1S4IA

Crystal structure of a sod-like protein from bacillus subtilis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
151
structure length
151
Chain Sequence
b'AFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNSGARIVCGALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords superoxide dismutase-like protein yojM
publication title A prokaryotic superoxide dismutase paralog lacking two Cu ligands: from largely unstructured in solution to ordered in the crystal.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 31
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1s4iA00
3LTVA 1SXCA 1HL4A 4BD4A 2C9VA 1MFMA 3ECWA 1S4IA 2AEOA 4L05A 1SXAA 2V0AA 4B3EA 3KM2A 1IBBA 1JK9A 2LU5A 2GBUA 2VR8A 3GZOA 3CQPA 1U3NA 3F7KA 2GBVA 4A7UA 3GQFA 3MNDA 1B4LA 1OEZW 1L3NA 1TO5A 1SDAB 2AQQA 2E46A 1F1GA 2K4WA 3CE1A 3H2PA 3KH3A 2ZOWA 1HL5A 2VR7A 1KMGA 2Z7WA 1P1VA 2XJKA 4N3UA 3GTVA 4MCNA 2AQNA 1IB5A 1E9QA 1JK9B 2Z7UA 2NNXA 1UXLA 4BCYA 1E9PA 2VR6A 4BCZA 3KBFA 5CU9A 3SODB 3HFFA 2WYTA 1OAJA 1COBA 1YSOA 3HOGA 1BZOA 4A7SA 2ZKYA 2AQSA 3HW7A 1OALA 1SPDA 1F1AA 2E47A 2WKOA 4U4IA 1E9OB 2Q2LA 2AQPA 1TO4A 2AF2A 3QQDA 5KBKA 3L9YA 1IBHA 3KBEA 2SODB 1AZVA 2XJLA 1SDYA 1EJ8A 2APSA 1FUNA 1SOSA 1PZSA 2C9UA 4FF9A 2ZKWA 1F1DA 1IBFA 2GBTA 1SXBA 1BA9A 1CB4A 1SXSA 2Z7ZA 3S0PA 3L9EA 4A7GA 1UXMA 1IBDA 1PU0A 3H2QA 2AQTA 3K91A 4A7GF 3GZPA 1YAZA 1CBJA 1Z9NA 2JCWA 2WZ0A 1SXNA 2WKOF 3GTTA 1RK7A 3KH4A 5KBLA 1DSWA 1JCVA 1E9QB 3KM1A 2WWNA 1OZTG 1E9PB 3RE0A 1B4TA 4OJAA 1OZUA 1XSOA 1SRDA 1ESOA 4OH2A 1N18A 1PTZA 4N3TA 1N19A 3MKGA 2AQRA 2Z7YA 2ZKXA 1YAIA 2C9SA 1XTMA 3T5WA 3GZQA 2R27A 2WZ6A 3ECVA 2JLPA 3ECUA 3QQDB 1QUPA 4A7QA 1Q0EA 1XTLA 1F18A 4MCMA 2WZ5A 1Z9PA 4A7TA 1EQWA 5KBMA 1DO5A 4A7VA 1E9OA 2WYZA 3PU7A 1SXZA 2WWOA 3CQQA 3F7LA
chains in the Genus database with same CATH superfamily
1NC2A 2XXGA 1NEPA 3VFTB 5C3TA 2A73A 2C3VA 2F19L 2NX5D 4J12A 4RWHA 5C0DA 1UM5H 4AQ8C 4ZQTA 3STZA 5HYJB 1IKFH 4PBDA 5FEBA 4WDIA 4X98B 2LTQB 2FX9H 1WFJA 1HE7A 2C9QA 4L5FH 4XVOA 2XTJC 1MLCA 3FT0A 3V4UL 2PXYD 1HILB 4XBEL 5MERA 2VITA 1DQQB 3C5ZB 2J20A 3KH3A 3WO4B 1IAMA 4WCYL 4Y9EA 4S0TD 1F86A 4XMKH 3NQKA 1MCFA 1KTBA 1MFDL 1ACYH 4N3UA 1MCPL 1G87A 4X5XA 1KN2H 4RESB 5C0AA 4H0GA 4MDIB 2G2RB 1BAGA 1EXUB 1J8HD 2A6DA 1AZUA 3QISA 4POUB 2ESVD 5E9DD 3RWJB 2XV2A 1HAWA 3PV7A 2A6KB 3KEDA 1HXYB 4I48A 1D9KC 3U6RB 2CKNA 1SQMA 4PGDA 3QDHA 5B38B 2OYPA 4OM0L 1Z9MA 4C4KO 2JFCA 5BRZD 1S78D 2VQ1A 1DEEB 3FU7A 4H0IA 1U3ZA 4PRHE 3AS2A 1KULA 2B3RA 3PJLA 1X7TA 5HHVL 1VDGA 4XE0A 4JAMB 1NC2B 1OP4A 5FXCH 1AQDA 1N8ZB 2C3VB 3BUQA 5MP6H 1T89A 5C0DB 4EUPB 4A6YL 1O9WA 3STZB 2AABH 3SJVE 2R4RL 1A4AA 2AJUL 4MMZA 1RP9A 3ISWA 4WDIB 3A4FA 3LHPH 3PV6A 5I8OL 2SEBB 1JDDA 1MLCB 1O6TA 4LPCA 4RGNE 4UOJA 3WTSA 4LKXA 4HUUB 2VITB 3AS0A 1GC1L 4HALA 5AENA 4JHZA 4AUYA 4MYPA 2IC2A 1UUNA 2Y9RT 3FUIA 3S3PA 1BMZA 1CF8L 2NY1B 3S5YA 3FT1A 4N25A 5I16A 4JRXA 2DEYX 5DMGD 1E3ZA 1KJMA 2X1OA 3H56A 4WIQA 1UFUA 2HUEA 2IANE 2IWFA 4R26H 3SE4A 4ELMF 2A6DB 2XU9A 1NLBL 1IT9L 4P5TA 2FTAA 1AOHA 4GXFA 4ZMVA 3FCGA 3FZUD 4I48B 1D5ZA 1QEWA 4AQ1B 3QDJA 4F9PC 5AOIA 4MB4A 4QYOA 4FA8A 5LBVA 5DMIH 1AO7E 5EF0A 1XL4A 1XIWC 1PNCA 1AQDB 3MRJA 4YWGL 1WHPA 1HHKA 2CLZA 4AV0A 2BWDA 4AENA 2I9TA 5D1ZD 1FGVH 4D0CB 1NDGA 3NACL 4G2AA 5C0BE 2Z91B 5KAQF 3UL4A 5C8JB 3W9DA 5LCVH 1HOCA 1S7QB 2EE2A 2EEAA 5LVEA 3DVGA 5KOMC 1RZJC 3AG3B 1UFGA 3MCLH 2VLKE 4G72B 4HWUA 4OIIH 4PWKA 3AT0A 1BMWA 4DGIL 4ECNA 1ZPUA 2G5BA 4L3AA 3LB6D 1M71B 1ZE3H 1KJMB 4WFFE 5E8PA 5FGCE 4NPYB 5LKNA 2R0WH 2NR6A 4G1MA 2W8CA 4P5TB 2VN5A 4TNFA 1JN6B 4P4KC 4XNMB 5C0CD 2X1QA 3O6ML 3RP1A 1D5ZB 1QEWB 2BLFA 2ZCHH 4Y4FD 3PQYD 3QDJB 1JK9B 3QI9D 4UZUA 4BCYA 4HG4J 1W72L 3W3BA 5ACLA 3QPXH 4NUJA 4QR7A 1WAEA 3ARFA 4XNYH 4OV5A 5EU5A 4IBSA 1K72A 2Y2TA 4FFZL 4KQ4H 2EAEA 2WWKO 2CJUH 2WD0A 1PL3A 3P3UA 1IGTA 4BINA 3CZFB 5FW7A 4BZ1L 3L08A 1F45A 2BS9A 3AFLA 2VKWA 5HGDA 4N6QA 2CHWA 2BVPB 1HHKB 2CLZB 2FQFA 5D7IA 1NAKL 2ZCKH 2WJ7A 4AENB 5D6DC 2O5XL 2W1NA 5IMOA 4NZUH 5IW1A 3Q01A 1NDGB 2QGDA 4UOW1 1UTDA 1DDHB 2DM2A 1O9VA 3O0RL 4YDIL 2P5WA 3W9DB 1HOCB 3BSHA 3L6FB 3WJJA 1GXEA 5LQBH 1FH2A 5ALBL 3PNWA 5AB1A 3KPOA 5CEXA 1VFAA 1HXKA 3QFJE 5I66A 4R8WL 2RACA 2C9AA 3IJ8A 4LGSB 1M4KA 3ULAB 2NY5L 4RAVB 3P30L 5FDWA 4F2EA 4UM8B 2PWGA 4KDWA 4YZWA 2C4FU 2ADJA 5E8PB 4UNIA 4XPGL 2RCSH 4QUOA 1TEGA 1IBDA 3RLSA 1PG7H 3NCYS 4NUMA 3ARSA 3KS0H 3S36L 3PS6A 4P5RA 5IVXE 1WWBX 2CGYA 4P9HH 3GM0A 4MA8H 2Q8BH 4MMYA 1Q9WA 4EDWH 1KJ2H 2JH2A 4NUJB 2HMIC 3TFKD 1CR9H 5E6IA 5EU5B 4OV5B 1RJLB 1IGTB 1QP1A 2C3WA 5DEGA 1KLUB 4NB7A 4R4BB 5F1NA 5HGDB 5J1AA 1I3RA 3BIKA 2ZX8A 3IJEB 1FAKT 2EZ0D 5IMOB 3T0EE 1NCBL 2NRDA 2I9LA 4HIXH 3MCKA 3I9AA 1WCQA 1XTLA 2PYED 1CL7I 3T2NL 5IFHH 1QACA 4F8OA 4QD2E 4ZUVA 5IESH 4HXBH 1YMME 3PNWB 3D39E 1MHEA 3KPOB 1FNFA 5CEXB 1FBIL 2OM5A 5I66B 3AREC 4BSWA 3X12A 4P49A 1FLRL 3PHOA 5FDWB 1U8QB 2AEQL 2G30A 4M62L 1CVSC 1VGKA 2ADJB 4O51A 3QUYA 1S4IA 4QHUA 2VMJA 4Y1SA 4R4FH 3O45A 4OBSA 3ALPA 3VWKD 2W38A 1U8OA 3QG6B 3HMXH 3FSOA 1LP9A 3U46A 5C0EA 5I1KL 1XR9A 3T0AA 4GSDH 3CE1A 3DGCR 1DQKA 3U4BL 3GMNA 1A6TA 1Q9WB 2VL4A 3SQOH 3GNMH 2KBGA 1EHKB 5E6IB 2HG5A 4ZTOL 3RX7A 3VB9A 2QQNH 1AQHA 3O4LE 4MMXC 5DEGB 5FKPA 5F1NB 4R96A 5AOZA 3ZR6A 1I3RB 5LWYL 5EO1B 3BKML 2P5PA 2I9LB 4G80A 3JTSA 3WFDH 4Z3TA 1XGPB 3NAAH 5LBSA 3V6OA 4ZUVB 1U58A 4A2GA 1UZ6F 5HHXL 1MRDL 2V6HA 1ZV2A 1KC5H 1MHEB 2DWEA 2G75B 1Z7JA 3IEAA 3MVSA 3FO1A 2YLHA 4JY4B 2KDYA 3LIZL 4BSWB 1T66C 4Y2DC 1PLAA 3PHOB 4A2MA 1WZLA 4L4VA 5E6SB 5SV3A 1VGKB 4O51B 3QUYB 4QHUB 2IAMD 2G5UA 1OARL 3FBKA 1J5HA 4LARH 5C0EB 3U46B 2WKGA 1WIPA 3QC5X 3RVUD 1XR9B 4M8QB 1IGFL 4M7ZC 2KL6A 4UI2A 6PCYA 4JG5A 1KELL 2D8KA 2Y5QA 4HQQH 4LLMB 1FLTX 2X6VA 3QS2A 3U1SH 4ZYKB 3GJEA 4I2XB 4YZFE 3WJLC 2HG5B 3WEOA 3K2UH 3X11A 2OP4H 5EZOH 1IEBB 1GC1C 1MF2L 4KVCH 1AZRA 2EVJA 5FKPB 4XVSL 4J3TA 4R96B 3T1WA 4Y9FA 1BF5A 4ZSOE 5EO9A 4FZEL 5J13C 3BHBA 2JI3A 1G0DA 4U1HB 3AU0A 3KYNA 3W9EA 2L0DA 3B2DC 2WINA 3PE9A 2QFRA 5BVPH 5C6TL 3W37A 4JFED 3NFPA 4LSQH 4IDJH 4MJ5A 2VC2L 3EFDL 4QXVA 3JTSB 5GGTH 3HCVA 4X42A 3O3BA 3MKGA 4HYTB 2N01B 1U58B 5C0RH 3KPPA 2DWEB 4OLZL 3JT0A 3TBWA 3QAZB 1D2OA 5ABAA 2YXVA 1J12A 3HN3A 5I1JL 3EYFA 4AC2A 2VXUH 4GRMB 3DV6A 1Z5YD 4KZDL 2ZYRA 2DM3A 4L4VB 1MCDA 4KZEL 2IADA 3CFDA 1TJHL 2K6ZA 1BYOA 4NI6A 1N0XL 2VAAB 4GBXC 1ZS8A 3ZSSA 4Z3HA 2WB1A 3CQQA 3G6AB 5F1OB 3ZVVA 2OW6A 3DDFA 1RI8A 4MVBC 5AD0B 4PRPE 1W91A 3GXFA 1MEXL 3Q43A 3NJKA 4HUMB 3BKYH 3CD4A 3MLTA 1BJ1J 1FDLL 1MW0A 2DDQH 3HE6D 3OKOB 4NQSA 4JRYA 5HSFA 2DLFL 4Z76A 2CSPA 3X11B 1HIML 3LEYH 3NSCA 2XHNA 3QXWA 5GRJL 2H8PA 2J4WL 2X6CA 2AJYH 2NY0D 3RB5A 4DJMA 5EO9B 1O6SA 2F8OA 3BHBB 4TPRL 5JHLA 2ZOKA 3W9EB 3KYNB 3D2UA 4ZW5A 2WINB 5AW8B 4MJ5B 3NFPB 3GJFA 4K8RH 1D7BA 1KIUA 3HCVB 1OQXA 3O3BB 1UD5A 4XWOD 1MZZA 3SO5A 3TYGL 5IMMB 4X5RA 4BCZA 4XC3L 5J11C 5DU7A 4JE4B 4AOFA 2HT2D 3APMA 1ZLVH 3QPQD 4CC4A 5TDNA 5ACMA 3KVQA 3DV6B 5ITFA 4QCIA 1QVOA 4XN9A 2IADB 2B4CC 1NFIA 3ILQC 1B9KA 3DXAE 5CLWA 3NZ8A 3V0VA 2WYHA 1HZHH 4NKOA 4FNPA 1NGYA 4HH9B 1B0GA 3MLTB 2ICEA 2ORBH 5E2VL 4G8GD 2BRRL 4KY1L 1P4LB 2X89A 3ETSA 4Z76B 1CD1B 4MJIA 5H4YA 4OCXH 5LAXB 2H8PB 1Q0YL 3C5JB 3JWNC 1Q38A 3V2AR 1U8JA 1NIDA 4GMSH 2E8YA 3D2UB 4N8PA 2NY5C 4UILL 4XO4A 3QHZL 3UIYA 3V6FB 2NW2A 1EHLL 4BKSC 1CLVA 3EH5B 1KIUB 2NZ9C 5EWIL 3VI4A 3NABL 3DGGA 5DHMC 1FHNA 5KSBE 3LXAA 4B9YA 3RE0A 3UGUA 3DMMD 4I13B 2GVYA 2NY7H 4PJ8A 1U9KA 5IGXL 2H0JA 4W9IC 1JK8B 4YXLH 2NY4D 5ITFB 3QJXA 4OSUH 4QCIB 5DMYA 4LSDA 1ILSA 4Y2OA 5F1IA 1ZGLM 2Y07L 1NFIB 4G7VH 3MXVL 2JI1A 3NZ8B 5GIRA 4HZLB 5FUOL 4NKOB 1DCEA 5C09E 1NGYB 4YLQT 2GQHA 4M1CD 2P8PA 2ICEB 1UADC 3AS3A 4E36A 2BP5M 1TQCC 4FCHA 3L1GA 1S9VA 3VI3A 1JYWA 1IVTA 1SOQA 15C8H 1CBVH 3QDGA 3D07A 1S7SA 2KZWA 4P23B 4UM9A 3ARRA 4Z7VA 4NKIH 5I1EL 1TJGH 3NIGB 1OQOA 4NBYB 4AKOA 3FMGH 1EK3A 4JRWA 2FB4L 1IGMH 2NW2B 4AW7A 1J7VR 5C86A 3HRZC 4P2OC 1BDYA 3UYOD 2Z0UA 4G43A 5DFVC 5DRXA 4PJ8B 5DHVH 5TF0A 4DPRA 1FSKB 1QATA 3UX9B 3QORC 4CSPA 3DOIA 1KWKA 1GGCL 1XGQB 2YJQA 4FMKA 4OIFA 3QHFL 1VZGA 3S5ZA 3E9TA 4FNUA 4R0LA 1GYVA 3UYPA 7CGTA 5HVWA 1WAAF 4DPBX 1D7DA 2PPFA 1NA8A 2D9CA 4W9HC 2E9IA 4PG9A 3N1GC 5KVFH 5GIRB 1BEYH 3C6LD 4N0CC 3MLRL 4MNQA 4DT2A 5K1JA 1NIFA 2ITDA 3FQYA 3A67L 3FT3A 2EYRA 4F7KA 1A64A 1DP0A 1MWAA 1S9VB 3BEVA 3VI3B 4UV4H 1TSHA 1GJUA 3WNIA 5JIKA 1E5UI 3G7TA 2YMTA 3CN2A 3N9GH 4TQEH 4UM9B 43C9A 4Z7VB 1RU9L 3WFBH 2XDHA 4FD0A 1ZLWH 4OI7A 1UENA 1FIEA 3F64A 5B21A 5H37H 2C3HA 3B9KA 2ZKHL 1QI4A 4NKMA 4LSRL 4Q6IC 4ODWA 1W8NA 1NCDL 4ZPVB 5ANME 3VGHA 3VD7A 3QUZA 2EXWC 4DN4L 2JB5L 5DRXB 4ZOCA 1TTUA 1UURA 5CHNA 4K07A 2P47B 3F84A 4R0LB 2G5RA 3GUFA 2P5ED 3UYPB 4W9ZA 2EH7L 3GINA 1ZHKA 4ABQA 2DQGL 2DH2A 2EDOA 1J0HA 4MNQB 4U33A 1KYFA 4QPEA 1MXGA 1MCIA 2HFTA 3KW7A 4JPVH 1I8LC 1NCOA 2EYRB 2ZXDA 1TZIB 4L18A 1MWAB 3BEVB 1U8NA 2XIIA 5CGTA 2J1XA 3Q6FA 4PRHD 3IGLA 1U30A 2I25N 1AR1D 1M57B 3LZLA 5HYEA 3FO9A 3NIGF 3IDXH 2DQ6A 3T8XB 1J8KA 1HNYA 3BVVA 5F70A 5BV7H 3QZWA 4C55A 5FAAA 1R0AH 5I5MA 2GHWB 1HHJA 1D5XA 2OQJA 2NW3A 1A7OH 3QJOA 2ZPKL 3B2MA 4NKMB 3D18A 3L5IA 4LVNB 1U33A 4OGXH 5FYJU 4RGND 3NFSL 1QLEH 2XX0A 3RILA 1VCBC 3Q1SL 1A6PA 2BVYA 4Y5YC 2V8MA 3OC5A 5F8RC 2CPUA 2VDNB 4Z7UF 5B4MC 2VJXA 3EG9B 3VSUA 5CHNB 1CWVA 1PD6A 2E46A 3U0WH 5GZOC 3HFMH 1OV8A 2P80A 2IAND 5EUOA 3WHE1 2LQRA 3WJMA 3FH8A 2OK0L 1E30A 1XWVA 1K8IA 1I31A 4AQZA 1M7IA 2LAGB 1F58L 5CZXD 1PY0A 1CICA 1U8NB 2YJLA 4KRMB 4Z7VF 2PYFA 3X1EA 3UTPE 4W6XB 1S7XA 3QZWB 4PJ5A 1IUZA 1E4HA 4R90L 4RMVA 1DJXA 4ZW3A 5HBBA 4ZUWA 2OQJB 4CC1A 3V5DB 2NW3B 1I85C 1NIAA 1HOEA 2IDQA 3FSVA 2FHBA 3L5XH 3F7RA 4H20H 1VFOA 3G6JA 2F58L 3RFZC 2AVFA 5EF3A 1J5OH 4HWBH 3MZGB 4GRLA 2XACC 4IIQC 5CXPA 3GI9L 2I85A 3DSFL 2J1YA 1PDKB 1P5VA 5D7LE 1E7UA 2F8IA 3BKCL 5J0BA 3ULUF 4ZOAA 1TCMA 3WU1A 1ASPA 3CC1A 4BFEA 4KI1A 1T6VN 3C60D 5EUOB 4TOYL 4F80A 4MD0A 4P3DB 2HRLA 3HZKA 4XB8A 3WJMB 1BVLA 5IBTL 1VENA 3RIAK 4I3RH 1TEYA 4OJAA 3OHXA 3MR9A 3ZRSA 3BUDA 4OVVA 4JFPA 2VZSA 3ET9F 4TSBH 1CICB 3KPTA 4WU7A 4G7RB 4KO6A 3UBXA 5JUEL 4OGZA 5KTEL 4JY5L 4LQFH 4PJ5B 2AANA 1PQZB 5DYOB 2JB6A 4WHYG 4ZUWB 3HZVA 4I1RA 2C26A 2NY2D 4XBPB 4XNZB 3QZOA 3MXWH 5BUPA 3O2WH 2IQ9L 1LLAA 3SPCA 2X88A 1BX2B 2CBQA 3O41B 2XA8L 3M8OL 4KAQL 2O61A 1HL4A 2D31A 5IBLD 1DO6A 4C8XA 3QRGH 1KUMA 2FJGA 2A4CA 3I9PA 2WNXA 1A9BA 1BYNA 2VXQL 3U7AA 1O7VA 4BQBA 4U6YA 1ADQH 5C07E 3FRPG 5F1KC 3N42B 1KCWA 3P9WB 2Q7YB 4K71C 4MD0B 3HG1E 2AQ3A 2IO5A 3HZKB 4LCCA 4LU5L 2OULB 2H47C 1BVLB 3QDMA 3W0WD 2MPVA 2HP4A 4AW4A 4QRPE 1ZLUK 3MR9B 2A5UA 1IC1A 4JFPB 3VXNB 2W9DH 4FFWD 2PCFB 3MPCA 4WU7B 3UBXB 2ROXA 4WGWB 2JIXB 1SBSH 4Q4EA 4A55A 4C54A 2X5PA 1X3DA 4XC1L 1TTAA 4ICWA 4RETB 4B0MB 5IMLA 2CBPA 2JB6B 1PY4A 3IPFA 4NZTH 4MAYA 4YBLB 3WTYA 5GGQL 3HZVB 2Q3XA 4KK9C 3SCMD 1ZD6A 1K4CB 1X7SA 5F7FA 5AVTB 5T1LA 3SPGA 4NBZB 1UM4H 5FGBA 2PO6B 2O61B 2D31B 1YMMD 3O2DH 4ZAKA 1PYWA 2FJGB 4AIEA 1GKEA 1N5AA 3ZN6A 5EUOF 2YK1H 5KG9A 2W9EH 1A9BB 5AVRB 3RDTB 3CUPA 4KKRA 1KTJA 4MRCA 1R3KA 4OJFH 2XLLA 4LEXL 4JO8A 3S3CB 3DYPA 4RCAA 1A7NH 3RVWC 4LCCB 1RZJH 3QDMB 5JW4Q 4PRAA 4OV6F 5D71H 4PIRF 2OR7A 2UWEF 4A7GF 2EINB 4PG2C 2NNRA 3UTSE 1KT2B 1DSWA 2DMHA 4LKCA 3JT2A 1FVCA 2ITEA 2QPEB 3GK8L 3N06B 3NRFA 4K4KA 4ONFH 1HK6A 5ESQA 1CMOA 5GGTA 1B4TA 2B5IC 1HZLA 4K55A 2XA3A 5ESVB 3O4LD 1ZHNA 4WUUD 1U8HA 2H6OA 5IMLB 3MLYH 4ZXBA 3ESNA 4XNDA 4MAYB 2QQKL 3UO1H 1ECYA 4Z0BL 1N19A 4N0UE 3ES6B 2DMGA 3CLEH 2DJSA 3JVGA 5BQDA 3VXQB 2VO5A 5I1GL 4Z7QB 4OU3A 2D3JA 1QFPA 1GL4B 2HT3D 5KWYC 1PPIA 5CCHE 1BZ8A 4AMXA 4J39A 4J4PA 5E0FA 4ZAKB 1PYWB 3TTSA 3C2AH 4RISH 1ZEAH 3N42F 3D09A 1YYLH 3HI1A 3TZVD 4JZJC 4AV4A 5KG9B 3BWAA 3CUPB 1R3KB 1QHQA 2N0MA 3QJRB 3ZTJG 4N8CH 2HXAA 2QSCH 2YOCA 5D1XC 3WXVL 4I1PA 3AXHA 5JOFA 1OF2A 3BPOC 4AVIA 5DRNA 3WXWH 3MUZ1 3QUKA 2R83A 3KWTA 4PRAB 1NBZA 1H3TA 4TNGA 3LV3A 4P2YA 4ZZFA 5AW6B 4TVPL 4MCYB 1U2HA 3KWXA 1VIWA 4FQXB 4P46C 4LKCB 2XKUA 5ESQB 8FABB 1FVDA 3WTUA 2XBDA 4BZYA 2X9YA 5EU3B 3KGSA 1EZLA 1ZHNB 1L9RA 4ZXBB 2IPUK 1C7TA 3LAFA 4ELKA 1RLWA 1L9SA 1MCWM 5TE6L 2CG9X 1QBLH 3BW9A 3QEQD 1G6VK 1YEGL 5F3HB 1KJVA 4PHZA 1ZLEA 3PDOA 3HNSH 5HDQH 2R1XA 3WFZA 2AGJH 3F62A 3O6LH 4RRPA 5HYFA 2YD9A 4IKIA 1MY7A 3HI1B 2Q5BA 4EOWL 3BZDA 4F7CA 1CF1A 3BWAB 1IGJA 3ARGC 3CFKA 1TZGH 4EZLA 4OI8A 4C58B 3QXTA 3F65A 3BPNB 1CFTB 2DKMA 2TSAA 5CJ8A 1OF2B 3D08A 4A67A 4UQ2A 4Y16D 5DRNB 3QUKB 4ZMQA 2WPGA 4MB3A 4WHTA 1NBZB 2HYMA 4GUPB 3QULB 4L3CB 3LSOA 5CN3A 4OZ4B 1HH6A 3HNVL 3KAAA 1BVKA 3KW8A 2XXMB 3U7WL 3FUJA 4APQB 5D2NC 5D7JA 3VH8G 2F19H 4XXWC 5HHNA 4ELKB 3DRTA 2RHEA 2YAEA 2FZ3A 3MV7D 1AD9A 2YFNA 4Z7QF 3KYAA 5DC9B 5AG9A 5G4NA 3CIAA 1QWUA 4C56E 3H9SA 1OTTD 3V4UH 4A37A 2IV9A 4XBEH 1KJVB 5ISZD 3PDOB 4PI0A 1V10A 5J3HC 2R1XB 2BM3A 3D4GA 1OP3K 2NNAA 3EDKA 4LO9A 3LRMA 4WCYH 3VRLF 1TPXC 3LZRA 3WEXA 4E41E 5HHOA 2AQRA 2YS4A 3DX8B 5IWLA 3ARBA 5L4MA 1OAQL 3U6XS 1MCPH 4WKZA 1IGJB 2VYRE 3CFKB 1DVQA 1ILUA 4XBGB 5DO2D 4PVMA 5SWZD 2W0LA 2Z6FA 3L3GA 3QO1A 2EIJB 3S35L 1I1CA 4UQ2B 1DO5A 3IAPA 4HDIA 4N8VG 3RL1A 5IVNA 1P84K 4WHTB 2F5AL 4FL4C 5HHMD 1U2YA 5IB4B 4G5ZL 3LSOB 4OM0H 5LXGL 3US0A 4BZ2L 4IMKA 3OAWA 4Q0XH 4IRSC 2JKWA 5E4IA 3CDGB 1UXWA 3FF7A 1LHZA 1ZK9A 3FSZA 5HHVH 5IKCB 3DIFB 1AMYA 4ZUTA 5D7JB 2YD1A 4FQLL 5I18L 1NOAA 5HHNB 4A6YH 1AD9B 2R4RH 2AJUH 3MJ9L 2FX8L 3VDAA 4PCSA 5KSAD 4YBQC 3H9SB 3F05A 4PJGE 3T71A 5E03A 4NO0D 3II2A 1GC1H 3T4AA 2QQQA 2DYPA 2AW2A 1SFHA 2IDFA 3UDWA 4ATTA 4O2FB 5HHOB 2R2BA 4K5PA 5LAPA 4R5VA 1ANUA 1CF8H 3NCEB 4KO9A 3ZO0A 3IE9A 4M6OL 1ETZB 4XH2A 1QTPA 4WKZB 5HVHB 3D4ZA 1UD8A 2V3EA 1S7UA 3RWEB 3L3GB 3QO1B 4N20A 3RIKA 1NLBH 1FG9C 3ALXA 3QCUL 4UIMB 3RL1B 2XTLA 3KEHA 2YKLH 4R97B 5HGAA 2J5LB 1N5YL 1ORSA 4BJLA 2Q86A 3QZBA 5HI4C 4AXWB 4WO4C 5JXED 5DUBB 1G1KA 3MGOA 1DE4A 4Z7WA 2Q9OA 3VXSA 1LO5A 4KRNA 5H37A 4LL4A 1UXWB 2X0UA 3RHWF 2DL2A 1DQDL 4PV9A 5C08E 1ZHBA 4ZUTB 4QLWA 1NCWL 2UZXB 3FYIB 1S9XB 4YWGH 3LNGA 4OLYL 4GEIA 3VMPA 1NOFA 4GW1A 4Q4IA 4GKNA 3NACH 3BSZL 1AGFA 1CVRA 4UINL 2XWRA 3Q3GA 4QT5B 3QB7C 5DMKA 2DYPB 1FO0L 1GW0A 2DAVA 1YYML 2R2BB 3RY6C 4Y7OC 4B3VA 4FADA 4LVHC 1RV6X 2VWEE 2WQRA 2Y4SA 3K1KC 5GRVL 4XH2B 1W6WA 7TAAA 4DKTA 3LN4A 3TA3D 1S2EA 1CUOA 1S7UB 2F68X 4QIRA 1UWXK 5CIPA 2GC4C 4NSKB 1MLBA 4L9DA 2PNDA 4GI9A 1OP5H 5HGAB 4NZ8A 3RVVC 1JPEA 2YMXL 3DTUB 4G7YL 2Q86B 4XAWL 4WI5A 4ACPA 3GMLB 3MGOB 1DE4B 3VXSB 2AHIA 1OB1A 1W72H 1KCSH 1UUSA 3EJZC 4QNPF 3MRCA 2Q6WA 1IAII 4FFZH 2XPGA 4G6FD 4PV9B 4BZ1H 4L4TE 4AVJA 3VVVA 4BQ8A 5FOJA 3O9WA 1NAKH 2O5XH 1INQA 4GKNB 1XF5B 3O0RH 4YDIH 3HPJA 2ZWNA 1I1YB 3CFBA 3Q3GB 5HGGS 1JXJA 4LVOB 4XI5D 3NPSB 5DMKB 5JW4M 3JWNH 5ALBH 2BZDA 4R8WH 2C1OB 4RSYA 2NY5H 3P30H 1J9SA 3IF1B 3LH8A 4K7FA 3V5HA 4LLVB 5IHZA 4IBUA 5GS1C 4GRWH 2QBWA 3CHRA 4H8UA 5C3LD 1W0VB 4NPJA 1B4JL 2JKRM 5CIPB 4FTVA 4PTUA 3RAJL 1MLBB 3S36H 1FAIL 4HJUA 1S6NA 1RURL 2PPCA 4NM4H 3RZWA 4A7SA 3T4YA 3MLZL 4Z8FL 4K5NA 4R6UA 4UUJA 4U3SA 3MRCB 2GCYA 1IRAY 3B7SA 2Q6WB 1KXQA 4RIRA 2XPGB 1KCBA 2ENPA 1QLEB 4HJIA 4F20A 4NUGL 3FUDA 3HE7C 3QO0A 1AD0A 2X9ZA 4IU2B 3O9WB 3ISYA 4QJ4B 1INQB 3HLKA 3TN0A 3EIFA 4AQ8A 1NCBH 4CUCA 4ZFOA 2XJLA 2O5ZL 2Q3AA 2X4NA 3BQUC 3ZY7A 3SE3C 4KO5A 3HPJB 1WHOA 3CBKB 2ENYA 2VDQB 3CFBB 1ZRUA 3EYQD 1WWAX 3T2NH 2FO1A 2VNCA 1T21A 2BIMA 1HVXA 1HEJC 4PWGA 1CO1A 1D7FA 1FBIH 2FSEA 2DWYA 4WZ9A 2WO2B 1FLRH 2QSTA 2FT8A 5FUCE 2BDNL 4K7FB 3V5HB 2AEQH 1YNTA 4M62H 3S8WA 4KKLD 4YSOA 3LEVL 3WFEL 2Z35A 4OFYA 2F7OA 2AAVA 3AG2B 4FTVB 5I1KH 1AZZC 3D30A 3LPFA 4YDKL 2I69A 2XCMC 3WEBA 3T4YB 1D9KA 3U4BH 3GXDA 4PJHB 4H0LC 1XDTT 3COOA 4JFOA 5BRQA 1O7SA 4U3SB 3K8LA 2GCYB 1S8DA 3FFCA 4ZTOH 1QSFA 4KROD 4OJCA 4RIRB 5JHDB 2E9GA 3FQ1A 2X2HA 4HD9A 4RMTA 3MQIA 3D69B 2NY3C 1AD0B 2VLRD 5LWYH 1A47A 1UEYA 1E8XA 3P3YA 3W5MA 3TN0B 4ZFOB 3UAJC 4BFNA 3BKMH 4NQCD 1JXFA 5LUMA 5G2NA 1TZOA 4QKTA 2YPLA 4C4UA 5ID0A 1JWMA 1R47A 2YD2A 3VH8B 1QPXA 1T21B 2NTSP 1X5GA 5HHXH 1MRDH 5D1QD 3DYOA 2V4LA 2FSEB 4A39A 3LIZH 3B7YA 5IK3A 3D3VE 2W0KA 1YNTB 2WXIA 2F8VA 1OARH 3H2PA 4G9FD 4TLTA 2CRYA 1DVXA 2MTPA 2OAAA 1UACL 3MV9A 4HUXA 1T80A 2BSSA 4JE0A 1M7UA 1IGFH 5D9SA 5AW7B 4YDZA 3GHBL 1KELH 1D9KB 3WE1A 2H7WA 4JFOB 4F9PA 4X0KA 5F9OL 1QSFB 3ESPA 2F15A 4WJ5A 1MF2H 4N2KA 1I8IB 4LP8A 4PWIA 4XVSH 1XIWA 1OIOA 1UWGL 4NDMA 3V0GA 3O2DA 1F90L 4O2EA 1ZSDA 2H2PD 4X5WA 3ZHNA 5KN5B 4WTQA 5LO7A 2XIDA 5C6TH 5SWSB 1TYJA 4JR9L 3KL3A 4E9QA 2VC2H 1BIIA 5IT2L 3EFDH 1IKNC 2K8QA 2YC1A 2YPLB 4KXAA 1ZDQA 3B37A 1JWMB 1MFNA 5ID0B 1CXLA 5TK4A 3AM8C 3FT4A 2FK9A 4OLZH 1P5UC 4DERA 4X6CA 2MPAL 1YC7A 2PXYC 4JFFE 2DTSA 1NGQL 3UCRA 4GXUM 5I1JH 4KZDH 2CUAA 5IK3B 2HRGA 3HVDA 3U7YL 1KEML 3TLRA 4FE9A 3MLUL 1TJHH 1P7KA 4N2OA 3ABMB 1HCFX 3UBXI 1N0XH 4O2CB 2WB7A 4FKHA 2VERN 3SDDB 1U0QA 3HG1D 4PJHF 4HUXB 4PVBA 3B5GA 5IJKC 1MEXH 4P4KA 5CMAA 5FWQA 5D9SB 3S3DB 4QRPD 5I1CL 3X13B 1FDLH 2F54D 1XCXA 1UQSA 5BS0B 1SLWA 4CKQA 3BVXA 1FL5A 2ENSA 3GGWA 1QNZL 1HIMH 1A5FL 2RMNA 1C5BL 2VXVL 3HEIB 5GRJH 1S78C 2J4WH 4LPUA 3RZCB 1XIWB 1MCOL 2E7HA 3ABGA 5IB2B 3QP3A 3ZT5A 4DH2A 5JOEA 4M1GL 4O2EB 3LNEA 4X5WB 1FVEA 5E95B 3BJ91 2D0HA 1MHHB 1OWRM 1BIIB 5A2IH 2YC1B 2QGCA 4S1RL 1QG3A 3TYGH 1IZKA 3WEMA 5L2KA 4XC3H 3DJSA 2F53A 4R7DB 4A7TA 3FT4B 3DVFA 4JO1L 3W82A 1YNTF 4X6CB 1R75A 5IROD 3TBBA 3L1EA 5A16B 1S9YA 4IMLA 4EPSA 2HVJA 4YHPA 4ODVL 4X6BA 5TH2A 1BG1A 3IDNA 3NCWA 4PB0L 1U3HD 4BSVA 3FTVA 2P1YA 1HS6A 3L2LA 3B2PA 1DJIA 1QMUA 2FECI 1HL8A 5DMGC 4A2EA 1OTUC 2OTPA 2GJJA 5CMAB 4D0BA 3SD2A 1VZHA 2XKNA 2TSBA 4AEEA 5E2VH 2H9GB 2AV1A 2IEPA 3FO2B 2BRRH 4KY1H 1OE2A 4DP6X 1FL5B 2YUZA 3FZUC 3GGWB 4XP1L 4Z7IA 2H41A 4ANWA 1LE5A 5EIIG 1DVYA 4YHYC 1Q0YH 2EDYA 3GHPA 5T1MA 4XMPL 4KI5E 3ZE0E 3ULVF 5F93C 2XPZA 5D4JA 4J3UA 4XGZA 1CXFA 4I87A 3QRFM 4UILH 1QO3B 1PCSA 1FVEB 4OQ1A 3QQXA 3UGXA 3QHZH 2XFGB 1EHLH 2CH8A 3O3AA 4LFHD 5EWIH 1VFMA 3NABH 3K4ZA 5D1ZC 5L2KB 5EC1A 3FXIC 2X87A 1NOLA 4U2ZA 1DEDA 5IGXH 1T83C 2PF6A 4AYMC 5FV2A 2AQ2A 1EMTH 1P7BA 4PRIE 3AREA 4IMLB 4KXBA 2MJWA 2ZWSA 3MRDA 2VJ8A 4YHPB 4X6BB 3IDNB 1A1NB 4G7SB 3WNLA 1XT5A 2Y07H 5F8QC 3TL5A 2VUKA 2IAAC 3KDMA 4G6KL 1VPOL 3MXVH 3MLVH 3LB6C 4GSQA 5FUOH 2YLKA 2VN3A 2O6EA 4D0BB 4X8GA 3KMDA 5MEQA 3NSYA 2AV1B 2YA2A 2FJSA 1IGCL 5EOTA 4F27A 1Z3GL 4Y4FC 3NH7L 3QWRD 4Y4KB 1BFOB 4NO5A 2EKJA 1SXNA 1LE5B 3OSKA 2NXZD 1RUAL 5T1MB 1A65A 1MOEA 1QR4A 1U4FA 4MMXA 1FA4A 2C7FA 4CN4A 1ET8A 5I1EH 2G60L 4XGZB 2P52A 4JKMA 2FB4H 2WLMA 3HS0A 3PWPE 4X6CF 3T3PB 4L3FA 1FWXA 3GSNL 4OCSL 5EC1B 1EAJA 4Q6YA 4FG4A 1TQTA 3PABA 4M3KB 2BJML 1GGCH 2BHYA 3AREB 4PRDB 2YXMA 1KOAA 3HJEA 4Y2DA 5I1DA 2VQ4A 3D8MA 1IAIM 3KPSA 2O26U 3MJ7B 4S11A 3LRSB 1PZBA 1KCLA 2G4GA 3KLAA 2I5YL 1QAWA 5E0QA 2WKLA 4L3EB 1IO4C 3MLRH 1BBDL 4M6NL 1L0YA 1NANI 1RPUA 3PJNA 4BDVB 3A67H 4KBPA 5GGVL 3RA7H 4A6YA 5MEQB 1UB6A 3OLDA 3PFUA 4FLSA 4J1UA 2X38A 3B7RL 4URTB 5EOTB 1OAZL 1BPLB 3QGVA 4NO5B 1EDHA 3T9WA 3WJLA 1G1OA 2CO1A 1NKGA 3HG4A 4MMXB 1NDMB 3HMWL 3O2VL 2XN9E 1RU9H 2A2QT 4WJKB 3TFKC 2YZ8A 1HJBC 4M9PA 4RX4D 4QXUL 4PS3A 3WUWG 2ZKHH 3HS0B 3WKPA 4LSRH 3TT3L 2H26A 4C56D 2LE9A 1NCDH 2EZ0C 2HWZH 2DB8A 3L1OL 2JB5H 2NNFA 3LN9A 5I1IL 1BVZA 1TENA 4B41A 4LMQI 2VXSL 4LLDA 2EC9U 4AVKA 4ZFGL 2WLIA 2DQDL 4Y2DB 3V55A 3ARDA 5I1DB 3MRKA 3M1OA 3KPSB 1PLCA 3CG8A 4TNWK 2EH7H 1AHMA 4OLEA 3KLAB 2DQGH 4GBXA 3FS9A 2GJ6B 3E38A 5FR3A 5HYJE 2QKIC 4MQSB 3VXUE 4F3FA 3BRFA 1DANU 4M7ZB 1BEXA 1UB6B 2X4UB 3MTRA 2MKWA 3ABZA 5FA3A 4Z7OB 5IV2A 3L4TA 4J2QA 2JJUA 1B88A 4KK5D 1NLDL 4RFNB 1DBKL 4FNLL 1DN0B 1ZA3B 2BZCA 3VXRA 2IBGA 3K0YA 4FQ1L 4LNRA 2V17L 2N0KA 3T3PF 4WWOA 1EAOA 1AHWC 1U4EA 3DX7A 4U6VL 5B7FA 5J13B 1RXLA 2KZKA 3UIZA 3FQ2A 1TLKA 2ZPKH 5GHWL 2H26B 4X5LA 3CDZB 3T04D 4WLCA 3NFSH 5JNYA 4ZMNA 3ARZA 3Q1SH 4F2FA 1H0DB 4QRRD 3NTCL 4FEIA 3Q44A 4NI3A 3CFEA 3IWUA 4NIYE 3S48A 5LHDA 2YQ2A 4ANXA 2WLIB 1NC4A 5FCUH 3IS0X 1JAEA 3ARDB 3HRPA 3KLDA 5D4QA 1UT2A 2LU7A 1IEHA 2UZYB 4HZ1A 4N8UA 1UA6L 4M03A 2OK0H 2VDLH 1Q0EA 3WCYA 2IAMC 4BZ1A 1MI5A 2ED9A 1FV1B 4F3FB 1ZV5A 2XQYA 4WFEE 2FGWL 1F58H 2GIYA 3GUTA 1C1EL 4G8EA 3AWGA 4OF6A 3QH3B 5FA3B 2DQJL 3P0VL 3RVUC 5I6MA 2OMYB 2A0LD 3EW3B 4JPIB 5DZNA 5C08D 3VXRB 2ZT9C 5DR5L 5EEYA 4M61A 2BNQB 4LNRB 1UH3A 4EBQL 3DX7B 4N86A 3HI5L 4PB9L 1JV2A 5C0AE 3LD8C 1QRNA 2Z4QB 1TOXA 2F58H 3LNFA 1R34A 5ICXA 3VD0A 2Z31D 1KEGL 1E5CA 5J11B 3M07A 4OJYA 3UROR 4Z78A 1TKWA 3GI9H 3QA3B 4EI5B 3DSFH 3OLIA 3CFEB 2ZX5A 4IKJA 4ZMLA 4ILDA 2YN3A 2K3TA 3OAYK 3IXAA 1T7YA 2IPTL 5D5MA 5DQDL 5FV1L 2ODIA 2ZNXA 1XH3A 3E9UA 4TOYH 2OYMA 1X6LA 2VOTA 3SDAD 1IM9D 1UD2A 5LXVA 3FOLB 1BV8A 3MUJA 4WWKD 5IBTH 4DWHA 2JJTC 3P9LA 3D6GA 4Z7OF 3RNKA 2GAZA 4N2CA 2FAUA 3FK3A 3AY2A 4N0YL 3RFRA 4TKWA 4Z3IA 3GUTB 4G8EB 5CSZA 5AB9A 1CGSL 2QSVA 3MSPA 4L1BA 2PN5A 5JUEH 3HE6C 3SBWA 4PLNC 5KTEH 3W81A 1IEAB 1TMCB 5E6ZA 1N4XL 4NWTH 4V33A 4DSYA 5AKVA 5MEND 3K72B 4JRXE 1BIHA 4UTAA 5SX4H 2C9UA 2NY0C 1QRNB 2IQ9H 3WKYA 4Z18A 1YDPA 1S7VA 4K94C 5EIIB 2MSPA 5ICXB 2XA8H 3M8OH 3QIBD 3OMIB 3HRZA 4KAQH 4B0MM 3NQIA 1PU0A 1X5ZA 3SIKA 1TKWB 1HESA 1L0PA 1XGRA 4NNXB 3QDJE 3KHQA 4XWOC 2X10A 1SYVB 2OXHA 1NCGA 3QORA 3VFMA 2J1WA 3JQOB 3C2SA 3IXAB 2I60L 2HT2C 2VXQH 4ZMTA 5K9QG 3QPQC 1MCBA 4LE8A 5D5MB 4QGTA 3PXHA 2Y3NA 4FAAB 5IFJA 3U9UA 1R3LA 1XH3B 3OBAA 4LU5H 5TDPB 2P26A 4JFDA 5AVVB 2DYRB 3P9LB 1A4CA 1AQKL 1BVNT 1QHOA 1NANH 2F74A 4J7RA 3R18A 3RNKB 4AYSA 1JZ4A 4IOSA 4BK8A 3EFOA 4HFUL 4QEGA 5CSZB 1X9UA 1O5DT 1WTLA 2XWEA 3ZO9A 4DTGL 4XC1H 4PEEA 4N9GA 4TULL 1XGZA 3BAWA 3IJ9A 2B0SL 5GGQH 3ATFA 1I9EA 1KIQA 3FTXA 3LIZA 3FTUA 3GM8A 4ADIA 4GG6A 1J88A 1MFMA 3VFVA 3VMOA 1YDPB 4UMSA 2WLLA 4HIJA 2DIJA 2D7TL 3HRZB 4K9JA 3P11H 4G6AD 1LMIA 3U83A 2WLNA 5CP7A 3VFMB 2OXHB 4ODBD 3C08L 3DMMC 4K5LA 4WW1B 5IR1B 1HYSC 4HIEA 5E6YA 2CR6A 5JQHC 1KCVL 2ZXEB 4LEXH 2NY4C 5F71A 1T2XA 1QW9A 3FHAA 4JFDB 1QWHA 2D7OA 5D7IE 1OAXH 1ITCA 4TVSa 5FK9A 1EGJL 3V0JA 3KLQA 5DK2A 3EYVB 2P5WE 1I8LA 3CZNA 1EV2E 2L8AA 1XZ0A 3GK8H 3H3PL 4M1CC 5DDHB 3RGVD 2CA4A 2Y1AA 1EA9C 1YEIL 2CO7A 1NL0L 5DJXB 2W60A 1Z9OA 2J2ZB 4N9GB 3HBQA 5TDOA 1NMAL 3B8YA 1EAQA 2QQKH 1JDCA 1A6VL 1T1WA 1KIQB 4JFHE 5AOLA 1JIBA 4GG6B 1OL0A 4LEEA 3KYKH 3VFVB 1VF5C 2WLLB 3L5JA 4HIJB 4HC1L 3JUZA 4ZNCD 2VKXA 4NS0A 3RNQA 3HVNA 1T0OA 2FRGP 2ICWI 4Y5YA 5CP7B 3T77A 1XBDA 1XB6A 2QVFB 3BT0A 4H40A 1J05A 4YL9A 5IVOA 3WUWB 5T8IA 1X4ZA 1QLFB 3O8XD 4AQOA 5ID1B 4HJGA 4HIEB 5DD6A 5GZOA 3B2XA 4FKKA 2H32A 2ZP0T 3WXVH 1X5IA 5FX3A 2FWOB 3QYCA 5I71B 2P49B 1B2YA 3LRGA 2V8LA 3IPEA 5E2WL 2Z8WC 5FK9B 2FDBP 3RI5F 5HHQA 5IY5B 4WSJA 3D12B 3MRQB 4TVPH 3H0TA 1RH8A 5DK2B 3C6LC 1KPRA 4HWZA 5K59E 4OD1H 3SJVB 4OFIA 3PHQA 4NN6C 3MBEA 2W60B 5I75C 5TDOB 1HYRC 4NC0B 4MYWB 4J28A 5TE6H 3QXUA 1X6NA 3HC2A 2FJHA 3PWLA 1YEGH 3I9GL 2UVEA 5J7CC 3W2DL 2UZIL 2WWOA 1VACB 4QHLA 1LP9E 3T2QA 4FG2A 3BD3A 4JHWH 1I8MA 3O6FB 4AEFA 1QBBA 4IIQA 4YK4C 4HK0A 3D9AL 3T77B 4Y5YB 3GMMA 1WA2X 3ECWA 4HCFA 3QQ9D 1LNUB 3B9VA 4OFKA 4EOWH 5FYKU 4HJGB 4GIOA 4YE4L 5TD4A 5DD6B 3ARQA 2H32B 4P8QA 1JZGA 1THAA 3GXTA 3HB3D 3SDCD 1KWGA 1JGUL 1AO7B 3CHQA 5HHQB 1DBBH 5ADPL 4YAQA 2GTWA 3BWSA 4W1TA 4BKTC 3DVNB 3KXFA 3TH4T 1KPRB 3R4RA 2DV6A 1IC4H 4JO2L 3MV8A 3V6OE 4HWZB 4J2XA 1BWMA 2NNXA 3L4VA 3OGCA 3U7WH 3NIDE 5FHBL 3QSKB 5C0BB 3PHQB 3MBEB 4FC3E 4PGJA 4HT1L 5TQ2L 3OL2A 3D2TA 1FYTD 3VUAA 4L4VE 1LEGA 3TIDB 1KENL 4JM2B 2FJHB 3PWLB 3HW7A 4JL2A 5GXBB 2YPVL 1PJWA 5KVGE 1JI1A 2D7NA 3UC0L 1KB3A 2E7DA 4KKCD 4G59C 4RQQA 4CBPA 2FJUB 3RX9A 4QHLB 4EIZC 1FJ1B 4HULB 1I8MB 3AY4C 1NKOA 4WFGD 1EWHA 4IIQB 2VDOL 4HK0B 1TETH 4M9OA 4WK2B 5FGCB 1KLFA 3GMMB 4Q7DA 3ZUCA 2VSKB 4LSVL 1OAQH 2G4EA 3FTYA 2VDML 2Q20A 3W39B 4WI7A 1GYAA 3QRLA 5IVXA 1KGJA 3GS0A 3ZE2B 5C0GA 4Q9QL 1MJ7L 1PZSA 2VZ1A 2W92A 3FQRA 4HD5A 5AB0A 3S35H 5IIEB 1QZNA 2DL9A 3DSNA 2F5AH 3OJ2C 4KJQD 2HVKA 4YAQB 2V2XA 4MNGE 1GRWA 2GTWB 4G5ZH 3DV4A 5LXGH 4BZ2H 2VDKH 3EUDA 4Y5VC 2ITFA 5E8OB 4ZX6A 5KBLA 2FH8A 2PWFA 4LRNL 3SD5A 1GS7A 3TVMD 2EP6A 2WNKA 5I8KL 5CZXC 4I5BA 4AZ8A 4MNHA 3CZJA 4FQLH 3MRPA 5I18H 1AGBA 5GJSH 4XX1G 3IS1X 3BLPX 2NY6D 1UZGA 2H0EA 3TJHD 4N0FA 1LEGB 1WISA 3PGDB 3MJ9H 2OYKA 2FX8H 4Y8AA 1UGNA 3LKSA 2I9TB 1XMEB 3QFJB 4Y19A 4J3VA 5DMJB 4I1NB 4LP5A 1E28B 4RQQB 4X6EA 2BIOA 4EN3D 4L8DA 5FO7B 1UB5A 2AJSL 1WUZA 4MTMA 4JRYE 4M6AA 1G7LA 4PRID 4MLSA 3FUKA 2DN7A 2FL5A 5IVXB 5C0JB 3CNKA 3S34L 3P77A 2GJPA 2UXTA 4FGMA 1RAMA 3FQRB 5C0ND 3QCUH 3CVCA 2EO9A 2WLHA 4M43L 3DSNB 1N5YH 1R19A 4HPOL 3ARXA 2LU5A 3C60C 2PW1A 2KHAA 2AEIT 3DV4B 4D9QD 2GUOA 4PG2A 4H1LG 3I02A 1N0LA 1J86A 1BZDA 2YHGA 4AZUA 3T0EB 5LG1A 4I5BB 4JM2F 1NCWH 4MNHB 4AZ8B 1OCRB 3IMTA 3MRPB 1AGBB 3AAZA 3BXNB 4OLYH 3LHAA 4NQED 5TTRA 1GZQA 1N59A 2DH3A 3ARUA 3BSZH 1RKRA 2VR6A 3D39B 4KFMA 4UINH 3T0BA 1JCKA 3LKSB 3TM6A 3PWPD 4MKTA 3RUGA 2WXHA 1AR2A 2NY2C 2WYTA 1Z2KA 3KWVA 5TPWL 1FO0H 3BPLB 2GUYA 1YYMH 3KGTA 2O5NA 1UB5B 3SEPA 1LVEA 3Q13A 4X0NA 3ZE2F 1UH2A 1U8CA 3GRGA 5AEAA 3ZGIA 1KB5L 2Q2LA 4L8SB 2XWJA 4XOBA 4R7VA 4MJIE 3P77B 5D1XA 3WDJA 3G5XA 3NIGE 2YMXH 4G7YH 3UTZA 3APNA 2PW1B 4XAWH 5BNXD 4HPHA 2RALA 3VVWA 2GUOB 2HVBA 3VI4E 3OXSA 3FQXA 4P59L 2EUWA 3I02B 1N0LB 4ZSOA 3CSFA 3ZL4L 4P46A 1I1RA 3Q2NA 5JA8B 1OHQA 2CBTA 4XNQA 2B5IB 3JWOL 3APDA 3AAZB 2EIMB 1PFCA 3L54A 1GZQB 1N59B 3R06A 2ADGB 4QTFA 2WWNA 4F57L 1FPTL 3B6SA 3PNRB 4LCWA 3GJFK 3P3TA 4PJCA 3QJSB 5KSVA 3VGAC 5EOCL 2ZICA 3RUGB 4CADA 2E75C 4R83A 3VTMA 3TBSB 1N7ML 3GMQB 4GG8A 4UWQB 3ZDWA 2RFXA 5EZIL 5IVXF 3VRIA 5F9WC 4YDVA 4ONOA 3K5RA 1H3XA 3VI3E 1U8CB 1VRSA 5L4IA 1L9PA 4W9DC 3T5WA 2WZ6A 5IOPA 1I9RL 3ARGA 4Z95L 3MLPA 3QDGE 4RMWA 4JMXA 4A2FA 5IQ7L 1B4JH 4Z7VE 3RAJH 2FIKB 1L9MA 4LPWA 1FAIH 2PWDA 1RURH 1RJZA 3UAAA 3UTZB 4I7ZC 2VABA 5SX5K 5E9NA 4UYQA 3MLZH 4Z8FH 3K5SA 3GSVA 3OXSB 4WW2C 5ECJE 3IKCB 4E0RA 4ZSOB 3WS3B 3S97C 1BREA 4P46B 2R2HA 2QHRL 3C5ZD 4DZ8A 2EIKB 1X5YA 1OP3H 2OCFD 4NP4L 1KY6A 4NUGH 4XPHL 1U3NA 3UJIL 4F1SA 5D2NA 1WIOA 4V1DD 2XG5A 5E51A 4KUZL 4MWFB 4AMKH 1CIDA 1U8PA 3R06B 1GGYA 1ROCA 3B6SB 3HKFA 3SHSA 1BW8A 2Q76A 4PJCB 4HETA 4PBXA 2OCCB 3X2QB 4CADB 4Z3GA 4YDLB 2D03L 4MNQE 2VL5A 4XCCL 4GG8B 1JMXA 3GXMA 4YR6A 3RJQB 3VRIB 4DGWC 5CZRA 1SJHB 4YUEL 1MCLA 2UXGA 2BDNH 2L3BA 3PUCA 4ZFFA 3OKLA 2XVLA 1PBYA 2JKLA 4D94A 3TBYA 3ZGHA 3LEVH 3WFEH 2PPEA 3DLQR 2EDNA 3TZVC 2DMCA 2DQIL 1NC2D 1LDPL 2K78A 4XNXH 1CDBA 1RJZB 2VAJA 4YDKH 2VABB 2AK4A 3PLYA 1OCCB 2ICWJ 2OMTB 2W0PA 3NCJL 1YA5A 4XOAA 2VDRL 4J3WA 3G5ZA 4ORGA 4E0RB 4OD2B 1CLYH 2VLMD 4ZO6A 35C8L 1AGCB 2R2HB 5BJTA 1UJTA 2OW7A 4DZ8B 4GO8A 2J25A 1E67A 4UT6L 4JFWA 3OMAB 4L4JA 4F7PA 1BFVH 2E86A 4JJHA 1RUKL 1HH9B 2NY1D 3BP4A 3U9PL 2GABA 5JORA 4UDTB 1J9QA 1WZ1L 2F7RA 2Q76B 4NNYA 1CBJA 3BGFC 4OUOA 5MHSD 2A99A 1SDDA 4XMUA 1N70A 4C83B 1CDUA 1TPXB 3FONA 1UD4A 1TZHA 4YR6B 3IMBA 4FCAA 4RMBA 2APXA 4I8DA 1BF8A 1G5GA 4I18B 4G8FA 3EYOA 5INDB 1KDIA 4YZFF 2FR4A 3LKOA 3IFLH 1UACH 3QEHA 5DC4B 4L1SA 3WY3A 4NT6A 1WE5A 3FTGA 3POHA 2XUWA 3GHBH 5FA4A 3WN5B 1JGIA 1FIGH 4YPGA 4WO4A 4Y16C 2AK1L 3EF4A 2AEPL 4ZT1A 4ORGB 1OY3B 3G5ZB 3TEXA 4OCMC 2CXKA 3OJDA 4B7LA 5F9OH 2HRPL 3BUPA 4G70B 2KPWA 4DEPC 3I6SA 2Y06L 1E2VA 3LTVA 3POCA 4PR5A 3P2DA 5F7NC 3A4AA 3CDYA 4F7PB 3GLZA 1MH5A 2EILB 4ZK8A 5KSBB 1F90H 4PJCF 2ZUTA 1ASOA 3BP4B 3J27A 4NZDA 4X9BA 4JR9H 4MRBA 5IT2H 4WNJA 1EAPA 2BY1A 2VR8A 5EUOE 3CQPA 4NNYB 5EDXA 3OQRA 1B90A 1YEFL 5IHWA 1SDDB 2VLJA 5DYFA 1EVUA 1OTTC 2MPAH 3FONB 1NGQH 5J6GA 1Y0LA 4Y1AD 3RY6A 3QDJD 1U8KA 4QRQB 3U7YH 4A04A 1XB8A 1KEMH 1W8OA 1N6QL 4KMLB 2DMKA 3MLUH 3ZT6A 4KZ0A 2BW4A 5C09B 5C1MB 4JEGB 3EYOB 5T5NG 1JNHA 2FR4B 3UPRB 2GTZA 4R2GB 3TOPA 3QEHB 1G4MA 1OCWL 1OCZB 5ICZB 4NT6B 4HMDA 4JFSA 3F5WA 5DO2C 3FTGB 4OZFG 4X6FA 5I8EA 4L9LC 4PHXA 5FA4B 5I1CH 1RSFA 2WIMA 3OMZA 4YPGB 1RY7B 4WO4B 1F3DH 1MJUL 2R2EA 2Y6SD 2Y6TE 3G6JE 1CGVA 3OJDB 4ZPTA 1QNZH 4P2RA 3C87A 4U0QB 5KBPA 4ZMOA 1A5FH 4KK8D 1C5BH 4KDVA 1RIHL 1F2QA 4BRVA 4PLOB 1MCOH 1GTNA 1H8OA 3HHMA 4P3CL 4WI2A 4N4YB 4M1GH 5CJXA 2DKUA 4H1LB 3PL6D 1A6WL 5IOKA 2BSTA 3QIUD 2XFXB 1EAPB 3G6DL 4IKNA 2IPUG 3S5LG 2ZX7A 3DKHA 4JDEA 4GB9A 2AZAA 1OW0C 4LSUH 1F1DA 1MFEL 2LVEA 3NK4A 4JO1H 5KSAC 4ZTPL 1TVBA 1T5XA 1Z0NA 4P2QA 4PS4L 1Y0LB 4LBAA 1U8KB 4ODVH 2OXGA 1REIA 2DY2A 1CDYA 4PB0H 3Q2WA 5HJBA 4HEPA 4RLDA 2IQAA 4B9CA 1JNHB 2XBZA 3K7UA 1ZJBA 5C6WH 5JOPD 1ZWIA 4RFOL 5DT1L 1MCSA 5IQMA 1E40A 3JWOC 3BIBX 1OSPL 5I8EB 4X6FB 3D05A 1KV3A 4MFHA 5I6XC 3IU3B 2CO2A 2R2EB 1YJDL 4XP1H 1JE6A 1ODAA 4JMNA 3B5HA 4ZPTB 4P2RB 5JXEC 2IBZY 5KSBF 4UCFA 2QEJA 2E6QA 1P9MC 4L8BA 5LG6A 4XMPH 4Y89A 4JQIL 4FFTA 4K2UL 5BZZA 3HE7A 4O5LL 5D6CA 3OMNB 1CU4H 5ANMB 5DJAA 4DP7X 2JKNA 1T0MA 3CZSA 4RMUA 2F2HA 4D9RE 4JFHD 2EDRA 4QAWA 3BQUA 5F7AA 1YNLL 4JDEB 3SE3A 3IGAA 5I2IA 5EU6A 4MDRA 1XHHA 1ZANL 2WBXA 5C9JA 2IH3A 4M8VA 4BFRA 1O6VA 1TVBB 4HWNA 1T5XB 4IEFA 3VACA 2ZF8A 3D0LA 4I0KA 1EFQA 2OXGB 3L16A 4BSJA 3PGFH 1QASA 3LRLA 4KQ3L 1NUNB 1OKEA 2J8UA 2UY6B 1I4FA 1VPOH 4G6KH 1ZWIB 4M48L 3NG5A 4L5FL 5JPMA 3HC3L 3TA3C 4DO6A 1MG2C 3D4YA 1D6VL 4N90E 4FFYA 4FG6D 1Q9LA 3F7PC 1IGCH 4JY6A 3KZ8A 1Z3GH 4DKFL 3V4VH 1YMHB 1CN4A 1H9VA 2HLFD 3Q7JA 5BMFL 5JTWA 3FO0H 1AJ7L 1RUAH 3N41B 4L8BB 1FNLA 3HE7B 1NEZG 2G60H 5D6CB 4F8LA 5MI0B 5DJAB 5KUMA 43CAA 4UQIM 1T0MB 1CTNA 1DQLL 1IGYB 3QUYD 4ODTL 2IDSA 3IGAB 4EZMA 3VO0A 5EU6B 5I2IB 2AMGA 3K81A 3GSNH 3L9BA 4OCSH 5HYIA 2XWBA 5C9JB 5J8OA 2IH3B 1M1XB 4IEFB 2BJMH 3FOMA 6TAAA 2C4FT 1KFAL 4XI5C 1X9QA 4E9WA 2KQNA 5MP6L 3QHTC 3GC3A 3MV11 4FF9A 4BZ2A 3BGAA 3OKNA 1ZHLA 1ZSHA 1I4FB 3BUIA 5JPMB 2I5YH 4Y4HD 3H2QA 4LOUD 1BBDH 5LN4A 1IIIA 5AVSB 3L9RA 5HI5C 5GGVH 2EXYD 5BOZG 2MKLC 4PJ6A 1QUNA 3QBTB 4JY6B 4NP9A 3MJ9A 3RURA 3SO3C 1OAZH 2QSQA 3AT8A 1SF3A 4BUHA 5D96C 2R39A 1PZDA 3O2VH 2NY3B 1DFXA 4KU1A 2DM4A 43CAB 1FRGL 4L4VD 4QXUH 4WY7L 3GZQA 3ROOA 1Y6KR 5DHYB 1N2RA 3TT3H 2ENJA 2WVSA 1L9OA 1BAWA 1IKNA 3NUKA 4GO9A 5D7LB 5I1IH 5IHLB 1EQWA 3FB8B 2EIDA 2XWBB 4JPSA 5I0XA 3AM8A 1NPJA 1AKPA 2VXSH 4BFIB 1M9SA 2IOIA 2O93L 4O02A 2PXYA 4WV1C 2R9HD 4ZFGH 2DQDH 3MGTA 1EO8L 3F12B 3IRZA 1BLIA 3C8DA 3OKNB 1ZHLB 4NAJA 3WG7B 1UCBL 3O81A 2BIIA 4QO1A 4YNYB 4KKLC 4DUWA 5IJKA 2D0FA 4QOKD 4YXKL 3L9RB 4EXPX 1J8HA 3MCLL 2ESVA 1QUNB 3O3EB 4WAFA 3N41F 5A2BA 4AIOA 3BSZA 4POZD 1NLDH 4J3XA 2CIIA 1DBKH 2DQCL 4FNLH 4P06A 1E4JA 3RIAF 5BRZA 4F92B 4FQ1H 1UXLA 2V17H 4KROC 1U3JA 4U6VH 2I32A 4Q6KA 3DVIA 1OE3A 4Y9CA 3V7AE 1RZGA 3ROOB 5BW7C 5GHWH 1N2RB 4OCRL 4P5MA 3RDJA 1KTDA 1DQIA 1QQDA 2AI0L 3QPXL 3SB3A 4PJDA 4AUJA 4TRPL 3LQMA 3B7TA 3NTCH 4XNYL 4GT7A 5CJQL 5GSRB 5C07B 2LAAA 1JZ5A 32C2A 5K9QI 4O02B 4X9YA 2GITB 5D1QC 3SDYL 4ZMWA 3B1TA 2JWYA 1RK1A 2A6JA 1UA6H 4QNPE 3L3IB 1I7RA 4N6RB 4QO1B 1P69B 3T1FB 3BUYA 2XWCA 4LF3A 3VNYA 4TF4A 5LQBL 3PPEA 1QYGL 1YEKL 3BVUA 3D2UD 5I73C 4NQXA 1TCRA 2AZUA 3CVHL 2FGWH 2ESVB 1C1EH 2DI7A 2DIAA 2E9WA 2DQJH 3P0VH 3NA4A 2O4EA 3GSXA 3QQ3A 1DSFL 3QWOA 1AIFA 3GTTA 4S10A 5HHOE 2CK2A 3VW3L 1A0QL 5DR5H 5DD5L 2IXQA 2PCPA 1XGYL 2MMXA 2BERA 1PG7L 4EBQH 5A6LA 1ZLVK 5E5LA 3HI5H 1RZGB 3THMH 5JPNB 2BFVL 2FHCA 2Q8BL 2AXFA 1KTDB 2H2PC 1Q4NX 4GOSA 1SNRA 1KEGH 3E2HC 5D1ZA 2ZG3A 1EERB 2EIEA 3VU1A 4HF5L 3NEOA 2BY0A 32C2B 4WNQA 1T83A 1FFQA 3S5LB 1TLMA 4FQIL 4FXKC 1EUUA 2IPTH 4A2DA 1UC6A 1HQRA 1YJDC 3HAEH 5DQDH 3HC0A 2OS7A 3EKCA 2A6JB 3A22A 4P23D 1I7RB 1W0YT 3UTSB 4OF5A 3SGEH 3BUYB 3EBGA 1MQKL 4LF3B 2WXLA 4E2OA 3CZKA 2WXOA 3EOYG 2C9VA 5GZND 4HXBL 4NQXB 4OCWL 2X1WL 4N0YH 1WFOA 2HRHA 5ICYA 3B3BA 3MRLA 5C0CA 3T08A 3GSXB 1CGSH 1SEQL 5D70L 4Y4FA 3PQYA 5HYSG 3QUML 4N0UB 4PJ8D 1MVFA 4CVZA 5LDUA 4YHYB 1N4XH 5DA4A 2PCPB 3WD5L 3V0EA 1RIVL 1KMGA 2WBWB 2A74C 2EXTA 4WWID 3D5OF 2J21A 1ZAGA 3NCBB 4KVPA 4GSDL 5CBEB 2AXFB 5FFOA 4YHKL 4LRIC 1NCTA 3DROB 3VFRB 2V7NA 1LO4L 3GNML 1G0YR 2PKDA 4ICXA 4WNQB 4Z7WE 3VXSE 2R23A 3MUY1 4EDXB 1RHHB 2OSXA 4YHOL 2NCEA 5IROC 5CGBA 4M7JL 3U0PA 4XP9L 1AG6A 3MRBA 3IDYC 2ZF9A 5E99L 1AC6A 2WLKA 5D7SL 5LNGA 1IFRA 2YA0A 5T5NF 3T6ZA 2R8SL 1E2WA 1AQKH 1A8JH 3GMPA 4RMQA 1IBHA 1KXTA 2MOVA 3FB6A 3F04A 1OT4A 4UU9B 4WTXA 2FHFA 1NEUA 4G1EB 3AZUA 4HFUH 1FORL 2FLBT 5ICYB 1G0XA 2ATPA 5C0CB 1FH5L 3CZEA 5B8CC 5GGUB 1T4KB 1EEYA 4Y4FB 4YL4A 3PQYB 4CSZA 4DTGH 4F8TA 4JS7A 5FYJD 2F9BT 1JPTL 4CVZB 4TULH 4HS6A 2CHZA 4PJBA 2EABA 3GSQB 1N67A 2B0SH 2BOBB 4YHIA 1I1AB 2OJEA 3FTWA 1GW6A 3HG0A 3P02A 3DK2A 1DFBL 1K8DB 1N9PA 1RSYA 3UTTD 2X7LA 4FXLA 3ULSA 1RK7A 1WLHA 1Z9LA 3ABKB 1EIBA 1G6RB 3SPVB 1E5AA 4WUKL 2D7TH 4X9IA 2V7NB 3GWJA 3ULUD 4MNQD 1XR8A 4G8IA 5EZOL 1GJIA 2PYEA 2CHNA 2R23B 1HSBA 3C08H 4QGYA 5IB1A 3F8UB 5EZLA 2LU3A 3ZTEA 5EZJA 3KL0A 1KCVH 4TUKL 4E9SA 4PLKD 2QV4A 4OLVL 5A2JH 4LSQL 2D0GA 5I1AA 1ZDSA 2IBBA 2YRBA 1YECL 3EBAA 4ZRGA 5AG8A 3GMPB 4KMTL 3CU7A 4AM0B 2QKIA 3FB6B 3UPCA 5LGYA 3K6IA 3BT2L 3VM5A 3S98A 2OSYA 2IDCA 2ATPB 3TEUA 4DN3L 4X9FA 3H3PH 3WV0A 3CV5A 1YEIH 3ME0A 3SE8L 4FTDA 1NL0H 3L3HB 4XMTA 2DMBA 2K0RA 4K7PY 4PJBB 4M3HA 4V2BA 1JVKA 5EEWA 1X44A 4JQXC 1Y18A 4BK5C 3ELQA 1A6VH 2YAQA 2NXZC 3LN5B 1AHWA 3SYQA 1GS6X 4N22A 3U4KA 2X7LB 3N50A 3ULSB 3REWA 2XOTA 5C9KA 3CFMA 1NCUA 1OEZW 4HC1H 2XVGA 1F4WL 3FN3A 3GBDA 4FTVE 1NINA 3K4AA 4OAWB 2VR7A 3NFNA 4PJIA 3VTAA 1PG7W 5EN2A 1CFMA 3CLWA 1U3YA 2OFQA 2PYEB 5IB1B 1R9FA 1HSBB 1MRFL 2OLDA 3PHAA 4B50A 2P45B 4EF3A 1XQ4A 3VD2A 5EZLB 1E9PA 2E5EA 2EE0A 1KXQE 3V0WL 4PSRA 2FX7H 3FF8A 5KEZA 5I1AB 3D85B 1YN7A 1R4XA 3UZVB 5E2WH 1HNFA 4JG9A 2QKIB 3WUZA 1QR1A 5KVEL 1DQTA 5E8EA 1GOGA 2WQAA 2XTJE 1BOGA 4N1CA 2VZUA 4J6RL 2B7DT 3SBPA 3WENA 1Y6NR 4B9PA 3NT0A 2Z65C 3ZKND 1F3RB 2OL3B 1H5BB 1P6FA 5KYWA 4LAQL 2DICA 5E1AA 3SPHA 4PJGB 1Y18B 3N0AA 1H15A 4MA3A 5GPRA 3UH8A 3UJTL 3OAYH 4U0RB 4X83A 2O6PA 3F7YA 2X4RA 1BFTA 3TWYA 3FHEA 2ERJB 1BBJA 1UD3A 1FI8C 3W2DH 2UZIH 5DZAA 3UZEA 4DF9A 1VERA 3NFNB 2AQTA 1MNNA 5EN2B 3D9AH 5KJ7E 3QUXC 2YD7A 1CE6A 1NAML 1U91A 3EADA 4P4RA 5IM7A 1HWGB 4YE4H 1E9PB 5CF3A 3BO8A 3FFCE 1AS7A 3NDZE 1QSFE 4I4WA 4KKNA 4OY9A 1QD0A 3A6OA 3CFJA 3MJWA 4CSSA 1MAJA 5I19L 2WAHA 1N18A 1B3IA 3TA4D 2XZAL 1JGUH 1YN7B 4PJ5D 1CL7L 2BMKA 5B1CA 5ADPH 2JJTA 1QR1B 1CQYA 1CGXA 3ULVE 2K45A 4XNAA 5E8EB 2J72A 4DOHB 2YPLE 3GXIA 2FBOJ 2PTVA 4NZRL 4JO4L 1YUHA 2AJZA 2W80C 3PAUA 4M7KL 5FHBH 4Y2NA 3HE6A 4JO5A 5KYWB 1X5HA 3BP6A 5TQ2H 5E1AB 3WE6A 4KK5C 1SXZA 4JG0L 3B56A 1QFWI 5LBGA 2EDEA 2CIKB 4MA3B 1KENH 4KH9A 1IC5L 5CSBA 2YPVH 1P1ZB 2BIHA 3F7YB 3C9NA 3UC0H 1HI6A 2YXWA 4MAZA 4ESKA 2QL1A 3MV9E 1G4RA 1I3UA 3FL7A 3SGDH 2CKBB 4EIGB 5M7QA 5HXMA 3I2CL 15C8L 2VDOH 1GCFA 2VDPL 4LSVH 1CE6B 3LS5L 4P4RB 4U1SB 5IM7B 1JXDA 2VDMH 3A6BL 5T33L 4JPKH 4I4WB 25C8H 3ZX1A 3EO1B 2JIXD 2V9TA 1K9TA 4Q9QH 1NZRA 2E7MA 3CFJB 1MJ7H 3MRNA 4HOZA 2IWGA 1GMIA 3VB8A 3OJVC 5FIEA 4MD4A 3T6WA 1T7ZA 4P57B 3WMPA 1ORQB 2DQHL 2NT1A 2E3VA 4L4TB 2UY7A 2H3NA 1YUHB 5EV7A 2AJZB 4LRNH 4PJGF 2WCSA 2YEQA 5I8KH 5DZJA 4X6CE 2PO6D 1IU1A 1QSED 3IRPX 5BO0D 4G8GA 2I26N 3QFDA 2A0LC 1KGCE 3MLXL 4KX8A 5CS7A 4HU2A 3RDTD 4LSPH 3UP6A 3C9NB 4FOMA 1GYCA 5HYSB 2FIRT 1HI6B 3QEUA 3P4NA 3WKNA 3GSWA 1ZA6B 3QDMD 3HBZA 1QLRB 2HFFA 1JNLL 4YDJA 2AJSH 3IGFA 1J0YA 1J8SA 2Z31C 4MS8D 3WFBL 3DMMA 2H3XC 3WFCH 2DF3A 3HR5B 3S34H 3N40F 1SHWA 4MXVE 3K91A 2APBA 4WHCA 3MRNB 4J27A 4AY0A 4ZX3A 4M43H 3N44B 2WLZA 4OVUA 4RNRA 4JHAL 4HPOH 4A2HA 2ENQA 4MD4B 5AQ0A 4U7KA 3AABA 3SDAC 2L7EA 4GXUN 4HS3A 1XO8A 4WWKC 2UY7B 5IUCA 1AYRA 1XF2A 1BZ9A 2DBJA 4FERA 4JLRA 4ZW6A 5L2KE 2F53E 4Z6AT 4DHLA 1WO2A 2C5DC 2V2WA 4K5OA 4PJ9D 3LIUA 2P24A 2HJFA 4G8GB 5E1HB 3CK0L 3G9AB 3KNBB 3MCG1 4YC2C 3V10A 4JVPA 1XXFC 5AW5B 4LAJH 2ZSVA 3L3DA 4L37A 4ZMZA 4PJ7A 4JPVL 3I9IA 2QQLL 4LCYB 4DO5A 3GSWB 3D3VA 4NZFA 2APVA 1AXTL 2TAAA 3OTTA 2CBOA 1QTYT 1Z6JT 3PXJA 5AAMC 5TPWH 3P54A 2HFFB 4YDJB 1UASA 8PAZA 2JQAA 3OR6A 2JF1A 4OQTL 4BE5A 2ZYSA 1NFDA 3DHPA 4QYAA 3QIBC 4ONGL 5J06A 2V0AA 2QZ5A 3KM2A 4FQXD 4XP5L 4X5PA 1UG9A 2HTLD 2CM5A 3NJVA 3SOBL 1LK2A 1G1YA 2NY4B 1T0NA 3IBEA 4WTZG 1F2XK 3J7HA 1BM7A 1G7JA 1G7PA 1BQKA 1YEJL 2R0ZL 4HS3B 1ES0B 3NVQA 2WW8A 2B1AL 3JWDL 1BVNP 2VQTA 4P59H 5JMOC 3C6LA 5DZ9A 4OKVB 3STBA 1BZ9B 2HH0L 4JLRB 1GVIA 4XHJD 3ZL4H 2V2WB 2W9LA 3DURA 4PWJA 4JRLA 5BXFB 1JF5A 2P24B 2HJFB 3JWOH 4J4PD 4DZBA 1P2CA 3GLAA 4WNSA 3E6FA 2VZTA 5IVZB 3BPCA 4F57H 1PSKH 1FPTH 3KPLA 4UAHA 3L3DB 3QYNA 2GIXA 1SPDA 4ENEC 4PJ7B 2EDMA 5EOCH 2N1KA 1XCQA 3D3VB 4MZIA 2R1YA 2YIHA 1FL3A 1GOFA 3FCTA 4KJWD 3MYZA 2H2SC 1N7MH 2OI9C 4NKDA 4LDEB 5EZIH 1KBPA 1SMDA 2X4OA 3BAIA 1R5IA 1E4WL 3CFNA 5I0ZA 4G6AC 1AACA 3ARVA 4FI8A 3N44F 4Z95H 4GLRH 2WVTA 2IGLA 1LK2B 4APQD 5IQ7H 1QBML 4NC1C 1M7DA 1SXBA 5T1JA 5DSCB 3B2VH 1G7PB 1G7JB 4EN2A 3K74B 3KWUA 4RFEB 4FA6A 4P2AA 2UUDH 4Q9CA 1PS3A 2OMVB 2W07A 1CFNA 4XX5A 5EU4A 2BP0A 2ZAIA 2QHRH 3DURB 1OZTG 1M53A 3D06A 3FCBA 3EXLA 3UJIH 4NP4H 5CLTA 5B38G 4XPHH 1P2CB 5DLML 3JBG7 3UFIA 4YHNA 3E6FB 5I75B 5FOBA 4KUZH 3RGVC 1XSIA 3BPCB 1WFMA 3EH4B 1H8SA 3KPLB 4ENZA 4KHXL 2E6PA 4JFFB 4F37K 3HAEA 1XCQB 3U1PA 2D03H 2R1YB 1FL3B 4XCCH 5D72L 4NKDB 5FFLA 3GB7A 1JTTA 2ADIA 5C2BL 4YK4B 2C3GA 2QPFA 4YUEH 1DVFB 1I1FA 4EE2A 1SBBA 2X2UA 3HZ3A 4Z7OE 3ZZQA 3B43A 3BESR 1OT2A 3NGBB 4HLEA 3O8XC 4TMPA 2DQIH 1VFBA 5D7JD 3RPKA 1LDPH 1M7DB 4JZNA 1AZNA 3DOHA 4PWFA 3O4OC 5KYUA 2CLRB 2GBUA 4JW3A 4BEIA 3NCJH 1PD1A 3PCYA 4BUQA 4AK1A 4PI2A 3GQFA 2VDRH 3H9SD 2W07B 5DVMA 4JUTA 5EU4B 4Y5VA 4NCC1 35C8H 1CDIA 3VWJA 3WIFA 1ADQL 5LLIC 1VAHA 3F85A 2HN7A 1LYQA 2J6EH 2YSSA 4UT6H 7FABL 3DHMA 5AW0B 1INEL 2R0LL 4YHNB 5FOBB 4PJ7F 1RUKH 3OZ9L 4S1SL 3LDBB 1J48A 1CZ8L 1DUZA 5L8KB 3U9PH 3MTXA 1HQ4A 2QELA 4YSAA 1N3NA 1WZ1H 1XCTB 1YEEL 3MJ8B 4NOBA 1ZGLP 3L2MA 3HAEB 4H0HB 3L7EA 4DQOL 3LPGA 2BNRD 4UNVA 4MB5A 1OAJA 2R4SL 1M1SA 3EYUL 2BP8A 4AQEA 1T2JA 2JE8A 3HTLX 3LKNB 5HVFB 3GB7B 2ADIB 1R46A 3KLSA 3NJNA 1AP2A 3SGJC 2NYYD 5DHXB 2VSMB 1ZVYA 4FULA 4O4YL 2FEDC 4B60A 3QQ9C 2P44B 3L17A 1WBXA 2EE6A 1EEZA 3MODL 3ILPA 1KCKA 1JMZA 5KYUB 5JO5A 3CZGA 3SDCC 1CE1L 3C60A 2AK1H 2AEPH 5DJ2B 4KPHL 4X7DC 1NH6A 1WT5C 4HGWB 3WBDA 3ZE0B 4DK6A 5J1SC 1GYWA 1S7RA 4KGLA 1WGOA 3CFUA 4UT9L 2HRPH 3M1BA 4BFGA 3SYAA 3H53A 3VWJB 2DYPD 2Y06H 2ZUUA 4XPAL 3WIFB 2HN7B 4F5CE 2YSSB 2BW5A 2VMEA 4NHUB 4NNPH 2KS0A 1HQ4B 2EEFA 4M3JA 3L7EB 2WN3A 3RWDA 5A1AA 4AQEB 1YEFH 2BP8B 2VW6A 1MI5E 4I0PC 4BFJA 4BWWA 3OJMB 4KKCC 2IF7A 2O1AA 1JHTB 4IBZA 3UOAB 1ZKAA 1IBGL 1AP2B 1EGJA 1XEDA 3N1FC 1N6QH 2R56L 1Q9KA 4NRXB 3OG4B 1SY6A 1QUPA 1MCCA 2G9HA 3GRWL 4JHVA 1JGVL 1OCWH 3JWNE 4TQHA 3ILPB 3UG4A 2L7JA 1QFWM 3A4DA 4YPJA 4E5XA 1TFHA 5JO5B 3TPKA 3DTXA 1QRNE 3VG0L 1IKOP 1MJUH 4KTGA 3W0WA 1ZEAL 3CDFA 4GRWE 2F1EA 4KJQC 2BCKB 3M1BB 3SKUD 1QA9A 3B4NA 2FLMA 2LLNA 4GI6A 5DUJA 3GBEA 1RIHH 1FNHA 4JKNA 2CJSA 2GBAA 2CGRL 1FCCA 4MHHG 4P3CH 4ABVA 3OF6D 3MN8A 3TVMC 3BAJA 4GAYA 4JFUA 1A6WH 5DFAA 2HUHA 5D5ME 3I6KB 3G6DH 4MQTB 2ATKA 3OLEA 1NGXB 2NY6C 3R0MA 4ABWA 4DK3A 5CGYD 2XJKA 1XGUB 3BCDA 3RWDB 3FFOA 1MFEH 2LW3A 3MI6A 3H7BB 4ZTPH 1A7QL 5DUML 4U3CA 4PS4H 4LCVA 4G71B 1EBAA 1OP5K 5CU9A 3FU5A 4EN3C 3ZKXC 3JWDC 1Q9KB 2X44D 4WK4B 2G9HB 4PGCA 1N12A 4RFOH 4XCNA 3EJTA 3T09A 1OSEA 4KI5F 3ZE0F 3BJLA 2FO4A 1T20B 3O9WD 1GS8A 4AMWA 1IM3B 4XPFL 3DTXB 4XNUL 2I24N 3VQ2C 1JWUA 5C0NC 4U1IA 2L7UA 2XQYK 5IQ9B 1URZA 1YJDH 5AB2A 4KKBD 1KPVA 4WW2A 4X50A 4EQ3A 4OZIA 1Q1PA 2XWTA 1QA9B 3SE6A 5BO1H 3DHUA 2QMKA 3ERXA 5D93B 4JQIH 1LEKA 4K2UH 2YAPA 2ZKWA 1WZKA 1IBFA 4GAYB 5AVUB 4FQCL 4TQIA 3DDGA 1T1ZA 4H4NA 1SHXA 3Q5TA 1YNLH 4WUUA 4CU8A 3V0FA 5DVLA 2IALA 5B1AB 1TR7A 1FF5A 3VGAB 4JFDE 4YFLF 2VO8A 1ZANH 5GS0D 2VUYA 5IP4A 4PLJD 3CFCL 2CK0L 3EOBA 3KPMB 4I9WD 3QJUB 4U7MA 5F9WB 1FQ9C 1KY7A 5FWRA 3VXUB 2NTFA 5FUZH 4KQ3H 5JHDD 1CLZL 4M48H 4PGCB 4TN9A 4XCNB 4PP2A 3TZVA 3NEEA 5GRUL 3HC3H 2BIPA 2H45A 1D6VH 2FO4B 3MNWA 4I88A 3TN0D 4B5ZA 4GG6E 4TNWF 4U1IB 1XF4A 3K6DA 2VERA 4HW6A 2YPVA 4TS6A 1YEDA 4W4OC 1KPVB 3U6XA 4DKFH 4WW2B 4I3SH 5HD8C 1HEZB 5BMFH 1AJ7H 5E2JA 2L7QA 2RJMA 3QCTL 3M46A 5B1JC 2RR3A 1LEKB 2NMSA 3P40A 5I0DA 3O11A 3OB0H 5JR1L 2CR0A 2K6WA 1E4XI 2RTTA 2G3MA 1RHFA 1G7QB 3T6XA 1DQLH 5FYKE 4DETA 4ODTH 3DBXA 4MJ2A 4KOCA 3REVA 4G83A 4J3SA 2OYLA 5E6RB 2BXYA 4Q0XL 5I6LA 3QEQA 3U30B 3TBVA 2ZE0A 1KFAH 3EOBB 1UOWA 5CP3H 4J23A 2A73B 2A4ZA 5AUMA 3E8UL 4KQ0A 4ANKA 9PCYA 1QSFD 3EJCA 4QRUA 4AG4L 1S46A 3BMVA 2ZD0A 3CTTA 5MERB 2YAMA 4PRNA 1XH2A 1EZVX 2DWTA 4AL8L 1TJIL 3MNWB 3V0DA 4KDTC 2ZKYA 3KPRD 5SWSD 2BY3A 3RTQA 3ULVD 1NIBA 2YPLD 4Y16A 5FW8A 1BLNA 1YEDB 1J1PL 4YJZL 2ADYA 1U2CA 4ZMYA 3UACA 4X5XB 4HV8A 2WQUA 2O30A 5C0AB 2JI2A 1NDTA 3TYFA 3O11B 4WU5A 4FXGC 5FYLD 3LVEA 3C5ZC 4KXZI 4PV8A 3SPIA 4H8HA 1FRGH 2P48B 4JQVC 4WY7H 2YKLL 3MRMA 4BGDA 2WXMA 3HI6H 4PGDB 2BRQA 2OZ4L 2B2XL 3RRQA 1X4YA 3MRHA 2VQ1B 3FU7B 2W65A 3MV7A 3SDDD 5IB3A 2A77L 2WIIA 3BGFB 3OVUB 4H8PA 3QEQB 1AC0A 3CSPA 1JGLH 3TBVB 1R3HA 3EZJB 3WY4A 1UXMA 5ISZA 4D9LH 3HHSA 5BS0D 3C8HA 1EO8H 1OSZA 2GEEA 4JVUA 2FGZA 3QWNA 4Z0XA 4MMZB 4W6YB 3PV6B 1UCBH 2ROYA 4IRZL 4QRUB 4ODHL 4ZO7A 3RZCD 1P7QD 2YGNA 3IRCA 4J6IA 4LKXB 4PRNB 1OAKL 4YXKH 1JZ2A 4XN5A 4WW2F 1N10A 1RZ7L 4KNTA 4L9LA 4ZW8A 1CTMA 4AK2A 3RTQB 5FM4A 2R0KL 3C75A 1JI2A 1I75A 3K3QA 4N85A 5I16B 2DQCH 1FZJA 4JRXB 2WTPA 4HV8B 4PGBA 2UZPA 4G6ML 3KYMA 1UKTA 2BSRA 4RA0C 4W6WB 4WU5B 1IBZA 4Y9BA 4PV8B 5KYXA 2AERT 3MRMB 1KGCD 3B3IA 5TFSL 4KX7A 2ZXCA 3ZE2E 1KB5A 4OCRH 4U1NA 3RX8A 3BWZA 4XAKE 4PGZA 4CILA 1A9VA