1S4IA

Crystal structure of a sod-like protein from bacillus subtilis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
151
structure length
151
Chain Sequence
AFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNSGARIVCGALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords superoxide dismutase-like protein yojM
publication title A prokaryotic superoxide dismutase paralog lacking two Cu ligands: from largely unstructured in solution to ordered in the crystal.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 31
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1s4iA00
2WWOA 4MCNA 3KM2A 1FUNA 2WZ0A 2AQNA 1B4LA 1DSWA 3GZPA 1SXAA 3PU7A 5KBMA 1E9QB 1IB5A 4BD4A 1N18A 2VR6A 3SODB 1UXMA 1Q0EA 1IBFA 2AF2A 1P1VA 2E46A 3ECWA 4A7QA 1COBA 2AQRA 2WZ5A 2ZKXA 2ZOWA 1XSOA 4FF9A 1CBJA 1E9PA 2Q2LA 1F1GA 3H2QA 2AQQA 2E47A 2Z7YA 1XTMA 3HW7A 2SODB 4MCMA 3GTVA 2Z7UA 4OH2A 4A7TA 3CQPA 2VR7A 2WYZA 1RK7A 3LTVA 4N3UA 1E9OA 3KBFA 1OAJA 1XTLA 1YSOA 1PTZA 2AQTA 2APSA 2WWNA 3MNDA 1SXNA 1JK9B 1EQWA 2LU5A 4U4IA 2C9VA 3GZOA 3QQDB 2WKOF 3KH3A 3S0PA 1SXCA 1KMGA 1F1DA 3KM1A 1OZTG 1BZOA 2WKOA 2JLPA 2ZKWA 1HL5A 2XJKA 4A7GA 2ZKYA 1SXZA 1HL4A 3ECUA 5KBKA 3GQFA 2WYTA 4N3TA 3CQQA 2JCWA 1ESOA 2C9SA 3HOGA 1TO5A 2R27A 2Z7ZA 4OJAA 1F1AA 5KBLA 1SOSA 1QUPA 3H2PA 5CU9A 1E9PB 1L3NA 1U3NA 3KBEA 2Z7WA 3F7LA 2AQSA 1DO5A 1OEZW 1Z9NA 4A7UA 3MKGA 4A7GF 1E9QA 1B4TA 1YAZA 2GBUA 1SPDA 1N19A 1E9OB 1AZVA 2NNXA 4A7SA 4L05A 2C9UA 4BCYA 1YAIA 2AEOA 1PU0A 1UXLA 1SXBA 1MFMA 1F18A 1S4IA 3GTTA 1OZUA 1IBBA 1BA9A 1SDYA 1PZSA 1OALA 3L9YA 2K4WA 1JCVA 1IBDA 3F7KA 3CE1A 4B3EA 2GBVA 4BCZA 3T5WA 1SDAB 1SRDA 1SXSA 1IBHA 3K91A 3KH4A 1JK9A 2GBTA 2WZ6A 3ECVA 2VR8A 3QQDA 3L9EA 1TO4A 3GZQA 1Z9PA 2AQPA 4A7VA 1EJ8A 2V0AA 3HFFA 2XJLA 3RE0A 1CB4A
chains in the Genus database with same CATH superfamily
3U9UA 1Z9LA 4XH2B 4LCWA 1KC5L 4XZ4A 1A6UH 1T7VA 3OC8A 3RUGE 4AMKL 1E5YA 1G0XA 5HHPB 4JFHD 1D5ZA 2A9MH 1FZKB 3R18A 4MCYB 3JTSB 4CBZA 4QHLA 2FWUA 3ZE0F 5KAQF 1NCDH 4PRIB 2NY4C 4LU5H 1GGYA 5TH2A 5F7EL 5IQNA 5EBLA 4QNPE 2E47A 1EAPB 3GMPB 1P5VB 4ODTL 4NB7A 4WKZB 3CSPA 1XCTA 2ZXBA 2CCWA 4X4XA 1X6LA 4X99A 4YDIH 4FQXB 1IGFL 4IU2A 2NY3B 4XXCC 2L4OA 3PLYA 3ZMEA 5FECB 2PWGA 3FQRA 2O6EA 4P2OD 2WUBH 2G5UA 5GRYA 2XFXA 3ILQD 1XGQA 3FF8A 4LQ1A 2BIPA 3EZJB 2OJEA 1A6UL 4YPJA 1LP9A 4P2OA 4OCYH 3MYZA 4NI6A 3ULVD 3OMZA 2V5TA 4DP0X 3KL0A 1QSZA 5CLYA 5CO1A 3VFNB 3DDFA 1HYSD 1OAQH 2WLKA 3CFJA 1ZLUK 2H2PD 1NCDL 4Y4HB 5I8KH 3B5GA 3T0XA 3WKNA 3W5NA 5IB5A 1MREH 2VLLB 2XN9E 3DX7B 4EZKA 3HC0B 3MCG1 4ZOAA 3FB6A 1MW1A 5C0CD 4QXVA 4J3OF 4YDIL 1PY0A 3SE4A 1YG9A 3QDME 3OHMB 1V7NL 5D8JH 2IDSA 3NCEB 3SDAC 2WUBL 1QACA 4Y9BA 2J5LC 3NZSA 5DJDA 2Q10A 1Y6KR 5C0CA 1JVLA 3VXRB 1WWBX 1CDIA 1QSED 4FYQA 2EDQA 3EF4A 2HT3D 5D70L 2XQYG 3UAEA 4JHZA 4UANA 2J56A 2P7TA 3ARDD 3SIKA 2F53B 4OCYL 3WENA 2HVKB 1KJ2L 1OALA 2CM5A 1QSEA 4M6AA 5KVMC 5EIIB 1OAQL 4AVKA 3B43A 5D2LF 3MRQA 2NY0B 3ARDA 2G60H 2YIHA 1ICTA 2GBAA 2VCOA 2WXQA 4L4VD 1FL6B 3EYFB 2B1AH 4N25A 1LHZA 1L7TH 1MREL 1T3FA 3MRFA 4FXLA 4DFIA 4ETYA 4BKLB 4RETB 4ZXBC 3U1QA 1V55B 4NC1E 4L4VA 3V7AG 2B77A 2BVPB 2V37A 4LSVH 4BSVA 5D8JL 1KTLA 1U9KA 1U8JB 2HN7B 4KI5E 3X11A 4KKBD 2V8LA 5CN1A 5GPRA 2ODHA 2PPAA 5GS1A 1QA9A 3FU3A 4X6BB 1I4FA 1JERA 3IVKB 3BH9A 3BKJH 2ZSWA 4HIIB 4L8BA 1EXGA 2BERA 2D7NA 1YEJH 3HE6B 3T1FB 3MRPA 3GFUA 3JWOC 2JQZA 1WT5A 3QDJD 4I4WB 1G6VK 4X6DA 2G60L 5IJCC 5ENWA 2NDGA 3APCA 2B1AL 1L7TL 1IIKA 4JEGB 4W1TA 1S5HA 1UXSB 4DSYA 5IW1B 1JD7A 3QDJA 3P4LA 4FP8H 3SQOH 4K0OA 3WNNA 3CSBA 4LSVL 4J3VA 5C07D 4BSWB 1K5NA 2AFNA 2X2YA 4N0YH 3GK8H 3FKUS 4PJ8A 4QRQB 1DBJH 1KJ2A 4H25A 3HUJF 3BLBA 2YXFA 1C7TA 4DQAA 3WUWA 3OGCB 1CFSB 3NCCB 4RX4D 5ESVA 3BKJL 3HG3A 3MV9E 3VGGA 4Y2OB 4PGZA 2FYYB 1JV5B 2GEEA 2HTKD 5DI8A 1X5AA 3R19A 2FL5B 3CQQA 2AGJH 4RX4A 2R9HC 3IDUA 2DQDH 1TVHA 2OCCB 3QQ4B 4G9FB 5FO2A 1OCZB 1G9EA 3VXUD 4NQED 2A9BA 3QQ3B 3IGUA 4WI4A 3LYRA 1PD6A 3MA9H 5IW6A 1TSRA 1D7BA 3LB6C 4FP8L 3SQOL 2MTPA 2ZONA 3CFDA 1CTOA 3ZOAA 2G75B 5F9OH 4NQEA 3VXUA 4EOWH 2Q5BA 4I9WE 5TQ2L 4N0YL 1C5CH 3MRIB 2XT1B 1DBJL 4YLCA 3O4LE 3DUUA 4Q89A 4HW6A 1FNLA 2HUHA 1NGZA 2X2HA 4KY2A 1DANT 2FT7A 4WEEA 1KN2H 4JMXA 5IK3A 3TO4C 3Q05A 3V6ZA 1NPJA 1H9DA 3ES6B 4JB9H 3NIFB 4MJ4A 2AGJL 2AXGB 1UB6B 4BQ8A 3LPOA 3KPOA 1MRCH 2DQDL 5J9PA 4PCSA 5D7JC 5M94B 4IBYA 4DZBB 1UGNA 3L3HB 2RQ8A 1NANI 2NR6C 5E6ZA 3QDMA 3FT2A 3MA9L 3BSGA 4G5AA 5GGRA 5I82A 1T1XB 2J5LB 2BW4A 1KCBA 3J2PA 4N6RB 5F9OL 2J2ZB 4WSGA 4EOWL 2WCGA 2ID5A 2DWEA 5DJ6A 4YJZL 3NJFA 1MY7A 3B5HA 4HOMA 2BSSB 1C5CL 2BY3A 4ONGH 1LDSA 1PIGA 1GSMA 4HUVA 3PWVB 4ELME 5I1LA 1W16A 4NNYA 1JYXA 1MHCB 3VB9A 3X1GA 2Q7YB 4F9PC 5CCGE 2ZNWA 1KJMA 2VO8A 4MX7B 5IHWA 1KN2L 3HC3L 1BVNT 4JCWA 5K33A 1ZE3C 4DPCX 1KTDB 3WEMA 1IGCH 3S2CA 1G9NC 1XGTB 2MNWA 2VSMB 4OUOA 3VI3B 1HQ4B 1MRCL 4ZXBB 2X88A 4F58H 2R1YA 4HK3J 1DUZA 4TN9A 3WY4A 1ZLVH 4HJJH 3NCBB 4PWEA 4QHKI 4WUUD 3L13A 1EFXB 4GKNA 3WY3A 3IKCA 4POZC 2W9EH 3UC0H 4ZMXA 4DOHB 2ARWA 1JK9B 1NKOA 4F1SA 4P2CG 4WSJA 1L5GA 4F8NA 1OWRM 4LVNB 5BMFH 3E80A 2DQ6A 1T89C 5KVDE 1IEAB 3DGGB 4ONGL 5F0LB 5FV1L 3KYKH 2FJFA 1J8RA 2OX5A 3M7OA 1H5BA 3RBGA 1W80A 4GG8A 2N0MA 4W9LC 1GAFH 3AWGA 3W0WD 1YN6A 4CVXB 2OPCA 1IGCL 2QT6A 3P11L 2QPSA 4PJXE 4F58L 3MGTB 1R3LA 2VN5A 3W0WA 5I1KH 4DIXA 2IAMB 4Y19E 3SYOA 3ROOB 4HJJL 3GMRB 4L8CB 1IV8A 2UZXA 1XD0A 1NFDF 1T1YB 3EJZD 5FGSA 4HFWA 2W9EL 3BVTA 2MMXA 5CLZA 4XBPA 1FC1A 1AZVA 1KPRA 2V17H 1NCWH 5E9DB 4IIZA 3I9GH 1S7UA 3L5WB 2ZX7A 5BMFL 5MENE 2VRKA 4MJIB 4MXWH 2GCYB 3QPXH 5A16B 3SY6A 1S9VB 3HR5B 5DO2D 3MV9A 4OGQC 4FN0A 3IEAA 3KYKL 3QJOA 1U8IB 2IADB 3DURB 4BIKA 4HKZA 4WFGD 5D1XE 5AUMB 5SWZB 4KKLC 4YMPA 4AJ0A 4H2AA 2QDWA 1J87A 2VZOA 1JDCA 3TURA 3MJ6A 1B4JH 5FFGA 4Z78B 3OV6A 2QELA 3SHSA 4NT6B 4Z7QF 4NQSA 1I1RA 3S35H 2WZ6A 5I1KL 4ZAKD 3FFDB 2DJSA 3FB7A 3IJHA 4H13C 1C8PA 4KAQH 1NA8A 1P84K 4OI8A 1WAAE 1ODAA 2K45A 2YAMA 4IS6B 1EAQA 1P4BH 2C1PB 4MD5B 4OD3H 5MEQB 3JV6A 4UQ9A 2OTWA 3N41B 3U7YL 1PZCA 2V17L 3O4LA 1NCWL 5TD4A 3SKJH 1EO8H 1NGWB 2R23B 2XFGB 3I9GL 5HHNB 3SJVD 5C92A 4KFZC 1FYTD 1S7VA 3QPXL 4LL9A 5DZPA 4YR6A 4R7DB 3TO4B 2QKIC 1TUPA 4UV7H 2VQ4A 3QUKB 3TN0C 5C0IA 2DQTH 4QMEA 4WI5A 3WNOA 3ZKMC 3PUCA 3SJVA 1GW0A 2F8VA 4RFOH 4GFXA 1RERA 3UIZA 3QPQD 3UPAA 2VIRA 4JY5H 4HBCH 1GVIA 1B4JL 1AOZA 2ZYIA 1OF2A 5IBLD 4OGYL 2C34A 2WV3A 1WBYB 2BHYA 4R3SA 5FYLE 4RAUB 5E7FA 3VACA 3FU5A 1MSPA 2GAZB 4XMKH 4LOEA 3DX9A 3JTTB 5K1VA 2GUOB 1P4BL 4ICXA 4HWZA 4ZW7A 1ASPA 1A2YA 3HPJB 3IF1B 4ELMA 4XVJH 3SKJL 4JGNA 3VG9C 5INDA 1EVTC 5J11C 2OFQA 1TIUA 4UV7L 4QY8A 2VXVL 1MCHA 4JANA 3TBSA 4F80A 5IROD 2AJXH 2DQTL 1XMEB 4B5ZA 4JREC 5EN3A 3VFRA 4JM2F 4LKXA 2VR3A 4FTVB 4RFOL 2D7QA 4NUQA 4OFKA 1UHVA 3CD4A 2RH0A 2WTPA 4ZFFB 3C6LB 1JHLL 5IROA 3ESUF 3PGDA 3QDGD 4HBCL 4JY5L 2LT9A 3T4AC 4Z5RA 5IJKC 3BP4B 3ILEA 1IKNA 2A0LD 1O7DC 3NJVA 5AVWB 2HLFC 2PMZA 5HDLA 5DRNB 1DSFH 5CINH 2QMKA 3VXMB 1OOAA 2DQMA 1XX9C 4G6FB 4XMKL 4A2FA 3JBG7 4NUJA 3KLAB 1JRHL 4AQEB 2XZQH 1WQVT 2FE0A 1RZ7H 2XA8L 3R06B 5DJAA 1TR7A 4P99A 5K59F 4AWJC 4XVJL 3SBPA 1KYDA 1WD9A 2KLSA 2WBJD 4Y4KC 5D1XC 4YO0A 4U1NB 2DLHA 3CZNA 3IFLH 1A6WH 4KOCA 4YPGA 2DLFH 3AG3B 3DJSA 3IDNA 5EWIH 4I88A 1NDMB 3ZDXE 3CK0L 1ZV5A 3VX1A 1NDGB 3QR1A 5CZXC 2AJXL 1G7JA 2BSRB 1UFGA 3TBVB 3H3PH 1M1XA 2N4IA 4PJXA 3P0VL 2WN2A 2A74C 3TZVA 3U0WH 3DXAD 5DJ0B 5DUPH 2GBTA 1G7QB 1UKQA 3QQ9D 1JL8A 1EJ8A 3POHA 5CINL 4IU3A 5CHNA 3G04B 5JYMA 3QQXA 4UTAH 5I18H 2J73A 1B3IA 1JNJA 5B1JC 1HHHB 3QDHA 5DXWA 1UGKA 1Z9SB 4ZNCD 3GUTB 1LDPL 3GSNH 1E6OH 1RZ7L 3BD4A 2P5EE 2ZCLH 3IU3A 3TOPA 3BT0A 3IFLL 1A6WL 2CIIA 4MCZA 1AQMA 3RVUD 2DLFL 5EWIL 1I8LC 4NKDA 5JIQA 4M61B 1SHSA 4PJBB 3PP4H 4WI7A 4D9LL 5G55A 1DTUA 3H3PL 5HYEA 4UZSA 4B53A 4N9OB 3AUVA 4P59H 5DC9B 4JGUA 3U0WL 2PTTA 2WM0A 3CX2A 4MA3A 5C08E 1WAAA 2FJGA 4BQCA 5AOMA 2R2BA 3DKHA 4AZ8A 3TA3B 2Z6FA 4UTAL 2ICCA 3S96A 2VB5A 3ORJA 5I18L 3KPMA 3DX8B 3ARXA 4S0TD 4QRRE 4ZUWA 2QKIB 5JYLA 3OKYA 3GSNL 1E6OL 5JO5B 1EPFA 3UTTB 4YXHH 4FCAA 4N85A 1AGEA 2J1WA 2AI0H 4HAFA 2Y36L 5TJWK 4DEWA 2ZCLL 1G9HA 4IOIA 4JE4B 2I07B 1JPGB 5FDYA 4OCMC 4EDXA 1FNEA 4M7JH 4OZGF 3RVVC 3VO0A 3PP4L 5CMAB 3S7GA 3RL2A 2GKIA 2Z4TA 5E5RB 4RMWA 1BVOA 1CDUA 1FL3B 4P59L 1AOHA 3H7BB 2NXZD 4AV0A 4NS0A 3HKZA 2EUZA 5KS9A 3K71A 1KB5H 1E6JH 1K2DB 2OL3L 4PJGB 1BPVA 4B9KC 5IFHH 4JX0A 5EPMA 1F3RB 3VG9B 3WJJA 4F5CE 3UYPA 4GMSL 1XCQA 5DJXB 5EULV 3L1OH 4WIQA 1ZS8B 1D7CA 4YZFE 3V6FB 4JREB 4CJ1A 1BQKA 2H26A 3G6JE 3PL6D 5I6PA 4PP1C 1DJYA 4M7JL 2Y6SC 2Y7SA 1GY1A 3EJUA 1MPAH 2F5AL 1V3KA 3GXPA 2ICEA 2H2SC 5BZWA 1LWHA 4JDVA 3TESA 1Z9OA 1MFCL 2X4QB 4KK8D 3PL6A 2KZWA 1KXVC 3BEVB 5H35B 4UDTB 4UTAA 4DGWC 3KPRE 3I84A 2OMYA 4GI9A 4CVZB 1E6JL 1XQ4A 4PMEA 3GSNA 3VFMA 4XMPH 5EEWA 4DCQA 5EORH 5FM8A 4KXZH 5IFHL 1TOXA 2BNRE 3DMMC 4XCEB 3IJEA 2V3DA 4Q9RH 3FCBA 4W9EC 3AXLA 1IILE 3L1OL 5FOBB 3RGVD 5LGJA 1QRND 5FLVA 4KMLB 1WPCA 5D1QE 1A1NA 4YDVA 2X1XR 2VR5A 4PS3A 4F57H 2YZ1A 2LQRA 1SLVA 4HJ0C 1S78C 2J1XA 3NZUA 3H54A 4Z3GA 1QRNA 4HK0B 1MJJB 2YA2A 3VGHA 3O6FC 4K8RC 1MPAL 5AW0B 2I69A 3EDKA 3NTCH 2CHXA 2OL3A 2MQ0A 2ZOUA 5CFAA 2WIMA 5C0ND 4PJCB 1HHKB 3RVWD 4ZS6D 5I8EB 3TBCA 4L18A 2YC1A 4U6XA 3UEZA 3QIBC 3ZHKA 2DAVA 1AQDA 5KYNA 5A2CA 2F19H 4TTDD 1ZHLB 5EN2A 1IM9D 3IFPA 3B2DC 1KLFA 3NZHH 1KENH 5FYKE 3CFBA 3L3OB 2X42A 4YL9A 4PJHB 4N2MA 4Q9RL 5F44A 1R19A 5FX3A 1MLBA 2NCEA 1MI5D 1IM9A 4F57L 1MELA 4PWFA 3KHQA 5E5UB 1ZVSA 5FKPB 5DQJB 3EFOA 4L3FA 2EUVA 4NENB 1D5XB 1BOGB 1FIEA 1UUSA 1CDBA 3FT4A 1MI5A 3RJDA 4GKLA 5C08A 3BWAA 3VRJA 4YS4A 3NTCL 2H1PL 5C3TA 4R7NB 5ESAB 4U0RC 4FNQA 3MBWA 3KPLB 3CSYB 5IF0A 4PHXA 5IZ7A 5JQ6L 3BH8B 3FO9A 2ZNXA 3P2BA 2CRYA 3CDFA 3VNZA 3FOMB 1TCMA 3L95B 4J3OH 3ZIYA 3HB3D 1JI1A 2F19L 3JWNG 4AH2B 4F2MB 3FRUA 4HLEA 2IGTA 3NZHL 4PU2A 2KH2B 1NAKH 1LQSR 2W9LA 3RWIB 4WTWA 3B2UC 3VD3A 3IS0X 5DJZA 4FHBD 1IZKA 3SBWA 4U0QB 3ZMRA 5F3BA 4QT5A 4HEME 4WNQB 2IH3A 4XVTH 1BBJB 2J8UA 3V0FA 2ED6A 2IPUK 3ARWA 1CLCA 1T1WB 5C0BE 4P5TD 1FVCA 4HLZH 4LCCB 2FQEA 2CXGA 4QWWC 1ZTXH 3PAZA 2PXYA 4EKJA 3RY6C 2YD3A 1CMOA 3MR9B 5MERB 2KC0A 4PIBA 3AU0A 4P5TA 2IV9A 3T08A 4B0MB 4XPFH 2CHNA 2QTVA 5H37H 3PP3H 2CRMA 4APQD 5KSBE 6PAZA 4Y9EA 5DA0B 1E4JA 1N4XL 5D1QC 5EU3A 4OT1H 4JFEB 4XP1L 1F4XH 2D2CC 4JFDB 3JT0A 3I75B 5DJ8B 3G6JA 5SWSE 3CIAA 1YMMB 1U3HA 5HI4C 4APQA 3TPKA 1SY6H 3KPRD 5F1SA 5KZCB 1BOYA 2Q3ZA 3ESPA 4KUCF 3QVAA 2Y23A 2AQQA 3B9VA 4P9HH 4XVTL 4PJEB 3DHUA 3PV7A 1HQRA 3DPBB 2NZ1A 2FJSA 4MKTA 5JPMB 3PFUA 3KPRA 4JL1A 1G5GA 1IT9L 5FK9A 4WU7A 1ZTXL 4L1DA 2IGLA 4JO1H 5HHQB 4Z95H 4PHZA 3N1FC 4NJAH 3VMNA 3DMMB 1W72B 5E1AA 4QRUA 5K9KB 4KJPD 5JPNB 1HXMA 3FO1A 1O6VA 4OT1L 5EU6B 5J6SA 4N0UA 4W9IC 3MV11 4W93A 2EEDA 4NDMA 2ATKA 1T7XA 3O45A 2OMZA 4G8EA 4UT6A 4ALAH 3NCFB 2YA1A 3O6FB 1EDQA 3QWNA 1Y1UA 4NNPH 1SY6L 4H5SB 5CZVH 4MVBC 5JA9A 5KG9B 3MCLH 2Z7ZA 2V7NA 2WTOA 3GSQA 4P9HL 4P48A 4J3OD 2AK1H 4X7SH 3N41F 2NNAB 1QFOA 3LEVH 5JW4R 1JDAA 1F58H 3QORC 1J8KA 2IEPA 4Z95L 4NJAL 1H6FA 4EO5A 4DAGH 3SBRA 3HI1B 3FONA 4XNXL 2XC8A 4JN2A 2DQCH 2XQYK 2EH7L 1B2WH 1FHNA 3LOWA 3IDGB 5E00A 2M1KA 3VI4F 2H4EA 4HEPA 2XXGA 4Q4EA 4TF4A 4Y5XA 3WIAA 4U33A 1IAII 4P2RD 1VEOA 3I02B 4PY7B 4ALAL 2CKBA 2JQAA 3PYCA 5KSUB 5I71B 3FFOA 2QBWA 1XZ0B 2I9LA 4NNPL 5CF3A 2J7LA 5CZVL 4P3DA 5I8OH 1SDAB 2Q76A 3G5YA 3MCLL 4HISA 4WW1B 3MRHA 1U4EA 2YGPA 4PJAE 4P2RA 3ZVVA 4U0RB 4X7SL 4TNFA 4OVUA 1T21A 3X3FH 3ECVA 2H1LM 2F5BH 3C8HA 1U42A 2GK2A 2V6HA 1A4KA 3NSXA 4NQCD 5MEOA 1F58L 2FSEB 5H37A 2GJ6D 2IDUA 5I1CL 1BYOA 1U95B 3ZYJA 4Z23A 3F12B 2XVBA 3B3IA 1JZ7A 4OZFB 3FU7B 3BAKA 4DAGL 1A64A 1EHNA 4L5FH 4NQCA 2DQCL 4QUOA 3VFOA 4FXTA 2GJ6A 4H44C 3P77B 5AVTB 4U2ZA 2XU9A 2COVD 1PZAA 4UDUB 4OF7A 5EOCJ 5PAZA 2E7BA 2XG5A 3BPOC 2F74A 3P2TA 1NFIA 4JVUA 5C0BA 3D51A 4R7LA 1TZ8A 5I8OL 3A6OA 1FLTX 2YGQA 3MREB 3CMOH 5DRZB 1IM3B 4PH8A 3CSTA 2WBKA 1I82A 4JUSA 4WTQA 4D7BA 1ROWA 4EUPB 3PPSA 3WHE0 3X3FL 3X2QB 1E67A 5I6OA 1S7WA 2CU9A 3ZZ1A 2F5BL 4QO1A 3WYRA 4ATWA 2VGLM 3MYJB 3BGAA 4UQCA 3C5JA 1RLBA 5CJQH 3LNFA 5KSBA 1PYWA 1XGRB 3WIFA 5IUCA 3EDDA 1OSPL 3AMKA 4FG2A 3TNMB 3A4EA 2Y7QB 2JE8A 2OCJA 4L5FL 4NKOB 4ONFH 2ZWSA 4NZUH 4AYFB 1OCOB 3LZOA 3HUJA 2H32A 2YPKA 5DC2A 5CIPB 1CFNA 2EDMA 5AZEH 3WIIH 4EN3D 3O6KL 4ABWA 4ODWB 1R3IH 4POYA 2G9HA 3UTQA 5L2JA 2Y5TA 4XOCA 4LPXA 4L0YA 5LBSH 4UI2A 3ESOA 3HZMB 4RWYH 1T03L 2FO8A 5J0BA 5ERWB 1EUTA 2WSDA 4M02A 3D25A 5I1JH 3N91A 3WS3A 2Z92A 3TF7C 4B27A 2V9UA 2VC2H 1XF5B 4D0BA 2W59A 2ZTBA 5HHOE 3K7UA 5CJQL 1BQHG 1AGBB 4JKKA 4PJBF 2PCPA 4JLRB 4OZHE 5AAWA 4KQ0A 1LJMA 1YEDB 4G8IA 1N64H 4U6YA 4PJFF 2B08A 3SSGA 7PCYA 3DI2B 5E1GA 4ONFL 1RZQA 4NZUL 2BNUA 2F7RA 3Q5YA 2Q7NA 3KLQA 4X4ME 1A4CA 1UKSA 1HL9A 1WZKA 3TXAA 1ZSDA 4QRSB 5AZEL 3WIIL 2GBVA 2IBZY 4YDMA 1OTTC 1JVOA 2NXYD 1EZVY 3VH8B 4N2DA 3VFUB 3MNWB 1FBIL 4GBXC 3IXTB 4HWEH 2OYPA 3T6XA 4EVNA 1FNGA 1IE4A 4RWYL 3FFCD 3HRZB 5DHYA 3BZFB 4KY1H 5I1JL 4IJTA 5F3HB 1XO8A 5BS0D 1FE8H 1XH3B 3BD5A 5D5MB 2VSKB 1AXIB 3FFCA 3SYQA 3THMH 4S0HA 3LKRA 4AYSA 1NBZA 1LD9B 3VYNA 1IGTB 3FHQA 4I13B 4BK5C 3IT8D 5BS0A 2G4EA 5DZVA 4BDVB 5DMYA 2HJFB 3VTAA 1RH8A 3MMEB 4AQZA 3DV6B 3IXAB 3PAUA 3RTQB 2HYMA 3VWJB 1MW3A 5DFVD 4LOFA 4HWEL 1DZBA 1DSYA 3AG4B 3H8NA 4YSAA 4QF1A 3O3BB 4DGIH 4JFFE 4DN3H 1D9KB 1BF8A 2YPLD 5JXEC 4ZTPH 3GRGA 5IHUH 2JB5H 5HYIA 5IMLA 3QQDB 4DW2L 2OR7A 1F8TH 4L3EE 1IZJA 1FE8L 3LPWA 2D9CA 5HY9B 4YHLH 3THML 3RWCB 3VE0B 1ID2A 2YPLA 3MRLA 3ZYZA 4CW1B 2K0RA 2JLPA 5GSVA 5EEUA 1KB3A 4KK9D 3B7YA 3ZMNA 1S3RA 3BPOB 5E1HB 1TZGH 4PLNC 4LZKA 3ZR5A 3L5XL 1L9RA 1MCLA 3KVDD 4P46D 1ET7A 1YQ2A 4DPRA 4OQTH 3D2TA 1ZLWH 4AIZA 1DE4A 3QA3B 1QD0A 1UYWL 5DZAA 4CADB 5J4MA 3MXVH 4XB8A 4CVUA 2W0KA 4JDZA 4P46A 4JE0A 4DN3L 1WLHA 4A7UA 3QZPA 4QHNA 5AAMC 2AV1B 4ZTPL 3ZGHA 5IHUL 1MXDA 3X12A 1D6EB 3NIDB 3IB4A 1B2YA 2ZP8A 1KB9J 2CA4A 3D69B 1F8TL 3LDBC 3NCJH 4FQQB 4R0LC 1PS3A 3UTSB 1AIFA 1KJ3H 3AQZA 3K6OA 5DJ2A 5DK0A 1FFPA 2QVFB 4Z7VE 1LXMA 3E8UH 2VXSL 3QO1B 5K9OB 3L2NA 2GTQA 2HJLA 2ZUVA 3C6EA 3RBSA 4WFEE 4RMQA 2WVUA 3SPVA 3BGFC 2VDNL 4XHQA 4JY4A 2VDMH 2OMVB 3FAWA 4PJCF 3OKOA 3O3DB 1YEKH 3K4DA 1FRGH 4HJEA 2FATH 4O5LH 4OLVH 2Z4QB 3TNNA 5AW9B 2E7LC 1S9YB 3EDEA 3TFBA 3DTXA 2AJ3B 1Z3GL 2FYVA 4OQTL 2Y07H 4CDHA 2EC9T 3ZX1A 4OD1H 1XDTT 3MXVL 2H6UA 3L45A 3JV0A 3W9EA 2A7BA 3KGTA 5KJ7E 1FSKC 4PJHF 1IARB 3A67H 5F7YC 4BFOA 2B8OT 2J8OA 1GS8A 1G94A 1FDLH 1BFOA 5EUKA 1KJ3L 3M1CA 3VWKC 1REIA 3OSVA 2C9AA 4XNUH 4X4MA 3F01A 5DHEA 4MMXC 5IQ9B 3S5LG 3DK0A 4OTXH 1NLDH 2FWOA 1YEKL 4PN6A 1N9PA 1FRGL 1FVEA 3U6RA 4O5LL 3CFKA 4NQTA 4OLVL 3UO8B 1ETA1 4ZUUB 3C5SB 1GGCH 4OV5B 3G7TA 2QSVA 3OKDB 5DEFB 1DQQA 2R29H 3D0LA 4R4ND 2Y07L 2YBRB 4IOFC 4YWGL 1BMGA 1JWMA 4OD1L 1F56A 1QSFD 2X9ZA 1WWAX 4LHUG 4CJ0A 3X14B 2OCFD 3JVFC 5B39B 4MD0B 3A67L 3D07A 2VABB 1HXYA 2BP8A 1BM3H 1FH5H 1FDLL 3MHZA 1OPGH 3F7YB 5HGHA 4ZMNA 4GPVA 3HPLB 4MB3A 4K55A 4HWUA 4XNUL 2XZZA 4BE5A 4JM2D 5BVJB 1VKXA 3SKOA 1SMOA 2Y7OA 4TQEH 4XX1G 5IFAH 4K9EL 5F88B 2VE6A 4ZO9A 4OTXL 4OQTA 1AGCA 1NLDL 4F9LC 2CBQA 3KYMB 1XSIA 5IJVB 1A4BA 1UT9A 1QZNA 4QYOB 1N8ZB 3T1WA 4XBGA 3L4WA 1V7MH 4LARH 4PLJC 2QQLH 2BS71 4TUJB 1BYPA 2R29L 3H56A 5I1AB 4XCNA 2BIHA 4HKJB 4XH2A 1HSBB 3L5IA 1RUPH 4PRID 2YXVA 4IRJB 1KEML 3D9AH 4MDJA 5HHPA 1AACA 2XCMC 3Q0HA 4QRPB 3FJTA 4MCYA 3JTSA 1BM3L 1FH5L 2CCVA 5GGSA 3GIVB 1L9PA 4UOZA 4PRIA 2X0UA 4PJEF 2PW1B 4JL2A 3GSUB 4FQXD 2NY3D 4FEMA 1NIAA 4L9LB 5L88H 1EAPA 3GMPA 1P5VA 3QYCA 4FJ6A 1JNNH 3F5WB 4WKZA 1I8MB 3NG5A 4QOKB 1U6AL 3ATBA 4LFHD 4FQXA 4KV5F 1KPVB 3FH8A 2ZPKL 3TFKC 5FECA 4X7EC 4H2CA 4OM1H 1V7ML 1QUNB 4LARL 1XGPB 4BELD 4JDTH 2QQLL 3KPSE 4H1LG 4L1SA 3TVMC 5LQBH 4HG4J 3EG9B 3ARSA 3LDBB 2D7MA 1WZLA 5AL0A 4WFED 3FQ2A 1RUPL 1GZHA 3D9AL 4XXDB 5GRVK 2IWFA 4AYMC 2L7QA 3ZGIA 3FZUC 1QSVA 3VFNA 3D12B 4JFUA 1UM4H 5EZOH 3GXUB 5ACZB 3CZFB 4Y4HA 1MCPL 3UDWC 1A5FH 2P5WB 2XIDA 3G3LA 5F7HA 5I0DA 4FYRA 3AB0C 3NIFE 2VLLA 1PKQB 3QUMH 1F6AB 2NTFB 3HC0A 4R9HA 1J1OH 2XLLA 3AM8C 5CILH 4LAQH 3VXRD 1OCRB 4J3WA 1UXWA 2OS7A 1R75A 4IJ3C 4UU9A 4O9HL 3KLLA 4WHYH 1KGJA 4M93C 4OM1L 2F53D 3CDCA 5LG1A 2JCCB 2YR3A 2ZAHA 4JDTL 1CDJA 1NGPL 3VXRA 1TKWB 2X7LB 3S88L 3DHPA 1VFAA 4B95C 1KBPA 2NY0D 2WNXA 3AG2B 3SE9H 1LTXA 3KHOA 1WV7T 4UT9A 3KS0J 1FFQA 2IH8A 1TQWA 5EIIA 4U1IB 2C3HA 5EZOL 3ZHFA 1ZHKB 2Y7NA 4GRWE 1N2RB 1AHKA 1FL6A 3GSWB 1A5FL 4LOVA 3IRZA 4HJGB 5CEXB 2Q87A 3BP6B 4L48A 3VI3E 4BKLA 1J1OL 1ESOA 5CILL 2LGNA 2OBGA 2C3XA 2XVLA 3LQMA 1I8KB 2GJZB 3OM3B 4LAQL 4JG0H 1RY7B 1SBBA 2BVPA 2P28B 1QBLH 2BC4B 2LLGA 3TCLB 2XXMB 4JG5A 4JW3A 1CF8L 2BP0B 1U8JA 2HN7A 3S35X 4AE0A 1INEL 4ELDA 1Y0LB 4JFXB 3HE6D 3PWUB 5KBPA 1JP5A 4BCXA 3TLRA 4G7VH 3TIDB 3IVKA 1KCRH 3SE9L 2XVKA 4HIIA 2JJSA 1Y6MR 5ABZA 3GC3A 2PO6A 3HE6A 1RUML 3OPUA 3T1FA 3KLSA 3KZ8A 3Q1EA 4I4WA 1N0XH 3ARBC 3QI9B 4HOXA 1YUKB 1G7LB 3S5LB 2H6OA 2XQBH 4FRWA 4TYUA 3UZEC 4GH7B 1WWWX 3BQUC 3HN8A 5KVGE 1UXSA 2R51A 4FD0A 4AQ1C 1GPOH 5IW1A 1KYAA 1JIBA 5EZIH 3SPIA 1TZAA 4JG0L 4NFBA 1QBLL 2YOAA 1DYZA 3ZDZB 4BSWA 2EVGA 3TASA 5E95B 3QG7H 4QRQA 4FXGB 2XPZA 3HIZA 2N7AA 2WKGA 2VM9A 4G7QB 4WAFA 3A3YB 1CFSA 4G7VL 3NOIA 5FYJH 3E3QC 1KCRL 4G9FD 2R2CA 1D5MA 4MNQB 4Y2OA 2FJHB 2FYYA 4KNUA 3LZRA 2VO5A 1JV5A 4OCWH 3WBDA 4OCSL 1BXXA 1AZCA 3AXHA 2FL5A 3T0BA 1NC2B 1GJWA 2YHGA 4RWHA 3QQ4A 1GIGL 2B20A 2XQBL 4G9FA 3T0EC 2WZAA 5C7ZA 3MNZB 4N2AA 5I6KA 4JFSA 5FA3B 4FFZH 3QQ3A 2VAAB 1ZDQA 1GPOL 4L1TA 5BRPA 3D1MC 3TVMB 1PNDA 2D7TH 3LPGA 5EZIL 2HMIC 1H8NA 3RWDB 1P7QB 1KBKA 1SJHB 2E6JA 2G75A 1I8UA 4NOBA 2ZE0A 5D71H 2FEEI 3IBOA 3MRIA 3DUSB 3QG7L 4KHXH 4I1NB 5LNEA 2JFCA 2ZWYA 1K9TA 1FHGA 1WFTA 5GS0C 3LXUX 2WKOF 4RGNC 5F6IC 2B1HL 4FQJH 4MMYB 2CBOA 4PTUB 2PYFB 1B4RA 2NW2A 1OZTG 4OCWL 1JMZA 3ES6A 1U8NB 3IFNL 5DEGB 3CUPB 2AXGA 1UB6A 2OJZH 5E2UH 3SZ6A 1WUNT 2DTMH 1UKTA 3BZDA 1H8SA 4DZBA 2XACC 3HNTH 3L3HA 1EAOA 3DJTA 1J48A 1EEYB 4LCVA 1NM4A 3U4BH 4JKWA 1IAMA 3O0LA 4N5EC 3VGFA 4C83A 1T1XA 5L4MA 2A4EA 5D5MF 3P3TA 4ACTA 4N6RA 3AC0A 3EJTA 2J2ZA 5KVEH 4DQOH 5IWLC 1C5DA 3BIBX 1CXEA 4JPIB 2DEWX 5D71L 4RFEB 4IHBA 2BSSA 1MJ7L 4EJ1C 2JKNA 2CE6A 3I2CH 3QIUC 4KHXL 3PWVA 4XNAA 4DUXA 1ORSB 3C8KB 4DWHA 3PHOA 4WO4B 1MHCA 2PWEA 2HFTA 2Q7YA 2C9PA 5ADPL 4MX7A 4ZXBD 1XL6A 2B1OA 5IVXE 5T5FH 2BXYA 1KFAH 2JI3A 3GJFK 2QV2A 4FQJL 4AGNA 2DWDB 4GSDH 1EFXD 1OP9A 1XGTA 2C4FU 5E2UL 5ID0A 4FTVE 3VI3A 5F9JB 1HQ4A 2DTML 4JZNB 1JCKA 3OTTA 2IO5A 3QR2A 1KTJA 5EIQA 5C9KA 2DJUA 3HNTL 2DBJA 1EFXA 3U4BL 2VERA 4ESKA 3T0DA 3Q2VA 2N7BA 4QYAA 4FXKC 3WMSA 4AKPA 2YD6A 1JK9A 5GRWA 3L3IA 3UG4A 3EDJA 5KVEL 1Z3RA 4DQOL 4ES9A 1KCKA 3SGEI 1F6FB 1IEAA 3DGGA 1O0VA 1PLGH 3I2CL 1EZUA 4JO3H 3BUBA 5EO0B 1IKFH 3UXFA 4ORGB 4UQBA 4JGMA 5A6IA 4R26H 4TUKH 4H8PA 1MW0A 5T5FL 2MPVA 3N3EA 1ZE3H 2IAMD 4CVXA 3RKPA 3NJIA 1J10A 4XWGH 3BQUB 4GSDL 1NCJA 2QL1A 3KWUA 1NINA 4KUCD 3L8QA 3ASNB 1XIWC 2RBLA 3MGTA 4ZFQA 4LMQI 1MKFA 1UH2A 3RYMA 2IAMA 3V0HA 3ROOA 4L8CA 1MCFA 3GMRA 4D2NA 5E9DD 5EZJB 3PS6A 4L37B 2YZ8A 1T1YA 3NIDF 4MJID 5JHBA 1YLBB 3HJ0A 4XR8C 4DK3A 3QEUB 5KYXB 2W5PA 3X1NA 2CNYA 4G9DB 5TFSH 1JVKA 4OBRA 4PGCB 1FVDB 2KS0A 5SWZD 4F20A 5E9DA 2ESVB 1LL1A 2CLRB 3HA0A 5F97E 3L5WA 4UUJB 3EH5B 5A16A 1L0YA 5I6XB 2GCYA 2BX5A 1S9VA 3HR5A 1XCXA 1I7ZB 1JZGA 3EH3B 5DTFB 3ULUE 1G84A 1SQMA 5EUOB 3VXNB 1ADQH 1U8IA 2IADA 1PZBA 1IKFL 2WUCH 3DURA 3PRZA 4JO3L 4JZJB 5SWZA 3RU8L 3WUZA 4R26L 4XPHH 3IJ8A 3T0EB 3A6CH 4R8WL 1WTGT 2GY5A 4UCFA 2VDKB 1NDTA 3RI5K 4XWGL 1LM8V 1HNYA 3S2AA 1BVNP 4D9QE 4ILDA 1W91A 4RAVB 4FQ1L 2L04A 5DEZA 2AKRB 4KGJA 2EE3A 4NT6A 5PCYA 4NUGH 5D93C 4E5XG 3ZE1E 1OGAB 2A77H 4LBEB 4RQQB 4I87A 3RZCC 4NBYB 1NCUA 3DX3A 2B3RA 2XQYA 4IS6A 3TO4D 3UZQA 5MEQA 2C1PA 4MD5A 1XGYH 3F6JA 3I9IA 1DO5A 1JF6A 5ESQB 5TFSL 4BUHA 1SF3A 2BFVH 1NGWA 1VESA 2R23A 3T8MA 1JAEA 4RGNB 5HHNA 5F6IB 5ISZB 3A4AA 5T5FA 2DLTA 3QXDB 4Y4FB 3RAJH 3UTTE 5AG9A 3QUKA 2NR6D 5AL8A 1TTCA 3RVXC 1ADQL 2WUCL 3BGMB 5INCA 2K3TA 3PIQA 1FPTH 1JV2B 4XPHL 3GINA 3A6CL 4M7LH 5JMOC 1X3DA 5DUMH 3L5HA 2NR6A 4OY9A 4ZZKA 4Z18A 4HIHB 1AE6L 1KPUB 2ALWA 5FCSH 4KK5C 1QFUH 3BXNB 4NUGL 1WBYA 3FDWA 2V7HB 4OZIB 1ANUA 2A77L 4RAUA 1AGFA 4N26A 2GAZA 5D1ZI 2X6UA 3QIUB 2D3NA 4LPWA 4PJGE 1FFTB 1XF3B 5C2BH 3HPJA 4F9PA 3TJHC 3RFZC 4FEIA 4FTVD 3S97C 1RHFA 1AKJA 3RAJL 5FR3A 3MBEC 1H6EA 3X17A 4H8VA 3TYFB 3U9WA 3OKMB 4C4KT 3CU1A 2Z34A 4FTVA 4M7LL 4NHUB 2J88H 1F13A 3ZZQA 1WISA 4N86A 3VXMD 4ZFFA 4GY4A 3C6LA 2ILLA 2W07B 3GI9L 4IMLA 4PEEA 5A7EA 3BP4A 4FXKB 1QFUL 4JK0D 5EZPA 4AEEA 1BVZA 3FQ4A 4X6FB 4YHYC 3VXMA 4MCMA 1ZD6A 1Q72H 2ZX5A 3WKYA 3CQPA 5HGGS 1JZFA 5AB0A 5KVDH 3KLAA 4AQEA 1YEIH 4MA8H 3R06A 1OY3B 5C2BL 2Z64C 1ADQA 2YAOA 4Q4IA 1HOCB 2XZCH 1KNOB 1ORQA 2R56H 2V9TA 2JK5B 4NC0B 1N10A 2FR4B 2AEWA 3FS9A 1J1PL 3FCSB 4WI8A 5I73B 1NDMA 5DVOA 1NDGA 2BSRA 4Q6KA 3TBVA 1UJ3B 1IAKB 1NKRA 1WK0A 2WP3T 3DC0A 5J7CC 2J88L 3D48R 3MJ9H 1UA3A 3WDIA 2VRQA 3MUJA 1SYVB 5DJ0A 4ELKB 1YUHB 4I85A 3K6SB 1LK3H 1G7QA 1DJSA 4P2YA 4X0NA 1CYXA 1A6VH 2R1XB 2MQCA 4JZOA 4YOKA 3G04A 4EIUA 4DT2A 2HLAB 1Q72L 4HCRL 2CNZA 1HHHA 4LT7A 2IXQB 5CSBA 4EZLA 1YO4A 1IC5H 4TS6A 2UYLB 2GI7A 1YEIL 1Z9SA 2OMUB 3UAFA 4MA8L 3GUTA 1KGCE 3F85A 3ERXA 2E59A 4Z0XB 3O8XB 2XZCL 2F7IA 1XR9B 3JV4B 4NQUA 3TEUA 5T3ZE 3APDA 4IM8A 3I85A 4BV1A 4M61A 4PJBA 1ZT1B 3U1PA 3QRLA 5D93B 2BW5A 1VCBC 3CXDH 3D85B 2JCCF 3MX0B 1N7ML 3MJ9L 3TA3D 2B16A 3W9DB 6TAAA 3GSXB 4A04A 1LK3L 1PY4A 1NCCH 1HEZA 5CCHE 4XN7A 1A6VL 3UTTD 3Q5OA 1ZVYA 3TA3A 3ZKMD 2GUYA 4OF5A 3GZQA 4WWKC 2AQPA 3DX8A 1IC5L 1WFJA 3GS4A 2DH2A 4QJ5B 2QKIA 3BAXA 2C3GA 3ECBB 1JF5A 3UTTA 2RR3A 5JO5A 2IGFL 2NYYC 1G6RB 5BCAA 4MCNA 4ZTEA 3HNVL 4CKQA 4CUCA 2I07A 4X6CE 1SN0A 1JPGA 3EFFB 4HUXA 2IG2H 2VZVA 4AYBA 2WWMC 2X4RB 3EBGA 2R8SL 3OQ3B 3QW9A 1WDAA 4XB3A 3WSQH 5CMAA 5D2NB 5K1JA 3KLHC 5AB9A 2E46A 4F8PA 4MNGE 4DHLA 3O41B 1G4RA 1FL3A 2FBRA 1G9ML 4GMTH 3P9MB 4AY0A 1BIHA 4OUUB 2WAHA 2YJLA 2IALB 3GLDA 1X4ZA 4KKAD 4DGUA 3O4OB 4HCRA 3O2VH 1HHIB 4BWTA 5EDSA 5TDNB 2QQKH 2APBA 3EYSH 1VFBB 3LRHA 4PJGA 3M88A 1CFQB 2B2XL 3OB8A 3RFZB 2W0PA 5DJXA 2Z31C 4JQXC 4U6TA 3MBEB 4B9PA 2EABA 3IGFA 1QFPA 1WWCA 1MAMH 1A6ZB 3V6FA 1OHQA 3ARGC 2X6BA 2HLFD 4CBPA 3CVIL 1AZNA 2IG2L 3MJ9A 2J55A 2CALA 3WSQL 3CN4A 2H0JA 1BD2B 3B9KA 3EIFA 3EGDB 1THAA 2X4QA 4CC0A 3FQTA 4GMTL 3H55A 2WC7A 3GTNA 4GSQA 3BEVA 4ANWA 5GJSH 4UDTA 3E38A 3O2VL 4AGPA 2ED7A 4M1CC 1A66A 3W39A 4TL4A 2CO2A 2BZ7A 2QQKL 1SNRA 4CVZA 1KY6A 1ILSA 4UQAA 4DVRH 1F3DH 4PREB 5CZXD 1D5RA 2BY0A 1DEEA 1OARH 1JYWA 2AEIT 1A4AA 1IGJB 5J5EA 5E8OB 5FOBA 1ASOA 1ZT4B 2ZIDA 1QR1B 1MAML 1N6UA 2G5RA 3P30H 2WNGA 3OB0H 1MIEH 4N0CC 5T3XH 4JHAH 4NQDE 2CO7B 3BOVA 1U3YA 2XTJB 1FV1B 1MJJA 3O0RH 4HK0A 3HAEG 4MHHI 4PGBB 4AGMA 1GKOA 4WK4B 5A1AA 5EU4B 3QZWB 4PJCA 1L9MA 4NP9A 1HHKA 4C55A 4Z7WB 1B90A 1L6PA 4RAHA 5I8EA 3VJ6B 2EE2A 3ML9A 1MFVA 2AMUA 3I6LD 2QLYA 3EOAB 4DVRL 2XXFA 1IJNA 1I7RB 1WCBB 2W60B 5C0FB 1OARL 2XXCB 5EG6C 4FX5A 1QEXA 1A8ZA 3L3OA 1J5CA 4PJHA 2XV3A 4PJ5B 4HS8H 1JUFA 5IMOB 5A3IC 3U82B 4OJEH 2OXHB 1MIEL 3EYVA 3LZFH 5T3XL 4JHAL 5FKPA 3M1BA 3PV6B 5DQJA 4NENA 1AMXA 1D5XA 1BOGA 3GMNB 3ALWA 3HG1E 3O0RL 4AKOA 3MA7B 4WVRA 5DS8B 5DHMC 4WLCA 3ARRA 4Q9BA 4R7NA 1PAZA 2FH8A 5ESAA 3LZPA 1TJGL 3KPLA 3CSYA 3FT9A 3TH2T 5IP4A 3BH8A 2FNBA 2Y24A 2ZCKL 2OULB 5GRVL 4IKJA 3FOMA 3LVEA 2D31B 3O3AB 4ZMLA 3HKFA 1B6DA 3KBFA 3L95A 2UZPA 4JRWA 4TUUA 4TVPH 4I0PC 4AH2A 4F2MA 3QAQA 1W72L 1KCUH 1JFHA 2RCSH 1A8JH 3MLUH 1EJ6A 3DWTA 2XIBA 3RWIA 5E1IA 1PAMA 2BSBA 4HS8L 3ZQXA 3N1MC 3L4UA 2PYEB 5HDWA 3LZFL 2ZKHH 3ZDYB 4B9CA 5BOZG 4WNQA 1BBJA 4W70A 5I1GH 4Y2LA 1TSHA 3D5OF 1UA7A 3ME0B 2X4NB 5E2JA 1ZJAA 4OLWH 3T77B 1T1WA 2KLRA 4FQ2L 5IB3B 1YN7B 4LCCA 3WJLC 4FYSA 5HVWA 4WFHE 1INDH 1KYUA 3MR9A 3TO2A 5MERA 3CFCH 5DJCB 1X9RA 4JFED 2FZ3B 4JFDD 3EJRA 3L16A 5AENA 1PZ5B 5T3XD 4PP1D 4YZWA 1TFPA 2HVJB 3H9ZA 1YMMD 1T0OA 3BC9A 4MHHG 3NZ8B 5KZCD 4TVPL 4JFEA 1DJXA 4YX2H 3AXIA 1KCUL 2VZ3A 2RCSL 3I75A 3F04A 3MLUL 4PRDB 5DJ8A 1KXQE 5TPWL 3S8GB 5DQDH 3OKNA 1YMMA 1M3IA 1CDYA 3LHPL 1KYOJ 1BQUA 1YNKH 3QUXC 2FK9A 2P24B 4R7XA 4R6UA 1IFHH 4UOW1 2ZKHL 3F84A 5D7SL 4PGDB 4PJEA 3LMJL 3PNWB 2JKXA 5I1GL 3B2XA 3DPBA 3VGAB 3VW3H 3K46A 4OLWL 5JPMA 3DMMD 4JO5A 4NJ9H 3GPSA 3VM7A 4YHIA 2QR0B 1NMCC 4H26A 5L7XH 4K3JL 4EUPH 2PCYA 1ITBB 1INDL 5EUOF 5HHQA 3CFCL 1WP6A 4N2EA 4LKCB 3G5VB 5EU6D 3DMMA 3I3DA 3S3SA 4EAEA 2BOBB 1W72A 3CLEH 4EE2A 5I6NA 3LKQA 3D05A 3O6FD 3S3DB 4YHNB 5K9KA 3PQYB 2NYZA 5JPNA 4IW4C 1SLUA 1AAJA 1NICA 2AJSH 4KRNA 4YX2L 5KYYB 2IWGA 3O9WA 1WS8A 4NCC1 5DQDL 1HH6B 2NY1C 2HKHH 1OW0C 3O6FA 2IDTA 1YNKL 3DTDA 1N8OE 2TRYA 1O7SA 2AF2A 1P1VA 2APVA 4H5SA 5B38B 5KG9A 3N44B 1DO6A 1IFHL 3KG5A 2E9JA 5FB8B 3K1KC 5E2VL 2NNAA 3ZTEA 1PCXA 4TVPD 2BP5M 3OJ2C 2WXKA 3DX6B 4NJ9L 1F41A 1KGXA 1UT1A 4PAZA 4ZX4A 5L7XL 4GKSB 4OH2A 2QLVB 4EF3A 4PYGA 1NWOA 5C09E 3JWNE 3QIWB 5HI5D 3BDBA 3CLEL 3HI1A 5JXAL 2MOQA 3SZKC 3HMXH 1XGZA 4O2EB 3OAZH 3WY1A 1QNZH 3HZYB 2W8CA 5F7DB 2AJSL 6CGTA 3RWHB 4L8SB 4I2XB 3I02A 4PY7A 1QWHA 2GHZA 5KSUA 2HKHL 4OZIF 4G6KL 2OMTB 3JWDC 2W80C 1XZ0A 5DLMH 1HXKA 4XCFL 1C1EH 3H9HB 4WW1A 4R2GB 4FE9A 1A9VA 3CG8A 3LXCA 1YVLA 2LU4A 2ICWA 3ZE2E 4ZW6A 4RISH 2CRIA 2PR4H 4P5MB 3B2UD 2FSEA 4RIRB 1RP9A 3A47A 4LP5A 1ZXQA 1U95A 2PCXA 5FM4A 1MCKA 2YLHA 4OZFA 4L3CB 3BFWA 4PW3A 4Z7NF 2NLJB 3FU7A 3E6FA 5FOJA 5IVZB 4HF5H 3HMXL 2EYRB 5CP3H 5TGBB 3L3JA 3OLGA 4A7SA 1QNZL 3P77A 2XWTA 3SOBH 3PJNA 1IM3D 3PDDA 2CPCA 4UDUA 1X5GA 4PY8J 1TZHB 4MMZB 4A2EA 1TG8A 4K4KA 5DLML 1ND0B 2ERJC 3MREA 2WXHA 5DRZA 2UY7B 1IM3A 1E50A 4NI3A 1WHPA 4EUPA 3L3GB 4K3DH 1MF2L 1WVZA 4IEFA 1SM3H 1RI8A 4N68A 4RISL 4YK4C 3FUHA 2PR4L 1X5XA 3K91A 3VXQB 1TTFA 1HNFA 3C5ZC 2N3JA 2A9NH 1MHEB 1XGRA 3U25A 5DZLA 4X4ZA 1IFGA 3TNMA 4U6VH 2Y7QA 1CXFA 4NKOA 4HF5L 2CJ3A 4AYFA 3EGXB 4OFVA 5ABAA 2NY2C 1E5BA 5CIPA 3NSDA 1NUNB 1PJWA 3SOBL 4TL5A 2WVTA 1P4LB 4ODWA 4TTGA 4ZI8A 3QFJE 2JXMB 3EJCA 4A7QA 1DJZA 2V9QA 2ZX8A 3QUYB 3QCTH 1KELH 4KTEH 3HZMA 3QXTA 2FDBP 5MI0C 5ERWA 4OJDH 4K3DL 4TVSa 1SM3L 3WXVH 1L9SA 5HDBB 4J28A 1ZK5A 5A2BA 2BSED 2WTRB 3WXWH 5IVNA 4HKXB 1MCWM 5FF6B 1XF5A 3HMXA 5CGYC 1MH5B 3RB5A 1A4JB 5GGTH 4ENZA 1AGBA 2A9NL 2WNWA 4RBPK 4JLRA 1I7UB 3F7VA 5JHDB 5KSAA 4AEIL 2BSEA 5D7HA 3X13B 2NY1B 3KH3A 3RFRA 1YEFH 4NERA 4QRSA 2XBZA 2EDWA 2WKOA 3OAYH 2EDYA 4GO8A 4LCYA 1HL5A 3VH8A 1P6FA 3E9TA 2GT9B 3MNWA 2XYCA 3SE6A 1E4KA 1B0GB 1I9JH 3VFUA 2EVIA 2BMKB 3BUTA 3H0TB 1X4XA 3QCTL 1KELL 2I5YH 5IVXF 2PPEA 2XWBB 5CLWA 2XI9A 4Y2DC 3HRZA 3ZL1A 2LVEA 3BZFA 2IANB 3OZLA 3BIAX 3WXVL 2A1WH 1AS7A 4NXSA 5F3HA 1E9PB 2A99A 3WXWL 1S7SB 3GJFA 2VLKB 2YD7A 1QRKA 3QK0A 1XH3A 5D5MA 3FCTB 1R46A 5CP3A 3PHAA 5GGTL 1Z9NA 4DW2H 1LD9A 1IGTA 3FU9A 3CX5K 3SYCA 3R1GH 1M57B 3RTQD 1NCGA 2W81C 2KL6A 4JRXE 3G5XB 3KEHA 4F24A 4BDVA 4XHJC 3UMNA 2HJFA 3DHMA 3W5MA 2PPDA 3MMEA 4OM0H 3DV6A 3IXAA 3IETB 3RTQA 3WNJA 4F8OA 5EZLB 1D9KD 1JZJA 3VWJA 1RIUH 4ETQB 2EO1A 3RDJA 5E23A 3U46A 5B1BB 1U2YA 2C9QA 3KPPA 4WW2C 2I5YL 4G8FB 5CJBA 2W65B 3O3BA 4OCXH 1D9KA 3V5HB 4YL4A 4D9RE 3M86A 2A1WL 3V6OE 4LLUB 3BAJA 3QQDA 4ZBJA 5IG7B 1A9EB 4ZFGH 1J88A 3SGKA 3RWCA 3VE0A 4OU3A 3K0WA 3CC5B 4TPRH 5G4OA 4RRPA 4PI0A 1MCOH 4XMLH 4CW1A 1U8MB 4GUPB 4MXVF 5I28A 1A7OH 4HPYH 5F7MC 5LVEA 3S34H 4E9LA 4E68A 4WEMB 3C87A 3EBIA 5F1NB 2YGVA 4KJWC 1HN1A 4OM0L 2QVKA 4XO4A 5IESL 3AROA 3HC2A 2CSPA 3ECWA 3MRGA 1RK1B 2I32A 1RIUL 2OKMA 2ZG1A 3CNKA 2VDPH 4FZEH 2CIKA 2ZOWA 3QA3A 3TWYA 3HC4H 4CADA 2YN3A 4NAQA 3ULSB 3UTSD 4BZYA 3C5ZB 4OCXL 1Q9KB 1JPTL 4PRNA 3MCKB 5E6RB 5GGTA 3HLKA 1U2HA 3B56A 3D39B 1D6EA 4I5BB 4FQQA 3D69A 3UTSA 2DQJH 1T83C 1JRHI 3WFBH 3WGVB 2NY2B 3WMQA 5E56A 3QO1A 1ZRUA 5K9OA 2YD4A 4L8DB 4PJ6A 1MCOL 2W91A 4XMLL 5A2AA 3BZEB 2L0DA 5J1AB 3AS0A 1A7OL 3MUHL 5C7XL 4A2HA 3S34L 4ZJ9A 4K7PL 2OMVA 3ZZLA 3O3DA 1CJYA 2VN7A 4Z7WF 1NUGA 1U8KA 1MCSA 1PKQE 1OP4A 2EE6A 5L9DH 1S9YA 1MFBH 1OAXL 4G59C 5D7LE 2ZOOA 3FCUB 3QWOA 1MCWW 3S5ZA 4FZEL 1AD0B 4GRMB 2BJMH 2CGRL 2DMHA 4NYLB 4PRHE 3IDJB 2ZXGA 3STLA 4H0GA 5AEAA 1L9OA 2ENQA 1NGQH 2X4UB 4EBQH 1CR9H 1NFKA 3HE7C 1IC7H 2DQJL 3GHBL 3WFBL 1FO0A 3K5RA 5J6GB 3QJHB 5DGRA 3MVSA 2IOOA 1JXKA 4UQEA 3U36B 1MN4A 2XN2A 5IQ9A 3L5JA 1N26A 2H3KA 2OSWA 5E4AA 4TVUA 3FO2B 2FD6H 4GXVL 1UVQB 3VUAA 4KTDL 3Q2NA 4GFTB 3T09A 3DX2A 5BRQA 4KVCL 4RSYA 5AALA 3DETD 5L9DL 1F97A 3GNMH 5I9QB 1ZEAH 1MFBL 1X7TA 3Q06A 3JSSA 3C5SA 2YD2A 4OV5A 3OKDA 5DEFA 3V4PH 4RNRA 2YBRA 4XRCB 3KPNB 5CSGA 5EF0A 1UOWA 2BJML 3MSPA 4Y16C 1BXAA 3ARFA 4TRPH 4NZJA 3X14A 2F2HA 4DPAX 4MD0A 1EWHA 3W11D 1OD7A 2VABA 3L9EA 1NGQL 4TQIA 4BK5A 5D6CB 4ENED 4EBQL 1CR9L 4LLMB 4V1DE 3QH3B 1U4FA 3ZDYF 1IC7L 3F7YA 4M29A 3U2JA 5JNYB 2D3JA 5EIVA 1AQKH 4O02H 4BQBA 2H3NB 2WB7A 2Z8RA 3HPLA 1KCSH 2UXVA 3EO0A 2ZX9A 2F68X 3US0A 4PR5B 1ROCA 5CD5C 1LEKB 1GS7A 3EJJX 5F88A 5JXED 2HLEB 4OB5H 1MY5A 3KYMA 4AG4L 5IJVA 4WW2B 2ZCZA 3W56A 4QYOA 1KOAA 1CXLA 1N8ZA 4IRJD 3KXFB 1I1YB 3ABMB 3GMQB 4ZQTA 4TUJA 1QLEB 5JXEA 5I1AA 2Z7YA 4QRPD 4GJTB 4HKJA 3ZDZE 3V6OA 5T1LB 1HSBA 1PG7W 1BECA 1EXUB 4TRPL 5C0AB 3TBWB 2IF7A 4IRJA 3B2PA 1OV8A 1QATA 1E7UA 2DWSA 3Q6FB 4ZSOE 2WYZA 1B0IA 4AENB 3M8OH 5I15H 4AITA 5CEZE 4B3VA 4QRPA 2WQVA 4L9DA 4P2QB 3GIVA 3BH4A 4OSUH 3E0GA 3T2QA 1BIIB 2Q8AH 3KPQB 5AOLA 1A1OB 4EZMA 4QOKD 1WHOA 1UD6A 4MNQE 5GXBB 2PW1A 1AQKL 4G8GB 5BQDA 1AFVH 3US9A 1KCSL 2JKSA 4L9LA 2GC4C 5GZNC 1KN4H 5F89B 3CZGA 4IBUA 1IFRA 3F5WA 3FT1A 2IH1B 2HJKA 1KGUA 3WTWA 3KYOB 4Y9CA 4OB5L 1H3XA 1IC1A 1P84J 1KPVA 1SXZA 1SFHA 3IM1A 4WJ5B 3SGDH 4F8QA 4WI6A 1QUNA 3SDCB 3ZKXB 4FOMA 1OCCB 3L4VA 4IMKC 3S5YA 3WFCH 3EG9A 2VQUA 4YDLB 4BEIA 2ADYA 1OQOA 3LY6A 4XXDA 4C4UA 1UENA 5I15L 1VZGA 2P5WD 3M8OL 1MNNA 3NCYP 1T0MB 5HYQB 3BEWB 3WU1A 3SY0B 3NQIA 3SB3A 3UJIH 1AHWC 4OSUL 2YAFA 3N44F 5ACZA 2X41A 2Q8AL 3CZFA 4N5UA 1KIUB 1CLZH 2LV4A 3B7RL 4ACPA 1AFVL 2P5WA 4MQXC 2R1WB 1RPUA 1KLUB 1KN4L 4H8UA 1PKQA 4WK0B 1F6AA 5D9SB 5DC4B 1OZUA 2NTFA 3F7QA 3U4EA 1ASQA 3MC0A 1YPZE 3LIUA 1AZZC 2XIIA 1JFQL 1BZEA 5JW3H 2CO6A 1KIPB 2LW3A 3B6SB 3F7KA 3FSWA 3N2JA 3LN4B 3WFEH 4B50A 1AJ7H 4DP7X 2VXQH 3ZY7A 3HNSH 1N0LB 2QADB 4PRHA 1MHPH 1A7BA 2JCCA 5FM5O 3COOA 3OF6D 3WFCL 1M7XA 2X1QA 1TKWA 1Z0MA 2X7LA 1DL7H 3HE7B 1CXKA 3N1GC 1GMIA 2C7UB 3H4HA 4YGAB 1N3NB 4ADJA 3AZUA 3HVDA 2MFNA 1J05B 3DUHA 3OF6A 3K8LA 4TNVF 4KXZI 3ARUA 3UJIL 3CMGA 2W0FB 4U1IA 1QW8A 1HU8A 1ZHKA 3F58H 5F0JB 3H1ZA 4IOFD 1N2RA 4XX1E 5I66B 3GSWA 2JJTC 1W2KT 4HJGA 5JHLH 5CEXA 5I6MA 2Y1YA 1L7IH 3BP6A 2ZYSA 4OIAA 3HHSB 1RMFH 2WXLA 2Y22A 2MNJB 5IBUG 2GJZA 4Y16B 5JW3L 3MRDB 5T5NG 3WFEL 4ZAKB 2BC4A 3TCLA 4TNVK 3NFNB 2VXQL 4PY8I 2BP0A 5CXPA 1MHPL 3MOAH 2BNQB 2QVMA 4Q56A 2ZUWA 5JOFB 2ATAA 4X4KA 1NEUA 4E9QA 3SEPA 5HYJB 4Y5YC 1Y0LA 2X10A 4JFXA 2ZD0A 1DL7L 3QI9D 5F72S 3OBAA 4YSEA 4IGBB 5C86A 1FNAA 5IV2B 1FYTB 3UBHA 4QI3A 4LDOB 3ZRFC 2KBGA 3PGCB 2VW4A 3QI9A 3F58L 1G7LA 1QHOA 5IQ7H 4N6QA 5DYOB 4KGLA 2EDHA 5C3LD 2F54B 3QAZB 5JHLL 3BVXA 4YXKH 2A73B 4W9JC 4X5WA 1E65A 1RMFL 3OSKA 1FFRA 2O5ZH 4B9ZA 3U48A 3NIGE 4D0DB 3SKMB 2CK2A 4Z7UE 5ILTH 1B9KA 4MTMA 1FZMB 2NSQA 4BRVA 4FXGA 1BFVH 2B5IC 2B0SH 4FERA 4X5PA 2I60H 2LU7A 4H0HB 3OKLB 2CG9X 3IJSB 5JW4Q 4P9ML 1E4WL 35C8H 5I1EL 4LGPB 4M56A 5I30H 2EUXA 1CZ8L 4MNQA 3RWFB 2FJHA 5LAPA 2CGYA 2X1OA 4Q58C 4QJ4B 1AXSB 1NC2A 4AV5A 5A6MA 2YO3A 3TVMD 3T3PE 3VRLF 5IQ7L 1UXLA 3SE3C 1DN0B 1G1OA 1S4IA 1RJLA 2J71A 2NT1A 2XQ0A 1KG0B 5HDBF 4YXKL 2VAAA 4YDJB 5AW4B 1AP2A 2DB8A 5F0MB 4MWFB 1RUQH 2O5ZL 1P7QA 3FZUD 1SJHA 1L4IA 2DICA 1WC7A 4U1LA 2X38A 1JHKH 4RZCB 2Y2WA 5CSZB 3SDXB 1NIDA 2DQHH 2OJ1A 2NQ3A 3DUSA 1BFVL 1PIFA 4EXKA 1B6UA 2B0SL 2DMKA 2E4TA 3JVGA 3ZTNH 2VR8A 2JKJA 1AHWB 1TETH 3BVWA 3B2VL 3ZYIA 5L4JA 4HIPA 1IEHA 3ABZA 3OXSB 1ZLSH 1EFQA 4ZFZA 4PTUA 2PYFA 1U8CB 5JHLA 1U8NA 5DEJA 1MQ8A 5DEGA 3AT8A 3CUPA 5C0DB 1F4HA 4V11A 4Z1PA 5KAQG 2DRUA 3MUZ1 5LCVH 2VDKH 3ABGA 1UM6H 2AQ3A 1OSEA 1BQSA 4FI7A 1A02N 5GRUL 3DXAB 5EV7A 3D3VB 1BF5A 4MXQC 2DW5A 4XWOD 1ZPLA 4XGZB 5HVHB 3V0VB 1JPEA 2E56A 2XWXA 3GXFA 1DFXA 4MZ3A 4GO6B 5CUSH 4JPIA 1JHKL 4YBLC 2EZ0D 4RFEA 2E7HA 2DQHL 4IRSC 1HI6B 1U3JA 3OLDA 3WIHH 5B8CC 3B7UX 1ORSA 3C8KA 4NWUL 3ZTNL 2BHFA 4OAWB 1TETL 4WO4A 1RJYB 5H2BB 5GS0H 5ITFB 4U4IA 1ZLSL 1CFVL 2XBTA 1XXFC 2DWDA 3KJ6H 4G42B 5G4MA 1YY9D 1E42A 1JGUH 2YEZB 3RIFK 4PGJA 5F9WC 5F9JA 2O4EA 4JZNA 1QFHA 4KQ4H 3UP6A 1XH1A 3UPRB 4Y8AA 2VDKL 4N1EA 1YNTF 5AYQA 5B7EA 4MZ2A 5ALBH 1SUHA 5L2KE 4J3OG 2GTWB 5CUSL 3PG2A 4QPEA 4ZTOL 1MNUH 4ODHH 2HA1A 1KFGA 3CGTA 1HZLA 4XCYB 5FDWB 4PJIB 3QJVB 4C58B 4HVBA 3BQUD 3VXSB 5EO0A 2ZUUA 4HEPG 1TJHH 2CK0L 4NBZB 4ORGA 5D7KE 5GS0L 1TNNA 4JR9H 4HU8A 1SPDA 4N2HA 4XP6L 2NNXA 3KJ6L 1DP0A 4M4RB 4HPOH 3AS2A 1JGUL 1UD8A 3NP4A 5FA4B 4H4NA 4HLZG 3HFMH 1LO3L 3QFDB 4KQ4L 1P9MA 1A6TB 4JPKH 3H42L 4H1LA 2ESVD 2YEVB 4L37A 3FB8B 1CE1H 4HH9B 4Z7UA 2OK0H 2ZOLB 4AJWA 4U6HB 5ALBL 1QPPA 2R7EB 3QEUA 4DP6X 5KYXA 3QEQB 5H37G 1ACZA 4G9DA 4JO8A 4PGCA 1FVDA 1OGSA 3WS6A 2CLRA 5E6IC 1AZRA 4C54A 1MNUL 4ODHL 5D7IB 3T0ED 5LGYA 5DTFA 1DBMH 3KNBB 3BYYA 4YAQB 1ZA3B 4LLVB 1L9QA 5EUOA 3RGHA 2ARJB 4JZJA 3VXNA 3D06A 5LUMA 2HMID 4L23A 3T0EA 1TQVA 4UTCA 4UTBH 1OGAD 2MPAH 2J57A 4BFIB 3GZKA 1WGVA 1DQML 4HULB 4RAVA 1JSYA 1PY9A 2ZOKB 3DO4A 2AKRA 3HFML 5EO9B 3NFSH 3S37H 1OGAA 4LBEA 3GHEH 5IW3A 4ODVH 3U30C 5GS0D 1USQA 4RGND 5ISZD 2OK0L 2XWDA 4YVUA 4K73A 4Y4FD 1F1GA 4W9KC 2AEPH 5DWPA 2PNDA 4PJ9C 2VZSA 3NYKA 5ESQA 4HP5A 3Q3GA 1BGXL 1HWHB 5ISZA 3L6FA 5IOPB 1RURH 4Y4FA 1Q1JL 3EZ8A 5HTSA 4C59B 2E7MA 4Y8DC 2DQEH 3CBRA 1QLFB 3BGMA 2NNRA 1RZFH 3WTSA 3ATDA 4N5ED 3C60C 5CCJA 1PLBA 1IEBB 2Y3AA 1JV2A 3RWGB 4UTBL 3K80A 4RDQF 5BW7A 1X9UA 1U21A 2MPAL 2D3VA 4HIHA 2P42B 3VFVB 1KPUA 1IQDB 1O5PA 1UB5A 2M26A 4GUCA 4AX3A 4B7IA 3QIUD 2H0FA 1OM3H 3BXNA 4CA4A 4JG1H 3NFSL 3S37L 1A6AA 3SGJC 2ROXA 2V7HA 3GHEL 1Z5LB 2O6CA 3DYPA 4ODVL 4YBLB 3EO1B 4GG6E 4XXWA 3QIUA 3P3UA 4JPVH 2AJZB 3TEYA 1X5HA 1XF3A 2HT2D 5E08H 4A2MA 1XFPA 3IWUA 1U3NA 3UAJD 4Z76B 3NACH 5KVFE 2DZEA 1RURL 3H9SB 1F2QA 4F7EB 1I3VA 1OEZW 4XPAH 2DQEL 4WFFE 3T65B 1RZFL 3TYFA 2GHWB 3MLTB 3WLBB 3OKMA 1TEGA 4WW2F 5DQ9B 3UAJA 3RRQA 4NHUA 4LQFH 1KB5B 1YJDC 1QFWM 1CLYH 3H4FA 2WVSA 2W07A 4HFUH 3GS7A 3DRTA 4WTZG 3NSFA 4FXKA 3NFPB 1OM3L 4JG1L 3WI9A 1W6LA 3QARA 4X6FA 1BXUA 4AIXA 1NOFA 4KDTA 4LEXH 3MLVH 2WLIB 2CJUH 2YQ3A 5D7KD 3VDBA 4WV1C 4OFPA 4W4OA 1JWSA 3SBQA 4I18C 4JPVL 2FUQA 3DA0A 1PPIA 1DQKA 3LD8C 4M7LT 5E08L 4PRPB 4ADIA 1KDIA 3BLKA 3GXMA 1HOCA 4CU6A 3BRDA 1KNOA 2PW2B 2CHWA 3MV7B 3NACL 2JK5A 2VMFA 1F3JB 4UTBA 1D3CA 3GRWH 3FCSA 4Z7AA 2JKTM 4XPAL 5GGRY 3LXAA 4OQ1A 2VDOH 1J11A 3KL3A 3OAUH 1UJ3A 1CG9B 1IAKA 2XPYA 3D4ZA 1ACXA 3NEOA 4LQFL 1CLYL 4ELKA 5H4ZA 4HFUL 1YUHA 3K6SA 1L0XA 2HRPL 1A3ZA 1PFOA 5F93C 5KJRH 2ZSVB 4JKLA 4XNDA 4QRBA 3GHPA 2R1XA 3PGFH 4ZYKB 3OJVC 3P3SA 2H9GB 4QXTA 4FF9A 4LEXL 3AVEA 3MLVL 3O8XD 2HLAA 4XOEA 3D87B 4P23B 2NY7H 5AVRB 2IXQA 3FULA 3B8YA 2AERT 2OMUA 2DQGH 2P8PB 4OLEA 4YBQC 2UUDK 3HCVB 3UH8A 4UOJA 4ZNEE 4ZMAT 3UTOA 4W9GC 4L0ZA 4Z0XA 3O8XA 3MUUA 5EEYA 1T6VN 1QW9A 1XR9A 4E0RA 5TTRA 3D85D 4HV8B 5JIPA 3GRWL 4QXGH 4PJ5E 1LO4H 4WGVB 2AABH 1DVZA 3IWVA 3IJYB 1C12B 3GLZA 3D85A 4KQ3H 1U93B 2JWYA 3MX0A 3NGBC 5E6UB 2AJYH 1OT1A 5JA8B 5I26A 1AYOA 1GZPA 4LSDA 3UG5A 3TBBA 4A7GA 1HX0A 1U0QA 1QKZL 4J8RB 5KJRL 5DD3H 4Z7OF 2YGOA 1KY7A 3RVXD 3PGFL 4NM8L 3T6VA 2EAEA 3BAIA 3O6LH 3AFLA 3QBTB 2NNFA 4G2AA 4ZUSB 1BLIA 2NY7L 3MRRB 4U3XA 4UF7C 1ZHBB 2DQGL 4IKKA 1P5UC 3ECBA 4LMQE 4ZK8A 3WDHA 4OV6F 4P4KC 1QBBA 3VFTB 2V2TB 1QHPA 4X7CC 1G6RA 2BRQA 3MKKA 4KK5D 5DT1L 1YRKA 3C09C 3EFFA 3LH8A 3O2WH 2XZAH 4LOUD 2GBUA 4ZS7H 1RK0B 5J13B 2X4RA 2WXGA 3NDYE 4FLSA 4F7MB 1LO4L 5HI3C 5D2NA 5CJ8A 4GP5B 4L4TB 3BZ4B 3V7MA 3O41A 2ZXAA 4RFNC 4KQ3L 4LSRH 3GBDA 3P9MA 3EUUA 2AJYL 4G6JH 4OUUA 2D8KA 2IALA 5K9JH 1VERA 3PJSB 1HHIA 1S3KH 2OMXB 5TDNA 4MYWB 2X28A 1VFBA 3AGVA 3MBED 2OQJB 5AOIA 1VACB 3O6LL 4JBSA 4C4BA 1CFQA 1AXTH 4C56E 4LVOB 3B7TA 4PBWD 1JE6A 1CICC 2PP8A 4AOFA 3GRWA 2G3XA 4ZD3H 2DJ4A 1GYWA 4TLSA 1VJSA 4XPTL 1A6ZA 1BD2D 1DVYA 5E4OA 3EXJA 4W9CC 4GEJA 1RL1A 4FJZA 1HHGA 3KCPB 4OLXL 3QWRD 3O2WL 3ZT5A 2XZAL 2AZAA 4ZS7L 4KROC 3PDOB 5IB4B 3L1EA 3MGAA 2DM2A 1KEGL 1BD2A 3EGDA 3FQNB 1FN4B 5LXGL 1VB9A 1SBSL 1AR1C 1ZLVK 4XMZA 1UACH 3QWRA 2FUTA 4NPYB 2X87A 4G6JL 1FG2A 4E41E 5K9JL 5A2FA 1BCIA 1RZKC 1S3KL 1NFAA 4I18B 1MFDH 1Q1PA 1AO7E 4XOBA 4GAFB 5E9AA 4ZO8A 2Z8VC 5L8LB 4PREA 3CAFA 4DEPC 1AXTL 5ICUA 2KDGA 1KF9B 1A14H 2BZDA 1P4IH 3EH2A 4UAOC 5E8OA 3T3ME 2XTJD 4TULH 8FABB 2LE9A 1Y6NR 1YDPB 1QR1A 3M1OA 1MAKA 1IL1B 3GBNH 1HIMH 3K2UH 5G5DB 2CO7A 4IQHA 2DWYA 2FO4A 3I50H 1FV1A 4E5XA 1GOGA 4LXFA 4PPTA 4PGBA 2Z91B 1D2PA 5JW5B 1UACL 1E8XA 3VU2A 3CDYA 5EU4A 1A7PH 3QZWA 4QIRA 1SOQA 3IMRA 3RB7A 3VJ6A 1MFDL 1HJCA 4PJ5D 1MIMH 3EOAA 1WCBA 1I7RA 2W60A 2R0ZH 3VQMA 1PX4A 3OMNB 2OP4L 1TQCC 1A14L 3A4FA 3BN3B 3ZXAC 4J2XA 4KHTH 1VCAA 1P4IL 3X1BA 2LLLA 4PJ5A 4TULL 4XP9L 3OHXC 3CBKB 1KSRA 5IMOA 1CGYA 2X6MA 2OXHA 4N8VB 1R47A 4BFKA 2QEJA 3K2UL 1HIML 1NIBA 3Q9PA 3NGBB 4KKZA 3I50L 4BFNA 4EN3B 3QJFB 4WQOA 4QRTB 1T1ZB 2CUIA 3DI3B 5DS8A 1I3RB 1BA9A 3Q9QA 3MACH 3GB7A 1HCYA 3P9WB 1K4DB 4HGWB 3EYQC 4PV9B 2OW7A 1A7PL 3ZT6A 4LFHG 2WLJA 25C8L 1S8DB 5DZJA 2QV4A 1QQDA 2WWMD 3O3AA 2Y3NA 1QBMH 4HKBB 1MIML 5AQ0A 2DL9A 3BQVA 4OKVB 3KLHD 2FEJA 4X5RA 1K4CB 2R0ZL 1UZ8A 2KYIA 2PYED 5E8NA 2AJVH 2CDFB 3C09B 1Z9PA 3CIQA 1TQSA 3GMOA 4KHTL 2OLDA 4TSAH 3PPEA 2G2PA 1PEWA 5JDSB 2PYEA 2ZZUT 4RFNB 2Y1VA 4ABQA 3KAAA 1G7PB 4P07A 3V0AC 3W81A 2X4NA 3T77A 1Q4NX 4FQLH 4HAGA 2DYPB 1S6NA 4KPHH 5IB3A 1YN7A 2VWEC 2W94A 3MACL 1ODUA 1C8QA 2D0FA 4P5SA 1UTDA 4PJIF 4FG6D 4TOYH 2A6KA 3BCDA 1T5XB 4OJFL 1I8IB 4UNVA 3D09A 5HGDB 4C56A 3VCLB 2FZ3A 2QSQA 1VIWA 4J3XA 1CICB 1PZ5A 1N12A 2FHFA 2XWJB 3ZIMA 1B88A 2HVJA 3OD3A 4N8UA 4EQ3A 3NZ8A 3V10A 1XAUA 2CRZA 5D1ZC 3QDAA 3TT1H 1FLRH 4EZJA 5EIIG 1FAKT 2AJVL 1MHHB 4PRDA 4KROB 1PKOA 1GZQA 4KZEH 3FTXA 1FJ1B 4M1CD 1E8WA 4UYPA 3FQYA 4TSAL 4ODSH 3ZKSD 4LGRB 1J12A 1N5AB 2P24A 2QFPA 1BJ1H 3HS0B 4H8HA 4KRPC 3IMUA 4PGDA 4OCRH 5DUJA 1TEYA 4X50A 4GIOA 2Z3FA 4JAMB 4LLAA 5E4IA 2F8OA 1I7TB 4WHTB 5D72H 5EFIB 4KPHL 3F00A 2QR0A 2YSSB 3QCVL 4JRYB 4LCWE 2BVTA 4FLHA 1G7HB 3B1TA 3QJSB 2EKJA 2X4OB 4TOYL 3PQYD 1JGEB 2EC8A 1SZNA 1WEJH 2PABA 4NN6B 4LSSH 4LKCA 3G5VA 3N04A 4N0CD 4WJG3 5D96C 1WITA 3RWJB 3RZWA 2BOBA 2CPUA 4N2FA 4JUTA 1KUMA 4YHNA 5B4MC 4FA6A 3PQYA 3KLDA 5JHDE 4JFHE 1BWWA 1CL7I 3TT1L 5DFWH 5KYYA 5KYUB 1KBVA 4ODXB 3T6WA 3RILA 1HH6A 3QXAB 5LXVA 3K0YA 4ODSL 5B38A 2E9GA 4LPYA 2PKDA 1K8IB 1L9TA 4OCRL 3DIVA 2EIJB 4PJ7F 2VC2B 4M5TA 3FTWA 3DX6A 5D72L 5DFTA 3QIWD 2ATPB 1JCVA 1NFDB 2JKIS 2MKLC 3EYUH 6FABH 1LP9E 4GKSA 1UCBH 3PAYA 3PJLA 4R4BB 1WEJL 2BH0A 4LSSL 1TQCB 5IB1B 1CLOH 2VLKE 3QIWA 2UZIH 4UIMB 1OAZL 2VDQB 2ZCHH 1AQHA 3ULVE 1JGVH 2YLKA 3HZYA 5F7WC 1UASA 1V8HA 4BA0A 1WJ3A 4R2GD 3RWHA 4L8SA 4I2XA 1MWOA 3WAJA 3QRFM 2RFXB 1HE7A 2OMTA 2SEBB 3SYAA 1J0HA 1BZQK 3BCFA 4WHYG 1S7RB 3FQ1A 3H9HA 4F91B 1X7QB 1TLKA 5AW3B 5LBGA 4KNTA 1WH0A 2C9XA 4M48H 1KZQA 2CCLA 4GYBA 3GYRA 1SMDA 3E7JA 4P5MA 3KCWA 1N59B 6FABL 4RIRA 1UCBL 4HCGA 1TQBC 1FCGA 4L3CA 4A39A 1QSEE 2NLJA 4HX1B 3UO1H 4L2YA 4DKEH 5IVZA 4APXB 2UZIL 2EYRA 5TGBA 2ZCHL 4JHVA 4TQPA 2BIOA 5AVVB 4CU7A 1JGVL 3RVTC 1H15A 2VH5L 4FA8A 3B4NA 5F8QC 1HAUA 3HI6H 3ESNA 3V5DA 3V4VA 4GW1B 3U0TB 2VLJB 1TZHA 4MMZA 1WBZA 2CH8A 4A6YH 4NN7B 3WO4C 1ND0A 3UOAB 3WJLA 3C2AH 3BI9X 3GKZA 1CIDA 4E9WA 1HKLH 3L3GA 1DLHB 2X6CA 4X7FC 2WK2A 5FGBC 4M48L 4XVUD 1Z5HA 3BX7C 3N85H 4YHOH 3WN5C 3DSFH 4N3TA 4HJ1A 4IBSA 4D3CH 5B1AB 3LEXB 4OIFA 1QSFB 2FX8H 4ZRGA 1MHEA 3D39E 3IPBA 4CU8A 5C1MB 3JT2A 1NEZB 3UGUA 3UO1L 4DKEL 2FCBA 2GJJA 1EZLA 4N2IA 4X6DE 5I1DB 3EGXA 1EANA 3G6AB 4V33A 1EDYA 3QUYD 2ZKMX 4FKKA 2ADIB 2WLYA 1AI1H 2VJXA 4LE8A 4JM2B 4XMWA 1P4LA 3HI6L 4AQAA 4XE0A 4PWJA 2JXMA 5F7UA 3QUYA 4U1HB 4B5EA 5B3SB 3TBTB 1ZGLM 4N28A 5EOTB 4PP2B 3HJEA 3P0YH 3SDYH 4P2OC 1VZIA 4M6NL 1HKLL 2E8YA 2H0PA 1K6QL 3ILQC 5JHDD 4TM9A 1CT8B 5K1NA 4YHOL 1P0SE 1Y18A 1I1AB 2WTRA 5JLZB 5C07E 4D3CL 4HKXA 2NY1D 5FF6A 1W6WA 2DIBA 2FX8L 1A4JA 1HS6A 4NZDA 1XB8A 4UB0L 4XO8A 5KJ4A 3CBJB 5LAXB 3WTXA 2VDMB 5JHDA 3GWJA 3CN1A 1T6WA 3LKPB 1EDHA 3CDZB 5JIMA 3X13A 4LLDB 2H2PC 3FN0L 1RVFH 4G80B 3SE4C 2NX5B 3B37A 1CB4A 4XX5A 1FAIL 2CAKA 3DVNA 2BVOB 2P3YA 2IAND 3UP1A 2GT9A 3O6MH 4X5XB 2X40A 1IB5A 1B0GA 2DWXA 2MWCA 3DRQB 3ZHLA 4KK6C 2BMKA 4LL4A 4NQEE 3H0TA 3VXUE 4BQ6A 3QJTB 1XB3A 3QEHB 4LRNH 2VLKD 3R7QA 2XWBA 5A40E 4LEOB 3IGKA 3P0YL 3QR0A 1TVBB 4HXBH 3SDYL 3HMWH 5L0QB 1ZY9A 2IANA 2ICWJ 2AQRA 2IQAB 3IFOB 4PGEB 3V5KB 2YD1A 2A9ML 3C9NB 3VRIB 1E9PA 2W88A 4S1DD 1NBCA 1S7SA 2BY1A 2VLKA 5AW6B 2J6WA 3FCTA 2JF1A 1BAFH 2L3BA 3ARDC 5K93A 3VD2A 4LU5L 2C4XA 3BT2H 3NK4A 4F7KA 2RB8A 4J6IA 1A7NH 3OKEB 3AGWA 3VTMA 3FTGB 1R3HB 1INQA 2EC9U 3JZYA 2IFFH 1J9RA 3G5XA 2WB1A 4PG2C 1U92B 1RVFL 2D4FA 4X7DC 3IGAB 3IETA 1S2EA 5DHXB 2FX7H 5EZLA 3F8UB 3O6ML 4ETQA 2K3HA 4N8PA 5DWUH 4PJDB 5I75C 4LRNL 4G8FA 4TQHA 1K3IA 4HXBL 4LLWB 3HMWL 3V5HA 3FSAA 4KKBC 4M1DH 1GOFA 1ACCA 5IQOA 1UWEH 5IG7A 3II2A 1WT5C 2BWIA 1UH3A 1A9EA 1BAFL 3LKNB 2KZ1B 2OTPA 1NCHA 4UOW0 3BT2L 5I8KL 1JMXA 3CC5A 1A7NL 4P2QE 4P5RA 3VFWB 5E99H 4AM0B 1U8MA 4GUPA 2Y2YA