1S4MA

Crystal structure of flavin binding to fad synthetase from thermotoga maritina
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
277
Chain Sequence
b'MVVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVHKFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRPTDARNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKFDSIEELKAAIDQDVKSARNMIDDIINSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of flavin binding to FAD synthetase of Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 82
structure length 277
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1s4mA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1s4mA01
4ZCRA 5TGTA 4EFKA 3CVWA 1KH1A 1J20A 2AZXA 3IODA 1MC1A 2A86A 4R2MA 1NB0A 3FH0A 1JMVA 1F9AA 3A2KA 3G6KA 4MW2A 1WXGA 1XNGA 3IOEA 3NV7A 5H16A 5LFAA 1O95D 3LOQA 5KCMA 3OP1A 4ND6A 1VBMA 3DLAA 3G59A 1T6ZA 1IQ0A 1J09A 4NDAA 4DLPA 3H97A 3CVVA 1FYDA 2GM3A 3UMVA 1EXDA 2PZAA 3DPIA 3H05A 2A1TR 3KT8A 1KQOA 2PG3A 4CT0A 4MUGA 1NUSA 1GTRA 1O97C 4KR9A 1QU3A 1JIJA 1MAWA 3Q4GA 1M8GA 1GLNA 2Z09A 2CV0A 4MULA 1OWLA 1V47A 2J07A 5DEOA 1QRSA 3AL0C 1WXIA 3IDFA 4XFJA 5K0TA 4ZCQA 1NP7A 1X8XA 3FI0A 5DASA 3HGMA 4EF6A 3SDBA 4DDHA 2VBSA 4ZCTA 4RUKA 1TEZA 5J58A 2A1TS 2DUMA 1NUQA 2QTRA 3FOCA 1LW7A 2QUKA 2JAXA 4PBRA 3TZEA 1N2IA 1N77A 1SURA 3FNRA 2DEUA 4A91A 2NSYA 1KQPA 4Q93A 1M8JA 5TS2A 1QQTA 2V0GA 1QU2A 1IRXA 2IJGX 3MLBA 4NATA 4MVXA 3H99A 1N08A 1WOYA 2R5WA 4BWVA 1EE1A 3KT6A 1WY5A 2A4MA 3G5AA 4XSVA 4YP7A 5FO0A 1JILA 4J76A 2X3FA 1LI7A 2PZBA 3BNWA 4ZCPA 3F3MA 3PNVA 1OWOA 1M1ZA 1G8FA 4EG8A 1OWPA 3ILVA 4HJRA 3K32A 3ZUGA 3SEZA 1T9GR 1NURA 1YIAA 3PNYA 1BS2A 2Z08A 4MW9A 3GMIA 1X6VA 4AQ7A 1TFUA 3BL5A 1M8PA 4OUDA 1NZJA 2BTEA 2E18A 3OTWA 3HZRA 4OJMX 4JXXA 4ZT7A 3AFHA 5DB4A 4L2IA 1PG0A 1D2RA 1N2GA 5HG0A 1LI5A 5LM3A 4AS1A 1N3LA 3JXEA 3IVGA 4TS1A 4EGAA 1NB9A 1I6MA 1QRUA 4ZCSA 1F4LA 4MW5A 4WNYA 4MUEA 1N05A 1NUUA 3MLAA 2YWBA 3IMEA 1EJ2A 4PY2A 2HGZA 1U3CA 3UK2A 4U7JA 5J59A 3VRHA 3AG6A 3CLTC 3ZJTA 1EFVA 1COZA 5HUJA 1EUYA 4GRIA 4UZEA 2E89A 1N2OA 1H1TA 1VLHA 3SEQA 2XRZA 3RK1A 1JIIA 1KORA 3KT3A 4CDMA 1JEEA 2WB2A 4HK4A 2D13A 2YXNA 1ZUNA 1TQ8A 3IUEA 1N2EA 1WXHA 3FIUA 3AKZA 1YUNA 3CVUA 1H3EA 1N07A 3ISJA 3Q10A 2CSXA 1GTSA 4R0NA 1JZQA 1ZH6A 1YIDA 4MW1A 5F23A 3CVXA 1S4MA 3HMQA 1O5TA 4I6GA 5FNZA 3IUBA 3Q12A 1WJGA 4KKVA 2EL7A 4ZT5A 1F7VA 3VU8A 1EFPB 3CA8A 3ZXSA 2E0IA 1TYBE 2QTMA 4JFAA 1M8KA 4KPUA 1NSYA 4XFDA 2YWCA 1N75A 2A1UA 4G5YA 1MB9A 3HL4A 5TEWA 5LLTA 3C8ZA 3L92A 1O6BA 4WSOA 3MUEA 1WZ2A 1OBCA 3LE8A 2VTBA 1WKBA 1TYDE 2PFSA 3N05A 1QJCA 1YUMA 1JIKA 5IHXA 3CLSD 3COWA 1O95C 1XJQA 3RJZA 3TQOA 1ZJWA 3A05A 3FETA 3PRHA 3AG5A 1NI5A 1QRTA 4DNXA 5KWVA 1U3DA 2DERA 2D5BA 3UC5A 1EFVB 2D54A 4ZT6A 3CLUD 1O96B 2TS1A 1NUTA 2VBVA 2WQ7A 4MW6A 1U0BB 3ELBA 2VXOA 1P4MA 3PNBA 3ND6A 1G8HA 3ND5A 2X0KA 3P0JA 4HPWA 1K4MA 2A84A 3RFFA 5HUHA 4KR6A 1MB2A 1VBKA 1K97A 4NAUA 4PBTA 3FY4A 3HFJA 3CLRD 1YI8A 4NAHA 3M5WA 1N78A 5H7XA 4K03A 2QJTA 3H9CA 3NBKA 4J75A 1PFUA 2QTNA 3QE4A 1K4KA 1MAUA 4YMIA 4EG5A 4G5FA 1O0CA 1IVSA 2O5RA 1JGTA 1N2BA 3IOBA 4MAFA 1N06A 1TYAE 1Q9SA 1WXFA 2C5SA 2QUJA 2CFOA 3QTTA 1WQ3A 3X1KA 4E1AA 1MOPA 4F4HA 3AIIA 2DXIA 2A1UB 3UY4A 1I6LA 3A04A 3RBAA 4JXZA 4MUNA 4ARIA 2J09A 2BYTA 1K92A 1IH8A 4RPIA 1TYCA 2P3MA 3CLRC 3INNA 2Z3VA 3N2YA 3FDXA 1GN8A 1Y42X 5TRDA 3MMXA 4QREA 4CDNA 1O0BA 1IHOA 1I2DA 4ZT2A 4MLPA 3TS1A 2CYAA 5A88A 1KR2A 1VBNA 2PIDA 3A4IA 5K0SA 3N9IA 4MUHA 5KHAA 3NBAA 1N2HA 1J1UA 2AG6A 3COVA 1UFVA 3P0HA 1OD6A 1VL2A 3COZA 2CV2A 3IOCA 1OWMA 5FO1A 1NUPA 1WQ4A 1KP2A 2PXHA 1A8HA 4YBRA 3IMCA 1N1DA 4YP6A 4MWDA 1B6TA 3TNJA 3H9BA 1KAQA 1IFXA 3IVCA 1O97D 2X1LA 5BNZA 3DV2A 1IQUA 4MVYA 4JZYA 2CV1A 1GZUA 4MVCA 2J4DA 1Q77A 2ZUEA 2NZ2A 1PFVA 1KKUA 2H2AA 2HMAA 2HZ7A 1KQNA 2GKSA 3ZJVA 1OWNA 4ARCA 1XNHA 3LCJA 3HV0A 2G36A 4MW7A 3SYTA 4OUDB 1Q11A 1RQGA 2V0CA 4ZT3A 3TZLA 1IQRA 1J1ZA 1OBHA 4MUFA 4MUJA 4R2LA 1T6YA 2B7LA 1U7XA 3D6UA 4L2IB 4U63A 1N2JA 2O8VA 2QUIA 3X1JA 2I1LA 4DJAA 1U7DA 4K0RA 2QJOA 1PFWA 3P0IA 1O94D 4MWEA 1KH3A 3DO8A 3ZGZA 1M8FA 4MWBA 1CT9A 4Q16A 3CR8A 3CTAA 5TEVA 2RD2A 4FZJA 1F7UA 4F3RA 2WSIA 4ND7A 3FHJA 4EG1A 1KP3A 2VBTA 2ZP1A 3FWKA 1MRZA 4H3SA 2GOYA 4EG4A 4PBSA 2XRYA 4QRDA 2OYNA 3KT0A 3QTBA 4X0EA 3VGJA 3RK0A 4MWCA 3ZJUA 1J70A 4CQNA 1MBZA 3U1VA 1MJHA 2DLCX 3IMGA 4MUKA 3S3TA 1Q15A 4UZFA 2DPLA 3FG9A 4EG3A 1ZH0A 5EKDA 4KR7A 2JANA 3PXUA 4S1OA 3UOWA 3X1MA 1I6KA 1ULHA 2DR2A 4DDMA 4G6ZA 1R6UA 1O94C 3D6VA 3SZGA 3ZIUA 4DDKA 1G59A 2ZUFA 3CLSC 4HJXA 1JHDA 2CYBA 4GU5A 4YP5A 2EJCA 5J5AA 1H3NA 2E21A 2A7XA 2CUZA 1JZSA 2H29A 2JA2A 2QJFA 4MW0A 1M83A 1J21A 3CLUC 2RE8A 4JYZA 3SZ3A 4NZPA 3CLTD 3ND7A 3MXTA 4KPUB 1NYLA 5IJXA 3COYA 4ZT4A 2WQ6A 5AHWA 1GPMA 3SP1A 1QTQA 1EFPA 1YULA 4I6EA 4MQ6A 3TQIA 1R6XA 2VTBB 2J08A 3GUZA 4I6JA 4MW4A 1R6TA 4NX2A 1FFYA 4U8HA 4QBTA 1Q19A 1PG2A 2A88A 3K9WA 2CYCA 3CVYA 1GAXA 1PFYA 3E27A 1HYBA 5A8AA 1V8FA 1DNPA 2X1MA 1JECA 2CT8A 1JEDA 4MUIA 1WXEA 2QUHA 3P52A 2J5BA 5DK4A 1G8GA 2OQ2A 4EG6A 4P2BA 1T6XA 1KAMA 1H3FA 5A89A 1T9GS 2YY5A 2PZ8A 1XNJA 3ZXIA 3IH5A 1EUQA 2AKEA 1P7PA 3RHSA 2VBUA 3I05A 3N8HA 1O96A 3IVXA 1QNFA 4EG7A 3GLVA 2IELA 2IP1A 1KH2A 2OV4A 4MVWA 3KFLA 2DETA 1ILEA 5JBNA 3L93A 4DE5A
chains in the Genus database with same CATH superfamily
3FYHA 2QX6A 1K8ZB 4G81A 5IEBA 5C3MA 3L8YA 3M6LA 2HRBA 5BURA 4NCBA 2IYLD 3MA0A 3UNXA 4DABA 4ENWA 3V97A 4Y2JA 2VP2A 3ZLTA 2C96A 5A9RA 1QHGA 1MX1A 3GB9A 3OE4A 1Q3HA 2DU8A 2RJOA 3NV7A 5ERGB 2DT8A 5LFAA 1IB6A 4R1LA 3D4NA 2RBKA 4KAFA 5BN4A 4HUQA 5JSZB 4ROSA 5CEJA 2PMCA 3AB3A 1JFLA 4F8YA 2O8EB 4HLDA 4REQA 1QHEA 1Q0SA 2JI6A 2OBSA 5LZ5A 4H7PA 4J4HA 1CUJA 4TMXA 2ZB7A 1WNTA 2GJ9A 3H97A 4IPTA 1KZ6A 2AN1A 2NO0A 4JQCA 4RD4A 1LPOA 4RQAA 2GN1A 1XEAA 2HEIA 4KQ6A 2ZRQA 1DE0A 4DY6A 4RPGA 3MS7A 2O1XA 3UHJA 4O2RA 4M1MA 3WO1A 4QGSA 3K30A 1WU8A 2LDBA 4DWWA 8OHMA 5K8VA 1RZUA 3AILA 3MGKA 2M1XA 2ZE5A 4RYDA 1O97C 1B2LA 1EVZA 1LF0A 1ZJJA 2F3SA 2GO1A 3Q4GA 4JJ4A 2OB2A 4CLRA 2CV0A 2MMGA 1K08A 2WIAA 1GILA 3D3NA 2E6UX 3HYLA 3IQEA 3LWNA 1PR3A 5I8ZA 4P4NA 4B84A 2JC3A 1MIOB 4EPWA 1P0PA 4IIGA 5AKGA 3FI0A 5FIUA 2BLNA 1B0AA 4I4TA 3SDZA 5EZ5A 3R4CA 4M0UA 1UC9A 2A2ZA 4LJKA 4P84A 4GP6A 3ZV6A 3JQDA 3B36A 2Y0DA 2C2ZA 4IF4A 4XKJA 1C5KA 4M0MA 3U3ZA 5JSQA 1CDZA 2ECQA 3I09A 1S8OA 3K9LA 1RNLA 1MNAA 5JD6A 2LCIA 1MPXA 4FVTA 1H0KA 4KRFA 2DUMA 2QTRA 4HNRA 1N1GA 5C8XA 5EN4A 1ZI8A 4PV7A 1C4XA 4GPAA 4CL0A 3CZQA 5AVQA 1ZD5A 1YZNA 4KNYA 4IGAA 4V0QA 2VDUE 4AJ1A 1E7YA 1RVDA 1KS2A 1ODKA 1ZPDA 2BEVB 4X93A 3RFXA 1VL0A 2Q4BA 3LHDA 3ZLVA 2JATA 1XMJA 3PC8C 4MVXA 1N6OA 1OJ7A 3PDJA 3T34A 2ENWA 4A4DA 2AEMA 1CUIA 3HLTA 1U3TA 1LW6E 3VMMA 3N2KA 4CMHA 1ESCA 5AKIA 4RZXA 2GFHA 4FXOA 2XA1A 1C3XA 1SOWA 1A72A 1N9GB 1I33A 5FNVF 4JP5A 3S8YA 3HN7A 1P4GA 3TSZA 5BWLA 1Z4MA 5UKDA 4MS3A 1NXWA 1X0VA 1R0BA 2G88A 1YC2A 1XXHB 5JY6A 3W3ZB 5EKSA 5C53B 3ZUGA 2ZVPX 3K16A 1YE5A 1I01A 1YIAA 3F5QA 3H3JA 2JFVA 5HM8A 1FLDA 1Z37A 3C7CB 2PKWA 1D03A 1M1YA 2PH1A 2PT5A 1ACJA 1X6VA 5EWLB 2KVOA 1ENOA 1WCWA 3UCEA 5TF4A 1OIWA 1V8BA 1E6KA 3AM3A 3BN3A 4N65A 4BNIA 2VNKA 1NGSA 4DEXA 4LQLA 3WICA 3QLTA 4L72A 1HEUA 4PC6A 4PG7A 5FBWB 3DOOA 3DZ8A 5HG0A 4QNRA 5BYKA 3IIKA 1Z4QA 4NE7A 1I14A 1S3FA 2Y92A 1KAGA 3AVPA 1D04A 2UYOA 3FYUA 4IQ8A 4ZO8A 1TO1E 4WLNA 1IIBA 3DR3A 4WESB 4GMGA 4IG4A 3EXEB 3IPYA 3MLAA 5CA1A 1XJ0A 2ZJ4A 3LXMA 2GXUA 4JLVA 1SXJC 4RJKA 1U65A 2JIOA 4DLRA 3PHLA 3S4YA 3S55A 3MTAA 4BQFA 5HZKA 4YY3B 1XZAA 2G0AA 3QLUA 1KC1A 3TAHA 1OFTA 4NQZA 4Q7KA 3UTCA 3GA0A 4UZEA 1XAHA 2E37A 2W7TA 2HMTA 3L7AA 1H1TA 4FE4A 1TM5E 4DV1B 4U2DA 3K1YA 1KI4A 4TROA 4E21A 4ZDIA 3ZTTA 3H5VA 4IDGA 4GBED 4XGKA 2BEWB 3DAYA 3WLFA 3F71A 4OJTA 5AVSA 3E8XA 3M6AA 4V1CI 3ILHA 5JC1A 1RM4A 1CQWA 4L9SA 4PZAA 1GTMA 1XKQA 1FRNA 2R96A 1B76A 1XZFA 3PUKA 4ALJA 4UBKA 2VPQA 3AI3A 3ASSA 2AMLA 4AC9A 4EHFA 2XD4A 1EJBA 5JRJA 1DG1G 4HS4A 4YPFA 4BMCA 3MJVA 4RVCA 1Y1TA 4KFUA 2Z57A 3DBHB 4MW1A 1SVMA 4WEQA 3L7LA 1Q83A 1UBSB 3CCEB 4Y2XA 1TVCA 3VSEA 3DZGA 1DKQA 1JS1X 3DV9A 3GVXA 1LLQA 1H2HA 2X0DA 3FN4A 3WYNA 3Q12A 5L3QB 4M3NA 1MHTA 1C3VA 5HKOA 1V8OA 1EFPB 1PGQA 2J59A 2NZXA 2PTGA 4HNHA 2E0IA 4JLDA 2FW6A 4PLGA 4QUBA 3F74A 4YT4A 2NUPA 3HGQA 1OLUB 1KDTA 2IYSA 3FMVA 2YWCA 5AK5A 4C6RA 1NQTA 2ET6A 4XASA 4YR9A 3M1IA 1Z5GA 4ZDKA 3VH1A 5LVAA 3VC1A 3C8ZA 3OE5A 2AOTB 3N75A 3IV6A 2VDQB 3TJRA 4HYEA 5LMZA 1EMDA 2JZOA 2HPHA 2PR7A 1J8VA 3PJGA 1GAEO 4XCQA 4JASB 1KVQA 5C35A 2C88A 3L2OB 3HCWA 5IHXA 3W3AD 3B3FA 3CLSD 1NN5A 3LPCA 5K2MA 4BRZA 4G07A 1NLZA 1A4XA 2FG7C 2VJLA 4XQ0A 2JHFA 3MJHA 3HA7A 2BR3A 4P4UA 4YS6A 4DNXA 4BATA 1OH7A 1W48A 4AJJA 4G5HA 3CLUD 4PTLA 5CYPA 3WNDA 521PA 2A7QA 3PV0A 2BM9A 3A8KA 1AGYA 2DBRA 4C4TA 1P2SA 2D2VA 4PE5B 1IG3A 1FP1D 1O6CA 2JAHA 5ALXA 5JG7A 1FMLA 7REQB 1MJ5A 3RVQA 5F98A 4LGMA 2Q1SA 2XHEA 1HFWA 3FKJA 5HXAA 4NJEA 1E3QA 1R12A 4LMRA 4QVKA 1LU9A 2C7RA 1UT6A 4HFNA 2FSFA 5LKRA 2VEDA 3ITKA 2LGJA 2XNDA 4R0MA 4PBTA 1FPMA 1JLRA 4PHGA 2WF8A 4Y2VA 3ZHCA 4EY3A 2ZRGA 2B37A 4HRYA 2I6TA 4WCFA 4J0DA 3LBFA 1X77A 2JLRA 5KX5A 1PWYE 2OBYA 4FS8A 4IDPA 1NJ8A 4RADA 3KB2A 1CQJA 3C8DA 3M83A 1BOOA 4PCUA 4DIMA 4BLPA 5BNTA 4HTFB 5I01A 2M6RA 2EW1A 2IBTA 5DIFA 2YN4A 3PE6A 4YMIA 5CIYA 4OJKA 4BXOB 3VSDA 3W05A 3ND8A 4RELA 1D6JA 3NTRA 1KJQA 3BX1A 5F2NA 1L5QA 5CDFE 2FX3A 1V11A 1ZVJA 3QUCA 3I9OA 3WZLA 1NMQA 2IHKA 1U04A 4YONB 3I9LA 1Y89A 1IEQA 2BKVA 5DE3A 3SLDA 1HQDA 4MO9A 3SYKA 1CUYA 5I7EA 1PK7A 2XCUA 3I2JA 4F6LA 3ZV4A 3BIFA 4UHFA 4YMHA 1KK1A 1KYQA 1NVXQ 2EDCA 5HA5A 5ERXA 1R3DA 3WFIA 1TT5A 3ABSB 1T10A 1LQ2A 2WSLA 2HFKA 10MHA 3GQBA 1P2DA 3RSQA 3QXJA 5GIPE 2HA2A 2DG2A 3TLMA 4QPCA 1JKFA 1K92A 4I1YA 3RT9A 1MC5A 2QVLA 5E4TA 1FUEA 4LZLA 2IIPA 5B1SA 2J9ZB 4NCNA 4Q3DA 4DCMA 3SLGA 1RAAA 3MJFA 4C6TA 1JIVA 5EUQB 4Z54A 4RKWA 5IJWA 3AGPA 1A2QA 1BJKA 3AEQB 3JATA 2J9YB 4RFSA 3L6EA 3UHFA 3UUFA 3K0SA 1M1UA 1ZHOA 3Q9NA 1E7RA 5EQTA 5GM1A 3AV0B 3JQCA 4XEHA 4BNWA 1JJVA 2AFIA 4Q3CA 4ZVMA 3NVMB 5C4MA 4HDSA 5I9NA 3K72B 4A0HA 2QG9A 4M0CA 5G0TA 4H4DA 2H31A 5CP8A 3T52A 4IDBA 1NI4B 3A3BA 3H42B 1VL2A 3I8OA 1GLGA 5DSXA 1EDZA 5AOVA 1X39A 1MEJA 3BF7A 4DNQA 4ZI3A 2CV2A 3NBZC 2JLYA 3GJQA 4II3A 2DPHA 3FZYA 3H7AA 3C3EA 3F7OA 2BFFB 4B3BA 4L7VA 2Q8NA 5FWNA 3CR3C 5CFNA 3BXZA 4GIBA 4RM2A 3M7IA 1K06A 4G3XA 1O97D 5ETJA 3QKTA 4L16A 1Y6JA 1PP4A 1F51E 3SFVA 4QRHA 2NO7A 3L0OA 1Y0YA 1UBKS 2I5PO 3KLPX 5IWCA 1T0PA 3H8SA 4CKXA 3T61A 4NBNA 1KRXA 4LJRA 2DJIA 2GRJA 4MMXB 4BFLA 3PDWA 3U60B 1SVIA 2CUTA 1CZOA 1G2QA 1S1MA 2HTEA 2XCTB 1T4BA 2BEUB 2O8DB 4HCJA 2I6FA 3ZDXB 9LDBA 3VYRB 1XNHA 2OCLA 5GADl 4X84A 2H00A 1ZCZA 3KCNA 5CNKA 1NZFA 1Q11A 2QBYA 3H1TA 3OM0A 4JJGA 2BMWA 1T9AA 3HKDB 4MUFA 2GXAA 1QF6A 4MHOA 2ZVDA 1X19A 1Z0ZA 3G9ZA 3QIVA 1XZKA 4K6HA 4N8SA 4XW2A 3ZZ0A 3KU4A 1Z82A 1V25A 4DR6B 3S2FA 1DMSA 1OXMA 1YR2A 3RUAA 5DV9A 3RSSA 4D6XA 2ZUTA 3VHQA 2WYIA 4DAEA 4EITA 4RTMA 3ZQKA 2EFEB 1KH3A 3ZIAA 3RT7A 2ORVA 1YWGO 2DT5A 3EGIA 3MK31 1P9WA 2ZXIA 2PD6A 3L41A 2B4TO 3N2NA 3NKLA 4B2IA 4CW7A 4AO6A 1PI3A 5IF3A 1H9CA 2UUPA 4ND7A 4JLKA 5DHRA 4ZO7A 3P9PA 5DLPA 4F4FA 4HB3A 4WNIA 3KYDA 2A9RA 3HB4X 4DQUA 4OFXA 4RPJA 4QNMA 4YLYA 1XPOA 4P35A 5CAEA 1B8PA 2OZEA 3ZJUA 4RK0A 4RHEA 1AGNA 1JHVA 2YHBA 3H9JA 3QF7A 2NUTA 1TOAA 3OO0A 1KI3A 2E4UA 3IMGA 1S5PA 1GXSA 1PUIA 1T2UA 2RKBA 3BJIC 3BM5A 3BCSA 3FF1A 1P7YA 3HJGA 5U4XA 1ZUIA 2DPLA 3SPXA 4EG3A 1YJBA 2JIRA 2XI4A 1QRRA 4JBYA 3G2LA 3T06B 2O52A 3KZKA 2VEOA 1G5FA 2HM7A 3V1KA 4LV5B 4PNZA 4EGSA 3UGKA 2FMHA 3P2OA 1SIUA 3W7VA 2JNWA 1MO2A 2WZBA 4MNTA 5LDGA 4IUBS 4AIRA 3KOYA 1R7RA 5AVWA 1KJYA 1ZVQA 4DMMA 3EIXA 3T15A 4GE3A 4X7CA 4DLLA 1HORA 2ZIWB 4NJMB 3OJXA 2ZUUA 5M3BA 3WXBA 2VHYA 4RSMA 5I9IA 3W5IA 1GLVA 4ZOLB 5DKFA 5A3JA 4JQOA 4GO1A 2PE5A 4CQMB 3ZKAA 4RF5A 3W5AA 1ML3A 3KJFA 3AOEC 4ITRC 4MUXA 5LOVB 4ZHQA 5BSKA 1I3OA 3FOWA 1YJ8A 4G0QA 1SXJD 2UU9B 3DSRA 5DULA 3JALB 4KNVA 1A5BB 5KINB 5K3BA 1TAUA 1Q7RA 3JQBC 3KWMA 4V0NA 4JEIA 2PNJA 1SRRA 1T3GA 2BEJA 3CKYA 3FNQA 3JR7A 4KQ2A 5GM2A 4WLOA 2ZS9A 3B5EA 1Z2EA 4EPYA 4BMOB 4JT4A 4QLBA 4LSGA 2ZM5A 1PAUA 4J0FA 4ZRMA 5BRJA 5EJ5A 3W4KA 2ZZKA 4MRSA 4D45A 3X1DA 3D4LA 3DBRB 2AK2A 2VP5A 1X7WB 2WINI 3QSGA 5DWVA 2BY4A 3FTFA 2NP6A 3UATA 4ZEXA 1DEXA 4ONEA 1RRFA 2CF5A 1YU9A 2F90A 4X54A 1RU3A 3LTNC 4K6GA 2ZL6A 1SCIA 4K1XA 3DE4X 4M22A 3WNVA 2UYHA 4Y6OA 2YJ3A 4HNTA 3TM5A 5LQUA 3EGVA 1P5ZB 1QAOA 2DHDA 2BP7B 3KPVA 3Q88A 1M2VB 5F9HA 1XDSA 3JYPA 5C0OE 2XCOA 2FLKA 3OPYB 3WIOA 4FMCF 3GRAA 2F3TA 4GLBA 4KYUA 1GM5A 2VUTA 3I58A 2I8AA 5F21A 4Z8YA 2WVGA 5AVRA 1SQ6A 2PV7A 2BHTA 1H2YA 3G05A 2FSGA 3I2YX 1RDFA 5EE9A 1F5NA 4IO1A 1Z0UA 4FJ0A 1Z2DA 1QIIA 5GP1A 4RPCA 4EDHA 2LV8A 1XHLA 4MINA 2C7QA 3MAJA 1K6IA 1EXWA 2W6CX 1T2EA 5ELXA 1OVMA 2XJ9A 4BNMA 2NU7B 4X9XA 4I4LA 3H4MA 3KLBA 1JFRA 4JJEA 1UWVA 4X1KA 3S2YA 4CLXA 4E4RA 4OQ4A 2XTMA 5BQFA 3OTHA 4OREX 1M34B 4RVNA 1SEPA 2CY0A 3ASVA 2GVNA 5BXYA 3SJPA 2PFKA 4NECA 1QYDA 1QWOA 5A7HA 3U5TA 1OBVA 4AX8A 3QKSA 4XQFA 1MCZA 2A86A 2NM0A 4GR5A 5F52A 1ICEA 1QCYA 1US8A 3GMTA 1TEHA 3V46A 4RETA 2JAUA 3NTUA 5TSDA 1EXMA 4CLEA 3Q8WA 4XARA 4LOAA 1L3CA 3DB2A 5LA6A 4PHHA 4GRDA 1SHJA 2ECOA 1GG5A 1GRCA 2OCPA 4A2CA 3NQ41 1ZSNA 1LJUA 3UH0A 3G88A 4TTTS 5A3VA 2IOYA 5B4VA 1A4RA 1YAHA 4XN3A 1FLVA 3I6MA 3ZU5A 3BMQB 4KXLA 3TMYA 1PNQA 2ZYHA 2WJHA 2O2HA 2ICAA 2PL5A 2O2XA 2OY0A 3PFCA 1ULUA 4JLOA 5DTIA 2LWIA 2Q6KA 2VHUA 5J4YA 1FRVA 1OXSC 2AW3A 2ZBQA 2ZYIA 3GZNA 3Q0EA 5F12A 6REQB 1A9ZA 4IZHA 3RC3A 2EG5A 3QH4A 5DPMA 5HIJA 4ACAA 1CR2A 2GS9A 3KHSA 5EHGA 3PVDA 1MJNA 4OPVA 4WCVA 4XIFA 4C3VA 1YKGA 3RPEA 2JCGA 1TUBA 1RR6A 1WMFA 1DAMA 3IDFA 4XFJA 1R66A 4EJFA 2D7DA 1WMDA 2O05A 3T9EA 3B89A 3SQDA 4YUAA 2GEFA 3PC6A 3V8RA 1OZHA 2OXTA 4UREA 5KAMA 3WVNA 1A3CA 2P1DA 1ID8A 2YZMA 4KPYA 4P2NA 5EJGA 1K8YB 3DE7X 1V7CA 2O4UX 2ZIFA 3PGMA 5I5GA 3TRHA 2F9MA 5JDCC 1IVNA 3PQDA 5ITWA 4CKBA 4D6PA 2O06A 3I83A 1A9YA 1SK8A 1GUZA 3LCRA 4CG0A 3UA3A 1E0DA 4I4CA 3OOHA 2HHLA 3AUYA 1SVKA 4UEOA 1H2RS 4XGRA 3RYHA 1F1JA 1I3KA 5G02A 3WDSA 4CT4B 1XB2A 3S5UA 3L07A 3CF0A 3AF2A 1Z39A 1T35A 5I7UA 3DA8A 3B6EA 3MGCA 1U7TA 2MSWA 1PW5A 2QVCA 3MLBA 5LYYA 4GPZA 5FXMA 5THKA 2B5OA 4BGEA 1JYEA 3W8FA 1HYGA 3JD0A 1WTAA 1Z07A 3UJCA 1WABA 3RADC 2OCYC 3K2IA 3B3JA 5H8WA 4NZMA 4QXAA 1VCMA 2CJPA 4YDRA 3ENWA 5B3JA 1LI7A 1HVXA 1DHTA 1TCAA 3AVUA 2HQSA 2FSUA 3LK6A 3PNVA 4W8HA 4NMLA 3D9QX 4TQAA 3GAMA 1CY0A 4BLRA 3GZTB 4X1YB 2Q7OE 4MDFA 3KELA 1L5YA 3NIBA 4IOMA 4OK3A 3KS9A 5HCIA 5A6VA 1SOVA 5E1BA 4CNQA 5TE9A 4TM7A 1UPXA 1ZMTA 2O3QA 2YRWA 1VYTA 3K2QA 3NONA 4TQ9A 3P9SA 1TTHA 1TJPB 3CUUA 2QTBA 5K8LA 3LBHA 3EZLA 1P3Y1 4G9GA 2OC4A 1TUGA 2QENA 2KWIA 1M8PA 4WI1A 3QA3E 4EHNA 2XNKA 4NYIR 4RGYA 5BVGB 3VNVA 2BTEA 2E18A 4UC0A 3VU0A 3V5NA 4KUGA 1DXOA 2RKOA 1HA3A 3KKNA 5F5XA 2YVKA 4RZSA 2IFTA 4F84A 3FCCA 4LHYA 4HAOA 2GPNA 2GUGA 1NB9A 2V3WA 3F8TA 4FOOA 4KTTE 4TLAA 2HT1A 2UXBB 2GD0A 3OURA 4OQFA 1N05A 1GU0A 3WFZA 4ENSA 3EIQA 1V0EA 4IFTA 4DMRA 4G1BA 4DY4A 3CRMA 2W2QA 4JL8A 1SVLA 3KQSA 2GN0A 3QPWA 3K1TA 1CJVC 1K88A 1VRVA 3MJCA 4LRXA 2R8RA 2C98A 1PN3A 3CLTC 3HSKA 4RMNA 3QX3A 4XPIB 3SG0A 1NXSA 1RWNA 2GN8A 2PVCA 1YJ9B 1X1TA 2ZYWX 4IYRA 5C8YB 5CEFA 5EJ4A 1U8ZA 2YICA 3GGDA 2VBIA 3VPDA 1YR1A 4Y1GA 2WRZA 1XTTA 1HYQA 1JTEA 2WWHA 1VLHA 2Z83A 3A9VA 4Y2HA 2IX3A 4BN4A 2I9PA 1XQVA 1T6BY 3EXHA 2NG1A 4JNCA 1JKIA 1P4AA 2W9XA 3DKPA 5CTJA 1RXYA 1I2BA 2OZVA 1P2FA 3THXA 4RWEA 2ZSAA 3RUIA 5IM4F 3MOIA 4KWHA 4Q34A 4V0LA 3BD8A 4DQDA 4EX6A 2VJMA 2WPDA 1PSZA 1TQ8A 2DLDA 2VHWA 2WHRA 2RI6A 3GF4A 1BS1A 4O1IA 5KREA 2BGKA 1FP6A 5IAOA 1PSDA 2VTKA 3WWDA 1K75A 2FAXA 1TJ3A 1NG9A 1S89A 1CJCA 1JFFB 2WUDA 3OFSA 3U1TA 5KNCD 3G4SB 1FS6A 2FR1A 1NNUA 1THZA 3IE0A 3OT4A 1RD4A 4MPPA 3VJKA 2WKWA 5KYNA 1PTJC 1XMPA 3OM1A 3CWQA 3O4RA 5KVAA 4PFKA 2NVWA 5ILOA 4H7HA 4QDOA 1ZFNA 4B85A 3T1NA 4BO9A 4U2GA 1LVGA 1XI2A 3LBIA 2QEQA 4CMAA 3VU8A 3M9LA 3EZNA 3BF8A 4MJLA 1JXMA 1VPDA 4OG2A 1IY2A 1IEVA 2M98A 4MVJF 1ZBQA 4LSMA 1JEAA 2CHUA 4M9RA 3ANLA 1H5NA 4XFDA 1XKTA 5K7SA 1Q1AA 4Q3NA 3IE1A 3LK7A 5E7JA 5ICEA 2TMKA 2HHHB 5L3SA 1Z7WA 2ECFA 4RD3A 1CXZA 3FR8A 1KU6A 4BNHA 1QLHA 3B82A 3E7FA 3IVRA 4U6QA 4ZO4A 5IAEA 5A5DA 1VJRA 1M2HA 4EARA 5D86A 5DSTA 1J2EA 3TN7A 4L8JA 2Z6BD 4Y6SA 1QJCA 2W6PA 3D2BA 4G6IA 3PL1A 3FPFA 3COWA 3ONWA 1XJQA 2KSQA 2LZ0A 3FMGA 3KJHA 5EEHA 4JC4A 3N8DA 2GA9A 4GRAA 1FL9A 2ADOA 1YZFA 5DI3A 3LPAA 3SNHA 5IYNA 2QZPA 1BH6A 1WU7A 4H7EA 4QSMA 5JNVA 2YS6A 4OMFG 2QROA 1LZLA 1E1LA 3E70C 3K6KA 3MGBA 3R5JA 4DA9A 1WP9A 1C8BA 3PTZA 2ZZGA 1I2ZA 1IN6A 1ZM2A 1P45A 1SXJA 3C6KA 3P9XA 4K7JA 2NVUB 2JGLA 7YASA 2YCLA 4MVJE 2I22A 2IYWA 1CJKC 4MPRA 3HRHA 1TVKB 3R5FA 4RY8A 3SX2A 1V5GA 4C87A 1Y6FA 1PS0A 2ODWA 1WRBA 2ZI3A 4P22A 2HT6A 3FBGA 4OP2A 1KHHA 4BRWA 3DV0B 2ZXEA 4D43A 1TTPB 3FDZA 2CW5A 1QO9A 2A84A 3AYXB 1UFKA 3AZQA 2I9KA 4RIEA 5A62A 2V3CC 3OU6A 2FWNA 1UDBA 2R4QA 1JPJA 4IKEA 2FUCA 1LLUA 1RACA 5KI6A 1I3NA 2W6MA 5GONF 4HGYA 5B1DA 2A0WA 3FZGA 4W9MC 4MEAA 2CBZA 5ALEA 5ICFA 4EHLA 1XQYA 3NBKA 2WWWA 4TKVA 2ZOSA 3N0XA 1FBNA 1M2NA 3TLZA 3U4QA 1USKA 1UAYA 1WOMA 2AZTA 1Z5NA 2IDJA 2VC2B 1FNSA 1MO5A 3HKEA 4WXMA 1SPXA 4CMIB 2I6GA 5AI8A 4URVR 5D2CA 4E2XA 1O0CA 4LJYA 2V7TA 3FDIA 3L40A 2JCVA 1E59A 2B34A 5DHFA 5JOQA 1OH8A 5E1DA 3U4MA 4JUFA 1QWSA 4P0QB 4HZGA 1PZEA 2GYWA 2ZRNA 3GUYA 5ITZB 4S1PA 3NM4A 3PQ8A 3GFPA 2BIFA 1C30B 3O6VA 3VPSA 3W6NA 4EB6B 4PPYA 3X1KA 4DLTA 1XCMA 1R1DA 2WT8A 1QX4A 1V3QE 3AIIA 2IZ6A 4JAVC 4MB2A 5BSWA 1Y1PA 2PL1A 1L5ZA 4ZEMA 2ADMA 1PJ7A 2IS6A 3LQQA 2ZYDA 4EB8A 2G25A 3KVVA 1OR8A 5BVHA 1LDGA 1JAZA 1K7YA 2H7XA 1E4VA 2P40A 2X0RA 3BWMA 3GP3A 1OPXA 3K2BA 3L7KA 2ZUDA 4JA2A 5EIHA 2IY8A 3WWYA 2OB1A 3RNOA 3VZSA 2Z2XA 1QAMA 4KL8S 1EZ4A 2E3JA 1SBTA 2X5JO 1OT3A 1RYMA 1PG5A 1ZINA 5ELLA 1BZYA 2ZIAA 1Q1GA 3INTA 3UMMA 2CUKA 4Z4YA 4CTMA 4TPKA 4NRDA 4CIDA 1V9SA 4ZT2A 2O2SA 3IALA 3IAHA 1URPA 3R2JA 3OQ1A 4QFBA 2FOIA 4NQRA 1DLIA 4Q7LA 1XTRA 5LP6B 3RRJA 4NKRA 2VCEA 2QMOA 3PQ2A 4W5TA 1I4DD 2GBFA 5EJEA 1VXOA 4ACBA 4MUHA 3NBAA 4U7FA 4UBNA 1G291 1J1UA 4X5OA 3CISA 4IRUB 13PKA 1DC6A 2FHPA 2EL9A 2XMGA 3TXYA 1CERA 2VSYA 1PJQA 4BJ5A 3QHQA 2ZKLA 3DG9A 2X8JB 4JT2A 4XWTA 4DHWA 2FPLA 3LT2A 4MJXA 3KYIB 3LJKA 3MJSA 5BOVA 3I01A 1H1LA 4CM4B 4G0YA 3KE9A 4AU1A 2QM8A 1QFYA 4HQLA 3GT3A 3NTLA 3HSSA 1GU1A 2F1KA 2RGCA 3GC6A 3MD9A 1XQ9A 2X1LA 2HXGA 1KEEA 3OOJA 4BRSA 2B82A 5TARA 5C1OA 2XXAB 3Q7EA 4NCKA 1Z45A 3WX0A 1CZUA 1H1DA 1N3IA 2Q8QA 3DMNA 3JRNA 3MXOA 4TSKA 3E5NA 5IC6A 4F4UA 2IS4A 1CRPA 3ZWYA 2YHUA 4XX0B 3OZFA 1QVZA 2VT6A 2HMAA 2ZB2A 4JJ6A 2C2OA 1KF0A 1YDFA 2CVQA 4N5MA 2RGNC 1Y8RA 1S7CA 3TQSA 2IKQA 4KLNA 2ON6A 4BOYA 1WSDA 2V0CA 2WV7A 3LT1A 2HXYA 4LS3A 4P3XA 4IIBA 3G49A 2XCLA 1ZD9A 4QTXA 4WASA 1OLOA 2XBLA 4IW3B 4R2LA 3TNLA 4RSRA 1U7XA 1ZOOA 5EINA 1QTNA 1ZGHA 3LH5A 2P8SA 2IPOA 1U7DA 2QTFA 1ISJA 4UULA 2NADA 1XAGA 1BDMA 2P9HA 1LH0A 2HQ1A 3R6TA 3C1TA 4ARSA 1M1NA 2HQOA 4FKMA 3WGGA 2P2YA 3T7AA 4XLAA 2NSLA 3ADCA 1EFAA 3JVVA 5TMPA 2DB3A 2HQBA 2JVIA 4LZJA 4S1WA 4DL9A 3Q7SA 4C03A 3DHVA 3CE6A 4PCAA 4HDCA 2COEA 4K6FA 3VO1A 4DQLA 3T9AA 1ZG3A 4EW1A 4PBSA 5KHOC 2V6IA 3USZA 1NVTA 3VGJA 2QRHA 4XGQA 4ZVNA 3UMFA 4XH9B 2EVWX 5F4MA 2Y1WA 4YJHA 1VJ1A 2CNBA 3JVEA 3R3JA 1ODJA 1X15A 1CZHA 3GW8A 4NS1A 4YJ2A 1N2ZA 4FILA 4CQNA 1ZX1A 1Q92A 1IY9A 2D1TA 5F7ZA 1H2BA 1LS6A 4GQBA 3WJ2A 1JBEA 1JIQA 1ODSA 4L08A 4A73A 1T4CA 4IXDA 5IRCD 4MR9A 2XPCA 2I3GA 4ETWA 2N42A 3RANA 5K8CA 4JI6B 2C59A 4M8IA 5FWXA 5K0FA 3NH6A 2IYUA 3D7KA 4IIJB 1XHFA 2QRQA 2X19A 4DV6B 1NT2A 3HYSA 4MYRA 1NJ2A 4OL9A 5BSFA 4LN1A 2XXJA 2YH2A 4AZ0A 4XCXA 1G2OA 4ABYA 3IHKA 1H3NA 4RKFA 1ZW6A 3CTPA 4GEGA 5BWBA 5KYYA 1DPGA 4XRRA 1JAXA 5F76A 2FPRA 2IXTA 4WUVA 3B6JA 1EDEA 3UT0A 5L8VA 4KQHA 1JDPA 4D4LA 4JYZA 4GLJA 4G1MB 5AHRA 4RM0A 3F5DA 3MINA 4EKYA 3CLTD 4KXYA 1OPRA 4YHHB 3KJNA 4RK1A 1GL7A 4WRRA 1CP3A 4XIJA 4XE5A 2HJGA 1VTKA 4Y9SA 4YUYA 1D2GA 1YCHA 4NMMA 2GCPA 5EIBC 2XSZD 3GFGA 4IDHA 1Q84A 3BK2A 5D01A 3W2EA 1DAKA 1G4AE 3SP1A 1FYEA 4TTJA 5CDYA 4IJUA 4MQ6A 1XROA 2VHXA 2VWPA 3SC2B 6NULA 2N1MA 4MWZA 1KC8D 2W0SA 1B1CA 1WB6A 2C2HA 3T7RA 5KTNA 4MV0A 4O59O 4F6RB 2EBFX 3C24A 1YX2A 1RLOA 1GGMA 2FZLA 3RVLA 3OVMA 1YS1X 4TWJA 1IAQA 3PHCA 3PF8A 1UM8A 3PWSA 5CURA 3SQOA 4N0QA 2V6BA 1L8AA 2YFQA 1CF4A 4U7HA 2CHFA 3BBLA 3WLRA 5FPKA 1GAJA 1PGPA 2CYCA 3GHHA 4EI2A 2K6GA 3PEWA 1HYBA 2BFBA 2FQXA 1IY8A 1K7CA 3JWJA 1QGZA 3PDIA 4O4IA 3OKFA 3QYJA 4I14A 4W5WA 4Y6LA 3H6KA 3FHLA 4AZTA 3AERB 4GM4A 3U4AA 1QE3A 2VBFA 2OBBA 1CPYA 1R4ZA 2D4AA 3W5DA 4DR5B 5KNCA 5CR9A 1UDCA 1ZVVA 1VSQA 2WP0A 3DQQA 4KBYA 1FQKA 1T9GS 1UD3A 1VJCA 2PGLA 4L6AA 4E31A 3OX1A 3QRWA 1KJNA 1BE6A 2JAWA 5DYNA 5DNUA 1NV9A 2VHVA 3QVWA 4BNGA 3U7GA 4P4SA 2ZWIA 4RD1A 3KPUA 2FSVC 1A69A 3DH0A 1JG4A 4GG1A 5KYXB 2ZI9A 3T5MA 3EQ8A 1XC7A 4GZ6A 3UJHA 4DCPA 2XUJA 1UODA 2F8MA 4WY8A 1BROA 4JCCA 5JBNA 4EO9A 4CKCA 2FH5B 2BHSA 3IJRA 1HLDA 4JBWA 3PEYA 3T7TA 4JP8A 1M2KA 4UBMA 4Y7CA 1I18A 3MCAA 1RADA 4ZGGA 5IK2D 4NBTA 1WXGA 3ZHRA 3GRZA 3NWEA 4XIGS 1RWXA 5F4JA 1ORTA 1VJTA 4WZ6A 1VC2A 4PRKA 3OP1A 1YIJB 2G83A 1SB8A 5E9WA 1FUYB 3G59A 3RFTA 3D8RA 3U9LA 3JQ7B 2ZR0A 3JQRA 4D0GA 4DRZA 1RHKA 1HV8A 3AOEA 1OLXA 2ZSEA 3S40A 2Q1UA 2RHCA 1GDDA 1ODLA 2HU7A 2Z1NA 2VTDA 3CMAB 1P1FA 1GQSA 1Z18A 2W6QA 2Z2JA 4A27A 1ESZA 1G20B 3M3HA 4ESHA 4ZN6A 4EJ2A 1GGEA 2W37A 1XG5A 4PFQA 4UDYX 5AK6A 1R0KA 1HT0A 4QDJA 4DT1B 2AG0A 2J30A 3RRNA 1RYDA 1U3GA 2JIZD 1PQWA 2B21A 3EQ6A 5SICE 2A59A 1X3LA 1VPLA 3PX3A 2EHDA 1DQNA 4RIFA 1PEKE 2Z0MA 5PGMA 5FAKA 3PUNA 1LQUA 3H1BA 2W8ZA 4IGIA 4DREA 1ZXXA 4PC7A 1YDEA 2Q2WA 1KE1A 4CBVA 2UUCB 2I2BA 5DLQC 1OTXA 4Z9AA 2FZ5A 2JIQA 2CVZA 2YMLA 3LGXA 3HJUA 4UFPA 1KTIA 3TI9A 1GPLA 1RXCA 3OIDA 4WBSA 1DKLA 3FUVA 4S2UA 3NVDA 4DDUA 1NUQA 1ZH8A 3MAGA 2Y05A 5CFPA 3CT6A 4OLBA 4Y18A 2I80A 2NSDA 3K20A 2GBCA 4AKGA 2R8BA 3WYAA 2EBHX 1Y7HA 2YV3A 3H5IA 3T6KA 3DLPX 1J90A 3L4SO 1KXJA 4GXTA 1U1GA 2FPGA 3G8YA 3PD7A 5J47A 1FSZA 3DZKA 2V0GA 1U98A 1W85A 3ZCTA 4ER5A 3RIXA 3H99A 3OT1B 5BWNA 4YRNA 2FFHA 4BWVA 4ARZB 3THRA 1E0AA 1XD2B 2P6OA 3G6WA 3JQ8A 4NYJR 4XSVA 1SQFA 4N8EA 4BIIA 3I5XA 3RSZA 4YX9A 1MABA 3EEQA 2A9VA 5JJIA 3ZC3A 1EQ2A 2EJVA 2HGSA 2DP4E 1WY7A 2PZBA 4IH9A 1KJZA 3FPPA 1E7MA 1GGFA 3RV4A 3WGZA 3WMRA 1RFLA 1VI2A 2CFSA 2BW0A 3H0CA 3ISTA 3AUJB 4HAYA 2C4NA 2EX4A 1KARA 2JRLA 3ADBA 3ZG6A 1YB4A 3DHNA 5K05A 2W0MA 4MCJA 3I1YA 4MI6A 4MS4B 1EAYA 1U1FA 2EGUA 1BS2A 1SMKA 2JD2A 1OIXA 1FRFS 3MM4A 4K87A 1XZJA 1I51A 1T4MA 2BGJA 2XAAA 1Y4ZA 2PO5A 2YVQA 3TTYA 1NW8A 4LXYA 1M7BA 1PVDA 4KTVE 4KVZA 5DHAA 4HXEB 1XLTA 2W2MA 2W43A 4CQLA 4EKDA 2SCUB 2C2WA 2QN8A 3IAUA 1YTUA 1RM0A 2QNIA 3A2MA 3GJ7A 1D09A 1PBTA 4PO3X 1KVUA 3BEOA 2O7VA 4DUGD 5B6JA 4HEJA 4KQCA 3BIJA 4DDWA 4R1SA 4WOBA 1FX0A 3G9UA 4UUBA 2MCFA 4LF7B 4IX9A 3C5CA 4HD8A 4B3IA 2XOXA 3BFVA 4NYIQ 4PY2A 3T9DA 2JA1A 5K5EA 4LF5B 5CITA 2DFKB 4JD5A 5J2UA 1L5WA 1NFFA 4KDEA 2E4ZA 3L7DA 1P1BA 1KBZA 2OO3A 3P9QA 4GMDA 3KQTA 2AHOA 2BLLA 3QV1A 2FPPB 1TEXA 3S8EA 1P18A 3IRVA 3O8NA 1XZPA 2GFQA 5AVXA 4Y30A 3ELYA 3CWZA 3DEKA 2NNWB 4NFYA 2Q4RA 4XKWA 1GUYA 2XOKD 4B7ZA 3LWZA 4RM3A 1JKXA 5DLEA 1ZRSA 1PWZA 1RYYA 2JCBA 3PNQA 4I55A 3P5BA 1K68A 3ZPXA 2WTEA 2GAJA 3SJZA 3X1XA 1PU2A 3BXPA 1KMCA 1GZ6A 4LYHA 2Y67A 4Q3BA 4KW7A 4H7DA 2YXNA 1KA9H 4GBMA 5CW2A 3VNQA 1AZWA 1UUFA 3RKSA 4YCCA 3EWNA 3DKIA 1ANKA 1Y48E 3HCNA 3BHNA 1JNYA 5IAGA 3AKZA 1K7XB 3Q10A 2QMQA 2X6RA 1YRAA 3PDCA 1EVEA 2VPZA 2EHJA 1UQUA 4OM8A 3SR0A 1UXGA 4ZV9A 1PX2A 3OLVA 4D8WA 2B7CA 3DT8A 2WE8A 4W6QA 1M5RA 5BN3A 5IUKC 3VTZA 1Z5WA 2Y0BA 4YWJA 5EE5B 1I5EA 4RY0A 5L4NA 5AOCA 1WUIS 4KMRA 4QQFA 5ES3A 1PWEA 2FW8A 3CA8A 1SBCA 3QUAA 3QYAA 3KEOA 3EXIB 4PLTA 3ZDRA 5JI2E 2VQFB 1E3JA 1LPPA 1M8KA 2GAFA 1MEOA 2RGWA 3QUBA 1Y5IA 4QJIA 4YCBA 4DCJA 1W4RA 2IYRA 5TPZA 3WMGA 3OBIA 5J23A 2FRDA 1XMOB 5D3ZA 5L6MB 4CF3A 2I2WA 5IJ0A 3LW8A 1AUPA 5EE0A 4E3WA 3RTEA 2BDUA 4HQFA 1UBMS 2R1ZA 3O31A 3PXBA 3J81k 1OBCA 3UAZA 3RWOA 4EQZA 1DKNA 1M6NA 1G16A 5DX1A 3ZCRA 5J9FA 4B31A 2ZT6A 3GPIA 3TTSA 4EY6A 5AFSA 5EIAA 4WVFA 1TW2A 4KG7A 5B3KA 5B1HA 2CZGA 2QHXA 4H2DA 2Q6OA 1O95C 5KTKA 4G85A 3VR5H 1V16A 3STYA 3WRYC 5EZSA 4BDTA 1R0YA 1V5FA 3V8BA 4IXWA 4AB1A 1ZLYA 3IBFA 4DNTB 5KIAA 3NXKA 3O4FA 2DERA 2JW5A 4BASA 3IEXA 3OEHD 3AU8A 1F0KA 4NABA 1F8YA 4N3NA 4TYPA 2PSDA 3FTEA 2HJ9A 4TTPA 2H4JA 5PNTA 1CFZA 5EVCA 1VHOA 2ZJ6A 4YFYA 3KTDA 5FBKA 3ZWXA 1KR5A 5DWDA 3ND6A 2I7VA 4C14A 2DECA 5D3KA 5EIBD 3G7UA 1SQ5A 1P0QA 3AR8A 1C9MA 1GL6A 3WHLA 2BBWA 3D0RA 1OXVA 3ABRB 1GR0A 2XE6A 1EUCA 2XSZA 3PIRA 4FJ2A 5EWMB 1YF3A 3NZEA 4J4TA 2ORED 4B43A 3W4JA 2Q3EA 5AVVA 1QQAA 3FY4A 2UUOA 3B85A 4PLYA 1HFJA 4EMSA 2PXAA 2N0SA 4PTYA 4ENVA 1HSZA 1YI8A 1ENPA 2Y1OA 3DE3X 5F5NA 5IT4A 1ZI6A 4N01A 3OQPA 3V4ZA 4BNXA 5I51A 3HCDA 5IZ4A 3RSLA 3RDPA 1YONA 2BSXA 3IQHX 3SZLA 3V8VA 5B57C 3DMFA 3KNZA 5F35A 5J40A 3WB9A 1Z5PA 3TDNA 4D0RA 2VJIA 2IYQA 1XVIA 5AT1A 1ZCAA 1ZZGA 5JBIA 4GLLA 2RG1A 4R2JA 3KAKA 5B12A 5DX0A 3HO1A 3ZXXA 2A6PA 2O5RA 2Y77A 4P54A 3RRFA 1BIFA 1EEXB 3TBFA 4N48A 2ISCA 2PS9A 1USUA 1DXHA 1U28A 1X9GA 4TUYB 3ZHUA 2BFDA 2NV6A 1HEYA 3QJGA 4NV3A 1PTJA 3FYTA 2WF9A 4QELA 1PR4A 2BGTA 4E5YA 1L7OA 1J33A 1E7SA 4EI8A 2WYRA 4PG6A 3NOVA 4B8WA 5BUSA 5EC8A 1LSOA 2H4HA 3QITA 1BDJA 3KTAB 4X60A 5LUBA 2FPKA 3JQAD 1DMRA 4LJ6A 3WP0A 1JPVA 2NQTA 5BN5A 4OEHA 4IQFA 3K0CC 4ZOAA 1RHMA 3C6MA 1DL5A 4Y9TA 4B3HA 2XYHA 3PVSA 1BE8A 3NAZA 4IGEA 2BYTA 2EP7A 4FS3A 3A3KA 4GD3Q 3MWDB 1EX1A 1ADJA 1AUVA 1OZ0A 2P9BA 2W2PA 2WAXA 1MA3A 3B1YA 4QBKA 4BE7B 4GPTA 2I6QA 3V33A 3KQHA 4CODB 1LEHA 3CNBA 4GSLA 3TKAA 3MILA 2I34A 2J45A 2HEGA 3OOYA 2CB9A 5F51A 1G8YA 1RYZA 1I2DA 2JFZA 4MLPA 1NBOA 2CJFA 2EV9A 3QENA 3F47A 1IXKA 3JYNA 5EL0A 4C4ZA 5IK2A 3QLVA 1M7HA 4ROTA 1VBNA 5A4KA 1U8AA 1SKYB 4G4SP 1TIKA 3TLXA 1U2SA 2VHCA 4R8MA 1RHRA 4BLQA 3VAZA 4OQDA 2JCSA 4NG5A 1IZ7A 1QMGA 1ACLA 3DNPA 3E9QA 4O33A 4XOIA 4MV3A 5JLAA 4PCVA 1DOAA 1B3BA 4OLHA 1UFVA 3SYNA 3E15A 3UC9A 3VV3A 5FOQA 4EMBA 3ZXUB 2BCGY 3TRJA 3WAKA 2WJZB 3VZCA 3SZMA 5JS7A 4Q9NA 3WC4A 1ZK3A 1LJLA 1W88B 1II9A 2AGVA 2H3HA 3AKCA 4IG9A 4O2AA 2WMDA 5AXCA 1ZEMA 3AM1A 1E2PA 2QA4B 2WTNA 1KTVA 2QYTA 3GRPA 3EFHA 1T5TA 1JYSA 2EKZA 3P97A 5ALRA 5DRTA 5BMVA 1KIAA 4ZIRB 1Z29A 2VJKA 4G7WA 3SLKA 1TEVA 1V4VA 2Q4OA 1TA9A 1GT91 2UVQA 3DYVA 4JUAA 3DV2A 3NEJA 3Q15C 5D85A 3UMSA 1NYQA 3V6LA 2JAQA 2JIZA 1FF9A 1H6CA 5D6NA 3WG9A 5KWJA 4DN6A 4LJSA 1Q77A 4H1UA 1E64A 2YXEA 3MCUA 3RK4A 2C2MA 2DVMA 2J4CA 4P6VF 2H2AA 3E8SA 1JE0A 2PLAA 2ILVA 5FI3A 3CCVB 2FWMX 3SE0A 1OWNA 4I1PA 4ARCA 4Z4SA 1VKRA 4B33A 5EIFA 1U8YA 1HDCA 4F1KA 3HCFA 4MW7A 3U44A 2VJYA 3LA6A 4UTRA 1E1NA 4KJZA 1EJ6A 1J1ZA 1CU1A 2BHRA 1OBHA 2BZ1A 3AF5A 4ZT3A 3OTGA 5G0UA 4CCAA 5DYIA 4XXHA 5KYUB 4QVGA 2H17A 4D9FA 3ZDDA 1TZBA 4G67A 4KIWA 5FUXA 2JEZA 4KPGA 4YN3A 2I1LA 1SHZA 3HS3A 5EWJB 1PFWA 4PAMA 1JV2B 3DMDA 3ZDYB 4JN6B 5JARA 2Z5LA 1JWBB 3F8WA 4YCJA 4KHPB 4XR9A 5C31A 1ZHHA 1WTCA 2GJ4A 4MOWA 5IJ9B 1CEQA 3SKXA 1FXWF 2QTWB 3BWVA 5K0LA 1KQGA 1Q7BA 2R25B 3NMUF 1EX7A 3NLLA 4F3RA 5LQRA 2IH2A 5HK9A 1J9ZA 2ARKA 3FCSB 5I4KA 3UCFA 2ONYA 3CLKA 3UHPA 1KEVA 2GOYA 3EQ7A 4HY3A 3W9UA 1DGQA 1FFXB 3HFRA 3NVAA 4OD0A 2OYNA 2OUIA 3A27A 4G97A 5ITSA 1C1YA 4OHWA 3FOEC 1L4BA 1GARA 1NZDA 3FVTA 3OIFA 3UAXA 3DBLA 4FFOA 1CNMA 3PUHA 3KV1A 2CF6A 2P62A 1BWQA 5B53A 4ZZ3A 1RRKA 3ST7A 2EATA 2AZMA 1RHJA 1Q15A 1YZHA 2LIVA 2BOVA 3HJCA 4H1VA 4P7GA 1XJWA 4KGZA 3W2HA 1UJ2A 1UP7A 5BSVA 5FUMA 3RD5A 1C1XB 4MSUA 1QSGA 5FTLA 2FPMA 4OPMA 1U0LA 2QD2A 4UU1A 3TX6A 2I55A 1KFEB 4B48A 2IZ0A 2WF5A 2FGJA 3E2IA 4D96A 3PA6A 4EQ6B 1I6KA 4U3JB 2DLNA 1PT9A 4PGMA 1U6JA 4C6SA 1VHEA 1ODFA 3EWAA 3TIFA 4Z4EA 4EPXA 1P7ZA 4Y2SA 1B93A 1T5BA 3DXXA 2Q21A 4K40A 4LXXA 1TK9A 4MP6A 1U0NA 3RSOA 3FIJA 2E21A 4JB3A 5I7RA 3GLGB 1UWLA 4J03A 2P2SA 2J3JA 4L3WA 2H29A 4DLKA 3BTOA 5A4DA 2UYYA 3AEXA 4V3CA 4JKYA 3C6QA 4UTNA 5FJIA 4KKXB 3DBVO 2WB4A 3F2VA 2EJWA 3MUFA 2E4WA 1OQAA 3RTCA 2DY0A 3AIMA 3HYNA 4W7SA 3IT0A 1XTZA 1PS8A 5GGXA 3R6DA 5LQSA 2WU8A 5CVTA 2G1PA 3QLEA 3COYA 3OP4A 4UAVA 4LUCA 4ZAVA 4GL2A 2O8FB 2IPXA 3BH4A 2DQSA 4DA6A 5JECA 4II2A 4H77A 1SZPA 1J5PA 1L7RA 1R6XA 2ZB4A 5G1NA 5ALYA 3GUZA 1OKKD 4EBBA 4JVLA 3TIXB 3NDPA 4TVKA 1C41A 4X1IA 3ZWCA 4MV6A 1AKMA 2AR7A 8AT1A 3RVOA 1G3UA 5FI5A 1NASA 4NK4A 3UK1A 4OHVA 3I0NA 1CYDA 4MDHA 1DBIA 1OC2A 1MW8X 5KQPA 4C4XA 1UP4A 1V1MA 4TV8F 5LQAA 2YN2A 3ASUA 1DP4A 4QOIA 2BBSA 3N0RA 3PKZA 1JDUA 5THQA 5IPFA 1F12A 3F96A 3FTPA 2QUHA 3BE8A 4KKSA 4FNMA 4M86A 4X8MA 2IV7A 3ZDBA 3T7CA 5EKUA 4UDOA 2OQ2A 4I19A 4O4JB 2QSUA 4BVJA 3ZCSA 4X3CA 2HWWA 1QH0A 2POQX 3IAM6 2ZCVA 4MKXA 3UMBA 2O54A 1M6EX 1NVUQ 2ZG6A 1NRXA 4YAGA 3OUUA 4JNKA 5C18A 4F38A 5AM3A 5I45A 4PLFA 4Q03A 1ZGZA 1OAOC 4RYLA 5DM4A 3RTBA 3FJOA 4WLFA 4D82A 1J2JA 1ZMBA 2CLSA 2D1FA 3EC1A 4M6WB 5IC4A 3UHOA 3GLVA 2W71A 1KI1A 1OXXK 2JIMA 3GG2A 4OXYA 5AW5A 2XYGA 3QE9Y 1XHEA 2O8CA 1UXIA 4OB7A 5JZ9A 5EXPA 4MQFA 2Q3LA 4HDAA 1AHIA 3MFYA 2NXEA 3VR6H 3E4DA 1S3GA 3TXAA 1ILEA 4D26A 1OC4A 3BH0A 1DELA 2M6LA 4I5EA 2JI8A 3FFAA 4UQLA 2Q3CA 1JPNA 1W93A 3A36A 3PG5A 1YI0A 1PJRA 4QAJA 2HIHA 1PWHA 1J8QA 1KI2A 4KGDA 3FMOB 1O95D 2QSYA 1Q22A 3ODGA 5HIIA 5K20A 2YZ7A 3UZUA 3UYKA 5ARBA 4DQ0A 5DTMA 1EGMB 2Y0PA 4GPD1 3H1FA 5KPDA 2OO7A 3ORYA 2XCRB 3HVRA 4F71A 4YELA 3IC5A 4W8OA 1J07A 5CVCA 1PVOA 4L4ZA 3SX0A 1YLOA 1GQRA 3Q0TA 2VK2A 4B6QA 2OC9A 3B9QA 4MPDA 4XX1A 3SBXA 4CEJB 5GVSA 5T4FA 1UBOS 1Z3CA 4IQGA 5KVQA 2B2NA 3KT8A 3UK0A 3OLCX 3R0JA 3L6BA 4FYWA 5FTJA 3ADDA 3UBTA 1FP4A 4YAIA 1E4OA 3BK1A 1AV6A 1KSHA 4KBFA 4KE9A 5EAIA 1LDEA 1UMKA 3MRSA 3NPAA 3ZY3A 2OGSA 1Y33E 3SSNA 2WUWE 2VF4X 3SSMA 3V1YA 2B1IA 2QGNA 5DASA 2JHCA 4FB4A 3II6X 5GAJA 5IEJA 3B20A 2ZXHA 1QRDA 1YC5A 3N8KA 2PS0A 3DXFA 3PI7A 5KU1A 4DNRB 2BBTA 1YOBA 4KZKA 1X1EA 2VDVE 2CXHA 3OO1A 3ORSA 2V31A 5MN4A 4DM4A 4X94A 4TX1A 5DWQA 2PRZA 3JZIA 1DSSG 4LQCA 2O8BA 5LZ4A 5T41A 4XLFA 2WV9A 1JHQA 2P68A 1S4QA 4IGFA 3WLPA 3DOFA 3EVZA 2ESRA 1T5HX 1YT5A 5HF6A 1K89A 3GJTA 2J5XA 5EE3A 3DQPA 3RWMB 4PABA 1IRXA 2V9ZA 1E92A 1JHPA 5C8ZA 1E1RA 4ENQA 1IHDA 3AFNA 4K3UA 4V1CB 3F49S 1GSIA 3EIHA 1S1CA 3JQAA 1WY5A 3AY3A 5CJJA 5ALVA 3DQZA 1BKSB 5DNCA 3BZWA 3SMQA 1Z4LA 5TPWB 1BKDR 1EHCA 3KK0A 1WSVA 3A0UA 1H93A 3U49A 5HFJA 3VPFA 4EJ6A 3K15A 4ALKA 2PX3A 3LVFO 4ZGBA 5J4HA 4W1QA 4BO3A 4HUQB 2BZGA 4PSAA 4FCVA 3P9ZA 4IHKA 1P7WA 4REQB 2WWVD 3TWOA 1CEEA 3ZWPA 4DR4B 1N3YA 3CZ5A 1NURA 4PCLA 1J00A 4DF3A 4UM7A 3HHPA 1YBAA 4IAOA 2QIOA 4NYJQ 4YGXB 5CLLA 1CZRA 3EULA 3C41J 4DDTA 3D1VA 3LDUA 2BGIA 5JT1A 2CLIB 3S6JA 5GV7A 1NZJA 2D1SA 3HL0A 3I2KA 1AA6A 4CV2A 3PYMA 2H07A 2AI1A 5IZCC 1ZICA 2EKPA 3DMYA 3GEEA 4ZO6A 5DB4A 1OMOA 1LI5A 5LM3A 4KO1S 3FVRA 2QVZX 4Z8XA 5DOVA 4CLRB 1JMKC 2ZL5A 1JSRA 4PC3A 4GSKA 4NF2A 4R7TA 2IDZA 1OZAA 4L28A 2CKMA 4ZYWA 4JOBA 4WXHA 4ZQHA 1KD1D 2JLCA 5AM4A 1CIVA 1HM5A 5FR1A 1VMAA 2O7NA 3NXSA 5GMOA 2CDCA 2IX9A 4B34A 5JRZA 3I45A 4GECA 1BRMA 4I4TB 4YI3A 4PNEA 3CF4A 3CZ4A 2FOLA 2J0UA 3U19A 2X5XA 3NORA 2PS3A 3W9BA 1EWTA 1II0A 3BB4A 3OCZA 4YTEA 3LF2A 3UJ3X 1MG0A 4LRUA 1QUEA 4BEVA 1SXPA 3WNCA 4GRIA 3RYCB 4ZCMA 3LDHA 4UPEA 3G0CA 5ALTA 3RK1A 4BCBA 3ETLA 4DPMA 4PPGA 4KQ9A 4Z9BA 4F9GA 3PUYA 4CDMA 1E1CB 1TU0A 3FSRA 5TB5A 3D3JA 3OICA 4GF5A 4RVFA 2LTAA 3VTKA 1JN0A 2PL9A 1BFDA 2G5PA 4Q6BA 3WBFA 1VIMA 2WD7A 4L07A 4AF8A 5AW6A 1E8DA 5HNKA 1HEIA 3QXGA 5IFLA 5DTEA 1CVLA 3ZY5A 3GJ8A 3N2KB 4ZYVA 3Q5DA 1D8AA 3OU2A 4EY5A 1H3EA 3CZRA 2AN5A 4ZANA 3TRDA 3FVQA 3GIWA 4F2WA 5IKPA 3SKBA 1JSXA 2GR9A 3G2PA 4EZIA 3A35A 1YS7A 3PYLA 3QOFA 2ZIZA 4RDXA 4RV5A 5J2TF 3GBVA 2R6GA 2PMWB 1RSZA 2IUTA 2EL7A 4KUHA 4TXMA 2QX7A 2FV8A 1JHYA 3FWZA 3X44A 1VLVA 4QV2A 1Q0LA 2PLRA 3V4PB 1UBGA 1YRYE 3VKWA 1M1YB 5JCOA 5IYPA 2Q1XA 2YYSA 4ZZ0A 4IJWA 3EG9A 1JR2A 1MB9A 2Z8YA 3JVIA 4GMKA 2FWAA 3U9SA 4DBVO 1E9DA 1XTBA 2AV6A 3VM6A 3VVCA 4D3FA 1KWKA 4WA7A 1R0SA 4LHWA 4FBGA 1JP7A 1Z4JA 2CNOA 2FN8A 5CPBA 5CXSA 2VJAA 2YWFA 2CMFA 2QAIA 1WKBA 2QE7D 2WWXA 4FMDB 3LHIA 1K6EA 4JU8A 3UGTA 4B9AA 4JI7B 1JIKA 2JBWA 5JLJA 3CCUB 1VHJA 3E22A 4YCDA 3W77A 5TMDA 3A06A 5HMMA 2H2IA 2C3PA 1X14A 1WW2A 1NXXA 2ZRLA 3OF3A 4KWCA 4XB6B 3RJZA 4EP1A 5JATA 3A05A 2M2IA 1BVHA 4RLZA 4BFUA 1TM4E 4QQ8A 1U9IA 1QHHB 3K5PA 4YC7A 4GL4A 4IOLA 4DMCA 1I7SB 4R1MA 1GCOA 3HB5X 1FJGB 2XUQA 2IS2A 1QJ4A 3HI6A 2E9SA 1NUTA 2VBVA 1L5SA 3CU5A 3FW1A 3H1PA 3W2GA 4L5AA 4PW0A 2Z6UA 4UBIA 4QUDA 3GIRA 4UMVA 4HL6A 5E3JA 3CJTA 4ZVOA 1X13A 4EAAA 5KTMA 3AF1A 4B79A 1VE5A 1D8TA 3HVKA 4WZEA 1DRVA 1U2EA 2YHIB 4LIPD 4UUPA 5J2TB 4IO0A 3EPLA 1U2QA 2AOWA 1GN9A 1P1RA 1WF3A 2HL6A 2Q3BA 3L8DA 2HRRA 2FCAA 1SG6A 4WDRA 4C1BA 3ZNPA 2HAEA 2QNRA 4RA9B 5HUHA 4TZ0A 1J0CA 5B30A 2FMTA 3GLFA 1U6IA 4KKTA 5ESXA 1F1BA 3W0LB 5LXTB 1DTWB 1BO6A 4WFKA 3D8BA 2VNIA 1OKKA 4X71A 2IYYA 3G8AA 4F93B 2QRPA 4Q4JA 1L8OA 1W52X 1Y5NA 2N75A 3RABA 5JNUA 4EEZA 5CK5A 4H6VA 4MVJI 2EQBA 1K4KA 1P9LA 5AVOA 3UXMA 3V1NA 1AN0A 4O6VA 4S12A 4EG5A 2QTAA 4UD2A 7ABPA 1XELA 1IVSA 1CUZA 4CM9D 4N0MA 4URHA 1SUPA 4ITUA 5BPHA 1JGTA 4BNTA 3B78A 2FPIA 4U1RA 3R7BA 5EJ2A 3SFTA 1BNCA 4BP9A 2X5KO 4BNDB 5JSZA 3LKBA 4R1NA 3EPKA 1QHSA 1Q9SA 5F5LA 2O8EA 4PPQA 1YSCA 4XOUA 3W1VA 2H5EA 5AW3A 4KKUA 3O73A 4KQKA 2V7QA 3AEYA 1HZJA 2OOKA 1XO1A 1NBAA 3OSUA 4I9FA 1RJFA 3QBVA 1WOPA 4Y9UA 4LVOA 4TMTA 1T0HB 4Q37A 3KKZA 3DAGA 4R83A 3QPBA 2JH8A 1DJOA 1Z0AA 4ECEA 2D9RA 4U9HS 2DYKA 4F12A 4Y1EA 2Z8XA 1RKUA 1PHPA 4KHZA 3QPUA 4LRQA 4U5QA 4UCXA 3U39A 4CN8A 3DKKA 1W30A 2NP7A 4P3KA 2P3MA 1U31A 4PZEA 2KM1A 2I65A 2Q1YA 1YVPA 1DAGA 3WKDA 3IBSA 1N7JA 3QMMA 1J4AA 4QREA 2QTTA 5TT0A 3UN1A 5CM9C 3I4CA 2R48A 2F00A 2YWHA 3KQVA 1K5PA 3GP5A 3S28A 2B99A 2CXQA 4FD2A 1G9SA 4IXTA 1MIOA 3GFTA 5HGXA 2AZDA 3U4HA 3IILA 3H5RA 5CRIA 2XJ4A 3L8ZA 4GDMA 4KLZA 3HB1A 3NTVA 4W9RA 4J0KA 4MGEA 2UUAB 4YRSA 2QD4A 2QVGA 4G0UA 4BAGA 1Z74A 2GBLC 3Q3IA 4WOKA 2K7FA 3COZA 4P32A 2FGKA 4NBVA 1D1PA 5FR2A 5IH3A 3O94A 3TGWA 2WUEA 4NJEB 1SUCA 3VI3B 3A31A 3ZWWA 1Q1QA 2OQRA 4GC5A 5CYFA 2Z3WA 2MINA 4JEUA 2ZJZA 3CFYA 4R9RA 3UGJA 3C4QA 1B6TA 1EIWA 4DLUA 2XWJI 1IUKA 3AKDA 4DG9A 1O6GA 4ZFNA 1WSRA 4C7OB 3J7TA 2R2GA 3JAWB 2DUUA 4WCFB 5TQJA 4QL3A 2ALJA 3KVRA 1ZC4A 1SVOA 1WCIA 2FR8A 4JJ7A 1W34A 3CRZA 1AB6A 4HLUA 3PP8A 5AIAA 2JJYA 3KAPA 1OYOA 3PUXA 3WLKX 4OQNA 3EBPA 4J9VA 2F1MA 2PMKA 3V7YA 3ZJVA 1E3XA 2V7VA 2C9BA 3EEIA 2QR2A 4A0SA 4PINA 4CLOA 2WJWA 4QECA 4ZJZA 5E6TA 3CW9A 3ILYA 4ZMSA 1IQRA 1XXHA 3W5VA 3EZGA 3VXKA 1GKLA 4MUJA 1WPRA 4D80A 3CLHA 1N2JA 4FR0A 3KJGA 2FEAA 2Q50A 4HNAB 3RH0A 2YCBA 1OCEA 3HABA 4BN0A 3M6VA 2Z8ZA 4HWOA 1TT5B 1S2MA 2IYXA 2XTZA 3LUJA 1TO2E 3ZWAA 4YALA 2Y4OA 2A92A 2VKTA 4MWBA 3EZ7A 2YMPA 4J0JA 1E9RA 5CFQA 3VHXB 3ASRA 3WYBA 4AY2A 4E03A 2GYYA 1J8YF 4LQ4A 1CWUA 2RBGA 3WGKA 5K45A 3L1UA 1EINA 4INOA 2BJWA 3ES9A 3RLIA 2ZSKA 4B8ZA 4MLDA 4B3GA 2CUNA 3K0CA 4OIFA 4TZKA 2FA9A 4CQMD 2N3ZA 4E7PA 5E8RA 3IEKA 3KT0A 3K8ZA 1VXRA 1DKRA 4BC1A 5JAZA 3LZ6A 2FSHA 3EGOA 2FZGA 3RS2A 1QKIA 3I5MA 4OBEA 2COKA 3MQFA 3P9RA 3OUTA 3TO5A 2RC5A 1OF1A 4ZQEA 1S72B 1D1NA 2F9FA 5IX8A 4ALIA 4C2TA 2BZ0A 1A4IA 4PO1A 1L6IA 5A3QA 5MF6A 4JEMA 3HI4A 1P91A 1QK4A 5EKDA 2E1BA 1UPAA 3O2SB 4M8NE 4MAMA 3S27A 5B7QA 3BYZA 3LLVA 2OLEA 4O02B 4RQTA 2JJQA 5ENDA 1GTL1 4KR7A 2RAUA 3L05A 3L7NA 3PKJA 1DARA 3RI3A 1NC1A 2JGNA 1OFIA 2P3OA 3KL4A 4UNSA 4HVCA 3D6VA 2LPMA 3ZWOA 1RMYA 2X9QA 1NDHA 4G65A 1E79D 1RQXA 3ETNA 2BEWA 2AX3A 5LDDC 2ZRIA 1E2JA 2EW8A 2F1OA 3EUEA 3IERA 3NYRA 3ZNQA 4CRWB 4D42A 2C5FA 2RH8A 1JKJB 3IV7A 3DKRA 1KDYA 2XYVA 4H35A 5LNK6 4RTQA 3PE3A 5BWMA 1CUFA 4AF6A 1I2MA 2QRNA 4IL5A 2PX4A 3W9SA 3CVOA 3MOSA 4JYBA 3GELA 2HBQA 4I99A 1WSWA 2HJRA 1Z6ZA 5K99A 2EFYA 3MLEA 3OI7A 1E1YA 4Y98A 4KQIA 1T9CA 5ALFA 3QWHA 1QZZA 2X58A 5ALLA 3THOA 2OHOA 1ZW1A 2GPTA 3U81A 3O90A 1QTQA 1EFPA 2ZJ7A 1R6AA 1SG0A 2AWNA 3D7NA 4YJDA 4RFVA 3ZE8A 1SIBE 3HCCA 5JO0A 2JFXA 3SBDA 1OLUA 3FNFA 2J5KA 4OKNA 2VDRB 3EDOA 3TUIC 4KR3A 4Z1MD 3ACCA 4AJEA 4K2AA 1T2NA 1WORA 4QBTA 4W9NC 4F11A 5F1YA 4BCDA 2AOTA 3QKIA 1ABBA 3I6YA 1G7RA 1AV7A 2QD3A 4ZEVA 2I91A 3EDCA 2RHLA 1V39A 4Y2QA 1OGJA 3EPHA 3KZOA 5LP6C 2YJ5A 4PAAA 1B8UA 1G8MA 1X70A 1Y9AA 3HAGA 2VZ0A 2WIGA 3OTIA 2PSSA 5EZYF 4FUTA 4IJKA 4UXJA 1C29B 4KK3A 1AS3A 5FJJA 1KAMA 1H3FA 1Y82A 4GXNA 1WX1A 4L6IA 3UUEA 5M04A 4DV7B 2WIJA 1L7DA 2IPMA 3HDJA 4QDZA 1C4WA 5AW8A 1T3TA 2AVNA 4UOQA 1I7QB 1KFJB 4HDNA 4YB8A 4YMLA 4CE6A 4P6YA 3NHZA 5FH9A 2G06A 4FZVA 7REQA 1FIUA 1IBCA 1CRZA 1XEFA 2QZ9A 1PF7E 2QS9A 4U8GA 4WAUA 4EPRA 3B3AA 1QX3A 3K7EA 4FDAA 1YFKA 1YS9A 3VAAA 1B74A 4X7DA 3TZHA 2D74A 2V7GA 3F1KA 2DBYA 4B80A 2HZBA 5C8DA 4X62B 4JI1B 4LMPA 1L4NA 4EW2A 2HSEA 4D8XA 1Y0RA 5IM5A 2H1VA 2WKQA 1CEYA 1TX4B 3D2LA 3EYAA 3HB0A 3IOEA 5HZBA 1MA0A 2AG8A 3NWOA 3QVOA 3K5HA 4IJMA 1PVVA 3VZPA 1VBMA 5JMWA 2F62A 4LEIA 1YHQB 5HZGA 3AWIA 4HTFA 3I5UA 1H4SA 1TTTA 1E7WA 1MKYA 1YL6A 3MTEA 3U17A 3CP8A 2LR0A 2VDJA 4JXJA 1V8PA 3T0IA 3SEFA 5IYZF 3BSWA 2IEAA 3I42A 1DRUA 4A0RA 2H52A 3WJAA 2ATEA 4JI8B 1ACMA 1Y9JA 4YCNA 2IYPA 2GEVA 1QIEA 2XMCA 3ECAA 3KZVA 3OJCA 5EESA 1KQOA 2H2DA 3BIWA 4R68A 1F0NA 4XLZA 2ZU6A 4YAUA 4CCWA 3R9XB 4CVNA 1NUSA 1AXGA 3EFOA 4XORA 2ZUWA 3BA1A 3I73A 5ALUA 1EK2A 2I03A 4YWHA 3T4PA 5FEUA 2VNHA 1M8GA 3D02A 4RAQA 3PSAA 3U7QA 1DWPA 1T1SA 1P5HA 3LO5A 2WAAA 5IANA 2CMDA 1A8SA 3R75A 3RVNA 2CL5A 1WXIA 4YVFA 1UD5A 4JY7A 4PR3A 4OBBA 1NP7A 5AKJA 3TVTA 5EJMA 3M1AA 4FYKA 4J6EA 2R4UA 4HFMA 3GLIB 4CL8A 2OBMA 3LX4A 3WRXC 4M1QA 5JJLA 5TXGA 1IXZA 3ET4A 1SUIA 3JWIA 3Q6RA 5E9AA 3EXG1 2BF7A 3U48A 3B13B 2G70A 2BGNA 1TMGE 3LYHA 5J58A 1NVBA 2GN6A 3CW8X 3AEQA 1DCMA 1DDOA 4CMEC 1T9DA 4G86A 4DKJA 1Y81A 2HDOA 4CM9A 3U2QA 1NW5A 4NBKA 4PBRA 4QUJA 3K70B 4U39A 4XM2A 4PGHA 1NQVA 2H11A 5LZ7A 5DHQA 3FNRA 1O5OA 3GX1A 1DIRA 1SHLA 3I6BA 3K0AA 5BT9A 4KX5A 2G5TA 4ZALA 2HTFA 4X1KB 1OAOA 1QQ5A 5FD8A 3RU3A 3PWZA 1O2DA 1RZVA 4YP9A 1N08A 1P3DA 2HIAA 3F3YA 3IAM1 5JZSA 2PKQO 4PIVA 2GEUA 4NCHA 4LF4B 1K7SN 4L9AA 4FYXA 2XF2A 1T2VA 5JDIC 2ECKA 1IC6A 2VAVA 1US8B 3DVAB 3MJRA 5FA5A 1Z9BA 2A3NA 3E23A 4XUEA 3S99A 1CD5A 2C5BA 1XLUA 4B8YA 3MQ4A 5MN5A 3VU9B 5MGBA 3F3MA 5IYQA 4TQUS 5FFMA 2H92A 3M70A 3MOGA 5LA6B 1D07A 4L85A 3ZHZA 4AULA 2JASA 3PQ6A 4OYYA 3IEMA 2O8DA 3KU1A 2G5CA 2BEUA 3GT4A 3C1UA 3IXLA 3ME5A 1D2EA 4JGGA 1C9YA 4Q4AA 4W1RA 4DUYB 4AVYA 3C15C 4B3XA 1OVGA 4YRBA 4WXEA 1HG1A 1XU7A 3ZW8A 1P1IA 4ESEA 4L7QA 5T57A 4HQKA 1V48A 2R4TA 4P4LA 1R6DA 4WVLA 4LW8A 3HKDA 1OHHD 5A2GA 3C6YA 5L9AA 5HBGA 1U7OA 4B45A 5LZ2A 1QH9A 2H57A 3RVSA 3UFXB 4DCGA 1D9ZA 3TMKA 2YNMC 3FPCA 3GLHB 4U7DA 2GPAA 2R00C 1T9ZA 2GESA 4B6JA 3LCUA 3EF0A 4JT8A 3UV7A 1DT5A 5JZOA 3C3AA 2PGIA 2WG0A 1A9SA 2HGZA 1X7YA 3QM1A 3RIHA 3WYFA 3RAPR 3BMXA 4B4OA 2BH2A 2F3RA 1NRIA 3SC4A 2GGSA 3SZUA 2HLDD 3GVLA 4LJ8A 3EY9A 2IWRA 2AD5A 5CA0F 3L0BA 3LYAA 1FJ2A 1L9KA 1CB7A 2WJ6A 4PAWA 4TVBA 3JYHA 3KT3A 4OQZA 3KL9A 4I5GA 4Q9LA 2HHJA 1E9CA 2Y2VA 3RASA 3ZNOA 5TF0A 3KYCA 1H22A 4WZAB 4U4AA 2YJZA 4GKBA 1X8LA 4Q02A 5BORA 5CG2A 4LJ4A 2GZRA 4LOLA 5I9SA 2IY7A 3VDMA 2EFDB 4G4JA 2JPDA 1EUDB 1G5RA 4N5NA 1CRWG 1ZEJA 1JAYA 1Z62A 1EG2A 3IUEA 3JCZA 3SU8A 4C76A 5HJEA 1A7AA 4JBHA 4YJFA 1DC8A 1FPQA 1HTWA 3O83A 4AYXA 2WZCA 2AOXA 3R44A 1Y6ZA 4E32A 2VRCD 1WEHA 3IJEB 1JZQA 1V35A 3CVXA 3G2IA 3N8NA 4NJMA 4EY8A 1NDQA 1Y3BE 1W1IA 3SDSA 1W0JD 3O0TA 5DBFA 1VGQA 3N8IA 4PRLA 3AONB 4CQMA 2WUGA 2JG3A 5EQFA 2F4NA 4YRGA 2C9OA 5LOVA 3PF9A 4KKVA 3DT6A 1LWNA 2FR0A 4B7UA 2HYIC 3KSUA 5HF8A 3JALA 1Z0JA 2ZIXA 3EHDA 1R5JA 1DJQA 2P75A 2WU4A 5HW0A 1OUMA 2KS6A 3EG5A 4QU0A 3DCYA 2CZQA 2HD4A 2R8EA 3S2EA 4Q9JA 5KJCA 3GSIA 4WBXC 3FI9A 5K8TA 5LLTA 3DTNA 5TEWA 1IE3A 3L92A 3TLBA 2HXSA 1F2TB 4AM8A 2C1ZA 5LZ9A 3AFOA 3T0FA 2AR0A 3DBRA 1X7WA 2ZZFA 3EGXB 3DZFA 4LOHA 1GTZA 1K3FA 2RH5A 4FC7A 3UWSA 3JPYA 3HPQA 2EG9A 4PYJA 3NGXA 3QY0A 3X1YA 1N32B 4XAQA 1HI9A 3ESAA 3RKUA 5TRTA 4LXTA 4NESA 1PNVA 3KFVA 1E79A 4RD6A 1CUCA 1N9KA 5H4HA 2VXYA 1E6MA 3KZ1E 1CSEE 2Q0SA 3CONA 3NP9A 2BP7A 2X85A 4REMA 4Z4ZA 1NR7A 1M2VA 4L1KA 2SNIE 5DP1A 4ZT6A 3JVDA 2GVZC 3AQIA 3I55B 2PX2A 5DHSA 1RI5A 3WNBA 1W19A 3H5WA 2AVDA 1JJFA 1B8VA 1X1BA 2G8NA 3BDIA 3QPVA 3ER8A 1U0BB 3NKVA 4R2XA 4KCGA 4UVDA 4F2PA 2JIBA 4QUIA 2HUPA 5DYGA 1M67A 2F7SA 2IXEA 4O2LA 4JZKA 4KAAA 4QOGA 2Z1MA 3LL4A 4RH1A 4RF4A 2NTJA 5JNRA 5LP6F 1W94A 4NCJA 4Q6WA 1QDEA 1FYWA 3THXB 1WVIA 3N8GA 3W7BA 1PYOA 2UZ1B 1YRHA 5BQ3A 3H8WA 3ZOZA 3CLRD 2NU7A 2WOOA 9ABPA 3D3EA 3AJAA 1K3UB 2GM9A 1AHNA 3OZTA 1KU0A 2E82A 4EYSA 1IAVA 4XLHA 4JJZA 1YXMA 3K9HA 4Z1MA 1M34A 1A7JA 2B4RO 4JXKA 2UUBB 1WUKS 3NNNA 4D4IA 4UAJA 3F5SA 4QXPA 1PX0A 3W2TA 1T3SA 3V55A 5C4IA 1GZ3A 1ZA2A 4HADA 3NHLA 2A0KA 2YRFA 4DV0B 2WWTA 3LUKA 3RU9A 4X7PA 2YZKA 5JQGA 2XMSA 3E03A 5AJZA 2PLWA 4AK9A 3KQYA 4XLEA 3ZGOA 5CB6A 4BMDA 2WLSA 1V3TA 2XUHA 3AHDA 3FVWA 3H84A 3ODPA 2G1AA 3BQMB 1NKSA 2JLSA 3F0TA 1UPTA 2PM8A 1L4MA 2G04A 3ZD8A 5LYJA 1PDWA 2G1JA 4MTCA 1K5DA 2C9DA 4GWGA 3CURA 4DJ5X 3D6JA 4EIWA 2P3QA 4MA0A 3MTJA 2J3QA 1Q7YD 1RPNA 3JR3A 3QJYA 4WLVA 5GTDA 3BT7A 2F43B 2GK4A 4B47A 3NASA 2DM6A 3KQQA 2PFGA 3PEFA 4A03A 3KWFA 4ARIA 4RULA 3OZRA 5DGCA 2FFRA 3HFSA 3PWKA 1ZM7A 3CYFA 5HKKD 1N5LA 2QTCA 5JASA 2IRWA 2ZIGA 1YS6A 2Z3VA 3FFTA 3O91A 2GYVA 3TLGB 1S8NA 3YASA 2HADA 3H2KA 1ABFA 3CRRA 4DJEC 3N5CA 3D1JA 2G63A 1V8DA 3MC1A 5DI3B 2GF2A 2JGFA 4BO2A 4ZGQB 1XEWY 3S7ZA 3EZ6A 4ZHQF 2GZ3A 3BWXA 1S7GA 1HL3A 1HZZC 5KHAA 1QKJA 3HCBA 2FEPA 4DNFA 3CEJA