1S4MA

Crystal structure of flavin binding to fad synthetase from thermotoga maritina
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
277
Chain Sequence
MVVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVHKFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRPTDARNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKFDSIEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of flavin binding to FAD synthetase of Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords riboflavin kinase/FMN adenylyltransferase
total genus 82
structure length 277
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1s4mA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1s4mA01
1WXEA 4I6JA 2J4DA 3SP1A 2PG3A 3IODA 4MWCA 1TEZA 1O97D 4DDHA 2I1LA 2QUIA 3PNVA 3UMVA 3G59A 5A88A 1WXGA 4ZT5A 3CVYA 2E0IA 4R2LA 1VBNA 3CLRD 1JIKA 2QJTA 3HZRA 3AG5A 3CLSC 1QNFA 4MVXA 5J58A 1WXHA 3A4IA 5TEWA 2E89A 4YMIA 3KT8A 1I2DA 3S3TA 1F7VA 1TYBE 2VTBA 4G5YA 4NX2A 3CLUC 5LFAA 3MLBA 1V47A 1O95C 2OV4A 2DERA 4XSVA 1ZH0A 3HMQA 3SEZA 4F3RA 2C5SA 1NI5A 4PBRA 2AZXA 3A2KA 1F9AA 3CVWA 3P0IA 3PRHA 3PNBA 4NATA 1QQTA 1A8HA 1KH2A 3G6KA 2AKEA 3VRHA 2ZUEA 4L2IB 3D6VA 2YWBA 1GAXA 3QTTA 4DNXA 1QJCA 4NZPA 4DDKA 3C8ZA 1OWPA 3KFLA 2CFOA 4K0RA 3QTBA 2VTBB 1XNGA 4MQ6A 5TS2A 2D13A 2GM3A 4MVYA 2VBSA 1N2EA 1F7UA 4MLPA 2DR2A 3DO8A 1PFYA 1KH3A 4HJXA 3LOQA 3ZGZA 1I6LA 3H05A 1KQPA 3X1KA 2QJFA 3A04A 1EUQA 1FFYA 3IVCA 1QRSA 2A86A 3ZJTA 4H3SA 2TS1A 1VBKA 3CLSD 5KHAA 1TYDE 4U63A 4XFJA 4EGAA 2R5WA 3KT3A 5BNZA 4DDMA 4RUKA 1N07A 1N08A 2NZ2A 2VBUA 4ZCTA 2CV0A 5DK4A 5FO1A 2CUZA 2QUHA 2A1TS 4G5FA 4MW7A 1NB0A 1OWMA 1VBMA 2JA2A 1F4LA 3LE8A 1YULA 4GU5A 1KP2A 4E1AA 5FNZA 2QTNA 1N75A 1XJQA 3P0JA 3IDFA 2A4MA 1NB9A 3TNJA 4ZCSA 2AG6A 4NDAA 2BTEA 2QTRA 1KAQA 2O8VA 1WQ4A 5DASA 3X1MA 3CLRC 2H29A 2HMAA 3KT0A 5HUJA 1PG0A 1N2JA 1NUPA 4NAHA 4JXXA 1O5TA 1KP3A 2QTMA 4MVWA 1G8GA 3K9WA 4MUNA 3H9CA 3GUZA 4XFDA 5LM3A 4QREA 2J09A 1NZJA 3SEQA 1X8XA 1NP7A 4ARIA 3DLAA 2DPLA 4MW5A 5IHXA 2J5BA 1MAWA 2X1LA 4JXZA 2X3FA 3N05A 1ILEA 4EG1A 4FZJA 4MUKA 1M8PA 3ZJVA 3FNRA 1JZSA 4KPUB 4KR9A 3IMGA 2RD2A 1WOYA 3LCJA 1H3EA 1Q11A 3N2YA 1K97A 1MBZA 2YXNA 4KPUA 1J1ZA 4X0EA 3H97A 3PNYA 2J08A 4K03A 3ZJUA 3RHSA 1MJHA 1M8JA 2PIDA 3AL0C 4CDMA 1YIDA 5DEOA 1KKUA 2ZP1A 3VU8A 4EG3A 1TQ8A 4YP5A 3Q10A 3CA8A 4JYZA 2BYTA 1WXFA 4MWDA 1K4MA 1NYLA 1NUTA 3X1JA 1GZUA 4MW6A 2OQ2A 4RPIA 1T6XA 3OTWA 2DLCX 4DE5A 4KR7A 4HPWA 3DPIA 3ND5A 1QTQA 1JHDA 5K0SA 3IOCA 1MRZA 1YI8A 3SZGA 4ZT2A 1KQOA 1N05A 3CR8A 4ZT6A 5TRDA 1OWLA 3FIUA 1O96A 4MW4A 1RQGA 1YUMA 2XRZA 3IOBA 3F3MA 1T9GS 1XNJA 4YP6A 4MUEA 4MUGA 3Q4GA 1I6KA 1WXIA 4MUHA 3CTAA 1WKBA 2V0CA 1COZA 1JMVA 1EFPB 1OBHA 3ILVA 2GKSA 3INNA 4WSOA 4ZCPA 3HGMA 2DETA 3HFJA 3RK0A 5JBNA 4ZT4A 4UZEA 2VXOA 1ZJWA 1GN8A 2A1UA 1NUQA 3FOCA 1UFVA 3IMEA 1I6MA 1N1DA 4JZYA 1WJGA 4MULA 2OYNA 3FETA 4YBRA 1GLNA 1Q15A 1JIIA 3UY4A 3ZXIA 3IUEA 3MXTA 4MW1A 1Q19A 1Y42X 2QUJA 3ZIUA 3FY4A 3P0HA 2D5BA 5H7XA 3UC5A 2J07A 4MUJA 1EE1A 2JAXA 2E21A 3CVXA 2YWCA 3UK2A 4HK4A 1G8FA 3HV0A 1X6VA 1ULHA 5TEVA 3D6UA 5F23A 1V8FA 5A8AA 1N78A 3TS1A 4CT0A 2G36A 1N77A 1HYBA 4L2IA 4PBSA 1EXDA 1OWNA 1VLHA 3FHJA 4MUFA 1M8KA 2A84A 1LI5A 2O5RA 2IJGX 2Z09A 1J1UA 1TFUA 1J70A 1IHOA 1J09A 2CYAA 1GPMA 4A91A 2QUKA 1PFUA 1JIJA 1U7XA 4CDNA 1NSYA 5AHWA 1N2GA 1J21A 3AG6A 3QE4A 3SYTA 4AS1A 4OUDA 1O96B 1R6XA 3COZA 1IH8A 4MW0A 2DEUA 2XRYA 3CLUD 3AFHA 4ND6A 4MUIA 5DB4A 4DLPA 4KKVA 2CT8A 3HL4A 1N2OA 3FG9A 1JILA 3CLTC 2EL7A 3MUEA 1N2IA 3IVXA 1K92A 5LLTA 4R0NA 1H3FA 5KCMA 1LI7A 1O95D 2QJOA 1EUYA 3E27A 1H3NA 3AIIA 3FWKA 5J59A 2CV1A 1OBCA 1IQRA 4J75A 3H9BA 5TGTA 1T6ZA 1T6YA 2A88A 4OUDB 2A7XA 5K0TA 1M83A 2DUMA 1N06A 2X1MA 3ND7A 3ELBA 3VGJA 4UZFA 1O0BA 4S1OA 1EFVA 3G5AA 4MW9A 4KR6A 1O97C 2PZAA 3IVGA 4MVCA 1O94D 4ZCQA 4U7JA 2JANA 4OJMX 4Q16A 3MLAA 3NV7A 3H99A 4HJRA 4JFAA 1EFPA 3SZ3A 3OP1A 3ND6A 2EJCA 4EG5A 1WY5A 2A1UB 1PFWA 1TYAE 1CT9A 1ZH6A 3NBAA 5H16A 4MWEA 3CVVA 1OWOA 3FI0A 4MWBA 1LW7A 5J5AA 5KWVA 1P4MA 1WZ2A 1KORA 4EG8A 3TQOA 2B7LA 4GRIA 2CSXA 2Z3VA 1QRUA 2V0GA 3UOWA 1MAUA 4QBTA 3DV2A 3ZXSA 1JECA 2VBTA 3COYA 2WQ6A 1IRXA 3P52A 3RJZA 4PBTA 2WB2A 4I6GA 1R6UA 1T9GR 4G6ZA 1MC1A 1MB2A 2ZUFA 1PFVA 4I6EA 1G8HA 1NUSA 4EG7A 1GTRA 3FH0A 1P7PA 1J20A 1SURA 1N2BA 1JGTA 4AQ7A 3KT6A 4EG6A 4ZT3A 1JZQA 1QU3A 2HGZA 1ZUNA 4EG4A 2VBVA 5HG0A 1D2RA 1IVSA 3COVA 1EJ2A 1KR2A 1IFXA 1N3LA 2CYBA 2GOYA 4MAFA 2CYCA 4P2BA 1VL2A 5EKDA 1N2HA 4PY2A 3TZLA 2D54A 1YUNA 4WNYA 1FYDA 2DXIA 4QRDA 4EFKA 1YIAA 4ND7A 3BNWA 1OD6A 4R2MA 2RE8A 3CVUA 1XNHA 1Q9SA 4ARCA 1QU2A 5IJXA 1U3CA 5A89A 1PG2A 1U3DA 3CLTD 2WSIA 3N8HA 1G59A 1S4MA 1MB9A 4EF6A 2WQ7A 1H1TA 1GTSA 3IH5A 1M8GA 3IMCA 3I05A 3GLVA 3RK1A 4DJAA 4J76A 4BWVA 2X0KA 3FDXA 3U1VA 2H2AA 1WQ3A 1M8FA 3ZUGA 4TS1A 1NURA 3ISJA 3L93A 4U8HA 2PZBA 4NAUA 3AKZA 3IOEA 1IQ0A 1DNPA 1O94C 2A1TR 4F4HA 2IELA 3JXEA 1MOPA 1O0CA 2YY5A 3L92A 1B6TA 1KAMA 2HZ7A 1U7DA 2CV2A 1Q77A 1TYCA 3N9IA 2PZ8A 3M5WA 1EFVB 3A05A 2NSYA 3RFFA 3TZEA 3Q12A 1JEEA 1KH1A 3SDBA 4ZT7A 4Q93A 1QRTA 5HUHA 2Z08A 1O6BA 3BL5A 1K4KA 2IP1A 1U0BB 5FO0A 3MMXA 1IQUA 3IUBA 2E18A 4CQNA 4YP7A 3TQIA 1KQNA 4MW2A 2P3MA 1JEDA 3RBAA 3GMIA 3PXUA 1M1ZA 3COWA 1R6TA 4ZCRA 1NUUA 3NBKA 1BS2A 3K32A 2PXHA 2PFSA
chains in the Genus database with same CATH superfamily
3ADPA 3SP1A 1P1KA 3AF2A 1O97D 3TGWA 2O3SA 1EK6A 2HIGA 4ITVA 1BU8A 4TZTA 4QGSA 4QOJA 4BJ3A 4IICA 2BUCA 1L6IA 1K68A 3FZQA 4UUOA 1K7CA 3OD1A 1R4MA 1N2SA 2B25A 2QVXX 3WZLA 1B6GA 2AUMA 4KPFC 3NTRA 3A4IA 3T51B 3IQGX 1X1SA 3CONA 1CVLA 4QNNA 4BQOA 4M9RA 5FTWA 3FFXA 3N8DA 4D44A 2AMVA 2X15A 2PX0A 4X7CA 3T7TA 1YJBA 2EG5A 2PR7A 5CMLA 3SQOA 3EDCA 1K63A 5L6MB 1EQAA 1AN9A 1CUJA 1TE2A 4YUXA 5BMVA 1ISPA 3FYDA 1VLMA 4N4AA 3SE7A 2ZRQA 4KGDA 4PO9A 3WYEA 2C97A 3C98A 4J3JA 4L4RA 4HLUC 5BN3A 1T3GA 1RE0A 1NQ5A 4I5GA 1FLDA 2BTQB 1CEXA 5IUNC 5CXXA 2QAJA 1C0LA 3TLYA 3WZ2A 3DB1A 5IRCD 2UXDB 5IAJA 5FYQA 5CDFA 3QX3A 3FVQA 4ZEXA 1I2MA 2Y71A 3FGNA 2CWWA 3PKJA 4G1BA 2JEYA 4YFVA 3TI9A 3ZVRA 2EKLA 3T6KA 3TSCA 4FC7A 4ECAA 2R2AA 1LX7A 4Q9KA 3RAJA 4RVNA 1THTA 1JEYB 2PGAA 2AI2A 3NBZC 1TM1E 2PHZA 5LP6B 1X1EA 2ZFUA 4CMBA 1PV1A 1EDDA 3JRWA 2CVPA 3W5AA 1NR7A 1XGKA 3QWIA 1FFXB 3V2UA 1JHAA 3IEUA 3OJWA 1T8SA 2EFYA 3OEEA 3QUTA 2JAWA 2QLNA 2WNHA 5CBKA 1H4VB 4R6WA 4LJYA 4C89A 5JDCA 3EDQA 5FEMA 5AM3A 4FT4A 4GZ3A 3WMGA 1QOZA 3OZXA 5BMVB 1ONOA 4ND8A 3RSOA 3SBEA 2UYCA 5I7WA 2ADFA 3L1UA 1Z82A 3QBTA 4WLEA 3UJ8A 4UVDA 1VG1A 1PX2A 2VHWA 3FRIA 5IASA 3HUDA 3VR2A 1UD4A 3IRVA 3F7NA 4FI3C 3S6JA 2GBIA 2Z5FA 1VCNA 1E1RD 1DS6A 3A14A 2GN1A 3NFRA 4P7JA 1IZ7A 2F9LA 2DBVO 1QO0D 4X00A 3SHTA 5EUMA 3SC2B 5HTOA 2YWFA 1KI1A 2GEUA 3A0UA 2TS1A 4I4NA 4JUAA 4KVGA 4RY0A 1G21E 4ER7A 1U9CA 2W6CX 2ZSDA 2PCLA 3AUAA 2J67A 4MWTA 1EAMA 2Q3DA 4X85A 2ZYSA 2Y1FA 2HBRA 3A4LA 3LQKA 4KXVA 1ZD8A 4ZO8A 4EGAA 1Q0SA 4DZZA 2ZM5A 3I37X 1NSTA 3UJHA 4IZIA 1DFIA 4ZYUA 1EDOA 2ZSKA 3OAAD 4FR2A 1N07A 2AZTA 3ROQA 1XZLA 1FNSA 1XZPA 4IYJA 1XAGA 3ADKA 3KXIA 4Y0NA 2WNSA 3K4PA 1XD2B 3IILA 3OLVA 3BIJA 1VQOB 2QDKA 3V8PA 3R7DA 2CUZA 4X1YB 4KITB 3C7DB 2VWHA 2NTNA 5C5DA 2VHVA 4YR7A 5KX5B 4JJIA 1U2SA 3OLQA 1BYUA 4NZNA 4C03A 4H7IA 4BS9A 3GDOA 2GO7A 3BGWA 4LBZA 3BIFA 5H02A 4MI3A 4RL6A 2HF7A 3MJCA 4R2JA 4EB6B 4Z1MD 2EHDA 2OKGA 5DTEA 3VU3A 4QG3A 1IOWA 3A31A 3KXKA 2ORED 1RC0A 1AV7A 3RUHA 3E8MA 1NP3A 2WUEA 2PPLA 3TCKA 4FGLA 3FWNA 2VR1A 4HEA6 4ZGQB 1ZIXA 5B3JC 5BWOA 3C24A 2AW5A 3DZGA 3REQA 4W6ZA 1UEXC 3JQ8B 3PVCA 1H1LA 2EKDA 4B35A 2OAQ1 2P35A 4E70A 1U0TA 2I6GA 5JIBA 2X3YA 3UNXA 3Q7TA 4Z7OB 3TIXB 1XAJA 1WU8A 1MW9X 1Z6TA 3OFVA 2QT9A 4MVWA 3M6MD 4PQEA 4Y6OA 1AHIA 3ITNA 3V8VA 3T06B 2BMWA 4URXR 3A1VA 3MA0A 3RODA 4BUZA 2B1JA 2VP9A 4UE2A 5F77A 5G3ZA 4J0IA 2RHHA 4HNVA 1G7TA 3KTAB 1XB2A 4B84A 1OTXA 2CBXA 1QQ6A 3B3GA 2ONJA 4HH3C 4IBOA 4BWVA 1CUFA 1L1QA 2AC7A 3CIFA 3ZE0B 2J46A 1EK2A 1U7TA 1U2ZA 1ORIA 3G0DA 4Q9IA 5LDDC 3W4JA 4QJIA 3ZJVA 3DLCA 5EWLB 1EK0A 4XKVA 1GUZA 3G8CA 4ZC8A 1K06A 3EG9B 3HQ4O 2DFTA 1DARA 4WT7A 4RA6B 1ZA1A 1JL3A 4PGFA 4DA0A 2PIAA 1T91A 1YOBA 3N2YA 1OI3A 5FI1B 1ZGZA 3ZY2A 3SJZA 1D0VA 1RBQA 3RHSA 4RPDA 3W5DA 5GZ3A 3HM2A 2B8TA 1DJOA 1LTKA 3MGGA 2WWXA 2Y2VA 4XZ3A 3QHQA 1NX6A 1I9CA 3VV2A 4LE1A 2VRCA 2XSZA 2FCRA 3DDOA 5GJWC 2GESA 2W6ID 5HIAA 3E9YA 3U17A 4HAOA 4WCFB 4JP8A 5JJIA 4QU0A 4J0HA 4TMTA 2PXAA 1Z0AA 2I67A 3BJRA 4QYIA 4BNVA 1HG1A 4JA2A 4MW6A 1E7WA 3DBHB 5F1OA 1TUIA 3PICA 3FI9A 3HP7A 2Q3FA 1TMYA 3QZUA 3LT2A 2ATXA 4BFWA 2NU9A 5HZHA 1JHDA 1VCIA 2ODBA 1XRMA 4Q3NA 3DNFA 1E3QA 3H6HA 3KOWA 1M72A 4I2VA 1P17A 3GFRA 3PVDA 4D82A 5LD2B 1MT3A 3KZNA 4REOA 3UMMA 4K2AA 4CI0B 5FAKA 2XAUA 2PT5A 4DCJA 5IXYA 1NIPA 3K9FC 4HDRA 3DTTA 1LLFA 1KFBB 3UKDA 1PVOA 1H2YA 3R5FA 3ZOZA 4MVJM 3PJFA 3BE8A 4AX8A 1JB9A 1KYIA 1Y98A 4ENVA 2BFPA 5BN4B 4M8KA 5IU6A 1EFPB 1HQCA 3D7SA 4KO2S 3IT2A 2W6NA 1G3MA 3HJCA 2VZLA 4BMCA 2QUZA 2WIJA 1F3OA 3H18A 3THXB 3EVFA 4G0VA 4YXWD 4OQXA 3ZPXA 2YJTD 5D86A 1HTWA 3SKYA 3QKRA 2VK2A 1I2ZA 1PUXA 1SGWA 3GMDA 3O4GA 4CQMA 2C5EA 2PBRA 1FFSA 1T3SA 4XLZA 2WHPB 3DD1A 2IZOA 3RTGA 1LBEA 1NG1A 1XTIA 1J99A 2C83A 2HA6A 4BP1A 1B14A 1M2JA 4MGIR 3GCZA 5DTMA 3EYWA 2YN0A 1E2FA 3R7AA 4JI3B 9LDTA 5IAAA 1T15A 5BOSB 1M73E 4R7TA 2X86A 2VG8A 4RBNA 3WHPA 5AVQA 1GCGA 1LNQA 2F17A 3DS8A 2GF0A 4I99A 4YAEA 2C0PA 5ICSA 4KO8A 2FWBA 2AJLI 2WQZA 3RHFA 1E1RA 1VSBA 2ISQA 2VYVA 2R79A 2FW7A 1YVRA 1V45E 2G17A 3GWGA 1I5RA 4JYPA 5DBHX 3PNPA 1A2KC 1HQDA 1I8TA 1PZFA 2AR0A 2PMCA 4E5MA 5BNWA 4RM3A 1RHJA 1SA0A 2LNDA 4INAA 4NJOA 4GMGA 1X7ZA 4FE7A 2R6FA 3OZRA 2E37A 1X14A 2A9JA 4M37A 3GAAA 1KZGB 4MSUA 4TSKA 5DJ5A 3RTBA 2VHYA 3LX4A 3TTWA 4KWEA 1XEAA 2A8YA 2LR0A 2ZAGA 3RYIA 4XEHA 5A7HA 3RIYA 1C3OA 1T9KA 2JKVA 2ZJ6A 4KQWA 1OI4A 3KOMA 3QKRB 3VNQA 5EPOA 2PGOA 4NS4A 3NYWA 4CT0A 3VZQA 1N77A 1NSFA 1DXQA 4PBSA 2IBMA 1Y3IA 1M2VA 2RBEA 1T9HA 2BJWA 2BBOA 1YMVA 4P82A 1Y89A 3ZZMA 3MQFA 1L4NA 3OEYA 1NMSA 1M2WA 2ST1A 3HEMA 3O8OA 4EZIA 1H85A 5EP2A 5I9MA 5I8PA 1USVA 5THXA 1RSZA 1H2RS 2QN8A 3ICPA 3ANLA 2HSEA 1CRQA 4O4IA 1GSIA 3UGTA 2G71A 1OLSA 2HK9A 5ALQA 1F4VA 4GFDA 3DH0A 2R6GA 4TYYA 3I9FA 1G291 4KXUA 1P6QA 3KOOA 1ZC4A 4BFTA 2JZOA 4DYHA 2HHLA 1ODKA 5DW0A 5A6SA 1D9XA 3GUYA 2PZJA 2ILTA 1E64A 3P9CA 4AVYA 1WHSB 1IY1A 3FPBA 4V0MA 3ZNPA 3O1JC 4GMXA 3T7JA 2I78A 2CJYA 2ZRDA 3LF1A 1N36B 3KNZA 2BI7A 4MUIA 4LW8A 5KKAA 4BNZA 1JH9A 3LVBA 3EIFA 3FG9A 1XMIA 2FH5B 2HH9A 3EQZA 3GDGA 3O4VA 1UBUS 1NBAA 3S8MA 1M10A 1KYXA 4ND5A 1L7QA 4KFTA 1P2FA 3ECAA 3ESCA 4LK2A 4ZV7A 4CM6A 1QHNA 3R7LA 3MG9A 2BR4A 4IP0A 1W75A 2QTBA 3G88A 3GHYA 5L3ZA 1G5PA 4M1MA 1J24A 3NTQA 5DM60 5JS1A 1DB3A 4G0YA 3RV4A 2O2CA 5AOAA 3OQNA 2Y67A 2VC2B 3Q7PA 1GJRA 2AIRA 3SJCA 3RJTA 1C50A 3QJ5A 4W1SA 5LA6A 1SKAA 3KK0A 4HNHA 3A6HA 4FPXA 3LP5A 1F8GA 1T2UA 4HNAB 2BFMA 3CRZA 2QI9F 5FNVF 2EKZA 1L3BA 2PX8A 5HZMA 3DOOA 1CUIA 4AIRA 3LHDA 1MJFA 4S1OA 1EFVA 3PDUA 3Q5EA 4NMMA 5HIIA 3TQCA 4FHFA 2A9RA 2BFBB 2FGJA 2I7VA 4NSNA 2B0JA 3GGGA 4NDZA 3VO9A 4FM9A 3WWCA 4BRZA 1DBPA 3GJTA 4IIXA 2MYTA 2XB4A 5HKLA 3BRCA 1KC8D 2SKEA 2VYQA 1RJEA 4M2LA 3I83A 2QX9A 5HVNA 5CAEA 1N33B 3NXKA 1FPMA 1YB6A 3DZIA 5CJJA 5JG7A 5KZMB 4P80A 2W2XA 3C0KA 1OXUA 5IDQA 1F2TA 2XNHA 3NBAA 4XQEA 1ZZEA 3ZVLA 3CPEA 1UWVA 3P8ZA 2Q1SA 4U7FA 2V6BA 5IVDA 3PC7A 4CLEA 1T0BA 1QIEA 1X7DA 4EATA 5LIPA 2LKDA 2H1HA 4X92A 3WLSA 2CSXA 1E6KA 2TSYB 4REMA 4BY9E 3M6LA 1TDJA 4TVBA 5KNBA 2R0QC 1UD5A 5IHPA 1J42A 2HQSA 2XH8A 4W5NA 3SSNA 4B3MB 2VZ9A 3ASQA 4C1BA 1AM4D 4KXFB 2B83A 2HCTA 1EFKA 1PD1A 1R9NA 4MUAA 3UATA 3C7AA 5C52B 5DV9A 4B6RA 1N2CB 1XRLA 2BR3A 3F6PA 3AEYA 3P0EA 1GPDG 4IH9A 4I6EA 4MWZA 1U2GC 3MTIA 7GPBA 5K3CA 3S44A 1P0CA 2ODNA 5I7UA 4P92A 4R4JA 2JFOA 3FZYA 3DEIA 2GTIA 1NYRA 2W9XA 4UPEA 3OCCA 1U7WA 1Q3KA 1IXRC 3K5IA 3Q88A 4UHEA 1D2RA 1U7PA 3ENWA 3LFUA 3DZFA 3OKXA 3COVA 3NZEA 5H9WA 5LQKA 3P9QA 2F3RA 5CA0F 1Z8HA 4RC9A 1Z63A 5A0TA 1ENOA 1VGVA 2CFSA 2P68A 3NETA 5AW7A 4US0R 1L4MA 1KOJA 4HB4A 3ZHZA 5DLYA 4Z2AA 1SKQA 5B2EA 1GZ5A 2CXRA 2QMZA 4U2KA 4ZVUA 2KE5A 4WNAA 3WLIA 4Z9BA 2W2KA 1JHMA 3T1TA 4Z4EA 2DAPA 4TV9A 2VN8A 1ZMXA 4UFPA 3VHQA 5D6OA 1E2UA 4OBWA 1TVKB 3CU5A 4DC0A 3YASA 1XYYA 3D81A 1QIFA 4B4VA 1E96A 2Y1KA 2VLIA 4HC4A 4W1PA 2JFZA 4A23A 2VIIA 3AEQA 3EOAI 2WSIA 2VDUE 4DHWA 1L4GA 2CL7X 4Q4JA 2XE6A 5KYUB 2ZM6B 3SG0A 5IDXA 1EG2A 2ATIA 3RBVA 3LV8A 3OFKA 4AO7A 3V8BA 4CIXA 3PJRA 3VJKA 2NQTA 3FCCA 3GEEA 1C1XA 5BNTA 4I19A 3W5CA 2K4MA 2B4TO 5KTOA 2OGWA 2W58A 3P9RA 4AXXA 1DC5A 3T5AA 1CUAA 1DDOA 2OMKA 1VJRA 1HXHA 1EFRA 4Y0AA 3ZE2B 4E08A 3IOEA 3NIWA 4RE5A 1DNPA 1O94C 3DYIA 3OOJA 2ODWA 4M9UA 3UCEA 3ZE9A 4BYGA 4DABA 2GPYA 2I2FA 4EO7A 1RXWA 2IELA 2R60A 4CM9A 5KJEA 4XN0A 2XOKD 4PWYA 1YDWA 3TDNA 1QRAA 2RHWA 3QFTA 3FPGA 1GNRA 2F1IA 4FILA 4K3VA 4KYUA 4PG6A 1OC2A 1YB5A 4NWIA 4WWHA 4FE4A 3GJ0A 3AH8A 4X1IA 2FEOA 3UHJA 3SYLA 3ELWA 3R0IA 3F6YA 3JARA 3CN9A 5A1JA 3OO1A 2QMEA 2FP3A 1HFKA 4YWJA 4PV7A 4Z3KA 3IS3A 1PZMA 1U0BB 1CDOA 3NO4A 5CDSA 1HDEA 3RU7A 3C1OA 1D1SA 3NORA 4YJKA 3I2IA 1KYTA 1PVVA 4TV8A 2M1ZA 1LFDB 2YDXA 4IDCA 1SIBE 1PJAA 4BWGA 3OCUA 3FCYA 4GE3A 2K7FA 3JATB 4QO8A 3NEJA 3RS4A 3UFBA 2OHFA 3PXUA 5LZ9A 5CDGA 1I7DA 1Y33E 2BUAA 4EHNA 3C5EA 5J35A 4MR9B 3BB3A 1FXSA 1FYFA 1C4WA 3K32A 2WIBA 2F4VB 3AGQA 1BMFD 3G2MA 4RHEA 5L7TA 3IODA 3P4YA 4IGFA 4GP7A 2H17A 3MJTA 3PNVA 3GCDA 3OM8A 1CS0B 3P20A 4PX9A 3H6KA 3O31A 2ZIAA 3TFQA 4HVLA 3K4HA 1KGDA 1UZAA 3LC2O 1ZAYA 4A8JC 3AF0A 2WKQA 3CLRD 2V4UA 3O0TA 4PAWA 3P26A 1VLYA 3HR4A 4EGCB 1F2VA 4KN8A 2I1QA 4RSGA 5AWFC 2O2YA 3GJRA 3VUEA 4J0JA 2QTHA 2YZKA 1BA2A 3O8BA 4C14A 3K6KA 3LXRA 1JP7A 1JW9B 1MNQA 2Z3WA 1H5UA 4OGKA 4Q4AA 4S12A 2GHIA 3RF6A 5EJ8A 3OW7A 2VF4X 3KE9A 1ZW6A 2CUKA 3NYIA 5IYZA 2IH5A 1YZTA 2N0SA 1LVHA 1NPTO 4PZYA 3PQ6A 5CJPA 2ODQA 2OV4A 3E9DA 1NHGA 2Q9CA 1RZUA 1L7XA 1X1AA 2VBIA 3SZOA 4DSOA 3HHEA 4GBED 5CDFE 3ZHOA 1PZGA 4TL9A 4D9GA 5A5FA 3LVQE 2GBFA 1WXWA 5C1DA 1OR8A 4FFMA 1V35A 4TMWA 2PLRA 5CG2A 3NNSA 1XWFA 2OHXA 1Y1QA 3PBKA 4Z4GA 2OHGA 4NE7A 2OZPA 1NFRA 2BAGA 3QXJA 5H3LA 2JH8A 3IIJA 1MA3A 4RKYA 4YIHA 3W9YA 3W5HA 1RKXA 1L7OA 2C3PA 3CG4A 3TTXA 2J7PA 4LTDA 5CFZA 4UC0A 5IULC 3SYKA 1YCHA 4MEBA 2X5OA 4J7UA 1P39A 4GT1A 5CRIA 3UH1A 4DCTA 1WXQA 1N0VC 4RHFA 5H83A 4CMAA 2B4QA 2D5IA 2YZNA 2IU4A 4NZPA 4C4RA 2VBGA 4XLLA 2PT7A 1V2GA 4IIBA 1PTJC 1OH5A 4K3UA 4L3OA 4EGQA 1G5IA 2H2HA 2ZPUA 3PQ5A 3U7JA 1Q3HA 2C1ZA 1UBMS 4GF5A 2FGKA 4YUVA 2PMEA 2XB2A 1Y8RA 1VHQA 3R8FA 4NAVA 2INGX 5JBIA 3G8BA 1I0ZA 2F48A 5CP8A 1F17A 5ICFA 3DMYA 4P9NA 2COUA 2GKGA 2AJBA 1I6LA 5EMNA 1H4QA 1YA4A 3PEWA 3K70B 1ZK4A 3GXBA 2XBMA 4L4UA 4Y1GA 3G2NA 4WXEA 3LC0A 3C14C 1JEQA 1VQNB 1WHTA 5LZ2A 2P6NA 3SVLA 4B31A 1LQ2A 2JBWA 3EXHA 3OT1A 4XD7A 4L6AA 2IPMA 5KHAA 4N5LA 5AHXA 4HQNA 3Q3AA 1KDTA 3CY6A 4M1WA 4BOYA 3SC2A 4C4ZA 1FX0B 2FMIA 2MINB 3OZUA 2XCRB 4M49A 2PNJA 4FQ8A 1W4BA 4ZVVA 1K8ZB 3EBPA 1BC5A 5A2QA 1E9RA 4Z86A 4NXMB 3RVRA 4CR6A 1X7GA 1ZSYA 3DYVA 4HF7A 4MWGA 4OVKA 1Q1AA 1Y80A 4DA4A 2VRCD 3N0RA 1TCBA 4LF8B 2ZATA 2CNKA 1V4BA 3ILSA 5D6NA 1MAHA 1UK8A 2IYWA 3DG9A 1RLMA 3Q3EA 4DDWA 4MP3A 1SQFA 2NYRA 2GI4A 3H9EO 3PR1A 1CJCA 5F4BA 3EZXA 1NXVA 2ZR0A 3TLKA 3T1QA 2CVFA 1XJQA 2QTNA 1M2FA 4P3KA 4QX6A 1H65A 3BH7A 5FUWA 3BH6A 3V4SA 4ZCSA 1WETA 1VHJA 2YASA 3L0ZA 1W30A 2PX2A 1HE5A 2VNSA 5ECWA 1YC2A 3HTXA 4FS8A 4PLHA 1XMJA 4QUZA 2O8VA 2BN4A 2IUYA 3E9CA 4UQLA 4C5CA 3IAS6 1PK8A 4B4KA 1UBHS 1KL7A 3O91A 3D4OA 4JLMA 4NNPA 4BFVA 1E2LA 2H29A 4DANA 5ED4A 3AFNA 2BGNA 4IINA 4O4JF 3VH1A 4ESVA 1N2JA 1QVRA 2YR0A 4BAZA 1NUPA 1P7ZA 1R9GA 5ILOA 5G40A 1H5QA 1VQ6B 3OM1A 4KDFA 2G80A 1KSFX 4RD6A 3CEAA 3PUYA 3ADOA 3C39A 1WD5A 1RADA 5AKZA 5LM3A 2NV6A 4YGXB 2I87A 3LX8A 5HSGA 1ONSA 4QXAA 3RC9A 1O08A 5ANRB 3CWCA 4MKXA 3VZRA 2HDWA 4BMXA 4LZNA 3MS2A 4IDGA 1S1CA 2C78A 4QPDA 3T5DA 3W6PA 3W4KA 1ESDA 1IZYA 2DMRA 1W0JD 3HEBA 3ITDA 4BEWA 5DBFA 4C7XA 2YHAA 1THGA 1Z73A 3RS7A 1CIJA 2RD2A 4N0QA 4S1TA 3WLQA 3QE3A 1QKKA 1WP6A 2XDAA 5JALA 1J2TA 2A59A 2Z3ZA 4HYTA 5HA5A 3CPSA 3O9ZA 1BCSB 4I50A 4DLXA 1K9SA 2PL5A 1UH5A 3LBIA 3ZJUA 1OPXA 4UCWA 2D4AA 3ZWPA 1PRYA 3AF1A 2XOEA 4QSMA 4IJ6A 5B1DA 3T0GA 1HQYE 4E22A 3MMPA 1DG1G 3ECSA 2BKAA 1W0KA 4AYXA 1N2ZA 3HZOA 2GBPA 3TW4A 5HM8A 5CFMA 3Q0IA 4RD0A 1MDFA 2JJ1D 1GUFA 1D2AA 3T52A 1X7YB 1L4LA 1QTIA 3E6AA 1AKQA 3D4BA 3F9CA 4Z7QB 2QPTA 4DE5A 1AGYA 2F9FA 1O57A 4HPWA 3R3WA 3OWOA 2DFDA 2OK7A 1ZRMA 4TYMA 1E4VA 1N8TA 2B82A 3G2QA 1RKVA 4V03A 1NBMD 2XB6A 1NXXA 2GJPA 3UG6A 4L27A 2G9ZA 4OXXA 1J8QA 1EZ1A 4TTQA 1E1QD 4R5HA 1MCZA 3TG2A 3W05A 1M6VA 2OHJA 2C2ZA 4KSYA 1ZI8A 1WRBA 2JGJA 2VK4A 1LC3A 4JA0A 3RY8A 2GAFA 4MUEA 4KQXA 2OBLA 1XAIA 4HMPA 1COZA 5JO9A 2G7MC 1OBHA 4M7OA 2VHQA 4E2XA 4OPMA 1FX0A 2MINA 5TNXA 4ZANA 3SCZA 1LWOA 3KVOA 4GKKB 3R3HA 3FCXA 3OQMA 1HBJA 1XF9A 1W0CA 1W44A 3CCRB 2IP4A 1FK8A 1PO7A 3NPMA 3RK0A 3V7YA 1L5HB 2DPHA 4YCAA 2OCAA 4BV8A 1GN8A 2X2PA 1EWRA 2FPLA 4N8SA 4X1KB 3A9UA 3BPSA 5CH8A 1QXSA 1LSUA 5JI2E 4EHDA 1FFXA 4DQDA 4UAGA 1T5TA 3OE4A 5ILGA 2OZKA 3E9NA 3WWEA 3VKHA 4CG2A 5SZHB 2P7IA 2V5VA 3QJYA 5L3RA 1MV8A 2JDID 1CYDA 3V55A 2O8FB 1XALA 3M34A 1DBIA 3BMXA 2Q2OA 4EA9A 1XVLA 2Q3JA 3CWQA 3BDIA 3GFBA 3JVDA 1VMAA 3HYCA 1Y1TA 4GL4A 1BA3A 3CMAB 1LF0A 3KQYA 4QUDA 1H22A 4URYR 3TLBA 4EY7A 4ENQA 2DFNA 4MHTA 3H5IA 1RHRA 4BNGA 1QCZA 1IN4A 2IWRA 4YPOA 4CL2A 1U2QA 3VVLA 2CGEA 2FOLA 3WL5A 2DX7A 3HV0A 4YP1A 2HGSA 4ZRDA 1A7UA 1GPWB 5F1PA 3GQBA 3OTGA 1GPUA 2JS7A 2J3LA 2NV0A 4BMYA 1EZ4A 1P0MA 1N34B 1K88A 4BMNA 1XU7A 4AF6A 1MN6A 4R7GA 2OFWA 5BRJA 3B9PA 4L7VA 1KZ1A 1QHFA 4ZAVA 4ZOCA 4DMFA 1EXDA 1M2NA 4LZAA 4M0KA 2UUBB 1R7RA 4JOQA 1P1JA 1JLLA 3I6YA 3F3YA 3G9XA 4HGPA 4P4LA 1I18A 4BASA 2C7GA 2J1LA 4IJWA 5HPYB 5CLJA 3D7RA 3AETA 1CRZA 1FUKA 1OZHA 1AKYA 2QUKA 3DV0A 1LPBB 3B6JA 3GFSA 3IEKA 1FFCA 5EZYB 5HDBB 4ETMA 2IW3A 4YR9A 2JFQA 1U90A 2FZ4A 4G0ZA 4FYVA 3PPXA 3WFIA 4RCZA 4A6EA 5CW2A 4F4CA 2I6SA 4ZAXA 5ICGA 4OLBA 4TLAA 5E3JA 3IQIX 2R96A 4JKIA 4O0LA 1XQBA 1H93A 2HM7A 2XZTA 3I9KA 5E2BA 4AP5A 5C1PA 1KJ8A 1A8SA 3NRBA 2Z1NA 5A5GA 3DLIA 4E46A 3D26A 1UXJA 2AHOA 1ESEA 3OETA 3M9WA 4ND6A 2V7TA 2LUOA 1AO3A 4EHAA 2Y0PA 3U4CA 3FNBA 1ZKMA 4I5FA 2PUWA 1VIAA 4X8OA 1IZZA 1RFGE 4HMQA 3EFHA 2G1PA 5H4GA 3HKBB 2EL7A 4G5SA 2HDHA 1NM5C 1VMKA 2XUPA 2XA2A 4UVGA 4WXHA 4Q6BA 4BX9A 3BK1A 4RPKA 5DNDA 2YFQA 3FOBA 4V3CA 1H3FA 2ZITA 4XARA 3M4XA 5IANA 1BYIA 4P5DA 4K1XA 1VZ3A 3SSAA 3RS5A 4J75A 4RK0A 4DDUA 5HF5A 2QL9A 3SICE 2ETXA 4FX5A 4ZQIA 2Z0MA 4MGHA 3HUTA 4HPJB 2FF5A 4R40A 5A5EA 3CW2A 3AJDA 3QP9A 3PNOA 1QV6A 1Z2AA 4C20A 4ZAWA 2FDRA 2XTNA 3VTKA 1XQVA 2RSLA 2X1MA 3I1JA 3TJMA 1Z13A 2PUAA 1WCYA 3PL1A 4KPEC 1JDJA 1QH9A 1RBMA 1R4NB 1Q7EA 3QEBZ 1WUHS 4NYIR 1JALA 1G2QA 3G2HA 4FHEA 3WKBA 4CIVA 4W5RA 4ECEA 1NJSA 1R0XA 3EPKA 1KQ3A 1T2AA 3CH7A 3K1AB 3OEWA 2EIHA 4RGBA 1K6XA 3DDSA 1E61A 3JQFC 4JIMA 1Q7BA 4R1NA 4DCPA 3J80A 4TKLA 4ZZ3A 3U56A 1HC7A 4QULA 4IJ5A 2AI1A 3LW7A 5DHFA 3QUBA 2XHZA 3D8RA 4FQ7A 4IGKA 4Q16A 2AJ8A 4JFAA 1IATA 2KLHA 2GYYA 3T7KA 4EG5A 3DVRX 4KB5A 1PJ4A 4N3BA 2A1UB 3LFTA 4BO0A 4MAMA 1GY8A 3C2QA 4DCMA 4EHFA 5HNKA 1A9ZA 3FFBA 1RVV1 1YFKA 3C3EA 3UPDA 3WOHA 2ODTX 2J9XB 1NMYA 4DCCA 5F7ZA 2X7JA 3EF0A 4AJ4A 1X9IA 4YRCA 2H2WA 2BTOA 5FORA 2PRSA 2YHBA 2EP8A 1WB6A 4PTZA 1ISSA 3CLKA 5CJ2A 1L4YA 5B1HA 2Q5FA 2PLFA 5EFZA 2O7VA 1AGPA 1CNEA 2F3PA 4N3AA 5LPNA 2WFAA 3D3QA 4TT3D 4MH0R 5BURA 5HM6A 3SJPA 2QX7A 1G19A 4LOKA 1T9GR 1XZDA 5DBEX 2RARA 1J25A 5E6UB 2P3QA 2XB8A 2MYUA 3VR5D 4A36A 2VJLA 2QT1A 4Y30A 4GOOD 3AVOA 2V9CA 3F90A 4NH4A 4EMUA 2XNCA 4E7PA 1JGTA 1W2WB 1B7GO 1SG0A 1XEWX 4M0FA 3UGQA 3WNVA 4AJJA 2NW6A 2WU4A 5BW4A 1M2EA 2N47A 1M1UA 2OILA 3SDSA 1QB7A 2CVOA 2GTPA 3SVZA 5K45A 3THWB 5HZGA 1ULBA 4EG4A 2CVQA 4X7PA 3RRFA 4URFA 1JVSA 1UD6A 1HE4A 4L5CA 5BV8A 4K9LA 2H48A 4ATNA 1EAYA 3GMTA 3A3BA 2CYBA 3QY9A 3AJ8A 4S05A 2MSNA 2QWXA 5JROA 1OCEA 1VMIA 3AYXB 1HEUA 3HVIA 2BY4A 3W2EA 1LLDA 1TU4A 4LV8B 2Y0CA 4M9CA 1T2VA 2W6OA 4OPVA 3T3PB 4TZ6A 5ICMA 4DHEA 1NFFA 3MTJA 2O48X 1JBQA 3NCHA 4IQFA 3FYUB 4OHOA 3PC2A 4AJOA 5EJ5A 3H2IA 2XVMA 4JSRA 1IK6A 4RORA 3H9UA 4ND7A 4MK4A 4V0KA 4KR2A 1E1KA 4B48A 3EAGA 5LZ7A 4JI7B 4U5QA 3VQTA 2DQKA 2XAAA 4FNMA 3S40A 3ZLUA 2RGCA 4ZICA 5BSEA 1W9MA 3GLQA 4GOJA 4G67A 1C4OA 1L6RA 4JXKA 4PHFA 4QHTA 1PWXA 4ZAGA 3EYAA 1BMDA 1AO0A 3EPRA 4OMUA 4OP3A 3CUUA 3DJFA 1KXJA 1IHYA 5KNCA 5FUXA 2XWPA 3R0XA 3WK4A 4I8DA 3FLEA 1VL0A 1FVOA 3P4UA 3WY9A 3TTVA 1ECPA 5JSKA 2OBMA 2BRUC 3Q3GE 2ZZFA 3FDXA 4UEJA 3RKSA 2ZIZA 3SJBA 4WCVA 4TS1A 2IQIA 1N8RD 3F71A 3BCDA 3AR2A 1FVHA 5FWYB 1ZQ1A 5L4LA 1PJBA 2BGLA 3CURA 3TLEA 2XMPA 7ABPA 4NAUA 5K2OA 3L7YA 2HNKA 4IZOA 2W90A 3QMPA 1HTTA 2I1VB 3L46A 3K53A 2G67A 1P8JA 3G79A 4QPZA 4ZVRA 2YICA 4Q19A 3RIXA 4WK4B 2YY5A 2W98A 3L92A 5FR1A 2O5VA 4CBVA 1R8JA 2GHQA 1VRVA 1RQ7A 2QQGA 4JD5A 4JB0A 1SHTX 3PXGA 1EFVB 5ALZA 3U3ZA 2AOWA 1G38A 3C3YA 1TIKA 4IDNA 4J1TC 4RKEA 4CMGA 4HUQB 4OP1A 3GEDA 4ZT7A 1QRTA 1DTWA 2H1IA 4LZWA 1R0YA 2FN7A 3ICEA 2QORA 5JD3A 3L0OA 3MFYA 2R8ZA 1NL3A 4NRDA 3NP9A 5BQ5A 3QU7A 2VP4A 3HO6A 2O1EA 3IUBA 3L84A 4W5TA 4G7WA 1Y5NA 4ZQFA 2B7BA 2P90A 1PGPA 3H94A 5EZQA 4C06A 1SKUA 5JQGF 1HA3A 1H05A 1RIIA 2O23A 3L7AA 3HPRA 3TZQA 3A6JA 1KU6A 4BO4A 3QEMA 4TL7A 3COWA 3F5DA 4QJ3A 4L2IA 4OOSA 4HVAA 1QG4A 5AJTA 5DFAA 3ZGYA 2J4DA 3HJFA 5JY1A 1IOZA 1YB7A 3QVMA 3TOXA 5B7QA 4JVOA 1WW2A 1ZQ9A 1DAHA 1KI6A 2X5KO 2Y4OA 2YZ7A 3RAEC 2JLUA 3TLAA 1RAEA 4MA5A 4X91A 3GP3A 3SWWA 1OBVA 4C5BA 2QJTA 4ETIA 4L22A 3OPQA 3MQ2A 3IBYA 1SU7A 1FFHA 3AILA 4X64B 4AZSA 2GX6A 2H85A 2XZDA 1WCXA 1FXUA 4JI5B 3TLGA 2QTTA 3WNZA 1ZNYA 2AG8A 4GPTA 5DXJA 1ZMRA 1ECJA 3DVAB 4I08A 5U4XA 2E89A 4CLXA 1PJLA 2WF6A 2C4TA 4Y6RA 4O2BF 5T4EA 3ILYA 3T3IA 4WBXC 2VQSA 1BFUA 1BJTA 1S9DA 2EJUA 2VH5R 3ENNA 4XVQA 5AVKA 3FZNA 1UINA 1W47A 3VOSA 1PLKA 2QIOA 3OQHA 3VR4D 4DC9A 4OJTA 1KDYA 3FPAA 1DI0A 2I33A 2C5SA 3HFRA 2XA1A 3UJBA 2NAFA 5B7PA 2YOGA 3CVWA 2QP4A 3DBOB 3PNBA 4IGAA 4NFSA 4XIGS 1KH2A 3O8QA 2BHTA 4MYTA 4WPGA 3BK2A 4AZ0A 4AMYA 1ZITA 5AP9A 5HQTA 2XOKA 2CVZA 2XWQA 4FGSA 2EKQA 2L42A 4H7HA 4R69A 5HF9A 1UD2A 3AFIA 4I4LA 3IELA 4FZVA 3BWBA 3A1TA 1T1EA 3GPBA 4AN4A 3UF0A 3IOYA 4L3VA 4W9RA 1VB3A 3JZIA 1J23A 1WEHA 4QYXA 1JDTA 1QJCA 3AM3A 4BV9A 2CHQA 4XX0B 3SXPA 4R7ZA 3O38A 4UM8B 2HV9A 4E88A 2BEUB 3K0HA 2GKOA 1WSDA 2P1ZA 4F60A 2G5PA 2HQBA 4GI3A 1QIJA 1MNAA 3FR7A 3H1BA 3OQPA 3ORRA 2VBSA 1J8VA 2CXOA 1PJSA 3TOVA 4IOLA 2H54A 4ETNA 1Y8CA 1CHNA 1NYQA 2FPPA 4MLPA 5C46F 3LGSA 2O20A 4LYHA 5A9RA 5E6UA 2D8AA 3TKLA 5SZKB 1P6UA 1U0FA 1TB4A 2I99A 5EHGA 1H1LB 2AG1A 2ZRAA 3MUNA 5F7XA 2FUNB 4R9SA 4BGVA 3K8YA 3CNEA 4RK6A 3W3AD 4QGHA 1HRKA 4L9WA 5K8TA 3GHHA 1LK7A 3KALA 3Q5DA 3LXMA 3GN2A 2R1TA 1D4ZA 1E89A 2R1ZA 2VVTA 3DO6A 3IGFA 2Q4BA 3A4MA 1RXIA 4U6SA 4WZ6A 1JJAA 4BFCA 1UKAA 3QOXA 4B43A 4DA6A 1I30A 3IT0A 3ESAA 3PX2A 5CLFA 2P3OA 4UBMA 1WNTA 2EU8A 4DDMA 1CY8A 2V9ZA 1BDIA 3CT4A 3PQCA 1V7QA 2R66A 1HL3A 4UM7A 5DYGA 1F20A 2ZWMA 4HFRA 4O25A 1Y4AE 2A1TS 4GE0A 3HXLA 3AYZB 5IAOA 3B9QA 4ZOAA 2C3MA 2NMVA 3T56B 4LCEA 4RGYA 3TXXA 4OKIA 1ZVMA 3CH4B 4QXPA 5HFAA 1ZO8A 1Q0RA 3F74A 3IUQA 3TTTA 4GH5A 3W8EA 3ZTTA 5ADHA 2HHJA 3INRA 5FNVB 1XVTA 2AG6A 3AHEA 3DUFB 3IVRA 4WI1A 5FA5A 4ZEWA 3H4IA 1YQWA 1V7CA 3WO0A 4X93A 1NWHA 3LK6A 2IOFK 3WWPA 3K5HA 2BKUA 1IUPA 3I55B 2DBYA 1TUBB 3MJVA 4HTFA 2QTVA 5AKEA 5DLEA 4Y2UA 1G7RA 2HL6A 2SBTA 3BK7A 3IT1A 4LYJA 3IAHA 5ALXA 1YAJA 2GHTA 4DSUA 2EGGA 3LSYA 4J03A 4QICA 3SIPA 2F00A 3U3RA 4L5BA 3I5YA 3QKSA 6NULA 1SQ6A 3JAWA 1QFSA 1MENA 1Z6AA 2P4SA 3GUZA 1KJZA 4S2UA 2ZRNA 3ZWWA 1KDPA 2ZI6A 3DKKA 3RTEA 2QS9A 4TTSA 1NP7A 4YGYA 2CHFA 2R7NA 3B9RA 2Z6UA 1PZHA 3SKBA 5A3JA 1FMLA 3FNGA 2J6IA 2XYPA 3EC7A 5JXWA 5D87A 5EJ4A 1EP2B 1QLJA 4P4SB 2IDKA 1A5AB 1Z5WA 1FE8A 4PGMA 2IF2A 3ZNOA 3JR7A 3NOQA 3O1LA 4DTIA 3M6IA 1MO3A 5DNCA 4RD4A 3B3JA 2QQEA 2WF8A 4IVQA 1RYFA 3L8YA 4YO8A 2AEJA 2NU6B 4MR7A 4QAQA 3F3KA 4AROA 3FNHA 3IXLA 4KPUB 4PSCA 1Z25A 1B3RA 4X44A 1C1XB 4W7SA 2XUIA 4DL9A 3FXAA 2CHEA 1KC3A 4BQQA 5F4JA 4BVFA 4F4DA 2GO1A 1CEYA 5LJIA 4D7AA 2X2EA 1BROA 1N1GA 2JGDA 1P81A 1Y8QB 2WA2A 2ZIUB 3HWWA 4H16A 4MIYA 3H97A 4X0EA 5E4FA 3D3WB 4DDTA 4QBFA 1NT4A 3RHTA 3TQQA 3ZDCA 3W2HA 1TECE 4ARSA 1AV6A 1FDSA 2AE1A 5BRNA 3N6VA 1H8ED 2LBPA 1R66A 3IBTA 3EWNA 1DMRA 1O6ZA 2C2MA 4DM7A 3DWEX 4E5UA 1RBYA 5AFSA 5H59A 121PA 1SCNE 1IMOA 1YL6A 3L18A 1OYYA 2WUWE 3X1JA 4M8IA 4AJEA 1W49A 4WESA 2JIPA 3NHRA 4RJJA 4B17A 5KSPA 3ZC3A 4JJ6A 1LS1A 2CMFA 4UFNA 3DTVD 2XQKA 4RKRA 3TH5A 4E6PA 4BRWA 1T10A 3MT0A 5CIWA 4JGGA 5JI3E 4UU0A 3SBDA 2LKCA 2YY6A 1YI8A 4PPQA 4AT1A 1TTQB 2BHRA 1EKXA 3S7ZA 5BSMA 2CXNA 1Z5PA 1QC5A 4I9GA 4H1WA 3V48A 2XRZA 5HGJA 4D5GA 2CZGA 1N4DA 4YJ2B 1LD3A 1PZNA 3CUTA 5BVHA 3HVRA 4LHWA 4KSCA 1KYZA 5MGBA 4ME6A 3FROA 3K6JA 4O08A 3X44A 5A6VA 5AESA 1NF3A 3CR3C 1PP4A 2XWBF 1HLFA 1PW5A 1GZDA 3GC6A 2IC5A 1QYXA 2ZR7A 4JROA 4OHFA 2L69A 1Y6FA 1GD1O 5K05A 1ZVVA 5I48A 1ESZA 3BD8A 4LHZA 4YC7A 5IBQA 3DTVB 1D1QA 2FE4A 5LZ5A 4WKCA 1WG8A 3CF4G 1B8PA 4PHHA 4JT8A 1ZGBA 2ORYA 4QGBA 5EJFA 3RGWS 4PQFA 1T2EA 4JZYA 3IP6A 3BQ9A 2YWHA 2OYNA 4DQKA 3J81k 4KLCA 4DA9A 3DL2A 4ZJZA 2G04A 4ESOA 4KOAA 2EX1A 4KQEA 4TKOB 4U7GA 1RXVA 1VQPB 3NM5A 3G0BA 1LS6A 1AKUA 2R47A 3CE9A 1DWUA 3ZU3A 5ALRA 2IUFA 5DXFA 1EE1A 3IPAA 4QVGA 4CU2A 1WMBA 2JAXA 3J81A 2AK3A 3QMVA 3Q38A 2NQ2C 3NT4A 5AJYA 4JLAA 3T4XA 1EVJA 1G8FA 3P2MA 1DAKA 4NEQA 3OZSA 1RCUA 1TJYA 4UAVA 3LI2A 3BS4A 3WLRA 1CP2A 2Q3CA 4DIDA 1V8FA 3QLJA 2G6TA 1G98A 4EL5A 3HA2A 1PGQA 1J56A 3PYLA 5CD9A 4K6HA 1Z4QA 1L9XA 2J9GA 3DDCA 4MYRA 4WECA 4YDSA 3A3GA 4BQFA 5L45A 1P4GA 1X77A 1XTPA 4G0OA 1FRQA 4KDRA 4KMOA 2HYIC 3MHTA 4E2ZA 1U8YA 3SHFA 2GVZC 1MX9A 2IU6A 4ZDKA 1YZGA 1PR6A 2ZK7A 3HN6A 4QOSA 2CYAA 2DQ4A 3AMVA 1SBTA 2V7QA 2YOHA 3U7RA 2IBTA 2QL6A 1Z5ZA 3QE4A 4V38A 3SYTA 2V5AA 1C9EA 3JQRA 1ACJA 3T7AA 6PFKA 2JLYA 4L0MA 2FEAA 3IPRA 4X05A 3PC4A 2ZTNA 4X6LA 3PLAE 1PS9A 2PMFA 4DG5A 2OENG 5IBPA 2NV2B 4P1VA 1S8AA 2ZIWB 3SNKA 3C3KA 2HTFA 3WK9A 1QORA 3PHLA 4PCVA 1Z7EA 1J0CA 1KAGA 1TADA 2PVPA 3PGVA 4I9NA 4PYOA 2P1DA 5EVJA 2OBYA 2NWQA 2DRIA 4KKVA 2IS4A 1FOEB 1G20B 2IY8A 3R9XB 1DBVO 1Q0PA 1M5TA 3VHXB 1W52X 1I80A 3UUWA 5B7GA 2SICE 1BXRA 2NM0A 3UHAA 4HWSA 4ZO9A 1KNQA 2VDWA 3THRA 1R10A 4G4IA 4LJKA 5FBKA 5E0KB 3MBKA 1OIXA 1V0FA 5KOIA 1UJBA 5HUQA 4AMVA 4G0WA 1NJ6A 1O3YA 3QKSB 1OAKA 1SCBA 1OBCA 5DBIA 2FG6C 4CEJA 3EIQA 4Q01A 4CKCB 2J3EA 1X1DA 2RH4A 3I9LA 2CKDA 4CKWB 1OX6A 4M1TA 1ODTC 5L3QA 4JI0B 2X9VA 1CUVA 1WZNA 3GJ4A 3QF4B 5NULA 1TAGA 2O2IA 1ZEJA 4TTPA 3RBZA 4AMZA 4FOOA 1XZBA 4M99A 3H3JA 4RDKA 2M6SA 3E84A 2FRXA 1HZZC 4MP6A 1WSWA 1WPGA 2RBGA 4RZ2A 2AQ8A 1IM5A 1Z4NA 2L2QA 2QAGB 3PA2A 2WDZA 4RKQA 4WKGA 5EE1A 4C87A 3T61A 4RH0A 1Q22A 2DUJA 1ZUNB 1ODCA 4LY6A 3JQGA 3L8GA 4L16A 3HB7A 4S3MA 3OKCA 3UTCA 1S3GA 4KG7A 2Z2XA 2Z58A 4MEAA 4B8WA 1EFAA 5IM5A 1PJ7A 4MUBA 3E48A 5T4BA 5DP1A 2HKIA 4DAEA 2EJCA 2YIDA 4KWTA 1T5LA 3BBLA 4CCYA 4BDTA 4EYGA 3R0JA 2GBLC 5C7LO 3FSGD 3BMQB 1LJ8A 3L6UA 3QI2A 4MARA 4DZRA 1KSJA 3LVFO 4OQFA 1R4ZA 3R3VA 3OTHA 3DW1X 3GT0A 5F4MA 5JCJA 4HNTA 5KWVA 3AF6A 3SSMA 3BL8A 3OY2A 2ZJ5A 4I4CA 3UOWA 4IDDA 3KKZA 2CLLB 4D79A 3QF4A 1MAUA 1V1RA 1EU1A 3QVKA 1YNOA 2VJIA 1S0UA 3C4VA 1U0LA 1N9ZA 1BE6A 1WZEA 3DDUA 3KQWA 2X8AA 3LH5A 1DCFA 1VB5A 3COYA 2Y1OA 4UDYX 1J8YF 2YJZA 1EDBA 4LRTB 5LQUA 3NBUA 4CIWA 4JWTA 1N5MA 2G4VA 2ZYIA 1MB2A 2F3SA 2ZYWX 3K8ZA 4L4SA 1UADA 2QUAA 3KQHA 3BVPA 3A9SA 2P69A 1UJCA 3FH0A 4FX2A 1UPBA 5A3SA 3H3FA 3AFOA 2QGNA 2Z8YM 3IP3A 3OPOA 3QPCA 1C3XA 3REFA 1XP5A 2LP4Y 1UJMA 3RYCA 1HUQA 1XT6A 3TW8B 3B89A 3F97A 1C4XA 4JC5A 3SD7A 1A9QA 1QU3A 3HJHA 1MZVA 3CZ5A 1P3DA 4CM4B 3BZUA 4YCDA 4QYTA 2GD1O 1YVDA 3BY2A 3FGOA 5IAKA 4MUYA 4Q47A 1HK7A 1U2TA 1Z6QA 1VHTA 5LQJA 2ZWOA 1E6UA 3TZLA 4FFRA 1KAHA 1R0ZA 4JWKA 5KYGA 3CYFA 5EL0A 3QPVA 3WIDA 4DUGA 3KAQA 3QYPA 1TPZA 2G1JA 2AJTA 3VPHA 5K0BA 1ZGGA 1L0BA 1HSZA 3BNWA 1I3OA 1UWKA 3HB4X 3X1YA 1DIRA 2BMEA 2QTFA 1RW4A 2WW8A 2XF8A 3BERA 1SUWA 3LPAA 4N0MA 2V03A 5T3UA 3C8HA 3EE6A 1XNQB 5K3FB 4CVNA 3BX1A 4PYJA 2PUHA 2LVBA 3KQQA 5HBGA 4LHYA 5DYYA 1EP9A 4O2LA 4LVUA 4U1RA 3LDUA 3QU4A 5B55A 3C4JA 1VQ8B 1VGRA 3N8HA 4MPDA 1G59A 3FHTA 1U0OC 2OTJB 2Z2YA 3HYNA 4JJEA 4EF6A 3DLHA 3W5BA 5KS2A 2I3DA 2XDWA 1YO6A 1DTEA 3A6DA 6GPBA 2IPXA 5DIZA 1U8CB 2CL6X 3DZHA 3U4AA 2WM2A 4KFSA 4AKIA 1CUWA 3QXHA 4HN2A 1Y5LA 1FVXA 1AMOA 1NURA 2PS0A 1C3OB 3IAEA 1IHUA 3M3PA 4D6PA 4R1QA 1YKFA 3NYRA 2QTLA 4KUEA 5KIAA 3IIIA 2I34A 4HO1X 4LVNA 2CWDA 5E8JA 4BZZA 5JECA 2GK6A 5CDTA 1CVRA 4YAGA 1PJRA 5BSKA 2B4AA 1QIIA 3W06A 2C8LA 1NJ8A 1HRDA 1SIOA 1Q77A 4HFNA 1P73A 2PH7A 3WB1A 4IW3B 1P0QA 2HIAA 3W1VA 2Z43A 1SVSA 3HABA 3LL4A 5D1HA 3RFFA 1JEEA 5HCNA 4W9NC 2AR9A 5IJZA 5IKXA 1MO2A 1RJWA 2OP1A 1QZTA 3DHEA 1CQIB 1G41A 1ZLXA 3NBFA 3P9KA 5BRAA 4TMXA 4BJ5A 3OPVA 4H7PA 5JVDA 3HB5X 1AOXA 5K8CA 1BVUA 2IP1A 3E3NA 3H3XA 1ZM9A 4IAOA 4PFKA 4AZ3B 4DY4A 5CHYA 1K5DA 4QLBA 2CNNA 4MGKR 5KAMA 5ISMA 2P9QA 2Y0DA 4UATA 1QGAA 5IDWA 2IHYA 1SULA 2X4GA 3CFYA 4PLYA 4RZXA 4QDZA 4GLFA 4B6OA 1C3JA 2CBGA 4RJTA 1NOJA 1PUJA 2BSQA 1XR3A 5CEFA 2IUEA 3PDIA 1OV4A 2JIQA 4I7EA 4PFSA 4ENUA 5DNWA 4R16A 2GDZA 5G4KB 1UAAA 4K8OA 2EEZA 4RPJA 1ZIOA 2PG3A 3IUYA 1M7HA 4F4UA 1JSLA 4O5AA 3E23A 5CNIA 3K0AA 1N6IA 4NFLA 3OE7A 1VBNA 2Z2KA 3ESRA 2NUAB 2BCEA 3QUCA 3RHZA 4AY4A 1PJ3A 4MXDA 5AUQA 3CXRA 4RPGA 2WJWA 4BO5A 3H4TA 5ALWA 5JSYA 4JK3A 3K9LA 3OTQA 4Y2YA 4D81A 3KT8A 5ARBA 3B60A 1SVKA 1TA0A 3GH3A 4KFUA 5FDFA 3GAZA 2VTBA 2WSSD 3MCZA 1OAOA 5CX4A 4EPWA 4OHRA 3ZW7A 4RH1A 5DTJA 3WWDA 1XJ5A 4LXYA 4RVSA 2SKDA 2PUTA 4U7HA 3KB1A 4L9AA 2X2FA 5D5HA 3OPYA 3R5HA 4BXOB 2GQFA 1N2CE 1K5PA 1NIJA 3PQ2A 5HBRA 3ZUPA 1F9AA 2ENWA 3STXA 3K70C 4I1IA 2BGRA 2ZUCA 1DIGA 4B46A 4YJGA 3K0AB 3QBDA 4CF6A 3K1YA 1VJGA 5EIWA 1IJKA 2TYSB 3WWYA 3MCWA 3PQEA 3DMDA 3GG9A 1XV5A 4HL6A 1ULAA 1HDXA 2COEA 3HXTA 3JWEA 4JLBA 4QA9A 3TGPA 2QL5A 3IQHX 4BVHA 3SHWA 1KQGA 2OB1A 3QVOA 4IDAA 4ENSA 3DQQA 4CL0A 3TJRA 1OWPA 3A9VA 3HDYA 2ERYA 4XEUA 3ZDZB 4AN0A 3KOUA 5JFTA 1H42A 2XUHA 2WTUA 2GPSA 2TMKA 3QPAA 2JCXA 4N7BA 3DMNA 3GJZA 2L17A 4AUMA 4OYRA 1XA3A 2QRPA 3IP5A 2XX3A 4NG5A 5FOTA 3LECA 3BMNA 5K2MA 3FWZA 1M33A 4YUWA 4HDAA 1CW2B 4G4JA 4PEVA 1NW6A 3NC0C 2R6AA 5G2OA 4CUKA 3ZHXA 4FYXA 1KFJB 1E9FA 1SHKA 5DO9A 3PX3A 2C3UA 2WWYA 4RXMA 1UIMA 1YS7A 1W5EA 4H3SA 1L8AA 2NV4A 5DPMA 4FSHA 1VBKA 4KTTE 1TT5B 2FRDC 3ZIAA 1YFLA 1YIJB 4L02A 4BMDA 4KI0A 2I6TA 2FPXA 2WHPA 4M7PA 3MAGA 2GPNA 2J6CA 2XGSA 4OXYA 4Q9AA 4AJ2A 1T1RA 2JGIA 4IWNA 3W7BA 5CYGA 2BT4A 3C3DA 2QTGA 1C1HA 4L3WA 3UH0A 3BBPA 4KMSA 3WTBA 1A8IA 1E1DA 3KR1A 2CL5A 3DB2A 3KVRA 3A2LA 3CPWB 1EBBA 2EKPA 1N4AA 3TYXA 2HWKA 5AUOB 1OKKD 2X6WA 1G0NA 2GREA 1PV4A 1IN7A 4JOBA 1Q1BA 4NBKA 1KI4A 1WZIA 4A5OA 2FMKA 2WJIA 3QXXA 1AQNA 4O4HB 7REQA 1JE0A 4URZR 3MCVA 2B78A 3R5XA 1Z06A 4IDQA 4CM7A 1DJPA 3A10A 3AKYA 5KTPA 2XYGA 2D5LA 5MDHA 4OF4A 1DX4A 2QTRA 1WTAA 2XEDA 3LKVA 4P7KA 1GAEO 1WQ4A 3CF0A 4BAGA 3CO0S 3EVGA 4D6YA 4RSHA 1Y8QA 2IX3A 1JMYA 1NQXA 3G0CA 2J3HA 3AUJB 3IUSA 1R50A 3DV9A 3H8SA 3N2GB 4ON9A 4REQA 3UAGA 4DUZB 1TQDA 3CRQA 4F5DA 2VJJA 1DQYA 1KO7A 3HN2A 3INGA 2PVCA 1V39A 2JG3A 3BDVA 2NTVA 1CX9B 3FUUA 4KPGA 4ENRA 3F5MA 4DILA 3L7MA 4Y3UA 1Y3BE 1LBIA 4QREA 2BCGY 4IDOA 1D1PA 2GJAA 5FHRA 3SEQA 1KZ4A 5CCDA 1U2DA 3I1FA 3CR7A 3OJ0A 3JQCA 4X5OA 2PSFA 1ULZA 4MW5A 1QOQB 2GXQA 2Z9BA 1GGNA 5CURA 2VNJA 3IKLA 2XNSA 4EGFA 5EZSA 2QMYA 2D2XA 3VOAA 4AK9A 4GWLA 5CNKA 5G3YA 4RZSA 2C7RA 1V5FA 1DBWA 3GLIA 4R8LA 2O1SA 2RKWA 5AK4A 1ZOLA 3KX2A 1KQFA 1GCAA 2Q5IA 3ZVKA 2GAOA 3QJGA 2FMTA 1LK5A 1KZHA 5C3MA 4ND2A 3HUEA 4G0UA 4NBSA 2HJGA 4MJLA 4CGYA 2RAVA 4Q4AB 1U7HA 3NU1A 4CRWB 1TJNA 1FLVA 4WWVA 3B1XA 1ZM2A 4U3JB 4DMLA 4F06A 3MGAA 4YP0A 1TZ2A 3QEJA 3OX1A 3AL0C 2FN4A 4ED9A 4HUTA 1JTEA 2FY8A 4JI4B 3KSMA 3LKBA 1K5GA 2AQHA 4B2LA 3BGOS 1RYEA 2ZI4A 3GYGA 3H5OA 2AT1A 4OHBA 1CZNA 4DNPA 2FLWA 4PSKA 3MGKA 1OB5A 1J0XO 4FJ2A 4GC9A 2ZSAA 4NICA 4LNAA 3WBKA 2XMCA 3OTWA 3MTAA 3C7TA 1NW3A 1SD5A 2WSBA 4KQKA 4OEHA 3RVSA 4FZ5A 2W2TA 2DUNA 5EGNA 1NU6A 1DXYA 1SC3A 3I9MA 1ESMA 3EY4A 4FQ5A 4IXNA 4X6XA 4Y2XA 2PFKA 5SYNA 1T2NA 2WIFA 5C5EA 1JTVA 5IC6A 4CG0A 4QTYA 4Q7JB 1TAQA 3WGGA 5KJCA 4R71A 1BD4A 4XUEA 1RQGA 3DVQX 2HPHA 4YI3A 4CT5A 2C7OA 1T9GS 2G8NA 4YP6A 5K0CA 1I6KA 4BTVA 2IP2A 5CDHA 5GJVC 4WOJA 2ZG6A 2IU0A 3WYFA 4HDNB 1R5OA 3LLCA 3WMRA 5BSUA 3VSDA 4LOJA 3QIAA 2VYND 4IH1A 4NCBA 2ZYAA 4ZCPA 1G8YA 1WCIB 4YRQA 3C87A 5E9AA 2QRVB 1CDZA 2VJAA 3R7BA 4I55B 1NQVA 3PC8A 3C3PA 4RDLA 1XKLA 3KXLA 3QKIA 4HZUB 1UT6A 2C4WA 1UMCA 2WVGA 3OUTA 3Q5GA 4G26A 2I66A 2V4DA 4WACA 4GRAA 2C2WA 4NE2A 2G25A 2E5FA 2GRUA 4G1FA 2ATEA 1UM9A 3HEAA 3UY4A 4EB0A 5DIFA 4AYTA 1N92A 4PFJA 4UHDA 1XFAA 1X0XA 1SOVA 4AS3A 3CBGA 2E87A 1W94A 5IYRA 1M6NA 2WWFA 3HB9A 4ILKA 3WICA 1CWUA 4RF5A 4RZQA 2H5EA 4MUJA 5J63A 1I94B 4MO9A 3ZHSA 4D43A 3Q7IA 3CVXA 2YWCA 5FBZA 3WGQA 1MGOA 2PZFA 3QYAA 1GTVA 3QRWA 4BLPA 3IURA 1RI1A 4WRRA 3MD9A 5FQOA 3U26A 2VEOA 2QU7A 4G5OA 3GVPA 3OLWA 1VIVA 2XUOA 1OT3A 3TZ6A 1JQ3A 1FDWA 3AINA 3T95A 4EX6A 4DK0A 4Z0HO 2PZMA 4IKPA 1N7JA 4YJ3F 4QOIA 4PN7A 4HQKA 3MGBA 2R8BA 1DIAA 2RGWA 5THQA 3KWMA 3RT9A 2PQMA 4O1MA 4WEQA 1JFSA 2JLRA 2UXCB 3MIZA 5LU8A 3EVCA 1IJEA 3ETNA 1QGYA 1RFLA 4IUCS 4JC8A 4BX8A 5KOHA 4IXWA 3S1SA 3BA1A 3O93A 4A91A 1JLRA 5BPHA 1W85A 1ECLA 1Q74A 1AA9A 2C61A 2EJVA 5AHWA 1J21A 1U8ZA 1GGFA 2C3OA 3BRWA 4DRZA 1X74A 3N2IA 3OZ7A 1FSSA 4RJ2A 4QU8A 1ODSA 3DR3A 2GFHA 3NP7A 3PL5A 3QA3E 4B4OA 5AN9A 4CMJA 1VPLA 5FR2A 4Q4JB 1OFVA 5KYUA 3X3HA 4CMIA 3KZMA 1AU9A 1IH8A 1N2CA 3A37A 1T3HA 3ESQA 3K09A 1O95A 4AUKA 3ONDA 4BN0A 3V97A 2BFOA 2FJPA 1P80A 4AZTA 3MOIA 3QVUA 3S8EA 2ZR8A 4MTLA 4RV9A 3R75A 4E5SA 2JHFA 2ONCA 3HL4A 4K05A 2ZJ2A 4DBLC 2H07A 1Z2OX 2WZNA 5KEIA 1G5TA 1T5OA 5JC8A 1T4MA 3DOFA 1N2IA 1P7YA 4AKEA 3ZDAA 3E0QA 3B2QA 4E21A 4CKBB 3TRJA 4JITA 3PFBA 2BCJQ 1JFFB 4ARBA 4YMUA 1XZJA 1H3NA 2LXNA 3W0LB 2V9PA 1PUIA 3LS2A 1ZOPA 4G25A 1YITB 2FR1A 4YRGA 2I80A 2QL7A 1J8DA 3GCXA 4HQOA 4XGQA 5LDHA 2YDYA 1DFHA 2NG1A 2ZE8A 2A88A 2RGNC 4GNKA 3WFZA 5BVGA 3HYSA 4Z3DA 1D9ZA 1ZVQA 4EEZA 2W6MA 2WIGA 1VTKA 2VNAA 1M83A 1Z2EA 4CQMD 2W5UA 1QYVA 4BQIA 5DBOA 1E3IA 1XEXA 2EYQA 1YVUA 2FZEA 2VF2A 1TGVA 1Z8NA 3MRSA 1SCUB 1L5KA 2PUCA 1XZIA 3ASTA 1SHUX 3HPQA 3KYJB 3J7TA 3UHOA 5TIIA 3AEKB 3ANNA 1AC5A 4G0PA 2C3YA 4YDRA 1RYBA 2FX3A 2MSLA 2J5QA 1XC7A 3NV7A 1XKQA 4XGKA 2FFJA 4OBBA 3TLXA 3DP9A 1HNWB 2VJCA 3FNEA 1QIKA 1T6NA 2QYSA 5FFNA 1E92A 3LQ1A 3EQ8A 1VCOA 4CODB 4UM9D 1F1JA 4DF3A 4Y9TA 2EW8A 2Y1CA 1NBMA 2I29A 3LZCA 4GRIA 3FN4A 3QVGB 3BWEA 1QRUA 1G7CA 5HE8A 2LIVA 1YACA 1KBZA 5HCUA 2OWDA 2UYHA 3Q2KA 1DJQA 4ETWA 3PUJA 2ZVJA 5JJLA 5ALHA 2AOUB 2AXQA 4LXTA 3UWSA 4Y1FA 1R6UA 2WTMA 1NAHA 1PJ5A 3H11B 2REBA 1GUDA 3EXEA 3OZBA 3HVUA 1EX9A 2B1GA 3KJNA 4X6YA 5EQJB 2XIQA 4ICIA 5TQJA 1KSHA 1XE3A 1MFPA 3G0OA 3UXYA 3WDMA 1DQZA 1RLOA 4QV2A 2CXTA 3G71B 2KB0A 5F9MA 1SURA 4D4IA 1DPFA 5DHQA 5A62A 1IM2A 2IXTA 1UT5A 4HAUA 1ZUWA 2GFIA 3P27A 1ULSA 4TT3A 3QVTA 4YASA 2KI5A 3ZY4A 1OGIA 2OXRA 5K01A 4OAOA 1BEZA 3GH1A 2JFVA 1NR5A 4UM9B 1IVNA 1ISRA 1EB9A 4HUJA 1EJ2A 4C21A 1QH8B 2H4WA 2XMZA 3JS5A 3WB2A 3LY7A 4TLCA 4EKGA 2I54A 4NF2A 3A1UA 1DKOA 1DOHA 2G28A 4TQUS 1S2DA 1ZRHA 3RVBA 3O95A 2DFKB 1Z5UA 5HTKA 4LYGA 1CUHA 2ZBQA 4HDSB 4NFHA 4LX0A 3UHFA 3D7LA 2QLBA 3VDXA 1N6HA 4PXSA 4F3NA 3QEOA 2Y6VA 3OPMA 4KAJA 2WV9A 2JJ2D 3BCSA 3SKVA 4CTJA 1MFZA 2O8EB 4WK2B 4HFJA 1E5VA 3RFCA 2A0KA 1YQGA 2P78A 1U1GA 4F2GA 5CPFA 3BT7A 2B1QA 2PGIA 5A89A 2OZLA 3L0YA 5DWQA 5EJMA 5TT1A 3W90A 5FBQB 2C2XA 4NV3A 5BY2A 2ZTUA 5HJ5A 5LIRA 4LRQA 1E1QA 4RETA 1LZLA 4G8DA 5E6SB 4ENWA 2HO5A 4YX9A 5KNLA 3GPDG 4ZVMA 3WQSB 4C2UA 4D3YA 2BM0A 4PVCA 1Z36A 3WIOA 3KD3A 2R5NA 3Q9SA 2A0FA 4J76A 1GL6A 4ND4A 3QWFA 2FG5A 4UJ3A 5HK9A 5JCOC 5A03A 1LEHA 1QDEA 2Z6VA 2VH2A 3QE2A 3NT5A 4FJ1A 1AUQA 3VVMA 4NV0A 5FPKA 1R6BX 2HLNA 3CC7B 4TVKA 1SKMA 4C7OB 3PA1A 3ISJA 1TK9A 2WTEA 5C51B 1Z0ZA 3I4FA 1S89A 3OUUA 3FYUA 2ZXIA 1R27A 4L5YA 5CTJA 2J0SA 1H2XA 4RD1A 4TL8A 3A27A 3L4BC 2Y1LA 3E3LA 3ENZA 2AA3A 3RC3A 1WD7A 3H5AA 3U37A 4C4XA 3W2GA 1S3SA 4M1SA 2PRKA 3OQIB 1GKLA 1TYCA 1HQKA 4QATA 4B73A 3NHSA 1UKBA 4DEVA 1YFZA 1KVUA 4AW9A 4V0ME 1ZY2A 4JL5A 4GMKA 3TCXB 3VPGA 4IIVA 1V3TA 2XNDA 1VA5A 4H60A 4C6SA 3T1YB 1RMQA 1TMKA 4RFSB 4PYNA 3VU9B 2D1FA 2EFEB 3LC7O 1GG8A 4NNJA 2PE3A 3PVSA 4MV8A 2HLPA 3B1KA 1ATZA 1K4KA 3WAGA 1SBCA 1EIWA 5FJIA 3NHKA 4D8VA 1GFWA 2IPNA 3AY0A 3AWIA 3HN7A 4GPBA 1K7SN 5LUBA 3TTYA 4OQDA 1XMQB 1N0UA 2W83A 3KQNA 4XQCA 2G9VA 4AZ0B 3N5CA 1WSVA 4F93B 3RABA 1KDZA 2ALJA 1QMGA 3ZIDA 5FT9A 2I1WA 3R9WA 2GYUA 4KX5A 4FHCA 4LGYA 5EC8A 3OX3A 5JZSA 2NO7A 2V4ZA 2YN2A 3IESA 2C0QA 2POQX 3ADCA 1ZJJA 1NVTA 4HPXB 4W1QA 1ZINA 1W1WA 4FONA 1GITA 3DBRA 1T1JA 5DGXA 1VE3A 2O7QA 3EAQA 1Q0TA 3EW7A 1JLHA 1J2RA 4EY8A 3E70C 1K7XB 3I52A 2FMHA 3NASA 1JVBA 2X4IA 3VPAA 1XCPA 1NY6A 2OE2A 1QNFA 2XLCA 4NJMA 4CCSA 4ZIRB 1YDMA 1ITZA 1HT0A 3EK2A 3MOGA 1EESA 5TEWA 4UTZA 2Z95A 4M54A 5BT8A 2UZ1A 5I3ZA 4J43A 1YFJA 1D6JA 4Q9JA 4N47A 3T41A 4LYYA 3MLBA 3A9TA 3WIUA 4JC4A 1E8MA 4R5MA 2CSUA 2SNIE 3U60B 2P30A 3VKGA 1UANA 2EVWX 1GT91 1GIAA 3KPUA 4PFQA 4WY5A 3OJFA 4RQUA 3N2KB 4PNHA 4P4NA 9GPBA 1ZHHA 1PFKA 3TSAA 4JBYA 5FTLA 2A30A 1SCQA 2OB2A 3W04A 5IFLA 4ZXPA 3KKPA 3WLLA 3K0CA 5DM70 4GKBA 3B1YA 1SXIA 4O3MA 4GUDA 3M6UA 4V0SA 1TU0A 3IEPA 3AZOA 4UMFA 3UK1A 2YMPA 1OX4B 3I6MA 3PCXA 1ESNA 3VR4A 1LW6E 4R68A 2ZSBA 3JWHA 3QTTA 4MPPA 4EPRA 1OI2A 3H8JA 4P34A 3UPTA 3V8NA 2Q0HA 1W4LA 4U2BA 3AB7A 4RVHA 1QO0A 4DEYA 1DADA 4GIBA 3WKDA 2FVGA 2AK2A 2V55B 3B78A 3AKEA 4IH4A 3OPNA 3UB2A 2D13A 5EHNA 5BUQA 3CUWA 1ECCA 5DTQA 2FYTA 3ASVA 1QYRA 2R751 4PZPA 4XIJA 3TIVA 3I61A 1F7UA 3TIGA 1QIMA 2NXJA 3F98A 4NZMA 5CK5A 1K3TA 4XKJA 5FPYA 2R00A 2WRZA 3IE2A 1VXOA 2A14A 1AKMA 2GPWA 3L7DA 3O1IC 1T29A 4MRPA 4PQYA 4K7JA 4ZQGA 1Z28A 1U1DA 3DEYX 3OOYA 3DE4X 3KJHA 3N8IA 2MDTA 4P93A 2WY2D 3VA7A 1RNLA 4HDKA 2RMKA 2O19A 1FFYA 2HT1A 2YOFA 5KTSA 2JARA 1MQAA 1PWYE 3UKJA 1HKUA 2Q0XA 3EFOA 3LQRA 2HREA 4WKOA 3U49A 3I76A 3PFHA 4DLAA 2BP7B 5BN3B 5C8DA 4FSXA 4UEQA 2F1LA 3VPCA 1X8LA 2GJ8A 1I36A 3K8QA 3PT5A 4B81A 2ZDQA 3UJAA 2FKNA 1XQ6A 2FNAA 2PZEA 2VZEA 4MMYB 4W4TA 4BE9A 4EHIA 5EIFA 2GVNA 3HACA 3UCXA 5AVXA 2VQDA 2AEEA 3OWXA 3MQ4A 4B34A 4ZGNB 1XK6A 4IIJB 2DWPA 1JNXX 3LG2A 3ULKA 3PXAA 1RDFA 1TVKA 2BF4A 1XWWA 2IEDA 4GPZA 1YR1A 3IL2A 3OM9A 4O0MA 4ALNA 1F4LA 1OY1A 4YUYA 4IXTA 5I9NA 4R98A 3AM4A 4D6XA 2O59A 1QE5A 1USIA 2P41A 3KKQA 1UJ6A 4C05A 4LJLA 3T3OA 1IY9A 4DBVO 1KAOA 4IQ8A 5CNJA 1NQTA 2J6BA 1AZSC 3HNRA 2HMVA 4F5WA 2WYRA 1E9SA 3P2KA 3QVJA 1DOZA 3G3EA 3G82C 4I8XA 1IUOA 4NMLA 3NHZA 4OI4A 3RI3A 1KWGA 5AW3A 3L1KA 3ML1A 4MNTA 1H6BA 1PG0A 1SHZA 2R44A 2V65A 3MJ4A 3NC4A 3FRJA 3OCYA 4I55A 3TIIA 1TT5A 4A8PA 3WG9A 4GZ5A 3SKXA 1M7GA 4M1YA 1UPUA 5IYWA 4Z9FA 5GQSA 1YHNA 3H9CA 2CUTA 4DLUA 4IEIA 2CXSA 2BEKA 1Q44A 3GLHE 5GONB 4AD8A 1FB5A 1GM5A 2C99A 3MJDA 4OJYA 1U7OA 4EA7A 3G2JA 4IZHA 5LXTF 1L4UA 1N8KA 1GDTA 1A0OA 2PJDA 2R8EA 4XX0A 2OAEA 2AE2A 4FYWA 4L85A 1DRJA 3D6TB 1VP3A 1V5EA 2KW5A 3OZEA 5AVTA 1BKSB 5JLJA 1W4CA 3RREA 1E7YA 1XCOA 2ZAMA 4HLDA 2OM2A 2UUOA 4EPVA 5J2UF 4V2IA 4J7AA 5BVHB 4DPLA 1RRGA 2P4UA 5JOQA 3X2FA 3ZWKA 1V6SA 1Q2XA 3SIXA 4A82A 1W29A 5ALMA 1RPNA 3IMGA 5B5SA 1V3QE 2P1RA 3EA4A 4D8TA 1L5QA 3AOGA 2UYOA 4MKGA 4BNDA 2QP9X 4Q34A 2V6MA 3HJTA 2XLBA 4INPA 4AQDA 3DE1X 4J8PA 1GDHA 1MBZA 3C6KA 4IFIA 1YS2X 1SOMA 4HAZA 1UKVY 4D56A 1OXMA 2J08A 3PQFA 4GX2A 1MJHA 2GAJA 1M8JA 1HDYA 3M3DA 3FBWA 1JNYA 4GVLA 2ACKA 1KKUA 2QUBA 4BECA 2DTEA 4OP2A 4ES6A 3Q10A 1TX4B 1SXGA 4B4DA 1MF7A 1R0WA 3L1IA 3NIDB 4JOCA 1TC2A 3FDFA 1CUZA 4P0PB 2R6HA 1FJHA 1NYLA 2VBFA 4KMRA 4BB9A 1ZK1A 4I55F 2RK4A 1S7CA 4TRMA 2COKA 2ZXHA 5LWQA 1Z2NX 2WB4A 3NOVA 2OQ2A 1DVRA 1PDOA 2B8NA 1D04A 1AQYA 1XZQA 2V8OA 3D1LA 2PT6A 2FQ1A 1Y81A 3IA7A 2QN1A 3QU9A 3IV9A 3VNUA 2P4HX 4OBEA 3KHSA 2YCLA 3PHIA 2QNIA 2JGLA 1YUMA 1U5AA 4C01A 3HA5A 4JSTA 3WGJA 3TBHA 3KSBC 1CK4A 3B3FA 3O3CA 1AY0A 5DNEA 1Q50A 4KKUA 3AL3A 2YJ6A 1C7JA 2K2WA 4J3NA 1XCLA 2OCDA 2W2NA 4NMWA 1MH9A 3GRAA 4YV2A 2Y9MB 4JJ8A 4TV8B 2Q3EA 3R09A 4P0TA 4H7FA 1WS6A 3ZGNA 5BW6B 5D51S 3D4IA 1Z0UA 3FTDA 4EY4A 4PZCA 3AVVA 4OG2A 4C7MA 2V97A 2VHTA 1U3GA 1UBRS 2NNLD 4L07A 2QF7A 1WE2A 2Z9DA 4S0ZA 4ZARA 4ZT4A 1U9ZA 3Q8XB 1FFDA 2Y1DA 4BATA 3CTMA 1W36C 3IAM1 3I2HA 2JIDA 1I1QB 4FUTA 3RDPA 4HN4B 1WJGA 2IDZA 1UF9A 4MULA 2CB9A 5ALFA 2R7MA 1JBKA 4LF6B 3ICOA 3GJ8A 3N0WA 4JUIA 1AK2A 1GZHB 1OXSC 2QOEA 1L7RA 5EIBD 2EZ9A 2WNIA 5DGCA 1Y42X 1PK9A 2BMDA 5GPBA 5AW0A 1EBUA 3E2PA 1SBYA 2VNHA 2GUWA 4TS9A 5CU7A 2QN7A 1IBCA 1PQWA 1E63A 1OH8A 1MIOB 4ZYYA 5FLEX 4DCOA 4EVSA 4US1R 3FTPA 2WMDA 4INJA 3JYNA 3ED1A 5IVKA 3HXKA 4LKRA 4BNIA 1OA1A 1MABB 1E60A 1T0PA 3KU1A 5CYOA 1E6MA 2NT3A 3TRIA 3ZLBA 4CV2A 3WBJA 1HE2A 2X58A 4D2IA 5BORA 4X20B 4MYHA 5CCBA 3FMVA 3Q11A 1TAUA 3WMWA 2OXCA 1BHO1 1K28D 2MIIA 3R3ZA 1C9KA 4V0QA 3KKNA 3TE6A 1IEWA 1QQ7A 2OVBA 4MUFA 5C8ZA 1MT0A 4BC0A 2Q07A 4BB6A 1Q81D 3R44A 3PR3A 3GA0A 1QOPB 3AP1A 2IHVA 3PNLA 4OK6A 5AR1A 4DWVA 5IARA 5FULA 3IDZA 5B1SA 1E2HA 3RANA 3TD9A 3IP1A 1B1CA 1J7KA 1NSYA 1YU6A 4CDNA 4BE7B 1ILWA 4CQJA 5HRUA 5C81A 5LOVF 1HOXA 5GJCA 4B75A 5HJEA 5TLSA 1YGPA 1SUDA 1DEXA 2M6KA 3L6DA 2JIZD 4L9SA 2IHUA 1WF6A 3IAFA 4U7PB 3U3DA 2VLBA 4PX2A 2FPUA 2ACWA 4DLTA 4AO6A 4EHLA 4DVGA