A 5KG0A 2AYEA 2AX0A 5JXSA 1LK5A 1BHNA 4TY8A 2R9LA 1DRZA 1T7PA 4LIRA 2IMOA 3QT7A 2JT2A 3QJJA 4DR6I 3HX9A 3K5LA 1AA1B 2YWHA 2JRSA 4URGA 1SV5B 1UWBA 4U3BA 2YWEA 2VFUA 5IZHA 1SIZA 2YKOA 1FVSA 4H4MB 5D78A 2WSEC 3PEJA 4X66F 1TAUA 5DDOC 2HHTA 2C2RA 3CJRA 2I1RA 1MWZA 5HAOA 4UOCA 4IOBA 4BA2B 5I3UA 2OMLA 2J0XA 2KKHA 3PS2A 4MKYA 3I5BA 2PA8D 1WHVA 2ZH6A 1KKHA 2BE2A 3ENWA 4NASA 1F3FA 2HWHA 3S7RA 2MLYA 1E6VB 4PAAA 1KTQA 4ISAA 2AJ4A 3FEZA 1SL2A 1ZAXA 1KFDA 3T5HA 3GG1A 3Q23A 4RZRA 3VQTA 2YNIB 3CC4S 1PYTA 2HQFA 1C0TA 3W7BA 4QCLA 3ADAC 2FTRA 2R7QA 2Y1JA 2BDPA 2VBWA 1MN7A 2VDHA 2O5DA 4AXJA 1TKZB 2PMWA 4YN3B 4LF6E 2MLXA 1FI4A 3CJ5A 1RA6A 2CNOB 3TUPA 3BQ1A 3DOLB 4LFBI 1JLFA 4B9NA 2LA6A 1TFWA 4CO0A 1FWLA 2WNRA 4IKAA 3E8OA 5LSRA 4DR5J 5KT3A 2O66A 2HHHE 4ECVA 5K8MA 5C2CA 2LXIA 1KWMA 1ZPVA 2XGQA 1FNOA 1VFJA 3R5CA 4NL5A 4TLRA 1U2CA 1I6JA 1VIOA 2RQCA 3ILLA 4FDFA 3GU0A 4A4JA 5KTQA 5JUMA 3Q89A 2IAJB 4J5OA 4O0NA 4X84A 4ITSA 2NREA 1AW0A 4B3ME 3PJ9A 2VDIA 4G6VB 4FXDA 3TO8A 4M5KA 2IM0A 5L1KA 1FXRA 3I96A 5LMUE 3OL6A 5HVFA 2V2KA 1JLQB 2VG7A 4MYTA 2UVRA 1JIHA 2EFPA 2CPDA 3V6JA 2XMKA 5I42B 3JQKA 3M2VB 4IG3B 2EK6A 5LT5A 2IA6A 1CEZA 3QATA 2YKMB 4LR8A 2X1GA 2MY8A 2XTJP 2OPQA 1ZAVA 3AT1B 1MWYA 4DR6J 4DU8A 3EM1A 4ENOA 2OPPA 3KLEB 2RUGA 2V9WA 3OHAA 4G1QB 5K8NA 3MFHA 1WORA 2AF6A 2CJXB 1KTVA 2BE7D 3FRYA 2DIVA 1VMBA 3I82A 4AYBD 2CQ1A 3D6MB 1OJ4A 3NY0A 4LF7E 2G2ZA 2VPZB 4XDDA 2HYIB 2XMAA 2NN6F 1HWKA 2HKEA 3QT6A 4DV1I 3KTQA 2WZ1A 2OLWA 4KGZB 1UEVA 3LP1B 1OY8A 4JI2I 3HKMA 4WK3A 2MZSA 2E9RX 3CTRA 1BC6A 2PT0A 2Z58B 4AL6A 2NN6A 3KUHA 2V8HA 3M8QB 1PBUA 3Q24A 1S4EA 3VAGA 1YRXA 4NXNE 1N5YB 1F0XA 3EZOA 1I3OB 3UD3P 4LFCE 2HMIA 1F2GA 2HNDA 2DIUA 1Q8LA 5EGYA 4X65E 4DFKA 1VC0A 2JL9A 4DPWA 2QZ8A 4DFJA 3ZZUA 5IQ6A 2Y9HA 2R7XA 2VQEE 4NMXA 2MQLA 3BN4A 1VQOS 4LSNA 1VBXA 1WDTA 1Z0BA 5LMNE 4O4GA 4QWAA 1T05A 4LFBJ 4WXOA 2FHMA 3B4MA 1H74A 3RRKA 4YUDA 5J1PA 3G8SA 2Z30B 4C3MA 5B0EA 5AXNA 4PWDB 1GFWB 3V6KA 3MEKA 1Z4UA 1S1UA 4ZVEA 1MU2B 4UZBA 1RT5A 4J9RA 1I51B 4OI2A 3UCUP 1YGYA 3OR2B 4P2MA 3MR3A 3VGUA 4DG1B 5BJRA 2DH8A 4X66I 5DZ7A 1S0MA 3CCWA 1T9YA 4PQUB 2M0GB 3PYEA 4IQXA 3C19A 2CVIA 1AZSA 4WXWA 3MCMA 1XTZA 1RT7A 1O6XA 5CAAA 3L7PA 1RAIB 4YR3A 3RB3A 3R9LA 4N3OA 4LFAI 4EWTA 3MPWA 3GV7B 4ID5B 1N54B 1T95A 1XIQA 4CYUA 1CULB 1KIJA 1BQNB 4NA1A 2DNYA 3AH6A 3D0GE 2GCFA 3DLHA 4OKGA 5D8HB 3WHIA 2C1EB 2PO1B 4DWIA 2IRXA 1CJKA 2H3EB 3CCVS 4YP3A 1VGYA 2GHPA 2ZDOA 4DX6A 3K2YA 1HQEB 3M8RA 4IS9A 2L48A 1SKWA 3M2UB 2QLJB 4OX7A 1FTRA 2BJDA 1K0TA 4C48A 3RTVA 2YPZA 2ZEJA 3EGZA 3C15B 2YNFB 3QT8A 3V6DB 3PRVA 4F7VA 3HSJA 2V4JB 3M9OB 3GILA 4M5MA 2NXCA 1TMMA 4USIA 4OI0A 4K0KF 2VPXB 4DV1J 3CCTA 3FEXB 4A8OA 4FW5A 4DL6A 4JI2J 2VFTA 3JSBA 3LPSA 3DKDA 3CNQP 4OJHA 5C42B 3P96A 2DR6A 2MKCA 3AQPA 1X4BA 3DLGA 3DD6A 3GG0A 1WG5A 2PEHA 4RWXA 3EPGA 3PIOQ 3D5MA 5KFDA 3QPIA 5L1JA 3FFIB 3VGVA 4WKRA 3H98A 1CBKA 3C2PA 1L3TA 4MJKA 5C2GA 3O6QA 1FX2A 2JLEA 1R8AA 1NJWA 4WUDA 4UQTA 1CJUB 1UPPA 2UVUA 4RW6B 2XWXA 1N32E 1F6TA 1VJWA 4AD6A 2DR8A 1NZAA 2X3GA 3MEGA 3ZFVA 4B3SF 1D6TA 3CWJA 3ENAA 1FRJA 1T3OA 4PR6A 1TU0B 2CYYA 1U1NA 2HQIA 2NXEA 3GJTB 3OXLA 2YNGA 3MF5A 3DMJB 4C9DA 3L95X 1BUXA 2GV1A 4MFBA 1RCOB 1WI8A 3RYLA 1SVDA 2HLTA 4A8XA 4FF3A 3MECB 4YY3I 5D4NA 4JYAF 4NLOA 4FN5A 1Q5VA 2JEBA 1K1QA 4I67A 3DOKB 2NUUG 3G8QA 4X66J 3Q8YA 2WHOA 4DV5E 2OD4A 3MHYA 5FJ4A 2AZ1A 3PJXA 1KVJA 2LVWA 2KHCA 4NXME 1ZM9A 4YHHF 1U2FA 1U02A 4Q0BB 1U1KA 4P71A 5HMZA 4LFAJ 3SSRA 3SSSA 2GS8A 2OTJS 2IERA 1JX4A 4DQRA 3L7ZA 2FY8A 4LQ3A 3M2RA 4J9LA 4DDFA 2VFSA 3H42A 4IFDE 4QIFA 3QIDA 3CCES 2XULA 5IT9Y 1W7WA 2YWFA 2HURA 4DZ6A 1D3WA 2ZJQQ 1HNVA 1JLGA 2QJ3A 4WFAQ 1YJTA 1CSJA 4N47A 1Z5CA 2IA0A 4X4OA 1RAGB 2J7UA 3J81U 3C16A 2KFYA 1H3DA 1S9EB 4IFYB 4LBPA 4GRSA 3BGUA 4USJC 2QLBB 4OYXA 1BQMA 2LU1A 2B8PA 4JV2A 5IT9Q 1AUDA 2G13A 3HK2A 4IUFA 2QYCA 5K14A 4PPZA 3TZZA 3MMJA 4DR1E 3ZC4A 2BE9B 3AFGA 3DRPB 3F44A 2C37A 4WE1B 1IKWA 2E5LE 4C7QA 2C3OA 1YLXA 1TL4A 4QR2A 2HAFA 2LEBA 3SQGB 3RAXA 2K1RA 4JI8I 4DV0I 2RS2A 1R6MA 5GAGU 4IFDB 2XM3A 2JFDA 2YWKA 4ED0A 3TARA 1NH7A 4XIUA 3Q86A 1JLAA 2W4CA 4J9QA 2D7SA 1HYSB 1DQ9A 4FWHA 2WK4A 4KGKA 1JJ2R 2UU9E 1XNQE 1CQNA 2ZC4A 2OEKA 2VKZG 3CIZA 2QSWA 2QSFA 1PCAA 5A8KB 1NPPA 4NLXA 1QAJA 4M5NA 2CJYB 1C1BA 3BSCA 5LM7E 3M30B 4ED2A 3OXGA 4J9OA 2RRAA 4PQAA 1J5OB 2EFVA 2BQUA 3H0PA 5H9FJ 4O3PA 5KFJA 1VQ9S 4YY3J 2DGSA 2ZBRA 3CJ3A 1Y7PA 4LRDA 4H4OB 1UJ4A 5HMWA 3QMQA 4B9LA 1S1VB 4DR4F 2UXBF 2CIMA 3GIIA 3OVAA 2QFIA 2F4VE 4ECTA 3PS3A 3CCQS 2B6AB 1U4BA 1XQIA 2WAQD 4RWWA 2ROPA 1Y0HA 1HK7A 3CC2S 2KO1A 1VQKS 1DLOA 3V5RA 4RKUC 5IOLA 2DCUB 4BC7A 3GIMA 2WVEA 2V6AA 1FJGF 1UJ5A 3FSXA 3UI3A 1M90T 2PO0A 1Z5BA 5AXKA 2KJVA 1NKEA 3QRQA 3UN5A 2QA2A 5DGBA 1Q7LB 4KC5A 2YNHB 4BDPA 1TAQA 4TN2A 2VPWB 1RISA 3JQJA 4DV2J 4P2SA 2R8HA 3D9BA 2HFVA 3H40A 2I2YA 2E1AA 1JLCA 2HKJA 3PACA 3QGIA 5J2PA 5GADI 2VODA 3FQLA 3IP0A 1UFKA 2HLUA 3IRXB 2G2YA 4UOGA 1D9DA 3MM9A 3IBFB 2UUBF 2CPJA 2N7YA 1S6QB 1XMOF 4J9NA 3C6TB 1HIYA 4ZDNA 1FF2A 5B0BA 1QSYA 3DLJA 5DM6Q 2R8KA 2BZ2A 4RNFA 1HR0F 2Y8WA 1SUQA 3NAHA 1UA1A 1AB8A 1KQFB 3TUJC 6FD1A 1MSWD 2C38B 1XMQE 4Z7CA 2RVJA 4JI3I 2V94A 4JI8J 3DRSA 4DV0J 1ZZNA 2G9OA 4X4PA 3KOAA 3DRRA 3KK3A 3ITHA 2XYPB 1PAUB 2DHGA 4DSLA 1J2VA 2AD9A 2OPSA 4KH1B 2ZHOA 1HHQA 3MEDB 5DRKA 4L74A 1U1PA 3BREA 3LWLA 1RT2A 2A6OA 4DI6A 3OTOF 2AJ2A 1HNWF 3BBFA 5KT2A 1H7WA 4OZ2A 3QWUA 4X4RA 3TJAA 1Q82T 2VG5A 4MDTA 5KT6A 3UE2A 3JAMY 1Q86T 1Z0GA 5JEAE 3PW0A 2I0XA 2IYGA 3KUGA 3DOMA 5DQHA 4UTGA 5F8MA 1FK9A 1DTTA 3HSGA 2PO4A 1VIXA 1Y4UA 4TLQA 4IO9Q 1HARA 2ZC3A 1OS5A 1IN0A 2BA1G 1VYAA 3K5OA 3AODA 2VFRA 5A8WA 4CLTA 3HVTB 3OPKA 1N5QA 2IBOA 1X8DA 3FVYA 4MKVA 3ZM7A 2GA7A 1GXLA 3KHLA 3CF5Q 3FGVA 4ED3A 4OI4A 2AWZA 3ET6B 3GR0A 3US5A 3C14B 1FJEB 1U8SA 4LJMA 2AIRB 4C8LA 3I31A 2EFNA 2NLWA 2GHWA 1S6PA 2JNJA 2MGZA 3OBIA 2PE8A 2AX1A 1XEZA 4CLLA 2XSJA 3QO9A 5F3ZA 2BQ3A 4K50A 4O44A 4WFNQ 4H4KC 4U9RA 4F4ZA 1VRUB 4V19X 3HKZD 1XN9A 4JP8A 2RMLA 4C0HA 3NWRA 1KRPA 1N88A 5E3RA 4HACB 2DK2A 4DL7A 1FO1A 1T03A 3FSYA 1LWCA 4OZNA 2BOAA 3NBPA 4JI0F 4ZIVA 2FVSA 4DUYF 4F36A 3CMQA 3KG1A 1TR0A 1SH3A 3GPAA 5GMEA 5G4DA 4Y2MA 1CC8A 3MURP 1UMJA 4IDKA 2A6MA 3BDPA 1FKPB 4ZPBA 4R0JA 3R7SB 1OYEA 1T02A 3T1YE 3VCDA 4ZPCA 4LF8F 1OPIA 4BA1B 1RBOB 2E66A 4LF4F 5DGAA 4XTJA 2Y1RI 5K36F 1R0CB 1RACB 3GV8B 3EGWB 4JI3J 1Q1KA 4C11B 2WVBA 1QTNB 4DR4I 4ZVRB 2UXBI 1NK0A 1TMJA 3DLBA 3TVKA 1IVZA 3EZ5A 5RUBA 3P45B 4W98A 2VQFE 3JAMC 5D0HA 5K36A 3DLLQ 1JXEA 2KZZA 3PVXA 4KAIA 4B9VA 3GTYX 5A2QU 1QZRA 3EX7B 4UY85 2BVZA 2RB7A 2GQQA 2A18A 2N82B 3HHLC 2C2MB 1TL7B 3VAJA 2IY5B 1ZBTA 4U7UK 2N7CA 4Z37A 1KEKA 2B3TB 3NG8A 2UXDE 3BSAA 1NDKA 5L9XA 1ELOA 1ZXNA 1FDAA 2WP8B 4JI2E 2WW8A 2AP6A 5JJBA 2UXCF 4MKAA 1ZOTA 3ZNUA 3T41A 2MZTA 3NGKA 5KFCA 2C2EA 1ITPA 1N8RT 3NEKA 2CZ4A 3PX6A 2KT2A 4JI7I 4F4YA 5KFXA 2UUBI 1SV5A 1XMOI 2QC3A 1SL0A 3A1YG 3HHKA 3RR7A 4WF9Q 5C5JA 3BJYA 3I56S 2HQDA 4QBUA 4ZVQB 4H4MA 4K4ZA 2M7SA 4DS4A 1Y9OA 2E1MC 3BKUA 3IO1A 5EUHA 3A8IA 1HR0I 2MLZA 1VK8A 4D3GA 1WEYA 2KRBA 1F9HA 2D9PA 3W8PA 2Z5BB 1YTYA 3UW1A 4ANCA 1N4LA 4ER8A 4RNOA 2UUAI 2JHEA 4ECRA 4M5HA 3CW2C 2W9AA 2QO3A 3Q8UA 3PHEA 2R7VA 4P73A 2EEYA 3QLHB 3ZZOA 4C97A 2BR2B 2YNIA 4FWDA 4TQRA 1O8BA 2EXUA 3TQEA 4RNNA 2AJ1A 4OZ3A 3MWBA 3LPYA 1ZTWA 1YVFA 2VB6A 3B78A 4V19J 5FLXC 3PHTA 4PG6A 2QV6A 3AXMA 2UV8G 4KE5A 1I94F 3G96A 1TKZA 2MKJA 5J2QA 2RKIA 4DN9A 5SZTA 1UDQA 4MKBA 5I3QA 1B7FA 3AA9A 1Y4ZB 2KB2A 3H4DA 3JTNA 2DPIA 1QSSA 4P6QA 3DOLA 2XS2A 2JEAB 4DR4J 1H38A 2B4VA 2QE5A 2H51B 4U67Q 1UEKA 3CJ8A 2P9CA 1HI1A 4H4KA 5KG6A 1Z2LA 2XLJA 3HHLD 2KG1A 4A8SA 4LCGA 4PKDB 3T5JA 1RDRA 3AOAA 5B0GA 4LCHA 4DSFA 4KY3A 3B4TA 4XO0A 5BR8F 2IIHA 2IAJA 4B9TA 3V4IB 1KVKA 2EW9A 4X62F 4XTTA 4EZ9A 4K4SA 3KLFA 4CTAA 3VQSA 4FBTA 3V6HA 2K2PA 5JVGQ 3O8WA 3IM8A 1JLQA 2XEXA 2BYCA 4LF6F 1WELA 2PC6A 5DDPC 5I42A 2ZWOA 1B4SA 1WF1A 3M2VA 4IG3A 4C0BA 1N36F 2DY1A 1R27B 2YKMA 3K7RA 4CM2A 4DR2I 2OP5A 2OAUA 2J6SA 3LP2B 2GVDB 4LF9E 3CD7A 1A7GE 3KMQA 3H8YA 4CLSA 3N01A 2LJPA 2JEIA 4KO0A 4JI7J 4JI0I 3KLEA 1GH8A 4WFZA 3GLJA 2UUBJ 3QJPA 2QX0A 3S6EA 4DR3I 2KYXA 1XMOJ 4G1QA 2CJAA 4X64F 1WC0A 4HI1A 3ILJA 2PFFB 2C28A 1SJFA 3PYGA 3WC0A 1RHUB 1NSPA 2HHQA 2CQCA 4ZOSA 1JB0C 1V3SA 5DROA 1JKHA 9ATCB 3GZ7A 1FA0A 4WFXA 1Z0TA 1AYEA 2RUSA 5KG1A 3HI9A 2HSEB 3PEHA 4KSEB 3TYTA 4M1KA 1FE4A 3LP1A 1DAXA 1X5OA 1M5SA 3JSMB 4MQYA 1NDLA 4PG8A 2FHJD 5HJYA 3W9HA 3DM2B 2I5JA 3O44A 4FW4A 5KFPA 2UUAJ 4NLGA 2VL1A 4U8VA 3TJ9A 4YMEA 1P8GA 4C8YA 5KFRA 1Y5NB 2EFGA 4L3KA 3RUBL 3AB2B 1N5YA 4PCQA 4DCJB 3BBCA 5C0XB 3UWTA 2LA4A 1QSLA 4K4UA 1Q4RA 4V1Ak 3P3CA 4WU2A 1U0HA 4ETXA 1NLKL 3VV2B 1LWEB 5LSLA 1M5VC 2RHSB 5IV4A 4CCHA 5D6GA 4EU0A 1HBUB 3M8ZA 3A12A 1S9FA 2DR9A 5DETA 2UXCI 2XYHB 4LF5I 4DSEA 4WUCA 3TNVA 1J5EF 4OYOA 1REVB 4F2RA 1H72C 4A8FA 1FCAA 2XY7A 2RD5C 2PN6A 1KLMB 2RILA 3N9UC 3TZWA 1NJYA 4PWDA 1EQ0A 4WIIA 1TK0A 4P10A 3UR3C 1MU2A 5J2MB 1SJ4P 1OO0B 3TR5A 1DARA 3V4MA 3J7Z5 4CRJA 4DG1A 2DRDA 1RAOA 1TELA 1LW0A 1WOSA 2COLA 2FHJA 4PQUA 2DHHA 5D3GB 1IQTA 4K8RA 1S97A 3E01B 2G1DA 3MAQA 3LF0A 1N34I 3OL9A 1VLYA 4ID5A 2DPJA 1CULA 1BQNA 3D4JA 5D0EA 1LFPA 3GFXA 2ASLA 3DDIA 4IRKA 4E2FB 3HVRA 1RAAB 3ZXWA 4DR2J 2WSCC 5LMNF 2XMVA 2CQ4A 4B3TJ 5T14A 2PO1A 2CQGA 4RPFA 3UCZP 2AJFE 1IBKF 1VQ4S 4IFDC 1HBMB 1EX8A 4E0DA 4JI0J 1TV6B 2XZTB 1IBMF 1S48A 3RR8A 4HVZA 4WP9A 4DR3J 3EGNA 3MMAB 4IG0B 3V6DA 1FERA 2XI3A 4AL7A 4LVOP 2SXLA 4ILLA 1WKJA 1NK5A 2X1FA 2N4CA 4ECWA 2V4JA 4U95A 2YH1A 1KNZA 2R7SA 2H65B 2D3UA 5F8LA 2FJEB 4C8MA 1YJWS 3ELHA 1DTQB 2E5IA 1EQMA 5H9EK 3MMBB 3KFWX 5K8OA 3D6HB 3PG9A 2OFGX 2WRMA 1S1TB 1XC9A 2CXEA 3K89A 2K06A 1Q7YT 4RL1A 3PJWA 5DNLA 2IOPA 4BWJA 1LWFB 2HRTA 1Y10A 1M5PC 1N56A 4OLOA 4PG7A 2UUCE 2DO0A 1U48A 1S10A 1PBAA 1NHUA 1TFYA 5T7LB 1X4AA 3KHRA 3OW2R 1RT3B 1RLDA 1U26A 5BR8I 5DQGA 2D3O1 2ZH3A 2QA4S 1K44A 4CLZA 4X62I 4EZ6A 3RZAA 2CA9A 2V69A 3NMAA 4ZPAA 4I68A 2HVIA 1Q8KA 1IKYB 2B5JB 4K0KE 5D0RA 5GVQA 2H1YA 2ACYA 4RW6A 4LF6I 1HKAA 4OZ5A 2ZJPQ 3BBBA 3R7BB 2UXCJ 1MG7A 2R7RA 4LF5J 2FZGB 4ED7A 3G9CA 2MZ1A 2BA1D 4JOUA 1NB7A 3DMJA 4CP5A 2J0WA 2HS0A 2PDAA 4WFYA 3MECA 1S6UA 4OO1B 4JI1J 4RW7B 4X64I 1Q53A 4DSJA 3Q8QB 3D3CJ 1R8BA 3MAHA 3I9V9 2FJWA 2F40A 2HHVA 4LUBA 5DS7A 2WVFA 3BGRB 2W7PA 2E7WA 1HNXF 1HQUA 2R8JA 4NCGA 2XSFA 4MH8A 2CWKA 3GMGA 5LMUI 2OGUA 1KHVA 1N34J 4B3SE 3BKTA 4B3RF 2OEJA 2HVEA 5GAHU 1WJ9A 3MR7A 1URRA 4PPDA 4IFDD 2MPUA 3DYAB 3PO4A 5E7OB 1Q81T 1KFSA 2B51A 4J9PA 4ZLLA 2X7IA 3SEOA 1F60B 1KN6A 5HI7A 5KFUA 4JYAE 3NWGA 3KMSA 4ETZA 1LXNA 1U45A 1VQPS 5HANA 4RUHA 2ASJA 2F8EX 3K5MA 3W2WB 5G0RB 1X9WA 1PIEA 4MU0A 3UQSA 1T9UA 3SV3A 4YHHE 4NRTA 1IR1A 2DY9A 3H59A 2QYGA 1N6QB 1DBDA 4X2BA 4OJ3A 1NK4A 2G0IA 5FWKA 3NGSA 1HL6A 1S9EA 4IFYA 3MFIA 4ZMMA 5M2PA 5HP1B 3Q8VA 2Q6CA 2ASYA 4YB6A 3H25A 1YJ7A 5ETQA 1X60A 2ALYB 2AMCB 2QMUB 3CD6S 2Y1IA 2HQCA 4I3HA 1FKAF 2BM0A 1FRKA 2KN4A 4ZP8A 1FDDA 3MUVP 1IJEB 5IWAF 4DUZF 4NXNI 3NGTA 4OHYA 4X4UA 1H98A 2B9EA 2OKQA 2AGOA 2M70A 4MK8A 2CJQA 4LFCI 1D9AA 1XMBA 2XMJA 1JNZB 4X62J 2XWYA 2NS1B 2BR0A 4IFDA 2CQ3A 3W64A 1H7SA 1UDNA 3K57A 4X65I 4IFVB 1R8HA 3WC2A 4OHXA 3IG1B 3KKFA 2X1BA 3AY0A 1HYSA 4LF6J 2AGQA 1IKVB 1UPMB 4WPAA 2MJUA 4PRXA 3W5YA 3PW5A 2O01C 5LMNI 5J1EB 4R5PB 3J7A1 3CCZA 1S5ZA 1J5OA 4N77A 1Z2ZA 2XZWA 4FPRA 5GAEU 2MJNA 1IBKI 3RB0A 3H5XA 4P7VA 4LREA 3T6JA 4NCAA 2LLZA 4HH1A 4DR1F 5JEAC 4X64J 3DDNA 4H4OA 3FC9A 3T5KA 1REGX 1AROP 1S1VA 4ED4A 2JLGA 2V9KA 4ELUA 4NMLA 3WX4A 3OQ2A 1IUJA 5KFWA 2HEKA 4OMFG 1U1LA 4MIBA 1R0AB 2B6AA 2WOMA 2GO9A 3FDSA 4BBYA 5LMUJ 4DBQA 3R5DA 5DNXA 1LNQA 4A8QA 3KHGA 4X4TA 1XR6A 1WDDA 1XNQF 4A8YA 3GCWP 1CJVB 4JI6F 2WB4A 4ZKAA 5DRPA 4NLPA 2HQGA 2YKQA 3NCPA 2YNHA 3QGHA 3H7HB 4DN0A 2B43A 4USMA 4P75A 4K7QA 3UCGA 1P42A 2KFZA 2VG6A 2HVHA 1X4DA 3BN7A 4DR4E 2GGPB 2UXBE 4OX9F 2ZOGA 4DQSA 3BO3A 1D8ZA 2GIRA 1PVGA 1X9SA 2DNRA 1MMLA 5KFLA 3QFWA 2QTWA 3QYYA 4USTA 1Y00A 5IQQA 1N0VC 1R6LA 3FSIA 3KUEA 3K58A 3GSIA 2YY3A 1FJGE 1S6QA 3DGPB 3C6TA 3TZYA 2MXYA 2F1DA 2E29A 1S0OA 1TKXB 4B17A 3H90A 4EYHB 4KB7A 3BQ0A 3P5TL 1OQ6A 3K59A 3J7YU 2JC1A 3ZTQA 1WWHA 4IZJB 2BA0D 2C38A 1JLBB 1H73A 4TU7A 1YH8A 3R27A 1NJIT 4NXNJ 1RYRA 4H54A 3QWPA 1WTBA 4LFCJ 3KLGB 1AFJA 3G8TA 3O1LA 2V8GA 3IA0A 1HWJA 4I2QB 4WWSA 4X65J 2B56A 5ETVA 2CVEA 5DLGA 3A8KA 2BKPA 1S16A 3MEDA 2AHOB 2DTJA 4DCOB 1S9GB 3G6XA 4F2SA 1Y4SA 2UUBE 4B3RI 1XMOE 5D77A 4EK2A 5KFYA 3VAKA 4DX7A 4ZVUB 1RREA 4QYZJ 5LMNJ 4NLUA 5GMDA 3LGNA 5JEAD 3A13A 2H5EA 1HR0E 2VONA 1WSVA 2YPYA 2L9NA 1IBKJ 3P76A 1YWXA 4QIWD 4TY9A 1EA6A 2BKOA 4WYLA 1OSDA 3W63A 4DPUA 4ZCMA 2V2QA 1LWXA 5J1NA 4FKYA 4LRFA 1MU5A 1PAEX 5AXLA 4UOHA 3K5PA 1TK8A 4NLWA 3A8EA 3HVTA 4OYAA 3NAIA 5KT4A 3OTOE 3J81j 1HNWE 4M5JA 4WYWA 3G6ES 1S72S 4C2MA 2VESA 2XLIA 4F4WA 2FVRA 3NS7B 3C14A 5JVHQ 1WEXA 3WX8A 1O51A 3POTB 4ES1A 1C4AA 1V5IB 4DUZI 2F3JA 1URNA 3H1CA 5CZXA 4CWBA 3TAPA 4N7TA 3G6YA 1VRUA 2HHXA 1VI7A 3BDEA 2G4BA 4KGVB 1Z0EA 4QU6A 4Q43A 2XMMA 5JEAA 2IJFA 4AXIA 2E7XA 4R25A 3THPA 3LH2S 4R8UB 3TVYA 3WU3A 4I6AA 4USVA 2Z0GA 3FUYA 5H9FK 3NP5A 2ATLA 4I2PB 1FKPA 3L4BC 3LGHA 5CA5A 4C8ZA 4K5SA 3CDBA 2IFXA 4PRVA 4DR1I 1D9FA 1NK8A 1S1XB 1QD1A 4BA1A 2DHAA 4M5GA 1UTAA 2E5LI 5C25A 1QAIA 4NI2B 3H5UA 4KHRA 1ZH5A 3KK1A 3UDVA 1SIWB 2DGVA 1F9FA 2MSSA 1VBZA 3RBDA 4C11A 2VH7A 3MI7X 1JMTA 4KFBA 1WF2A 4NRUA 2B9XA 2H5IB 4UZCA 3KK2B 3NNCA 3Q8RB 2RHQB 2QLXA 3PYDA 4GO5X 2KZMA 4IRDA 2O1TA 4M5DB 1NDCA 4GVBA 3BR9A 3UR0A 4DUYE 2BX6A 4B3RJ 1NRKA 1XNQI 1N32J 2KYZA 4Y0FA 2PSZA 3OVSA 4K2XA 3OTDA 4DS5A 2HBRB 3W5ZA 1ZTTA 1TL7A 3KJFB 3M6VA 4LF8E 4F3OA 4LF4E 2MTLA 2CNNB 5K36E 1WC1A 1RAHB 1WHYA 2WP8A 3WDOA 4ZN1A 3NRBA 2Z8QA 4OX9I 2RS8A 3OFEA 3MPYA 2R2RA 2ZD1B 1T9XA 3M8WA 2BKNA 3TRGA 4IH6A 3N4WA 5H1SV 1XXEA 2XC9A 2F4VI 3KG0A 2BE2B 4TYAA 2PNLA 1WKLA 3TX0A 3G2XA 4CH1A 4P52A 3PR4A 3MAAB 2KM8B 1OQ3A 2HNZB 3HCXA 2BJ3A 4HKQA 1Y3KA 1FESA 2ZM6F 2FJXA 1UJ6A 3HT0A 3TVZA 5L9NA 2BJ9A 4A48A 2BRKA 2VBZA 2F8HA 3MZIA 4QJVA 2KFNA 4DUZJ 2UXCE 2RQ4A 1MW7A 1VRTA 2R3VA 2GMHA 1JJHA 3HD1A 4P7AA 5AJ3F 4BLGA 3GJQB 3ZTOA 2KG0A 1KVIA 1M1GA 3MR5A 1FRLA 1NM2A 4CO4A 3SFUA 2UUWA 1RTHB 2ZZMA 4MT1A 2UUTA 3LUYA 2GMLA 2MKSA 2RDDA 1JLEA 3QLHA 5EWFA 4NPOA 2MQ8A 1NDPA 3IS9B 1SJ3P 2ZH4A 3J7AN 4DV6F 2M88A 4DQIA 4CH0S 2MKYA 2CRLA 3CT9A 3IR6B 1HNIB 1LOUA 1NHVA 1RR9A 4DR1J 2NN6C 1TKTB 2E5LJ 4BS2A 2KVQE 4Q2MA 5DZ6A 4RX6A 3K5NA 2VG7B 1XMQI 2CJ9A 2JEAA 3SI8A 4AIMA 2Q66A 2LEPA 1GQEA 2E44A 3D68A 4L73A 2K3IA 5CYJA 3KDOA 4FYVB 3W61A 3SCIE 5ELWA 1U25A 2ADCA 3U1KA 9RUBA 1N33F 1EZZB 2E9ZA 2QT7A 2UU9J 4LQ9A 1XNQJ 2ZBPA 3QSIA 3MOJB 5KFAA 2EPIA 1I94E 4OZJA 1NEEA 4LCFA 3TANA 3SDEB 4F0HA 1YZ6A 4DX5A 3TA2A 4O3RA 3GV5B 2ZHAA 4ED5A 2O1UA 4QNKA 3NCRA 4A8KA 4FWGA 2F4FA 2E9TA 5AXMA 2EFOA 4OX9J 1S7HA 1ZZFA 1KC8T 1F5AA 2C3MA 2ZBIA 5L39A 2MKHA 3LP2A 2GVDA 4KGMA 1W25A 3CDUA 5F8HA 3VVTA 2KDOA 4EI2A 3QQCD 3UPFA 3RAQA 2GVZB 2F4VJ 1IBCB 5DO2A 3O5TB 3WZ0A 1UCNA 2I6WA 1Y5YA 5KFIA 5F9NA 4ZVHA 4UY8T 3UDEA 5BR8E 1HMVB 1LXJA 2J65A 1ROFA 2ZKUA 4X62E 1QM9A 2C2ZB 3T19A 1RT1A 2RDIA 1RTZA 1U6ZA 4RNHA 3L7UA 2ZBQA 4YFUA 1TL5A 2FPHX 8ATCB 1UWAA 1H7UA 1U09A 1Z1ZA 2NYIA 5FLXU 2ZDPA 4UUXA 2BXJA 1UKUA 1N36E 5K9FA 4LSLA 3JSMA 3L9ZA 5HO4A 3KJNB 5M2RA 3HVAA 1WI6A 3ZKBA 4KRWA 4OYMA 4UUWA 3DM2A 4ZCKA 5C0XF 4JB8B 2ZWPA 3WQPA 5H9EJ 3T9NA 1HWIA 2HNYA 3OD2A 2ZH9A 4AL5A 3UO0A 2VBXA 3MPVA 2FIUA 3Q6MA 4LF9F 3CJQA 3J81Y 4MTPA 2RT3A 3EICA 3TJ8A 4X64E 2CPXA 5C0XA 1T9TA 1AT1B 5L1IA 4JG4A 4DV7E 1G1XA 1ZXMA 4GVLA 2LDYA 2M52A 2VA2A 2NN6D 2GZOA 2OO4A 2CQHA 3FBFA 4UF4A 3BGLA 2IVFB 2OH2A 3CCMS 1TUGB 4DV3E 1V3RA 3H4LA 2LQ9A 1OSCA 4NLVA 1DQAA 1LWEA 3T1YI 4ECSA 4Q5VA 1IWAA 1HBUA 1QTMA 4ZPDA 4ILRA 5LL6d 3H2UB 5I3PA 1X7VA 1ZA1B 1SKSA 1XMQJ 1YJVA 3NCQA 2CKWA 4F02A 1REVA 3BH6B 3J81Q 2VJUA 1KLMA 1U2RA 4LR7A 3UN3A 3T1HF 1Z0WA 3HPOA 3MM5A 2RJZA 2VQFI 4ANDA 3W2VA 4I0WA 2H48B 3CULA 1RWXB 3BPSP 5J2MA 4ECZA 1WD6A 4BHQA 1NPKA 2DR5A 3G4SS 1SCJB 4RW8B 4P9SA 3PCOB 3DDKA 1FKOB 2HIYA 3VALA 4IH7A 1T9WA 2ZOMA 4HR2A 3EPIA 2F5GA 3BYPA 3G87A 2CG4A 1N5SA 3NL0A 2ILYA 1QDUB 3GFZA 2UXDI 1J5EE 1B7YB 1UW9A 3RG6A 3ONQA 4NCBA 2OJ3A 4XPCA 4PXEA 2G1HA 5JMNA 1OWXA 3T1AA 4EUVA 1A0OB 4I64A 2AE8A 1HBMA 2C2OB 2E5HA 3DLGB 1TV6A 3FRZA 2Z56B 4HDHA 2EBGA 3CJTA 4IG0A 4M94A 4DV6I 4P7TA 4MMOA 2W8KA 3R5GA 3ZTSA 3D2WA 1Q95G 2FUG9 1ZM3A 3R1HA 4Y2KA 2BOPA 3PW7A 1VDHA 3MM8B 2WONA 1VC6A 3U27A 1DTQA 3MMBA 1RWKB 2ZE2B 1H2VZ 2F9DA 1HHTP 3VR1A 2YBVA 1RWVB 3MD1A 1G3OA 2KHDA 1LW2B 5L3JA 1S1TA 1Y5IB 5CHCB 1UZHA 1UDSA 1RT6B 3JYTA 3PV8A 1LWFA 3IN5A 1PJ5A 4D3HA 1QUPA 1IBKE 4X4QA 2YWWA 2YNGB 3ILIA 2ZJRQ 1IBME 4OQJA 4J9KA 4MFBB 3M85G 2LP4A 5T7LA 5ETKA 4KR0B 5E41A 3P3GA 5A6WA 1GMVA 1KLNA 1N52B 4KHMA 2C22A 2XBPA 1U1OA 3AHPA 2LCWA 2I9SA 1IKYA 2DH7A 2XY6A 2A3JA 1N5TA 3FKBA 5KFNA 3T1YJ 3GYXB 1U0SA 3MDFA 2HS4A 4GO7X 2BJ1A 4OO1F 3RBZA 2AEMA 2HZAA 4TYBA 3IWLA 2Q1LA 2MB0B 2V2ZA 4KKOA 3LA0A 2DGUA 3M2RB 1JWWA 4CLYA 1EB0A 2KXFA 2VQFJ 2YVSA 4OO1A 4DLEA 3MXHP 3HULA 4QIGA 2UUCF 2HHUA 4F50A 4HLBA 3OJUA 2BV3A 3ISZA 2JE6B 1UVLA 5DG9A 1RHJB 2HBZB 3BGRA 1UETA 1RU2A 3RB4A 1YDLA 5AE2A 1USVA 5IM0A 1HNVB 3DGVA 3IWNC 3OLBA 4WZMA 2P6TA 2EG1A 3RRGA 3SIPB 2L08A 2JC0A 2DEIA 2DGTA 3KYLA 2UXDJ 1S0NA 5A0YA 2R7WA 3NKYA 2MY7A 4CO2A 3S01A 2H5JB 3R7NB 1SI9A 5AJ3J 5KT5A 3W9JA 3DYAA 3ETOA 3GR1A 4RW9B 2DHSA 2ROGA 5CCLA 1IKXB 1R8CA 5B0FA 4IQMA 4OJ1A 3R6GB 4LF9I 3Q8SB 4OI6A 4FVMA 5IT4A 4UT4A 1O0PA 4LRAA 2BJ7A 4NLQA 3TW0A 3J7ZT 4KPYA 4O4RA 3W2WA 4KV8A 5G0RA 1VR6A 1HNXE 1FRHA 5HQLA 4DV6J 2Z5CB 2K1RB 3GCXP 4NWBA 4DEZA 2WVDA 3HHNB 1UFWA 1N6QA 3IMQJ 4B3RE 3KLHB 3FNNA 3JS9A 3ZZ0A 1WOPA 1JXVA 4FYWB 2I8EA 6FDRA 2K8GA 3EE3A 1CC7A 1IWGA 5KFMA 1NHJA 2IM1A 3T1HI 3IFEA 5F8GA 3GJSB 1C1BB 1LK7A 1X5TA 4IOAQ 4OL8A 4QW8A 3IM9A 2PI4A 3FJ2A 4TXSA 3V81B 4Y34A 2CWXA 2OUGA 3Q22A 2O3DA 4DPXA 3CSKA 2GQ0A 1DY3A 4KGXB 1R0BG 4HT7A 3FBBA 1VJQA 2M5YA 2AEFA 3L7OA 3UDCA 3LGMA 1H2TZ 1CJTA 4IFVA 2W9BB 4CLFA 4DV4E 3IG1A 4HI2A 4DR5F 3W3SA 1IKVA 4N8NA 2F63A 3ENVA 1GMWD 1NK6A 3DI6A 2FC9A 2CPYA 1FDBA 4G65A 3EDQB 2MZQA 2LYVA 3CE8A 1UVMA 3Q2TC 1WEZA 5AE3A 1SQFA 5J1EA 5DG8A 1DLOB 1ZM4A 1FKAE 2V2VA 2LQ8A 1P1TA 3DN9A 2J9DE 2PO0B 3IR7B 3DRXA 5IWAE 4DUZE 5A2QY 4CZCA 1HHSA 2IPOB 2BW2A 1TL1A 1Y3JA 2K3KA 4PXBA 1SH2A 1UFLA 2UV8A 3DLEB 2CJBA 3AJ2A 1SKRA 4OJGA 4C4WA 4K59A 3OUYA 1HBNB 3NLCA 2GJFA 2R2UA 3JXOA 3OHBA 2R7UA 1WC5A 3NOCA 1R0AA 2F1FA 3CIMA 5LOQA 2W2NP 1UEUA 1DZ5A 3MEEB 4YEAA 3GCMA 3CDIA 1Z0CA 1T9VA 1CJVA 3FZBA 3N6LA 1S79A 3P06A 5A2QQ 2LQBA 3RJMB 4LF9J 4F8RA 5ETTA 3IGNA 1X0FA 3WIVA 1YG0A 5EN1A 3AAWB 4ECUA 1VK3A 4L76A 1GMWA 2GGPA 4R1FA 1UAWA 1PC5A 2ZH5A 2A2CA 3BZQA 2A10A 2Z5EA 2ZUGA 5K8PA 2VASA 5U47A 3ETMA 3I0RA 2XQCA 3PFOA 2PA3A 1SC6A 3H5SA 4MU1A 3DGPA 3OFHA 5HQ8A 4JI6E 3HDSA 2W24A 3G86A 5F41A 2QLFB 3I32A 2R8GA 1S99A 5E3QA 2RQKA 2J8AA 3T1HJ 2VKRA 1FJCA 1ZA2B 1M1KT 3CVKA 2VG5B 4HDGA 4IRCA 1P6TA 2PO2B 2UUCI 3PM9A 3HHDA 3LAMA 4OX9E 3Q83A 3KLGA 1E6YB 1U1MA 1NK9A 4ZVFA 2RQMA 2B7BB 3G82B 4ES3A 4I2QA 5KOWA 4LFBF 3RB6A 5A8WB 4P2XA 2DNMA 1DURA 2Z2ZA 4ZJQA 3HZGA 2HFSA 4K0KI 1S9GA 1OY9A 1ZPWX 5IT9C 5A2QC 2GIFA 3AD8C 1RHQB 3J80U 1RKJA 2UVVA 5BXIA 2E1CA 4OZ1A 3OSNA 5DJBA 1BXNA 4PXDA 2QGFB 2Q3PA 4ZP9A 4NZ0A 4ZLPA 2MQNA 4QR1A 2GX8A 1CPZA 4OZ0A 3THTA 2VV5A 3NNHA 2E1PA 5K36C 4TKTA 5FIIA 2H4WB 4Y2AA 4Q45A 3IWXA 2CG9A 3DXBA 4FXWA 2RAQA 1S1WB 2Z4PA 1LWCB 4LRCA 4B3SI 4DHVA 4IO1A 4PG5A 3BGOP 3VZHA 1KSPA 4FW7A 1RTJB 1ACMB 5B0DA 1FNXH 1NSQA 3POTA 1HWUA 3SMZA 3UVJB 4M95A 3TAMB 3DHXA 4ZVIA 4TNOA 4JYAI 3EJMA 1MMNA 1L3KA 5AE1A 2O1PA 3PYFA 3CJKA 5KG4A 2M3DA 5CYMA 1FEEA 1Q79A 2PNMA 4OZEA 3M05A 4DMZA 1HNZF 4W4MA 4QOTA 1VQ6S 1RI7A 2J8SA 4TQSA 1HW8A 3K8VA 2XG8A 3GFYA 4YHHI 4YR2A 4J7CA 2GO8A 1YRUA 1FRXA 2DH9A 4R8UA 2A0FB 4DPTA 1QUVA 1KQSR 1WC4A 4NA3A 2MQPA 1Q16B 2L9WA 5BYQA 2W7OA 2BRLA 2EG2A 3NOGA 3M1VA 4DL2A 2C42A 2FDNA 1VBYA 2W01A 4I2PA 4OLPA 1O5JA 4OFZA 2C3UA 4DPYA 1S1XA 5E0OA 2YX4A 1MROA 1F5CA 4NI2A 4EFAC 2UUCJ 3ICLA 3M32B 1C0UB 5GAGI 1OYSA 3CDEA 4F26A 2ZZNA 1YBUA 2CQ0A 4EYIB 3KK2A 1X4EA 2HFNA 4HEA9 4ZK7M 4CO1A 1TVRB 2NXNA 3VWSA 7FD1A 4M5DA 5EX3A 2J7WA 4K0KJ 3M9MB 3FK4A 4CLUA 3AA8A 1X4FA 4ZHRB 3RAMA 4AE5A 1FRIA 4DCPB 4DQQA 3CD5A 2AYGA 4I56A 4QPXA 2GW8A 2OPRB 2BM1A 5K36D 2JJ4D 2QMXA 4YB7A 1CS4A 2FC8A 4CT9A 3ISNC 1QE1B 5EHHA 3PW4A 4AUKA 2Z2YB 2CJKA 4DPOA 3I87A 3KRNA 3N6NA 2W9CB 2XS5A 2DNGA 5HLFB 5KOXA 2EVZA 2ZD1A 4A46A 1RWOB 2AKWB 1SQEA 3QGGA 4LFAF 1DHMA 3DCAA 2AJ0A 3DXSX 1FXDA 3L3CA 1IQZA 3BF4A 4ZPWR 3PRBA 2K7KA 3TP2A 4RU2A 2F8MA 2HHSA 1TL3B 2G0CA 3W65A 4TVAB 2W1BA 1QY7A 4OYWA 3MAAA 3MM6A 3MM7B 4B3SJ 2QL7B 2HHPA 2HNZA 4HY1A 3F56A 4B3OA 2ZH7A 4ICLB 2AYBA 1BY9A 4HHUA 1SXLA 1BMQB 2KT5A 3DRYA 2GQCA 4MIAA 3DHWC 4HYMA 5EWEA 2X3DA 4CI0B 1U49A 4JYAJ 5J2QB 4RBUA 2RKIB 3M6XA 3TA0A 3M85D 1F9EB 1Z59A 3H2VE 5LXYA 1KOHA 4DSIA 3C3LA 4I7FA 5KFBA 3VAIA 4LIWA 3PXGa 4YR0A 2FVPA 2PI5A 2PEBA 2W2OP 1QVFR 5HL7Q 2C2KB 2UZAA 2B8QA 4YHHJ 1RTHA 2JVOA 5KG3A 3PZPA 5EKWA 4LRBA 1S59A 2F7VA 4QYZK 3N5BA 2JZ5A 4ZPVR 5B0AA 1HPZB 2ZM6E 3IS9A 1J27A 1D8YA 1FJGI 4USWA 1YZ7A 2EI5A 4CLPA 4TU9A 4QYRA 5LXRA 4RJVA 1S49A 2IC3B 4JV0A 3OV7A 2DJWA 2JDJA 2KXHA 1IBLF 2MMYA 1HNIA 4C98A 4EBCA 1IXKA 4J90A 1L3VA 1JK9B 1TKTA 2O67A 3MPUB 3KLFB 3RRHA 3GP9A 2JOQA 5ETNA 4CTAB 3EYZA 2LXFA 1M1HA 4FW6A 2NQPA 1OYDA 2Z57B 4Q7AA 3NS5A 1Y5LB 3SZ2A 1JJ4A 5EX0A 3MTKA 5DG7A 1HBOB 2J6UA 3P3DA 1NKCA 1NAQA 3E3XA 3E51A 2R7OA 3UD5A 3BV8A 3F73A 4F0KA 2MEWA 4KHPE 2DHXA 4KO0B 5C24B 3FMBA 4OX6A 4U7CA 3ISND 4YY3F 4DV6E 3MD3A 5E3AA 3M6UA 3NGRA 2IVMA 2RU3A 5ADZA 3SDEA 2XYGB 1RP5A 4RW4B 2ASDA 3J7AM 4QPTA 2BJEA 2FLNA 1Y11A 2KRRA 2HBQB 1JKHB 4YB5A 1VLOA 2AT1B 3HFZB 3EGVA 5J2NB 4BA2A 1HNZI 4J9UE 3SFGA 4DJBA 2E7VA 2JEJA 3NXZA 5HMYA 3N6MA 4ZVSB 2HIQA 3HHLB 3WU6A 2V4QA 5D15A 4WTOB 1V6HA 2I5JB 4WZQA 3B4DA 2BANB 3KXDA 2GVZA 1N33E 3OR1B 4XK8C 1OYPA 4G1IA 3EWGA 1E6VA 3OTOI 5SUHA 1HNWI 4ZVGA 1HI8A 1GXTA 4IR9A 1FEHA 2HVZA 2Q43A 1HMVA 3KLIB 4DV2F 3RBEA 5LL6R 1MNEA 4MK9A 1PSDA 3C66A 3M7NG 2HW3A 4S0MA 3C8YA 2DXDA 2QMWA 2N3LA 1IJFB 5BYRA 4Y3CA 2FJAB 1UVNA 4LMZA 2X51A 4IH5A 1APSA 8RUCA 3K85A 1W26A 1U0HB 3LNUA 5F0UA 4LOMA 2IESA 1RLCL 1RADB 1DQ8A 2W2MP 2Z2LA 3HVWA 1XWLA 2UXBJ 5EL9A 1XERA 4NYPA 1X9MA 1S7IA 4ZITA 5F0WA 3LWMA 4NYZA 4CO5A 1RB0A 3MMCB 2BA0G 4OI3A 3I5CA 2XS7A 2LFVA 3Q1QA 3IAS9 1KBRA 1FRMA 5IS2A 3H5YA 3R5JB 1WG4A 1FJGJ 3SCLE 3DNCA 3HJVA 1TP7A 3Q0AA 2NSCA 4FF2A 2OFHX 4JI8F 1LFWA 4DV0F 1LW0B 4J9VA 1JJCB 4OHZA 2BJ8A 2G2OA 2MZJA 2QIFA 4ZN3A 2R7TA 1W2BR 1YKWA 2ZVSA 1WUUA 3KJQB 5C0XE 4HTJA 3H4BA 1T11A 2DT9A 1WC6A 2VC1A 5KFTA 5M2UA 5KFVA 2AQ4A 4J9MA 5HATA 4ATNA 1YJUA 4ILMA 3CPWR 5MLCV 3OL8A 2AYMA 3RBXA 4NBQA 2EK1A 3I4HX 4DUYI 3FZ2A 4FVCA 4URQU 2HQ3A 3MR2A 4RW8A 4DF4A 1F1BB 4MIWA 1FKOA 4DV7F 3MCSA 3PRDA 4KQZA 2V8VA 4MAKA 4WTYA 2V34A 1OY6A 1HR0J 2ZHBA 2P5VA 4LF8I 5LSOA 4DV3F 3EZUA 4LF4I 1RT4B 1KP6A 1FXLA 2PNZB 2NSBA 1HNZJ 4PRFA 4QNJA 1RCXB 3EVOA 3FEYB 3TWZA 1AUSL 1PO6A 2HK2A 3ZTPA 2ZNZA 3D0HE 1R6VA 5A8RB 3T1HE 3EDRB 3RU0A 5KFEA 2A2DA 2CNKB 5IC6B 5CCMA 4OIXA 3ZNJ1 1IR0A 3M8QA 1HWLA 3PX4A 1XBWA 1L3UA 3OTOJ 3T3FA 3P49B 1HNWJ 2V50A 3OT9A 1NMEB 2EC2A 2ZBKB 3QZ8A 2B4UA 1FD2A 2FZCB 1IBLI 3M8PB 4B9MA 5ITHA 5KFQA 2DGOA 3MM8A 4N5SA 4Y6IA 4K2JA 2E5GA 3BSNA 3BR8A 2RNEA 1YJRA 2ZE2A 3F0NA 2DRBA 1B3TA 3P3EA 3P8BB 1JQGA 4F4AA 2JWNA 3D0IE 1LW2A 1VQMS 5MAOA 2JEFA 1FJ7A 3JB9k 1RT6A 3QIPB 3HJFA 2HVDA 4XDCA 2W2QP 4EMDA 3I5AA 1EAYC 3WBZA 3CCUS 4U7UD 2VUGA 4NLSA 5F3TA 1B62A 2FD2A 1KQGB 2M2BA 7AT1B 4DF8A 1H6KX 2HWIA 1P1LA 3JTPA 3M6WA 3OR2A 4PWUA 1D0EA 3G71S 4O0IA 4JI3F 1FNMA 1GTEA 4YQWA 1B70B 3D1QA 3EVMA 4KPCA 2VOPA 1T94A 1HQUB 1QLNA 5IXUA 4FW9A 4NCGB 4RLEA 5ETRA 1PYOB 5GADU 4J9SA 5KG2A 1NKBA 2CPIA 5HROB 4MU4A 3P6YC 2OSQA 1S4FA 2CAJA 4ZVPB 4JI4F 2ATCB 1ICEB 4YB1P 1RHMB 1P27B 5HBMB 4LBIA 3BGFA 5D4OA 2LU2A 3AJ1A 1EIYB 2KTQA 1HQEA 4USUA 3A3PB 2V8PA 3M2UA 4DUYJ 4DV2I 2FYXA 4ZLNA 1S57A 5L38A 1VQ8S 2JE6A 1S77D 3DC2A 4IZKB 2OTLS 3C15A 2YNFA 4Z7YA 4WU3A 2ZVIA 4OHVA 4JV5E 4A8WA 3AQOA 5L46A 1I94I 4RUCA 2P9EA 3QFHA 3D3BJ 3DLKB 5E3PA 4LF8J 1FD8A 3TAQA 4FXVA 4LF4J 4NLDA 4OO1E 2J5AA 6AT1B 2YTCA 2XNRA 1X5PA 1C4CA 1YI2S 4DL5A 4EO6A 2R8IA 3ILOA 5F9LA 4RW9A 4GC7A 1T8EA 4QWEA 3LAKA 3ULHA 1IKXA 4P2FA 2ZZTA 5C42A 8AT1B 3VZIA 1WC3A 2C2DA 1UVKA 5C7PA 2GAGC 3SXLA 3T9ZA 2CQIA 2CPZA 3FFIA 4AT1B 2GIQA 2Z5CA 1N48A 3CB4A 3B82A 1FFSB 1IBLJ 2ZH2A 2YKNB 4USHA 3QAUA 1TQLA 1CJUA 3B54A 3KLHA 4L72B 3LOUA 1BE4A 1UVIA 4ECQA 1IM4A 2IM2A 3ZZZA 1K8AT 1N36I 1NXIA 3H2LA 2DGWA 4WCEQ 2O1VA 1RWNB 3GYGA 3OSPA 5DRQA 1WOOA 1GEHA 3HM9A 1MX0A 2LEAA 1EETB 2VF3A 3LW5C 1FWPA 2MYFA 3V81A 3CC7S 2YH0A 1RBAA 1BKNA 3DOKA 4BWMA 4DV7I 4MYUA 2DNHA 2KL8A 2W9BA 5B08A 4DV3I 3W9IA 4OV1A 4Q0BA 2LMIA 2WOMB 1BD6A 3OL7A 3BO4A 2Q2EB 1WKKA 4C8KA 4JBCA 2M4MA 2DRAA 3KHHA 4USKA 5IC4B 1NHIA 1RTIB 1VISA 4I6WA 3TA1A 1QVGR 3HFKA 1RKIA 1SJRA 2OI2A 5B0CA 3T6BA 3TEHB 3QAEA 2BACA 2LXUA 2PMZD 3DLEA 5LJ3Y 4CDIA 4YS2A 5ETPA 2VG6B 5CYQB 3CMAS 1HBNA 4XAKA 4WK1A 2E5JA 2P2CB 3QGPA 1I94J 5IFMA 4DR5E 1Q0NA 3N79A 5THWA 1EP4B 4OZLA 1SC3B 1R8PA 3QT5A 4DV4F 1FFGB 3MEEA 1J5EI 4JI7F 4QIVA 4GKJF 5L8RC 2ZH8A 3PO5A 1L5UA 5F8IA 2NCKL 1U6FA 4ZVTB 3DRPA 3PIPQ 4WE1A 3WU5A 2LECA 2MKKA 3CDJA 1LEOA 5GMKa 1M5KC 1C2PA 1GTHA 3NGDA 3SQGA 3LPEA 4QWDA 5BR8J 3BO2A 2M8HA 2QRRA 4IOCQ 4WP8A 5K5MA 2H9ZA 3D1HA 2J9DA 1VQYA 2P9GA 2B4OA 5IV3A 1U24A 2UUAF 1VQ5S 4DR6E 3AD9C 4U96A 1YK9A 3VVUA 3DU6A 1X5SA 2V8DA 4JI4I 3AXKA 2HWTA 1N36J 5A8KA 2OD6A 4DQPA 5DM7Q 1G2EA 4AQYF 3M30A 3M6AA 4NZ7A 2EFQA 3HSZA 4RNMA 3GWCA 4ECXA 1U8WA 4RU9A 4FZVA 3H20A 2B9YA 2CG8A 4ZP7A 2PO2A 5AT1B 2WVCA 1CLFA 1IBMI 5CZVA 5LJ5Y 1YHQS 4DSKA 1Y60A 3OVBA 4OX8A 4I6YA 2KI2A 4QIEA 2FGOA 1YSJA 5KG5A 4DV7J 1E6YA 1AXQA 2AJQA 1Q5YA 1CG2A 1Z5AA 3G82A 3VHQA 1DFDA 4PABA 2NXJA 4F25A 3EXYA 4DV3J 4AIDA 3K0JA 3U02A 4Q8EA 4ZS6A 2DKOB 2I38A 1F3VA 3IGVA 4F04B 5HK4A 4GKKF 3D66A 1LQ9A 2CDQA 1B63A 3N28A 1FDNA 2Y1LB 4CLWA 3OTBA 2M8DB 3JAMQ 1UZDA 4LPFA 2DNNA 1UL3A 2C39B 5ETLA 2OSRA 3MUMP 2VD3A 1X4HA 4CNZA 3BB5A 1V9OA 2D74B 2MQQA 3GIKA 2D41A 4IYQA 2HFUA 1R43A 3C46A 2HGMA 2KH9A 4PXCA 4LFBE 3CO9A 2L41A 3M8YA 4C3LA 3M7ND 2DNKA 1X4GA 5CXTA 4ED1A 2W4PA 1S1WA 4DR2F 2ROEA 5GAHI 3IRXA 4B3TF 3ZO7A 5JEAB 2IM3A 2C2NA 1V3ZA 4PZVA 2HGNA 1VHFA 4URLA 1J5EJ 5F8JA 3NZKA 3OFFA 1SJ1A 2B7CB 2YX7A 1ZETA 1V5VA 2IVYA 1RTJA 4DR3F 3D67A 2IOQA 4KH0B 2XMUA
chains in the Genus database with same CATH topology
2UUBI 3J81C 1XMOI 3J81Q 4LF7I 3D4JA 1U2RA 4JI4E 4ED4A 4YY3E 2E1RA 4JI5I 2AJ4A 3J7AG 2HKJA 4DPYA 1Z0WA 4DV4E 3LPSA 4LF8E 2VQFI 3Q1QA 2WW4A 4LF4E 3J80Q 4JV5I 4RPFA 1N36I 1HR0I 1HNXI 2O1VA 3CWVA 4OX9I 4LF6E 4GKKE 1ZM4A 1N33I 1FI4A 1FKAE 2V2VA 2Z5BB 3B8HA 1MX0A 2J7KA 1XNRI 2VF3A 4DR7I 2UUAI 5IWAE 4DUZE 4LFBI 2F4VI 1WUUA 1FWLA 1BKNA 2UXDI 2PNLA 4DV7I 1J5EE 4MYUA 4USMA 4WUDA 4P52A 2HHHE 4IZJA 3GONA 4DR4E 4DV3I 2BM1A 2UXBE 1N32E 4FWDA 4Z7CA 1XMQE 4JI3I 1PVGA 4DV2E 1HNZE 4JI1I 4DV1E 1D6TA 2IOPA 1NHHA 2VQEI 4DUYI 3B78A 5FLXC 2Q2EB 4DR2E 5FLXQ 2UUCE 4B3TE 1N0VC 1Z0CA 4B3ME 2UXCE 1FWKA 4USKA 1NHIA 2ZITA 1FJGE 5LMUE 1VISA 3ZZTA 4DV6I 2R3VA 4YY3I 4P7AA 3P06A 2OI2A 5BR8I 2V34A 4FN5A 5A2QQ 1ZM3A 4DV4I 4JI0E 4MYTA 4LF8I 4DR3E 4X62I 4LF4I 1PKPA 2UU9I 4GKJI 4K0KE 1UEKA 4DV5E 2HK2A 4HY1A 4IZJB 4KQVA 1Z0GA 2X36A 4LF6I 1Y6ZA 3PRYA 4NXME 1H73A 1ZM9A 4UTGA 3T1HE 5L3JA 4R1FA 3HJCA 3J80C 2A2DA 4DR5E 2A2CA 1MG7A 4PU9A 4DU8A 1Y4UA 2Z5EA 2GS8A 4DXLA 5IWAI 4HXZA 1IBKE 4HYMA 3QT5A 3V2UC 1J5EI 1IBME 1RR9A 1KVKA 1S16A 4JI8E 1KTVA 4DV0E 2ZBKB 1Z59A 4HACA 1Y4SA 2UUBE 4B3RI 4JI6E 1OJ4A 1XMOE 4LF7E 1IBLI 4X64I 2XEXA 1XMQI 3ZM7A 4JI5E 2HKEA 1RREA 3QT6A 4DV1I 3WU5A 2O1WA 5GMDA 2R42A 4DR2I 4JI2I 1HR0E 3F0NA 2UUCI 4LF9E 1USUA 1EA6A 4AQYI 4OX9E 2LJPA 2ZM6E 2DEJA 1FJGI 5LMUI 4X66E 4DPUA 4B3SE 2V2QA 4JI0I 1Z5CA 1A6FA 4EMDA 3ZKDA 1MU5A 4DR3I 1XNRE 2V2ZA 1S4EA 4DR7E 1EI1A 1I94E 4DR6E 4NXNE 1B62A 3PYGA 2CZ9A 4LF5E 4DU7A 2HFSA 4LFAE 4LFCE 4K0KI 4HACB 2O1UA 4JI4I 5IT9C 5A2QC 2X7IA 4FWGA 5IT9Q 1Z0TA 3HULA 3OTOE 1N0UA 4JYAE 1HNWE 4X65E 4DR5I 4DR1E 4DPWA 3M6AA 2BV3A 1NZ0A 2E5LE 1FNMA 2CGEA 4M1KA 3ZZUA 4JI1E 1USVA 2VQEE 4FW9A 1IBMI 1PIEA 4GKKI 5GMEA 4JI8I 4DV0I 1K47A 3K1JA 1Z0BA 5LMNE 4YHHE 4KHPE 4JI6I 4JI7I 1XHKA 1H74A 2DEIA 4DUZI 4WUBA 4DV6E 3T1YE 1Z5AA 2EFGA 5BR8E 5FWKA 4X62E 4XTJA 4FWHA 1N34E 3J7AM 2UU9E 1XNQE 4JI7E 1Z0EA 2HHHI 2CG9A 2NPFA 4GKJE 4LF9I 4DR4I 2UXBI 1N32I 2V8PA 4DV2I 4I3HA 2ZM6I 4UT4A 1H7UA 1HNZI 4X66I 1B63A 2BM0A 4B3SI 4IZKB 2VQFE 3JAMC 3QT7A 4Z7YA 3JAMQ 3PYEA 3WU3A 4JV5E 1ZM2A 1N36E 3WU6A 3LTOA 1I94I 1HNXE 4DR6I 4NXNI 3ZKBA 4B3TI 4B3MI 2HK3A 1Z0VA 2Z5CB 2UXCI 4LF5I 4WUCA 4N3OA 4LFAI 4LFCI 1QZRA 1N33E 1H72C 3Q6MA 4ZVIA 1KIJA 1H7SA 3OTOI 4JYAI 1HNWI 4X65I 4B3RE 4PRVA 4DR1I 2HFUA 3PYFA 3ZZ0A 1IBLE 4X64E 2UUAE 2PNMA 2E5LI 4LFBE 2F4VE 5LL6R 4IZJD 4JG4A 2UXDE 4DV7E 1ZXMA 1ELOA 4DV5I 1ZXNA 4PRXA 1NHJA 1DARA 4NXMI 4JI2E 1HK7A 3T1HI 3K17A 5LMNI 4YHHI 3V5RA 4DV3E 4KHPI 3K85A 4AQYE 3LNUA 3H4LA 3PYDA 2Z5BA 4IZKA 4JI3E 4URLA 3QT8A 4DPTA 1Z5BA 1IBKI 2O1TA 3T1YI 4DUYE 2IOQA 4DPXA 2Z5CA 1KKHA 3Q6NA 3WU4A 1N34I 1XNQI 2GQ0A 3B82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB I;  3J81 C;  1XMO I;  3J81 Q;  4LF7 I;  3D4J A;  1U2R A;  4JI4 E;  4ED4 A;  4YY3 E;  2E1R A;  4JI5 I;  2AJ4 A;  3J7A G;  2HKJ A;  4DPY A;  1Z0W A;  4DV4 E;  3LPS A;  4LF8 E;  2VQF I;  3Q1Q A;  2WW4 A;  4LF4 E;  3J80 Q;  4JV5 I;  4RPF A;  1N36 I;  1HR0 I;  1HNX I;  3CWV A;  4OX9 I;  4LF6 E;  4GKK E;  1ZM4 A;  1N33 I;  1FI4 A;  1FKA E;  2V2V A;  3B8H A;  1MX0 A;  2J7K A;  1XNR I;  2VF3 A;  4DR7 I;  2UUA I;  5IWA E;  4DUZ E;  4LFB I;  2F4V I;  1WUU A;  1FWL A;  1BKN A;  2UXD I;  4DV7 I;  1J5E E;  4MYU A;  4USM A;  4WUD A;  4P52 A;  2HHH E;  3GON A;  4DR4 E;  4DV3 I;  2BM1 A;  2UXB E;  1N32 E;  4FWD A;  4Z7C A;  1XMQ E;  4JI3 I;  1PVG A;  4DV2 E;  1HNZ E;  4JI1 I;  4DV1 E;  1D6T A;  1NHH A;  2VQE I;  4DUY I;  3B78 A;  5FLX C;  2Q2E B;  4DR2 E;  5FLX Q;  2UUC E;  4B3T E;  1N0V C;  1Z0C A;  4B3M E;  2UXC E;  1FWK A;  4USK A;  1NHI A;  2ZIT A;  1FJG E;  5LMU E;  1VIS A;  3ZZT A;  4DV6 I;  2R3V A;  4YY3 I;  4P7A A;  2OI2 A;  5BR8 I;  2V34 A;  4FN5 A;  5A2Q Q;  1ZM3 A;  4DV4 I;  4JI0 E;  4MYT A;  4LF8 I;  4DR3 E;  4X62 I;  4LF4 I;  1PKP A;  2UU9 I;  4GKJ I;  4K0K E;  1UEK A;  4DV5 E;  2HK2 A;  4HY1 A;  4KQV A;  1Z0G A;  2X36 A;  4LF6 I;  4NXM E;  1H73 A;  1ZM9 A;  4UTG A;  3T1H E;  5L3J A;  4R1F A;  3J80 C;  2A2D A;  4DR5 E;  2A2C A;  1MG7 A;  4PU9 A;  4DU8 A;  2GS8 A;  4DXL A;  5IWA I;  4HXZ A;  1IBK E;  4HYM A;  3QT5 A;  3V2U C;  1J5E I;  1IBM E;  1RR9 A;  1KVK A;  1S16 A;  4JI8 E;  1KTV A;  4DV0 E;  2ZBK B;  1Z59 A;  4HAC A;  2UUB E;  4B3R I;  4JI6 E;  1OJ4 A;  1XMO E;  4LF7 E;  1IBL I;  4X64 I;  2XEX A;  1XMQ I;  3ZM7 A;  4JI5 E;  2HKE A;  1RRE A;  3QT6 A;  4DV1 I;  3WU5 A;  5GMD A;  2R42 A;  4DR2 I;  4JI2 I;  1HR0 E;  3F0N A;  2UUC I;  4LF9 E;  1EA6 A;  4AQY I;  4OX9 E;  2LJP A;  2ZM6 E;  2DEJ A;  1FJG I;  5LMU I;  4X66 E;  4DPU A;  4B3S E;  2V2Q A;  4JI0 I;  1Z5C A;  1A6F A;  4EMD A;  3ZKD A;  1MU5 A;  4DR3 I;  1XNR E;  2V2Z A;  1S4E A;  4DR7 E;  1EI1 A;  1I94 E;  4DR6 E;  4NXN E;  1B62 A;  3PYG A;  2CZ9 A;  4LF5 E;  4DU7 A;  2HFS A;  4LFA E;  4LFC E;  4K0K I;  4HAC B;  4JI4 I;  5IT9 C;  5A2Q C;  2X7I A;  4FWG A;  5IT9 Q;  1Z0T A;  3HUL A;  3OTO E;  1N0U A;  4JYA E;  1HNW E;  4X65 E;  4DR5 I;  4DR1 E;  4DPW A;  3M6A A;  2BV3 A;  1NZ0 A;  2E5L E;  1FNM A;  4M1K A;  3ZZU A;  4JI1 E;  2VQE E;  4FW9 A;  1IBM I;  1PIE A;  4GKK I;  5GME A;  4JI8 I;  4DV0 I;  1K47 A;  3K1J A;  1Z0B A;  5LMN E;  4YHH E;  4KHP E;  4JI6 I;  1XHK A;  1H74 A;  2DEI A;  4DUZ I;  4WUB A;  4DV6 E;  3T1Y E;  1Z5A A;  2EFG A;  5BR8 E;  4X62 E;  4XTJ A;  4FWH A;  1N34 E;  3J7A M;  2UU9 E;  1XNQ E;  4JI7 E;  1Z0E A;  2HHH I;  2NPF A;  4GKJ E;  4LF9 I;  4DR4 I;  2UXB I;  1N32 I;  2V8P A;  4DV2 I;  4I3H A;  2ZM6 I;  4UT4 A;  1H7U A;  1HNZ I;  4X66 I;  1B63 A;  2BM0 A;  4B3S I;  2VQF E;  3JAM C;  3QT7 A;  4Z7Y A;  3JAM Q;  3PYE A;  3WU3 A;  4JV5 E;  1ZM2 A;  1N36 E;  3WU6 A;  3LTO A;  1I94 I;  1HNX E;  4DR6 I;  4NXN I;  3ZKB A;  4B3T I;  4B3M I;  2HK3 A;  1Z0V A;  2UXC I;  4LF5 I;  4WUC A;  4LFA I;  4LFC I;  1QZR A;  1N33 E;  1H72 C;  4ZVI A;  1KIJ A;  1H7S A;  3OTO I;  4JYA I;  1HNW I;  4X65 I;  4B3R E;  4PRV A;  4DR1 I;  2HFU A;  3PYF A;  3ZZ0 A;  1IBL E;  4X64 E;  2UUA E;  2E5L I;  4LFB E;  2F4V E;  5LL6 R;  4JG4 A;  2UXD E;  4DV7 E;  1ZXM A;  1ELO A;  4DV5 I;  1ZXN A;  4PRX A;  1NHJ A;  1DAR A;  4NXM I;  4JI2 E;  3T1H I;  3K17 A;  5LMN I;  4YHH I;  3V5R A;  4DV3 E;  4KHP I;  4AQY E;  3LNU A;  3H4L A;  3PYD A;  4JI3 E;  4URL A;  3QT8 A;  4DPT A;  1Z5B A;  1IBK I;  3T1Y I;  4DUY E;  4DPX A;  1KKH A;  3WU4 A;  1N34 I;  1XNQ I;  4JI7 I;  3B82 A; 
#chains in the Genus database with same CATH topology
 4Z2X A;  2IJR A;  3GB0 A;  2Y0S D;  2AV5 A;  3UVJ A;  3BM7 A;  3C6U B;  3TAM A;  4LT6 A;  3KJV B;  2WTF A;  3BEG B;  3UNY A;  3G6V A;  2CAD A;  1WF0 A;  2H4Y B;  2N4D A;  2J0S D;  2MQM A;  3R2D J;  4LF2 A;  3I6P A;  1RAF B;  5C25 B;  4J37 A;  1QJH A;  2RRB A;  2CDR B;  3KK1 B;  1HNX I;  1NO8 A;  4KFB B;  5KFG A;  3HO1 A;  4CT8 A;  5FLX Y;  4G1P A;  2QA1 A;  1X31 C;  3B8H A;  4A47 A;  1ULR A;  2B0G A;  2KXN B;  1GX6 A;  3CD0 A;  3D6F B;  4GVB B;  3QRR A;  5B09 A;  2D9O A;  4JI5 F;  4JI4 J;  3AOB A;  2W25 A;  4O3S A;  1VRQ C;  5IT9 U;  2Q6B A;  2QEX S;  2VJV A;  2V0N A;  3TZX A;  3EVW A;  1YJ9 S;  2O3Z A;  1VQS A;  1RK8 A;  5KG7 A;  4FKX A;  1IBM J;  3M32 A;  2AGP A;  1XK8 A;  1HNZ E;  2WBR A;  4DV1 E;  1RWM B;  1C0U A;  1E3P A;  5E5N A;  1Q78 A;  1XNR F;  4DR7 F;  1NB2 A;  2DNQ A;  5FLX Q;  1SKU B;  4LF5 F;  4NX9 A;  2GQ2 A;  3ZZT A;  2DCL A;  1TVR A;  4LSZ B;  3HLU A;  3FCH A;  4DV4 I;  1VBK A;  1RWP B;  4ES2 A;  3TUZ C;  5DQI A;  1PKP A;  1RJJ A;  4ZHR A;  4TU8 A;  3ET6 A;  4JI1 F;  1RHK B;  4GKJ I;  4ZIW A;  5GAE I;  3MR6 A;  4HHH A;  4QWB A;  2Y8Y A;  2OPR A;  1VOM A;  3I0S B;  4MK7 A;  3PRY A;  4NA2 A;  2VA3 A;  1ZS6 A;  3EUN A;  3P5B P;  4F4K A;  4FYD A;  1RAE B;  1QE1 A;  2W8L A;  1RTD B;  1QAX A;  4DXL A;  3KG4 A;  5IWA I;  3KNG A;  3V2U C;  2W9C A;  3TEG A;  5HLF A;  5HQM A;  1N34 F;  3OFG A;  5DDQ C;  5KFF A;  5FDL B;  5T41 A;  1OMS A;  2DGX A;  1B0V A;  4CH7 A;  1VRT B;  3TI0 A;  4HAC A;  1U6B A;  4PUO B;  4B9U A;  4PYD A;  1PKU A;  2QA4 G;  4NYO A;  2W7A A;  3ZZR A;  2RF2 B;  2C3Y A;  1TL3 A;  3IAM 9;  4ALZ A;  2O1W A;  1WG1 A;  4DUT A;  1FX4 A;  3CJ0 A;  3MM7 A;  2R42 A;  1C1C B;  2JSX A;  3FBC A;  4CIO A;  1JLE B;  1NJZ A;  4ICL A;  4FF4 A;  4AQY I;  3LP0 B;  1NK7 A;  2UVW A;  4NEY A;  1Q8B A;  3OTE A;  2DEJ A;  4X66 E;  3B6B A;  2FZK B;  1BWE A;  2YKP A;  2OIH A;  4X4V A;  4N76 A;  3U1M A;  4NLT A;  3F41 A;  1EI1 A;  5HJX A;  1SC1 B;  1A6L A;  3TX8 A;  3SCJ E;  2BW7 A;  4FBU A;  1HQ2 A;  3SBM A;  4LFA E;  4M63 A;  2DNP A;  2HS3 A;  3I55 S;  4ED6 A;  3RGI A;  2BUN A;  3R2C J;  1K9M T;  1HNX J;  4TY8 B;  3CO0 P;  2FGC A;  2YQ0 A;  4U3D A;  1NSA A;  1M5H A;  4U8Y A;  1NZ0 A;  4ELT A;  1KON A;  5KFH A;  3U1N A;  4Y2I A;  2YQ1 A;  3QBC A;  4GKK I;  1EAR A;  3JSY A;  4B9S A;  2J6T A;  3K1J A;  5KFK A;  1HPZ A;  4L3N A;  4JI6 I;  3GQC A;  2HGL A;  1UWB B;  2IDE A;  4IR1 A;  2N3O A;  3J7Y I;  2IC3 A;  3EMT A;  4Q8F A;  4FF1 A;  4BC9 A;  2MQO A;  3OXF A;  3MTJ A;  3ZTR A;  1H7X A;  1SQG A;  1MN9 A;  5KFS A;  2JLF A;  4Q2L A;  2FHO B;  1S12 A;  3E2E A;  4K5R A;  3W5X A;  1K1S A;  1MMD A;  4L6V 3;  5C0X C;  5I3U B;  4N8O A;  2XY5 A;  1FVQ A;  3I9Z A;  3CJ2 A;  2R4F A;  1R7I A;  2XO7 A;  1VHI A;  2YWG A;  1HBO A;  2FLL A;  2DYA A;  2ZOF A;  3R97 A;  3LTO A;  5HSP A;  4B3T I;  2WB1 D;  1EHW A;  4DV4 J;  1SH0 A;  2DR7 A;  2KJW A;  5C24 A;  2HHH F;  3W66 A;  1U1R A;  4C8N A;  4YDD B;  4GKJ J;  1NHK L;  2P6S A;  2VC0 A;  1IBL E;  4UOF A;  4KJI A;  4RW4 A;  1C0T B;  4LVN P;  5HN0 A;  1SBR A;  5DRR A;  3IXQ A;  1RT1 B;  4JV1 A;  1F2H A;  4C0O C;  2U1A A;  4Y00 A;  3CDA A;  4M8L A;  2CPF A;  4F3M A;  3KLV A;  4B3M F;  5J2N A;  1R31 A;  5IWA J;  4CLK A;  3N5F A;  2YX1 A;  2Z5B A;  2DO4 A;  5LMU F;  4L75 A;  4LSL B;  2G0J A;  3HHL A;  1GX5 A;  2RE1 A;  2IDL A;  2QL5 B;  3W60 A;  1KR4 A;  2EKN A;  1JLF B;  3WU4 A;  1D1U A;  2HNY B;  2WNR B;  2BAN A;  5KFZ A;  4EBE A;  3OR1 A;  4LBH A;  1NND A;  5F8N A;  2LDI A;  4RBT A;  4YY3 E;  2CPE A;  2E1R A;  4JI5 I;  3J7A G;  3JAM U;  2BR2 A;  3KLI A;  1B0P A;  4KHP F;  2C3P A;  3PDN A;  4AQY J;  2P8I A;  4Y28 C;  2DNO A;  4FP9 A;  3X1L B;  4WBF A;  1VS3 A;  1KS2 A;  3CDW A;  1S0V A;  1SPB P;  3CUN A;  3CCL S;  4DOZ A;  2NN6 E;  4P74 A;  1VQL S;  4KTQ A;  2X1A A;  3HSD A;  3W8G A;  2JH3 A;  4LF7 F;  1XNR I;  4OYI A;  4DR7 I;  5DDR C;  4DL3 A;  3SV4 A;  4FYY B;  2PD1 A;  2A1B A;  2DVI A;  5DLF A;  3GFH A;  3EXC X;  2OHD A;  1XR7 A;  4K4X A;  2RRN A;  3BPD A;  4FNH A;  3MMC A;  2GO4 A;  2OPQ B;  5A6P A;  3LO3 A;  3MM5 B;  3W2V B;  4DV2 E;  4ZVO B;  4GKK J;  4JI1 I;  3FCV A;  1TUV A;  3GSD A;  2Z2M A;  2YXL A;  3QZ7 A;  2OPP B;  4NOH A;  4JI6 J;  2D3Z A;  1BLU A;  3BKF A;  4J91 A;  3CCS S;  4NXN F;  2ZUA A;  3M8S A;  3V4I A;  2PFD A;  4O3O A;  4CM0 A;  3PY8 A;  4LFC F;  3A4T A;  2ZIT A;  2D1C A;  3R5A A;  5C0X D;  2HRU A;  3D6T B;  4X65 F;  1SC4 B;  1UDO A;  1YJN S;  4OYB A;  1RXO B;  2FY1 A;  1GMU A;  4AM3 A;  4OV6 A;  1U1Q A;  2VQE F;  3CED A;  2XO6 A;  1IM6 A;  2X36 A;  4WJB A;  3O3L A;  1Y6Z A;  1TK5 A;  3THV A;  1HA1 A;  2FVQ A;  2NN6 B;  2CPH A;  3CJ4 A;  4GQU A;  4RUB A;  3MGJ A;  3PS1 A;  3JQM A;  2VIH A;  3RW7 A;  2ZNY A;  4JI8 E;  2BMB A;  3PW2 A;  4DV0 E;  3KNA A;  2VOO A;  2HMI B;  2HND B;  4Q44 A;  3MCO A;  4WKY A;  2QL9 B;  3A3O B;  1R3N A;  2V63 A;  3QNW B;  3GE9 A;  4LR9 A;  4QZV B;  4DLG A;  3IR5 B;  4ECY A;  2LQJ A;  1K73 T;  1YX2 A;  1RT4 A;  2WON B;  2FB0 A;  2PNZ A;  3PFE A;  1P9Q C;  1UVJ A;  3SYZ A;  3JSR A;  4OO1 C;  3W1Y C;  4E8U A;  1GT8 A;  1USU A;  2NPI A;  1GXU A;  4YOE A;  5A8R A;  4LSN B;  4OYP A;  2WBM A;  4O4G B;  2HHW A;  1OYR A;  3D28 A;  4OYZ A;  4E98 A;  1T05 B;  1NU4 A;  1CQM A;  5CD4 A;  3JYT B;  1OPZ A;  1A6F A;  1TKD A;  2HRY A;  4K4V A;  1S1U B;  5CAB A;  1FFW B;  2VZ9 A;  3VAF A;  4QW9 A;  4JI5 J;  2CZ9 A;  4DU7 A;  1RT5 B;  2QFJ A;  3HHE A;  3AJD A;  2DNZ A;  1M0S A;  3GIR A;  4W90 B;  2H54 B;  1EKR A;  3M8P A;  1UP1 A;  2IRU A;  2J9C A;  3KWM A;  3OJS A;  3A3N B;  4DZD A;  1YIJ S;  1S76 D;  3IBW A;  2CGE A;  4GC6 A;  1FT8 A;  1HFE L;  1AZS B;  4QR0 A;  2FJB B;  1RT7 B;  2CZV C;  1RZM A;  1XNR J;  3O2I A;  2OEM A;  4DR7 J;  4ZLJ A;  4NE9 C;  3UDL A;  2K7J A;  3QIP A;  5CH7 B;  3UN2 A;  4CYU B;  2RSQ A;  4UQG A;  2JVR A;  3VGT A;  4KKO B;  4CQ1 A;  2FHK A;  1G7C B;  5CQG A;  2CQP A;  3KDN A;  3VF0 B;  2HHH I;  2AW0 A;  1CJK B;  3HD2 A;  5BYS A;  2D69 A;  1RWW B;  1OIA A;  2BQR A;  3UFC X;  2EWH A;  1KQK A;  3Q8P B;  3BYR A;  2ZM6 I;  4ID8 A;  1M5O C;  3M7V A;  2GJI A;  3SCK E;  5D3G A;  1W2I A;  3HFV A;  2XNQ A;  3E01 A;  4PEO A;  5IM0 B;  4R0E A;  1E3H A;  4B3M I;  2HK3 A;  2APO A;  1JXL A;  2ZFH A;  2QLW A;  3UNG C;  5HRO A;  3VGS A;  3LAL A;  4X4N A;  4ZJO A;  4C8O A;  2YQ3 A;  5A0Y B;  4BCA A;  1N32 F;  3K8W A;  2PMH A;  5HBM A;  3RW6 A;  4F67 A;  3HF5 A;  3SQO P;  3GJR B;  1YRT A;  3J80 Y;  3U1Y A;  1H0H B;  1N5V A;  4KYZ A;  3CCR S;  2DXF A;  3BH7 B;  4I4B A;  1NJX A;  2AU0 A;  4KHP I;  4IZK A;  3MMA A;  2IJN A;  4JI3 E;  2YKA A;  4FW3 A;  1S6O A;  3PKM A;  2F65 A;  3CCJ S;  4KV8 B;  4FNI A;  3S8S A;  4MU3 A;  2XHC A;  1VQN S;  1L3S A;  3Q6N A;  2XHW A;  4OO1 D;  3UD4 P;  3DLK A;  1YBT A;  1XJW B;  3J81 C;  2ABY A;  4LF7 I;  1U7L A;  4DV5 F;  2DD8 S;  4JI4 E;  4NXM F;  3IBC B;  3D7S B;  2ZKT A;  4C6A A;  3J80 Q;  3W62 A;  3MEG B;  5FD1 A;  2CUY A;  3R1L A;  1YBA A;  1T0T V;  5D4L A;  1HD0 A;  2F9J A;  2HFO A;  3ZZP A;  5HVG A;  1N33 I;  1NCL A;  1LV5 A;  5K20 B;  4IFD F;  1RUS A;  1RT3 A;  3HT3 A;  2B9W A;  2J7K A;  4ZCI A;  2WSF C;  4FS2 A;  2JEB B;  4HYK A;  1NH8 A;  3QSY B;  2ACM A;  1PGZ A;  3GYN A;  3TOQ A;  1A9N B;  1G6B A;  4B02 A;  3VAH A;  4JV5 F;  2YKN A;  3OLA A;  2B5J A;  1CJT B;  2GC8 A;  2MKI A;  2RH3 A;  2XI2 A;  5D4P A;  3AB4 B;  2MST A;  4ED8 A;  3CJS A;  1NHH A;  3DI6 B;  2VQE I;  1MWQ A;  1RE1 B;  2RDJ A;  4RO0 A;  1WHW A;  1YIT S;  5EDW A;  3L7Z B;  2GO3 A;  3LAN A;  2BBE A;  1IR2 A;  2V5H G;  1FWK A;  5ETO A;  4RR5 A;  1D09 B;  1EET A;  3Q2S C;  4RW7 A;  2HHH J;  2VBY A;  1JNR B;  2NXU A;  4KT0 C;  4QQB A;  2DIT A;  1TL1 B;  2E5L F;  1WAC A;  2ZM6 J;  2GHV C;  3WIU A;  1B64 A;  4F4X A;  3OUY B;  2NZC A;  4KQV A;  1JLG B;  2Q79 A;  2XGP A;  3QJL A;  2DIS A;  3J80 C;  1KD1 T;  4B3M J;  3GME A;  1EKS A;  1RBL A;  4PU9 A;  2HAI A;  4FS1 A;  4ANE A;  4N41 A;  3VTI A;  1FHT A;  5KFO A;  3C16 B;  2UU9 F;  2Y0B B;  2V68 A;  1RTI A;  1BQM B;  4HH0 A;  5ETM A;  1WSR A;  4ZP6 A;  4F0M A;  2GFF A;  1VQ7 S;  2BAB A;  5ETS A;  3FCW A;  2OMO A;  2NR0 A;  1PG5 B;  5K14 B;  1BQX A;  3M4X A;  2M9K A;  4O23 A;  1Q8I A;  4W92 B;  3S1T A;  2C37 B;  1TUW A;  1IKW B;  4M5I A;  4JUZ A;  5HMX A;  4KHP J;  4NEZ A;  5KAK A;  3X3U A;  4QWC A;  2NUH A;  4DL4 A;  3R5B A;  1VCT A;  3FMW A;  5CYQ A;  1U47 A;  2DXE A;  2IRY A;  4HHJ A;  2UP1 A;  3MUT P;  4ZCL A;  3PKY A;  1EP4 A;  2RIJ A;  2NZ4 A;  2XCP A;  4P72 A;  3ZKD A;  3OTC A;  4RBV A;  3AOC A;  3I0R B;  4LF7 J;  1JLA B;  2F4V F;  1B0T A;  1YQH A;  5HP1 A;  1TTH B;  3VAM A;  1LKZ A;  4WIQ A;  2KVI A;  2ALZ A;  1N0U A;  4URS A;  5KT7 A;  2ADB A;  1F5B A;  2GJ2 A;  2MZR A;  1P9Y A;  5EWG A;  1UA0 A;  5D0G A;  4I69 A;  3CXC R;  2NYH A;  5CD4 H;  1N33