1S4MA

Crystal structure of flavin binding to fad synthetase from thermotoga maritina
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
277
Chain Sequence
MVVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVHKFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRPTDARNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKFDSIEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of flavin binding to FAD synthetase of Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 82
structure length 277
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1s4mA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1s4mA01
3COVA 5TEWA 3H97A 4J76A 2ZUFA 5IHXA 1ILEA 4KKVA 1J1ZA 5A88A 3X1KA 2WSIA 1VLHA 1FFYA 3ZXSA 2XRZA 1O5TA 3IMGA 1S4MA 3A05A 1HYBA 1MAWA 3KT6A 4R2LA 5F23A 3ELBA 1ULHA 3TZLA 1EFPA 1WXFA 4MUEA 3DV2A 2YXNA 1M8KA 3C8ZA 1N2EA 4UZFA 3N8HA 3SEZA 1IQUA 3G5AA 3K32A 2HZ7A 1LW7A 5BNZA 1IVSA 4G5YA 2BTEA 1Q19A 4EG4A 3VU8A 1O95C 1VBKA 3HFJA 5K0SA 3SZ3A 1WQ3A 1WKBA 4MVYA 2V0GA 3CR8A 2CV2A 1MB2A 1O95D 3OTWA 3PNYA 2D5BA 1OBHA 3ZGZA 1PFVA 4QREA 1Q11A 5EKDA 2ZUEA 4MUHA 3H9CA 1WXIA 3ZJTA 2YWCA 2DETA 1FYDA 1WXHA 1JEEA 2C5SA 4DDMA 1ZH0A 3AG5A 1YIAA 3Q10A 3TNJA 2DLCX 1KAMA 2J4DA 3COZA 1H3EA 4X0EA 2HMAA 1QU3A 2NZ2A 1PFWA 1QRSA 3SEQA 1IQ0A 1NUQA 1OD6A 4F3RA 1N2BA 4MWBA 1GZUA 2VBUA 1JIJA 5J5AA 1KQPA 3IUEA 3QTBA 1G8HA 1GN8A 4H3SA 1O0CA 4AS1A 3P0JA 1N1DA 4ND6A 2CUZA 5JBNA 5J59A 4PY2A 4DJAA 3ISJA 4EG3A 1O97D 1X6VA 1TYBE 3KT3A 1G8FA 1NZJA 3L93A 4MVWA 2HGZA 2V0CA 4YP6A 4CQNA 1U0BB 4MUJA 4ARIA 3A2KA 3RJZA 2OV4A 1NB9A 1TFUA 3I05A 4CDNA 1XNHA 1U3DA 2J07A 3ILVA 3KT8A 1O96B 3MLBA 4MUGA 1TYDE 3CLSD 5LFAA 1NI5A 1PFUA 2CYAA 5KCMA 3AKZA 1J21A 1YUMA 1JILA 2QTNA 3CA8A 1K4KA 5TEVA 4XFDA 1R6XA 1TEZA 2CYBA 3FHJA 4EG8A 5A8AA 1R6TA 3N2YA 5TGTA 3F3MA 2VXOA 4MLPA 3X1MA 2QTRA 5DK4A 1QNFA 4QRDA 1JHDA 1N2OA 1LI7A 2CV0A 1U3CA 3MMXA 1QJCA 3D6VA 4JZYA 4A91A 3CLTD 3UC5A 1I6LA 3CLUC 3ZJUA 1UFVA 3ZXIA 4GU5A 4ND7A 4F4HA 4EG5A 3UK2A 1D2RA 1MRZA 4YP7A 1A8HA 1MAUA 1NUPA 1J20A 3UY4A 3IOBA 4UZEA 1TQ8A 4YBRA 5HG0A 2A7XA 5HUHA 2D54A 1CT9A 3IH5A 1NUUA 4HJRA 2I1LA 5TRDA 1H3FA 1O96A 2E18A 1EUYA 4MUFA 3TQOA 2QJTA 4PBTA 1M1ZA 3H9BA 4MUKA 3TS1A 3KFLA 3FOCA 2VBTA 1N3LA 5H16A 1NURA 5FNZA 4ARCA 1F4LA 2YY5A 3FG9A 4ZT5A 4EG7A 3P0HA 2AZXA 4MW7A 3HGMA 1O6BA 1JIIA 2VBSA 1NUSA 2NSYA 3FWKA 4G6ZA 4I6GA 3RFFA 1M8JA 1XJQA 4HPWA 2DEUA 1ZUNA 1ZH6A 4XFJA 4MAFA 4PBSA 1T9GS 3PNVA 2O8VA 1JEDA 4U8HA 2CV1A 3GLVA 3CVYA 2Z3VA 1BS2A 1COZA 1R6UA 4EFKA 3QTTA 1G8GA 3DO8A 1XNJA 1EFVB 2CYCA 1OBCA 3RK0A 1N05A 4ZT7A 1ZJWA 3RK1A 1QRUA 4NAHA 3JXEA 2Z09A 4CDMA 1KH3A 1WXEA 3Q4GA 1DNPA 4PBRA 1G59A 4DNXA 2A86A 1T6ZA 4BWVA 1V47A 2B7LA 3ZUGA 1V8FA 1TYAE 2A1TS 4MWCA 1O94D 4MW0A 2WQ6A 2JA2A 1M8PA 3CTAA 1O97C 3KT0A 1IHOA 1F9AA 4KR6A 3TZEA 2QJOA 5KWVA 5DB4A 3H99A 3SDBA 1J1UA 1P7PA 1SURA 4R2MA 2GM3A 2PIDA 2QJFA 4Q16A 2E0IA 2PZBA 1JIKA 1N75A 4MUIA 5AHWA 4DDKA 1EJ2A 2TS1A 4I6JA 1NYLA 2EL7A 1U7DA 3CLSC 4ZT4A 2DERA 3GMIA 4ZCQA 4KR7A 1N78A 3HZRA 4I6EA 3S3TA 2IP1A 1F7UA 3G6KA 2X3FA 2QUIA 1U7XA 1EFVA 4E1AA 4S1OA 2E89A 3FH0A 4OUDB 2A4MA 4JXZA 5TS2A 1N2JA 1IQRA 3IMCA 1NB0A 1PG2A 1N06A 2H2AA 3NBKA 3MLAA 1NP7A 3LOQA 3OP1A 4GRIA 2GOYA 1N2GA 3IDFA 3CLTC 1WJGA 2J5BA 1J09A 3CVUA 5HUJA 3AL0C 4ZCTA 1GTSA 3IOCA 4DE5A 1QRTA 2EJCA 2X0KA 3FDXA 1N2IA 4WSOA 4HK4A 2D13A 3IVCA 4XSVA 3AIIA 2CT8A 1YIDA 3HMQA 1J70A 1GPMA 3LE8A 5K0TA 3N05A 1KP2A 3CLRD 3MUEA 3K9WA 3H05A 2P3MA 4U7JA 3IVXA 2WB2A 1X8XA 4AQ7A 4OUDA 4ZT2A 1I6KA 1KH2A 1OWNA 1JZSA 1KKUA 1KP3A 1QQTA 2CFOA 3PXUA 1JECA 3IVGA 5DEOA 4DDHA 1O0BA 4NATA 1Y42X 5KHAA 3LCJA 4QBTA 4MW9A 2OYNA 1VBNA 2E21A 4P2BA 4MW5A 3CVXA 2X1LA 2YWBA 5A89A 1YULA 2QUKA 4J75A 2VTBA 1WQ4A 1OWLA 1MB9A 4NDAA 4U63A 1H1TA 1KQOA 3AG6A 1N08A 4ZCPA 4MW1A 3VRHA 2WQ7A 1WZ2A 1NSYA 4KR9A 4MW2A 1YI8A 3ZJVA 1MJHA 3IOEA 4K0RA 4YMIA 4L2IA 1K4MA 4OJMX 1QTQA 4JFAA 1M83A 3ND5A 1KH1A 1T9GR 1VL2A 1IH8A 2A84A 3COWA 4EF6A 2Z08A 1IFXA 1Q9SA 2QUJA 1MOPA 3X1JA 5LLTA 3TQIA 1WY5A 5FO0A 2JANA 2O5RA 3NV7A 4MWEA 1KQNA 1GTRA 3ZIUA 1Q15A 1YUNA 3HV0A 3FETA 1K97A 2DXIA 3FI0A 2AKEA 4MWDA 1O94C 1T6XA 1OWOA 2AG6A 1I2DA 1PFYA 1OWMA 1KORA 5H7XA 1WXGA 1B6TA 1TYCA 1IRXA 2A1TR 3IUBA 3FY4A 2GKSA 4JYZA 4HJXA 4ZCRA 1PG0A 3A4IA 2H29A 1MBZA 3COYA 2CSXA 1KR2A 4K03A 3SYTA 4KPUB 4MVXA 4NX2A 3IMEA 2BYTA 1MC1A 3GUZA 2DPLA 1WOYA 2DUMA 3FNRA 4ZT3A 4EG6A 3VGJA 2A1UB 5J58A 3BL5A 1QU2A 1JMVA 4R0NA 5LM3A 1M8FA 3D6UA 4WNYA 2RD2A 1M8GA 3BNWA 3IODA 3L92A 4NZPA 3DPIA 1EXDA 1GLNA 3A04A 4RUKA 3RBAA 2IJGX 4MQ6A 1N77A 1NUTA 1KAQA 1H3NA 1OWPA 4MUNA 1I6MA 2R5WA 2VBVA 3SZGA 3U1VA 1RQGA 2J09A 3P52A 3ND7A 2IELA 1T6YA 4EG1A 2RE8A 1F7VA 1JGTA 5DASA 5FO1A 4MVCA 1P4MA 4ZCSA 2VTBB 4FZJA 3E27A 4MW4A 4KPUA 4YP5A 4ZT6A 3HL4A 1Q77A 2A88A 2PFSA 3G59A 3MXTA 3NBAA 1EUQA 1EFPB 1JZQA 3P0IA 4MULA 2A1UA 2PZ8A 4L2IB 4CT0A 3CLRC 4NAUA 1GAXA 2PXHA 1XNGA 2QTMA 3N9IA 2PG3A 3Q12A 4G5FA 3RHSA 3INNA 3UOWA 4Q93A 1VBMA 4MW6A 2QUHA 1EE1A 4TS1A 4EGAA 3ND6A 3PRHA 2OQ2A 1LI5A 2X1MA 3SP1A 1N2HA 1K92A 3M5WA 2J08A 3PNBA 3QE4A 4RPIA 2ZP1A 2PZAA 3UMVA 3CVWA 4JXXA 3CVVA 2XRYA 3CLUD 3DLAA 4DLPA 2DR2A 5IJXA 3AFHA 1N07A 2G36A 3FIUA 2JAXA
chains in the Genus database with same CATH superfamily
1P0CA 1RC8A 4YAFA 1ISGA 4QDUA 2J3IA 4LQ4A 4M0MA 1B93A 1N5OX 4OA5A 2FQQA 3RTDA 1EJBA 3LIIA 4REOA 5ICEA 3C8HA 1SCBA 2WAMA 3K0CC 4KKVA 2PT6A 1TAGA 1FW8A 3QPCA 2V55B 1UMBA 2QU8A 1NVBA 1NT2A 1ZIXA 2WMNB 1ZVJA 4NCIA 4RSGA 4ZYLA 2XRZA 4LZWA 1T36B 3DC7A 2ZJ0A 2D1YA 4ZEVA 4HTFB 1KA9H 3VUEA 3QVGB 4CV2A 2I80A 2PL1A 1XP5A 5TT1A 2I6GA 3E48A 3BZWA 3FOAA 1PEKE 4FPXA 2P9EA 2QYHA 5F5LA 3WWCA 1T9HA 5FI0B 5K8VA 4PIVA 4ENQA 4DNPA 1V6SA 3QEJA 1GGMA 2XYGA 9MHTA 5CNJA 4EHAA 1MC5A 4IGEA 4G0ZA 3GPIA 2OK7A 3RVPA 4GRAA 3V4LA 5I9IA 1T25A 2YXEA 1WW2A 1O95C 1MIOA 3PRJA 4X00A 1QVAA 4EG4A 3LA6A 1RHQA 2WUVA 4DSZA 1EWQA 3OWHA 1WQ3A 4HQKA 1G42A 1GL6A 1WF6A 2WG1A 1RBMA 3E3AA 4JA0A 4RX1A 4Y1EA 3V2HA 4BKUA 1KK3A 1P4JA 4LSZA 3TLJA 5TGDA 2YVUA 4CLOA 4L3OA 3G8DA 3L8EA 3ZWBA 3LUPA 2C57A 2OHHA 4ZHQF 1QGDA 1KMMA 2Q9AA 1XWWA 5HOQA 1BFKA 2YYYA 1Z5GA 4YREA 3HCRA 1C3LA 3ICVA 2D1SA 2IIBA 3A6FA 3LHIA 4E07A 4E11A 3JY6A 2UYCA 4DKJA 2ATXA 1SELA 5COQA 1SG9A 4AZSA 4EB6B 4EYGA 4LPSA 3QBJA 5D1NA 2XTZA 3UHOA 4PTYA 2JFOA 1HZEA 1OH8A 5A4MS 1EWTA 1Z8DA 2B8NA 4HDRA 4XARA 2LZJA 1Z6AA 2OTCA 4OQNA 4UAUA 1ZM4A 3AOEC 4WFJA 5HKAA 5I45A 5KHOC 1KEPA 4XASA 4X0EA 3CF4A 3R09A 3PKJA 2FN4A 1Q0TA 3LQ6A 1E7WA 2NVWA 4YJ3A 2P2GA 4KUHA 1B8VA 4P5PA 4J3NA 3VU9B 4BP9A 3OOHA 1JIQA 2FEXA 3CNLA 4V02A 5HS6A 5J5AA 2BGLA 3TX2A 3O7MA 5FDFA 1L4MA 2ENWA 2C5BA 3HDTA 2JIPA 4XB2A 4X60A 3OZEA 3UCFA 2NZWA 4HAYA 3I2GA 1QZXA 1J07A 2WZPP 1X80B 1E6KA 2HN9A 3D1VA 3WKAA 1J8QA 5F98A 3ISJA 5TQVA 1G63A 2WJAA 5JI2E 1SZDA 4I1UA 4ZIRA 4IIHA 4ARBA 8LDHA 4U6SA 4BBAA 3LPAA 1BCSB 3RYIB 3RPEA 1JR6A 2INGX 1BDHA 4GNRA 3P9SA 1U8CB 2C1EA 3GN2A 5ADVA 4WZBE 4RPJA 2VUHB 4MYSA 4MVJA 2F8MA 2OV4A 2O2SA 1L4YA 3BH6A 1NL3A 2NSJA 2OPBA 3Q6MA 3I30X 4R8KA 4TT3A 4J90A 1M6EX 3ZLVA 3ANXA 1XROA 4JYCA 3TN7A 1OC4A 1ZCJA 5F7OA 2Q5IA 1VHTA 5DM2A 1TYDE 3WQRA 1II0A 4P7KA 4Q9KA 4JUBA 4TL7A 4Y6SA 2DZDA 2GCOA 1K3UB 3BRQA 4MINA 4D99A 5BUZA 4RJ2A 2E4YA 2IWRA 1SVMA 1J8MF 1RQ7A 1X1AA 4CL8A 4EELA 4ZMBA 3D6HA 1BW9B 4IDFA 3IJPA 4NEHB 3EDRA 4AN0A 2Q9BA 4DMGA 5THXA 3VC2A 2UVPB 5ECDA 3WWPA 3ACDA 1AGNA 2RI0A 4OPOA 3B3QA 5DJ5A 1CEXA 2IVZA 4L9AA 4G01B 4Y0AA 1C7QA 2B4AA 4D3YA 5EHZA 2WAXA 4RD3A 4NPAA 5FBQB 5MN4A 5EG5A 5JMOA 1EBFA 1ZGHA 1SU6A 2FKAA 5ALSA 3TFWA 3WGZA 3A11A 1XRPA 1DJQA 1UKVY 1DAEA 2DPMA 2XDQB 4Q4DA 5DHRA 4DA9A 1KZ7B 1ZGCA 1MVLA 5BRAA 1XLTA 1J42A 2JARA 3JAWB 3M8KA 5J2UB 1XRLA 1KAGA 1VQ5B 1R5OA 1JKFA 1OE0A 4L57A 5FCDA 1Z38A 5EPOA 3KBOA 5IULC 1QYCA 3L7AA 3H2SA 3KJFA 3GF4A 4AXBA 3ZWKA 4UOZA 5E7MA 2F4VB 2FSVC 4J6EA 4TM8A 2ZWMA 3FUXA 4ZI3A 3KD3A 3FNEA 5D51S 1MB4A 2H7VA 3F5FA 2JFFA 5CMLA 4CEIB 4NCJA 5EJ2A 1AF4A 5DGHA 1U0TA 1ZD5A 3C5CA 4MS3A 1B0AA 2B5OA 3KTFA 1NUUA 2NTVA 3MRVA 1L5HB 2DBVO 1A7AA 2D2EA 3HJHA 1K88A 4YALA 1T29A 4F3KA 3FWZA 1ONNA 4ZOAA 4RXUA 1N3BA 1NU8A 3CXUA 2IV2X 5BQFA 3R6JA 1I4LD 1M1ZA 1T3LA 5K0CA 3OJLA 3V32A 1YJ5A 2IUUA 4EFMA 4ZVLA 3CBGA 1F1BA 3L0DA 5C1BA 3G9UA 3ZGXA 4CDRA 2RI6A 4WKGA 2WHPA 2ARKA 2ZIGA 3KXPA 4OHBA 1LKZA 2KMLA 4M83A 1N2XA 2I2CA 4AS2A 4CN8A 1G2OA 3TLBA 2NXCA 3TOSA 2RKOA 3SF8A 1A4XA 2V6BA 5JR3A 4GPTA 4RD0A 4RK6A 4JQYA 1EM6A 5TNXA 1YSCA 1NBMA 2ZBVA 3P32A 3LDFA 1MG0A 4IZOA 5IAEA 2CNWD 3WRYC 1KEEB 2CKMA 1R0ZA 3VR4D 2XNSA 4M1EA 1M2EA 2CL7X 4MZXA 1NRKA 2HL6A 4BXOA 2XZTA 4XOTA 2H51A 4G97A 2QNRA 2WJ6A 3MGCA 2YXBA 2MCFA 4BOYA 4OPVA 3ZK7A 1E3ZA 2YHAA 4Z3KA 2HUPA 3ANMA 4EJSC 1R4MA 1DX6A 3K1JA 2GTHA 4LG1A 4Z7JA 2CXTA 1TUEA 3H5NA 2CYCA 5EIBC 3WYNA 1HVXA 8GPBA 3JQCA 3OIWA 4BNVA 3OKFA 1A9TA 1U7ZA 4YWJA 3VR3A 3F9CA 3LLUA 5HCNA 4II3A 4DCSA 4FFRA 1YQ9A 1R18A 2R96A 2ZKIA 2IYNA 2Z8YM 1SBZA 2H3EA 3QF7A 2GNAA 4BFSA 3NWBA 4D9FA 1J0XO 3FKQA 4QGFA 3NO4A 1R37A 3CKKA 1T6ZA 4XGIA 1NMYA 1U3VA 1ZZGA 3BL8A 4UZSA 3RF7A 4K7JA 1G2QA 2PL5A 2JLXA 1XJ5A 4HX2A 1ZOSA 2R6CA 2PQMA 1X1SA 4NZOA 4PNEA 4MYDA 2VPIA 4PWZA 2BGJA 1H8ED 1V8BA 3OM0A 3GBVA 3F78A 3M3HA 1CUZA 4OKNA 4R81A 4HADA 3O03A 5EE5B 4ALLA 4Q37A 3G17A 1KNXA 1ZK1A 4YFYA 2Q28A 3G8AA 2QJWA 4ISBA 1OX4A 2QZPA 3H0EA 2EQ5A 3KSRA 2PS1A 4QAJA 2A0UA 4RTRA 1JH9A 3KKQA 3E1KA 3OZ7A 3SKYA 3M6WA 3F6BX 3AM4A 3GEPA 3BJEA 1FFAA 3AFMA 3ROEA 3TFQA 1DEAA 2YRFA 4D41A 5F35A 4AK9A 3NH9A 3AVTA 1NW6A 2AWOA 1N75A 3OCJA 1F3OA 2DUUA 2ZJ5A 3OJ0A 2PUDA 5EWLA 4KLRA 4PRKA 5BUQA 2C0PA 1H2EA 5DT2A 4RLHA 2EQBA 1V1MB 3E0QA 2IUYA 4FOOA 1MZVA 5AKJA 3UT0A 4N6GA 4RVCA 2OLKA 2JASA 4X9XA 1A9RA 1A8QA 1I2AA 2J41A 4I5EA 3G1TA 2I6XA 4I6EA 4MRMA 3EFOB 4MWTA 3EARA 1N57A 4UM9D 2P9JA 1NUAA 1LK7A 2QUIA 1GZHB 3ND9A 2HUNA 3ZZMA 3O2QB 4N54A 1O5IA 2OBBA 3AJ8A 3CRNA 2R7AA 3C8UA 1JIUA 3MZ0A 3ZR4B 3STUA 1SXIA 1EGAA 5F2KA 1RYYA 3KWJA 4CUKA 2AJCA 4GI2A 3FUUA 3NBKA 3MLAA 3GLIB 1GZ4A 3LOQA 1BVUA 3QFSA 1J2UA 3MGBA 3F7NA 4C6HA 1IWBB 1SIWA 1DAPA 3MHPA 4ARZA 2X3YA 3KQLA 3PHCA 4EENA 5JAIA 2Z2XA 1IZ0A 4KW7A 4G3XA 3KVNA 4WY5A 2C8KA 4LHYA 5EWMB 2W6MA 4DCNA 4DLLA 5IDWA 3CNHA 1ZUNB 4WXHA 4C4OA 1KGSA 1LVGA 3D3QA 2EZ4A 4U2BA 3THYA 5H81A 4LJRA 4HPJB 1TDJA 5E6RB 2R65A 2BE7A 2JDIA 4PSUA 3H5LA 1N7GA 2BUCA 2MSNA 3GFBA 5CFMA 3MM4A 3TLAA 3D8UA 1DQYA 5KWEA 1U4SA 2I4IA 2YH2A 3T9EA 2ZI9A 1QVRA 1VE6A 2G17A 1XMXA 3K9WA 4TTPA 1U3GA 2ONYA 3PJGA 2QXUA 2D1TA 3BFPA 3LLVA 2R6JA 3L8FA 1TPZA 1M2KA 2V8BA 4R7ZA 4BX8A 2FI1A 4YH1A 3T1VA 3VH1A 4CCWA 5BUCA 3OICA 1JHOA 1VHJA 3JVVA 3U31A 4YS6A 5KBYA 2ZB2A 1LV8A 2RARA 4ZAXA 1F6DA 5FHQA 3BK2A 1EB9A 3NT2A 1KU6A 3Q8LA 1ZS9A 4DOMA 2GZAA 3GJYA 4NLLA 1JQ3A 4BQRA 2ZRQA 4QWMA 1R50A 3GMDA 3L1JA 3A3PA 1O0BA 3W2GA 2IU0A 2XDYA 2EKZA 2ZBDA 4OI4A 2XUJA 2HTFA 1UFKA 2F2TA 3CC4B 4RVOA 3IT0A 1F0KA 1ZA1A 3AF6A 1LWNA 3QHQA 5JLAA 421PA 2AIRA 3T5PA 1YE5A 1PNRA 4OXQA 2VTBA 4TZTA 3X2SA 4C0WA 4D81A 4IVRA 3Q39A 3AG6A 2EP5A 1PX2A 4O4IF 4EUEA 1I36A 3AR9A 4UMDA 1B0PA 1FL9A 2JJQA 2M1XA 3DQQA 1L1FA 2V5AA 2C04A 5KTTA 3IUJA 1QHXA 2PM8A 3STTA 3UG7A 3RTAA 4BFCA 2HPHA 2HCTA 2ZRPA 2HRDA 1M83A 3D0OA 4GF5A 2GREA 4AO6A 1BYUA 1Q9SA 3HYNA 3O31A 1MHPA 1X9IA 4QOJA 1U2DA 1JEYB 4DRYA 3CZAA 1Q1AA 1YZ3A 1X19A 2PL9A 3I4LA 4L7VA 4RMJA 4DYVA 2IS1A 1DDGA 4E2WA 3HP4A 3MPOA 1XVUA 4I4IA 3V46A 1OBFO 3ONDA 4OP1A 5E6TA 1IPHA 1MAAA 1UJ4A 1EAMA 2SCUB 3H18A 3N0TA 3VJLA 1FTQA 1CJCA 1GITA 2G5TA 5KW9A 2A33A 4FCCA 1G5RA 1XMSA 1XRMA 1LBIA 1Z18A 2OG2A 3H65A 1BH2A 3DR5A 3IULA 3M9XA 3M33A 3I8OA 2DLDA 3TH5A 3W8NA 1JL3A 2AG6A 4MYRA 2J0UA 2FP3A 1SCAA 2AEFA 1WXGA 4TLCA 4OJQA 5H7XA 3LYLA 5HS4A 2W2LD 3FY4A 3VPCA 3WB0A 1NN1A 4O63O 5P21A 1HNZB 2BH2A 3VR5H 4NVRA 4ZWNA 4MV7A 2AG0A 1MH1A 4GWLA 3NGXA 2PKRA 5B57C 1SULA 5F7JA 3N59A 1PWYE 2HRQA 1YE3A 4MGZR 2A3RA 1XEFA 2QAGB 4W8HA 1D0VA 1JN0A 1M6HA 1PWZA 3ESZA 4OLFA 1V7PC 5CT6A 4WCFA 3WMGA 2OBYA 3ZW8A 3ABOB 5CIWA 2H17A 3MS4A 1Z7YA 5FLYA 3UAZA 4DBLC 2DIEA 4Y2JA 1BEZA 4Z4QA 2IOYA 2HHLA 3EIHA 3EMKA 1W48A 3FTDA 5E4JA 5G4LA 4Z86A 3WISA 5INTA 1V2GA 2ZBUA 3BIXA 3PZRA 4CM5A 3Q9SA 1FP1D 1X14A 1YDWA 1G8MA 4RJLA 4QQNA 2HMSA 1AXGA 2C4KA 4TV9F 3TZCA 4C03A 4Q7QA 2RD2A 3CNOA 1SHZA 3DDNA 3EVEA 1RBZA 5DISB 1JPVA 2RC5A 1Y1QA 2UYOA 2XDAA 5AKKA 3I0MA 4AB1A 1KWGA 2ZRBA 1DG3A 1PK9A 4UM9B 3Q3JB 2XZLA 4Z0PA 4CJXA 3RASA 5JYEA 5AVSA 3AM3A 2W0MA 1QF9A 1OWPA 3HBNA 4A73A 1MZPA 3IIKA 4A82A 5CB4B 2O20A 5I9TA 1YJAA 3G85A 1MX5A 1RYEA 2XYVA 4D9HA 4J43A 4ZOQI 2ZQYA 2C61A 3RYFA 3RVBA 3GXBA 1JI3A 1SQ5A 4RIFA 4E7PA 1AKVA 5FO1A 2WLSA 4WD3A 5SY9A 4HNVA 3V42A 3W4IA 4QJ4A 3CCSB 4E5PA 4G1BA 1EG7A 4RY2A 2PS3A 3OM8A 3GA0A 1D2CA 1WUTA 3QYAA 5JH7B 4ZT6A 4FMCF 3CX3A 3SQMA 5BVHA 1Q77A 2YWFA 1GUFA 5D7NA 3GPLA 1M2VB 4RBNA 4OIFA 4ZYWA 3KS9A 1FOEB 3H2BA 3ML1A 5IAOA 1Y5RA 1T8WA 2I7VA 2PV0A 5KYWB 1IG3A 3T7CA 1N2CB 1COWD 4BJ1A 3FHTA 1EQUA 3ZQ4A 3ZLUA 1R7RA 4TLDA 4FYVA 1IIRA 1CD5A 2IV3A 5AUOB 1NI4A 5T5QA 2VPWA 1VBMA 3PFBA 4OQPA 4UVIA 5ECGC 3BD9A 1U9IC 4UHDA 4UM5A 8ADHA 1TJ4A 2A7QA 1K6XA 5AW2A 4OKSA 2A9OA 2BFAA 4DRXB 2PRZA 4IIJB 2C2BA 4NK4A 4P82A 4ZGNB 4FD2A 3ZWAA 3OX2A 4ZALA 3QE4A 1F4PA 5CTJA 4M1SA 3VR6H 4U4AA 3AEXA 3DM5A 5EJ9A 2XGJA 2PA3A 3DLAA 4QTYA 3AFHA 4E0FA 1KPIA 3BS4A 3DFKA 3NIBA 3RI3A 3ITKA 4X6YA 1ORRA 4P35A 1S9HA 3DKPA 1IM2A 1DAKA 3T7DA 3WKDA 1TLLA 2V3CC 1EM8B 1L9KA 2QM8A 2RJOA 3B3GA 4L85A 3E35A 1D6JA 2BBTA 2Y3IA 1CY4A 4H6XA 3VO2A 3R0XA 3WOVA 1X7HA 4FWTA 5ALWA 4IRMA 1UKBA 3UW3A 1OT3A 1FPQA 4MHSA 1EWKA 3C7KA 1N6IA 1PNVA 5KNLA 4I1IA 1PJ8A 2Q99A 3WYAA 2WJWA 5DI3B 3O3CA 3H8JA 4RTOA 1TVMA 1ULHA 1EFPA 5D2CA 4P1VA 2O0JA 3TLXA 2Y1WA 4F1KA 5FOQA 3BIWA 5HKKD 1NM5C 4MWOA 4P08A 2NUPA 1CV2A 2PMFA 4FBMA 4AKEA 5FKJA 1I94B 1LFAA 1OXUA 3MWLA 3WHLA 2TMDA 5JADA 3V3TA 1M54A 2QTGA 3BWMA 1ISFA 3EA4A 3A0UA 4XRGA 3AW8A 3DLPX 1LW7A 2Z5FA 3DL4A 4DR2B 2R84A 4YUYA 2AZTA 1YC2A 1GRCA 1ZISA 2BEJA 3UN1A 1LPSA 4D45A 3O1JC 5CIYA 4UHJA 4A0HA 3GQVA 2QYOA 3JD3A 3HLKA 2O3UA 1Y8RB 3T99A 3CR8A 5A4DA 1NF9A 1P17A 5BYBA 2VA8A 4V0KA 4AZ0A 5FFNA 2DCUA 5HTOA 1SXGA 4AQDA 3ZGZA 4G89A 5K6TA 3HJAA 1TAUA 4O4LF 3KLBA 2IEZA 3DEJA 3LHKA 3UAWA 3WLSA 4CM4A 3PEEA 4RPGA 5JY1A 2JAPA 4RTNA 1HE1C 5BMVA 3H16A 1UC5B 2ZIXA 3JD0A 3N2GB 2I7CA 3W5BA 3SZUA 1J2EA 5IFLA 4UU1A 3O74A 3TQRA 4BGEA 4GX2A 1WHSA 5EJMA 1YB1A 2Q5OA 4ZYXA 1F0NA 4PW0A 5CFNA 1YFLA 1SQGA 2GNPA 4FE3A 1JVNA 1UT8A 3MWFA 4W5OA 1FYFA 1NX9A 3BT7A 2W48A 4EJ0A 2I4MA 2MINA 2ZAMA 1MTOA 2YHIB 3IAHA 5D3MB 5EP2A 2IZZA 5AW4A 4HDKB 1NVTA 5IM5A 2C94A 4D7AA 1UDWA 4I1PA 3EFEA 2HLDD 3EBLA 1ONBA 3L5OA 3PE4A 3ICEA 1I5EA 3AO0B 3QUSA 4G81A 4BVGA 1A50B 5KTMA 2QMHA 5F76A 1TUBB 4HYYA 1L4GA 3BXPA 5DHTA 1H4QA 3C3WA 1CIPA 1QMGA 2EYUA 1YHQB 5IHPA 4A36A 3P8ZA 3OHMA 5KDDA 1P81A 5DNVA 2ZI3A 1E6WA 1G8FA 3H5TA 4IUYA 1CQWA 1C1DB 1CZLA 1SM4A 4YP6A 5LKRA 3NEAA 1ZUWA 4WA8A 1J2YA 1WVGA 1R0KA 3L40A 2AQIA 3AHIA 4DV3B 2J85A 1IATA 1YNOA 2Z8YA 3UUFA 3I05A 2RGCA 3TLEA 4A1OA 1BMFA 1H8HA 1MENA 1XHLA 2DFLA 3Q2IA 5EIFA 3PQFA 3V33A 4M8LA 2WZBA 3AVUA 3I32A 1SCKA 1TU0A 1Q1NA 3IDQA 1VJSA 1O96B 4KIJA 4KHZA 1PZHA 3NANA 3SR4A 1FSFA 2ZZKA 1DIOB 2ZK7A 1PFUA 3AC0A 1SWWA 3FVRA 3KJZA 1XTTA 3HUTA 5T8KA 5KTOA 1XL1A 3QW2A 1UPUA 3TXYA 3R9IA 2B1RA 5TEVA 4CFSA 2DQZA 1MX3A 2A9QA 4S1VA 5A8AA 1RADA 2BEUB 3T53B 4DMCA 2X14A 2Z6UA 5J2UF 1Z4LA 3PNMA 2H7CA 3D8SA 1MF7A 2P68A 3HCNA 2VRBA 3NAZA 4Q3DA 5F7ZA 4OQ4A 4AF8A 4YUZA 1Z6YA 3NIDB 3ZBQA 2G80A 4JVNA 4QC2A 1U94A 2AX3A 2PEYA 4FI3C 2LD4A 3AB7A 5JD4A 1TO6A 1PT5A 1NN0A 2GT1A 5PGMA 4AJ1A 3S7ZA 4E4RA 3PC8A 1TZBA 3ASSA 3NJ4A 1F5SA 1XRQA 4CVNA 2XSZA 4F4CA 1YQTA 1C9JA 2MOKA 3FPLA 2CXSA 3WHPA 2TMGA 4GU5A 1TO1E 2R7MA 1NY5A 1GQYA 1T8UA 1R0RE 5C4MA 2DAPA 3BEOA 1XCJA 4ZPXA 1A8HA 1RSZA 3WGLA 2RH5A 3QXJA 5CNIA 4WXRA 1PD0A 3UY4A 3C3EA 3QVWA 1YFKA 3FVQA 1HEIA 1L7VC 2AEMA 3BGIA 4HAWA 4X1IA 4AS3A 1RWQA 4HGQA 5IXYA 4TXLA 4TV8F 3CT6A 3NHSA 4ENRA 2RHJA 3A58B 3TAXA 4D2IA 4D6PA 3QLVA 2NXNA 1F8GA 1RRVA 1Z0FA 2HA4A 4EI7A 3AXSA 3A1EA 3JAMA 4RA9B 3K9CA 3DZ8A 3H5IA 3BWDD 4HB2A 4RQUA 3EMBA 3CVJA 3L8DA 2Q6VA 2HF8A 1D2GA 3MUOA 1WCWA 2N3ZA 2NT4A 3PJDA 3KZNA 3ZDAA 1AUVA 1ESMA 5L45A 1M1NB 1JLSA 2QD1A 5EZ5A 1SUDA 3EVTA 4DAOA 2AOUB 1VMIA 3LECA 4G86A 1VSTA 2YV4A 1ATZA 4J9UE 1NULA 4DV2B 1V9SA 4B3HA 3VC7A 5E1OA 5TVGA 1II8A 3PDCA 5CFZA 1S02A 5TMBA 1P0PA 3RD5A 1YGPA 1KOGA 2L82A 1CUHA 1KYWA 3EB9A 5L6MB 4YJGA 2NYAA 3ILHA 1FYVA 4Y2RA 5IW8A 3ZQKA 1W88A 1LSUA 1WUYA 4JI7B 1VM6A 1MABB 4AF7A 1JIIA 4YRIA 5CFPA 3GXOA 4LRQA 5IF3A 1ODJA 1UJ6A 1M8JA 1ZDMA 1ZGGA 4HPWA 1TZMA 2CHFA 3DB1A 2FPRA 3L9WA 1UK7A 2EF1A 3OE4A 4NULA 4OVKA 5HFJA 4C1BA 3SLDA 5HM6A 2UZ4A 2OORC 4MAFA 3BE8A 4B3CA 3BULA 4MVJP 4WXEA 5AJXA 5JCOA 4KMSA 3L07A 1DC5A 3O75A 3NQ41 1YMVA 1KQFA 2A35A 3R0ZA 1U6JA 1BS2A 1W4CA 1YQWA 3CUTA 1TYEB 3OA0A 1COZA 3PQDA 4KXYA 1ZD3A 4PYKA 4EFKA 5IG2A 2SNIE 2PX0A 2RFLA 2NTEA 3EGDA 4IJWA 3QX3A 2QN3A 5DBHX 3SWWA 1UWVA 1VLVA 1NF2A 3DVAA 3IOYA 3QBTA 4TYMA 3RK0A 3UF0A 3U9TA 4KNVA 1GR0A 3CURA 1N0WA 2PBZA 1FDRA 1J06A 1HOTA 5IK2A 2FPUA 2CN1A 4C30A 2WW8A 2A86A 2O8BB 3DAYA 4RM0A 2J5RA 2YBDA 4MS1A 1NBHA 3WLMA 2H31A 1G1AA 2WJPA 3UGTA 1Z07A 5DCYA 4XQFA 2R1TB 3FVVA 2WZDA 4G65A 3FFBA 4LNUB 1LTQA 4QUBA 3UXYA 3W9UA 3WK9A 1NVFA 1M8PA 4GPAA 1ZJWA 1A69A 1D2NA 4YMUA 4F1JA 2QXYA 1FMTA 2WKQA 4E31A 4DWOA 3DZHA 2HWXA 5GONB 3DMTA 2ODTX 4OHXA 1XE1A 3S44A 5I9LA 2AMYA 4GKBA 5CX1A 4AYTA 3LWZA 1KEZA 2WFLA 1P91A 1FS6A 4Q16A 1WVIA 2AKYA 4P3YA 5TEWA 3F6CA 4W63A 3UMYA 1DU4A 3HYRA 3MERA 2PUBA 3H42B 3HR8A 4NJMA 4D74A 1VIAA 3SR0A 4OU4A 2PUHA 5KPJA 1CHDA 3F96A 5IVIA 2QE7A 1ADGA 1DQSA 1E5VA 1LZKA 1XQVA 2F1IA 3R7AA 2B1QA 3L18A 3GMIA 1LX6A 1FFXA 3HWRA 1N78A 3ESQA 3OOEA 3GLGA 4MV0A 1JF8A 1XZPA 1L7PA 4HC4A 4XX0B 4YR7A 4FNMA 2Q41A 4OPMA 5JI3E 2ZL6A 3O93A 5M34A 1H93A 1F7UA 1A8UA 4A92A 5K1ZA 2QVZX 4EGSA 4PHHA 1RYHA 4TSFD 2C7OA 1HG0A 1WSVA 4HBZA 1QWSA 3ZNQA 2LDBA 2QNBA 1KBQA 1EWRA 4E88A 1E0JA 1YKFA 3FUCA 5I9SA 1QR2A 5TS2A 1J7KA 3RANA 4XORA 4Z9AA 1JLHA 1LLUA 1YJNB 1HE4A 1NP7A 2CD7A 2R5FA 4XGRA 1EP3B 1BE1A 1NWHA 1L3CA 3JQ9A 4GRIA 2DE0X 1FNCA 1HV8A 3DDSA 4HN4B 4YFVA 5BQ5A 3WRWA 1PR9A 4CMEC 5FEUA 1T4MA 1CDZA 1QX3A 4UEQA 5ICSA 5FFFA 5CFOA 2W7TA 4PXAA 3WXMA 3BE4A 4JL5A 5HUJA 5EKXA 4WZKA 4JJ6A 4Y6GB 2BGNA 1G8AA 3FHOA 4LZPA 2WB4A 4EHHA 2JEZA 3QVSA 4HYEA 2PKXA 5FORA 3DMNA 1MFPA 3EF0A 1SC1A 4NKRA 4G85A 4TS3A 1ENOA 2VEOA 4UXJA 4AWXA 4DC9A 3K1AA 5ADUS 3T5CA 2D13A 3EXHC 4HEQA 4Y3UA 2V97A 4WUTA 4C2BA 3TLMA 1GV0A 2C4TA 2IHYA 2JAWA 4K1LA 3RF6A 4H6WA 5JAOA 4JLDA 1W5FA 4JKOA 1ZD4A 3EXHB 1XAHA 2X5KO 4WINA 5G02A 2Z57A 3TSCA 1DAOA 2LWIA 1Y1RA 1V96A 5BN3B 3IB3A 4G0NA 2LCFA 4HLCA 2PRSA 4US1R 2V7QD 3Q6QA 3TEJA 1XPJA 4UHBA 3UJAA 4F9FA 3FE2A 3DT9A 4Q9HA 1JJ2B 1V5IA 3AKEA 4BWGA 3G02A 3KZKA 1W73A 2ECPA 4EMUA 4OUDA 2A67A 3SYRA 3CO5A 4XUCA 2Q0QA 1IEQA 4MIEA 4BV8A 2WM2A 3EPHA 1VMAA 1OWNA 2O05A 3KYIB 1VLOA 2O59A 1I7PA 1G291 1PWHA 3F7TA 3U7QB 4FYXA 1LBHA 2GJ9A 1L5QA 4MW9A 1ORWA 3KG2A 4QV2A 1AKEA 1YRWA 2DGDA 1J2JA 4FC7A 4KFRA 2VG8A 2BOVA 4UDNA 2I4RA 2AZDA 1AZLA 4EF4A 5BSGA 3EG9B 3NT4A 4GMDA 5C8DA 3PXDA 5KVVA 2PR2A 1Z5NA 1PJRA 3L6UA 2FW1A 1HBJA 1MD9A 3BZBA 4LDNA 5GQSA 4AP9A 1H2ZA 1O9BA 2ZBGA 5C32A 5LYJB 3AX6A 1PVVA 2PAAA 2YQ4A 3LX5A 3OOYA 4TZ0A 4M36A 4UPDA 3FWYA 2OGUA 5E0KB 1T0IA 2BM9A 4DV6B 2GN2A 5KJ1A 3UAXA 4BC1A 5HW0A 1FDIA 2OCYC 4S3MA 1KH1A 2B34A 2C4WA 4KAAA 3K6RA 4YCNA 2Z08A 1GAWA 1YU9A 1MOPA 2FZLA 4ZREA 2WTBA 1NNLA 1W2HA 2D5IA 1TNDA 2Q4RA 4QVKA 1DV1A 1FX0A 2JI8A 4FLEA 5FO0A 3R1IA 2WHXA 1IBSA 3NYRA 3RWBA 1DO0A 3AF3A 1KMHA 1V45E 4E09A 1GZ5A 1XXHB 1JB9A 3ONVA 4L51A 2F8SA 1ENZA 1PR6A 1NU6A 2QX7A 3P4XA 3RUEA 3UHJA 2HLHA 2LTAA 5B4TA 1GTZA 1ZEMA 4YR9A 1A7JA 1R88A 1Z68A 2VHVA 4BMPB 5ARBA 2A9JA 2O2DA 1KI6B 4ZO6A 5CK4A 4F60A 5KOYA 1NATA 3V80A 1P9NA 2WMDA 1M6YA 4Q03A 2FP4A 2FR1A 4F12A 1RLMA 4ZCRA 4QM6A 2PZKA 4YPVA 2RC6A 2QD2A 1UZAA 3H0KA 3H86A 3L46A 4H1UA 3KZMA 3VZDA 2Q1YA 5LMCA 2JLYA 1ONPA 2VS1A 3DVLA 2V6IA 1VPDA 1TEXA 4GI3A 2ZXUA 2QV0A 3FNRA 3GT0A 3VR5D 3TJZA 1X87A 4NBNA 3O3OB 4P4SA 4QQRA 2DWQA 3A3OA 4DCTA 1Z8FA 5KC8A 3RS3A 4YLGA 4D9JA 3T7AA 2Q6KA 3O73A 1JMVA 2CLLB 3GLTA 1U8AA 4QKQA 2IYTA 3UBTA 2B4QA 4MEAA 2Y92A 1VCNA 1YR1A 4E5VA 2O6LA 2J3KA 5ESRA 3S2IA 3ABQB 4I4TB 4XR6A 2XB9A 3TD2A 3V8NA 4BB5A 4B74A 3A26A 4RPLA 2CLSA 2DVMA 3IUYA 1ZD2P 1G38A 3DL2A 5C8YF 2VBCA 1K9SA 2PRYA 1T10A 3UV6A 4X6LA 1ZJ4A 4Y2XA 3W2EA 4K2HA 1FUKA 1N5JA 2PN1A 2VJIA 1Z62A 1FJXA 2VBVA 4FOPA 1FXWA 3UQYS 5CVUA 2PAFA 1M2GA 1RBYA 1U3WA 4OJKA 2BHRA 1RQGA 3P2KA 4Y1GA 2NU8A 1KVUA 2CSUA 4OHUA 4C6TA 4Q6BA 5F3DA 1PU2A 2YV5A 3BFVA 2VP0A 1AV6A 4BU1A 4WOBA 1D04A 4K6CA 5D1HA 4V03A 5G0UA 3JRNA 4NABA 1P4MA 1E20A 1YO6A 4R1TA 2VAMA 3P0EA 5HF8A 3F7MA 1ZMOA 3AJEA 4N9QA 4PAMA 1WM1A 1W8DA 3EFBA 4QUHA 3HCDA 4BTLA 5FX2A 3G2HA 4B73A 2XJ4A 3DFIA 1O7JA 4X8IA 4FMDF 1D4OA 3J80A 4FTWA 1RW4A 2WT8A 3GDWA 5KNCH 4MKRA 3BQMB 2TRSB 4KAFA 4CIYA 4KJXA 1CP2A 3PKZA 3T7JA 2PG3A 4UNRA 3Q12A 3FA2A 5SYNA 4L7QA 4Q3EA 2OP0A 1GZ3A 2E87A 2WSYB 1GAQA 3KQMA 4K9SA 1Y81A 1EFTA 1T4GA 5IJAA 1QUFA 1OV6A 3ZNPA 4H7KA 3NDJA 2E1PA 1Y6RA 3P9NA 4CHTA 2E4UA 3H9GA 3DPSA 3E9QA 3BBLA 2IXGA 1PSWA 4W1QA 2JIOA 2DHCA 3L1UA 2WSSD 4B8ZA 3RC8A 4L6AA 3AB3A 1E1DA 1X1CA 1RLOA 4WIAA 2ERXA 1ZN8A 4MOWA 3UMVA 4O0MA 2OM2A 2Q2QA 4JXXA 1QKJA 2CUNA 2D4AA 1EVKA 1JHQA 3FKSA 1Y4SA 5A9SA 4TKZA 4XM2A 5JNLA 4YRPA 2ID7A 3ZS9A 4M60A 1M1YA 4YRMA 1L4KA 1RPAA 2JIZD 2VH2A 4F3NA 2ZSBA 3OC0A 3VVLA 3E8MA 4QTZA 1ECJA 3C7CB 4RDXA 2A14A 2WFAA 2ZE8A 3IJ5A 5DEIA 3VR6D 2I5PO 3G0IA 2PMEA 4CT5A 1EBUA 2XKKA 2AR0A 1UDBA 2G40A 2UVDA 4FFBB 1PQUA 2UUPA 5LZ8A 3HI4A 3DKVA 2PXXA 2R7KA 2DTDA 2QORA 3BB3A 4KYVA 4PPNA 1C30A 3R5KA 1K6EA 2OFOA 3PC6A 4URHA 3SHWA 4JHLA 4EECA 2A3NA 5EJEA 1TM3E 2V1UA 5DM60 4OGFA 3IVMA 3KT6A 2WFMA 4UE2A 1LW6E 2GPWA 3ECSA 3ZDFA 2D00A 4IDCA 1Q2XA 2VJDA 5HGJA 3PUKA 1H0SA 1RWWA 2GZ2A 4MUEA 2R86A 4XLHA 3FAZA 2GJ8A 2YXNA 3BMCA 4HDOB 5DCWA 5AW5A 1FMCA 4XUDA 1FBNA 2PUJA 3QG1A 3UMCA 4ZK6A 5JSQA 2IX3A 3GV0A 1G20E 3K32A 2FPXA 3O84A 2IODA 4HWKA 4L95C 1NHWA 2HWYA 4XIFA 4ETNA 2QTBA 3N70A 4Q4AB 2QY9A 3WRXC 3ZOKA 1IVSA 1CUEA 1ZESA 4L08A 1QANA 1Z15A 4LXIA 3BX1A 2BHSA 4EMSA 2HSJA 2X41A 1GY8A 1U0OC 3N0RA 1CRPA 3BXHA 1OLSA 1ZU5A 3A8IA 2VPQA 1SHJA 4MA4A 2J9FB 5DX8A 1OBHA 1O58A 2R7NA 3KKOA 1XFDA 3DLIA 2PKQO 3R7WA 1X7YA 1C4OA 3ZJTA 1O9GA 3B2NA 3CWZA 3ICOA 2V65A 4ADSG 1YL5A 4G5QA 3R5XA 3R75A 2Y4NA 4KGZA 4JXJA 3DFUA 3NTLA 4GSKA 4JHXA 4WEOA 4BO5A 5ALTA 1VF7A 1ZQ9A 1PGPA 4WERA 1AN0A 2YV2A 4NOLA 4PX2A 1ZHHA 3WAKA 3PUXA 5K99A 3QV2A 2UUAB 2E37A 3UAGA 1D6NA 3T51B 2Q6TA 4DBVO 2O8DA 2BFPA 4BB6A 1N8KA 3A1WA 4QSHA 1APBA 2X4LA 4B4UA 1E92A 1Q1EA 3WJAA 1NIPA 3TNDA 5F2EA 1BVRA 4EW6A 4HAIA 4OB7A 3QOWA 4OUKX 1H6AA 2NU7A 4E5UA 1FP4B 4MWBA 3KB8A 3NVDA 4RORA 4ID9A 5G1OA 5AXCA 3ZE1B 2BGGA 3LWBA 3IP1A 4X62B 5AYVA 4FFPA 1PF7E 2D7CA 2P8SA 3AZQA 3TIIA 3LH5A 3ZWXA 2DFNA 1C50A 1N1DA 4EHDA 1KAHA 5JBNA 4NECA 3LKBA 2G9NA 2NO5A 2ZXIA 2BMDA 3OFND 2NVUB 4FYYA 1P5HA 3FDZB 5AI0A 5IANA 1LDBA 1CUDA 4QYXA 5KU1A 2FPKA 5M04A 3NHUA 1VQKB 4EIWA 4PZUA 1BHSA 1E3LA 3MRTA 4HWRA 4MUJA 2QA5A 4TKVB 4O3MA 1PJQA 4B85A 1YZNA 2FPMA 4XJVA 4C4SA 2Q3FA 2PMDA 1CCWA 4RQBA 4DT1B 3PRKE 1CRQA 1F8YA 3L4BA 1DJMA 3PF8A 2NNLD 4B3JA 3QI2A 1YLOA 1LSOA 1BTOA 2ZYDA 3B6JA 1N8NA 4MI1A 5HQ3A 5LOVB 5DKFA 2P9FA 4UZUA 1EHYA 3TGLA 3CLSD 2DULA 4UMFA 1JWLA 5KCMA 3G7NA 4MGIR 4M9ZA 5B7QA 3W6OA 4R1MA 2WJVA 4TS4A 3UB2A 2BFOA 1IBLB 2PX8A 3OESA 1K4KA 2BFMA 2QD4A 4BNGA 1LDYA 3MPUA 4G0PA 5BSFA 4XM3A 3H17A 2HK6A 3SDSA 3B9QA 3G9ZA 3I61A 4FOSA 1SBIA 1CR4A 2YICA 4IHJB 5TGTA 5A04A 3ORQA 2VHTA 3O94A 5JMTA 1GT6A 5H59A 1WW3A 3UB3A 3QFRA 3UFXB 4UTZA 4FHCA 4GPZA 4QRDA 3FJOA 4L0DA 1X7DA 5IKOA 4D42A 4ENVA 4FP9A 1VSUA 5DLPA 5AM0A 4JASB 2ANBA 5C51B 4DMMA 3KK0A 4J0FA 4R1NA 2Z95A 1EK1A 3PU6A 5FV7A 1CY8A 1Z83A 2O8FB 2KSQA 3LC1O 1CETA 2Y1GA 1WWKA 1SD1A 2XKJE 4HRYA 4PX3A 1SOMA 1MRZA 4BMSA 4YHBA 1VKNA 4BU0A 4CGZA 1NUPA 2Z1DA 2DT8A 4FSDA 4NCBA 4J9VA 3AQIA 1GSHA 2ZRIA 3LWDA 3SEFA 4OU5A 1WBDA 5C7OO 1QH1B 4UZEA 4G1FA 2R66A 2CKDA 5HG0A 1K3TA 4NU0A 3I9OA 4KO2S 1ISHA 4ZTZB 4LF5B 4A0FA 3K6JA 2IU6A 2CCKA 1CEYA 2GAIA 1RWKA 1ZNZA 2WBLC 5C1IA 5AKLA 1U8EA 2G9UA 1PGOA 4KCGA 1G9XA 1UKYA 3MYRA 4G1CA 1YJQA 5FJJA 4EHBA 1R64A 1S8OA 2IS4A 4QGAA 3TRKA 4H7HA 3WZ2A 5FI3A 5JFTA 4MJXA 5GINE 4DR7B 1JJAA 1VL1A 3DOCA 1NURA 4CMCA 3FF1A 1UFOA 1LA2A 2FDCA 1EEXB 4DCVA 5DYGA 4ONEA 4R01A 3MT9A 4YASA 3TRHA 5AKEA 2A5DA 1JAHA 3BC1A 4NQZA 4PZAA 3G05A 4EG7A 3BSWA 1BD3A 3SF0A 3L7KA 4KBFA 5CVTA 4DIUA 3KKZA 4UBNA 1DKQA 3NBQA 4RHCA 4F4DA 3GJ4A 1ESNA 3VZSA 2C3PA 1NUSA 2P78A 1L4HA 3EA0A 5FBKA 1KYZA 5B7PA 3KHKA 4A6PA 3ELWA 2FVXA 4I9HA 2H1FA 1E1QA 2WT9A 3CCBA 3L5KA 3DZCA 5DU2A 3IO5A 5FADA 4YN3A 1PR0A 2QGNA 1I4DD 4F38A 2I99A 2RB5A 2XB4A 3FJYA 3EAGA 4WAUA 3RU3A 3GGSA 5IKMA 2AC2A 4PC3A 2OBNA 1JR2A 4BEBA 1DT3A 2HMYB 2I4TA 4LC1A 1EFVB 4XZ3A 2COKA 1OMOA 3T41A 1THMA 2G9VA 5CB6A 2I1WA 3C3CA 1RRKA 2BFEA 5KO2A 2VP5A 3BYZA 1QRUA 1PYOA 1Y34E 16PKA 1Q7CA 3AHHA 3EOBI 2VWHA 5DMXA 3FLAA 2LCQA 3UK1A 3T1YB 3RYHA 3W04A 1DNPA 2HF7A 2C78A 2X5NA 3CLHA 3T8YA 4D4IA 1TA4A 3E23A 2ZZQA 2R97A 3A4NA 4BKPA 1A9SA 4XOUA 1IAQA 1QIIA 2P6MA 5HPYB 1V8FA 1BOOA 4RCVA 2Z83A 4UPEA 3V8MA 5TT0A 5BQXA 1NBAA 5HFAA 5JATA 1RJFA 3E7PA 2BM1A 3V2GA 4JUFA 1YBAA 3MBKA 4M0EA 2QR5A 4BX2A 1KDPA 5L8VA 1WNTA 4ND3A 3TZEA 5KQLA 1GGHA 1UD6A 2V9CA 3R74A 1JEQA 1SKYE 4ZZIA 1A1SA 1B0ZA 5JMPA 1SURA 4BY9E 5J4LA 2PIDA 1BN6A 2FR8A 5C8XA 3C1TA 1U2PA 4LMRA 5EIXA 5EUCA 4G0XA 5KJFA 5JCJD 4MPDA 2OBLA 4FEEA 4MB2A 2O0LA 4PS0A 4QEKA 5EEHA 3G0HA 4Q00A 2O2HA 3GP3A 2EV9A 3F9IA 1Y9ZA 5ICCA 3CLSC 3FBGA 1UD4A 3N2ZB 1XU7A 4RADA 4NCNA 4JC0A 5JDIC 4HWOA 1U31A 5C7YA 3PQ8A 3QPWA 3OKXA 1Q86D 1U7XA 1X38A 5CX4A 1HGXA 4E1AA 1R8SA 1I7SB 3R24A 1XKTA 3NV9A 2BELA 4Y2SA 1QYRA 1W8IA 1WDWB 1XIVA 4K87A 4CKEB 2H06A 1CJSA 2HGSA 5J43A 3GRUA 2MU1A 5TXGA 1NB0A 3C3DA 5U4XA 4O4IB 2QTZA 4U2CA 4Q82A 1F2DA 2ADMA 2AFHB 1U7OA 3UWSA 4O2AF 1P5ZB 3OP1A 4PLWA 2RHGB 1OYYA 1NC3A 2QQGA 1N34B 1Z4JA 4BS9A 1RPZA 2PX2A 3BTUA 2ZZNA 2B2NA 2JGNA 3MJEA 4XLEA 3ZHSA 1I0IA 4AJOA 3OHSX 1XX6A 4MTCA 3VNRA 1Y6FA 4BUZA 3AL0C 1AM4D 2WSLA 4BP3A 1CF4A 1R9GA 3KLOA 3ZCQA 1XKLA 2QVCA 4ZTBA 4EX6A 1UBCA 1MB0A 2RKWA 1DIAA 2WE7A 4EPWA 4BFZA 2HD4A 1MLDA 1PD1A 3KOOA 1JYSA 4B40A 5JROA 3DHWC 1FYWA 1QO7A 4R4JA 3PUWA 4A5OA 2CCGA 3FKJA 3N87A 1XMVA 2QLNA 3GEHA 4K9RA 3H05A 4PS1A 4ML3A 1X42A 3MWEB 1AO3A 1K5HA 3Q5DA 4FHFA 2NQ2C 4OGWA 4QBGB 4C2AA 3K5WA 4CG2A 4OB8A 2JFVA 5LQRA 1I7DA 3KEWA 1QLHA 1UJBA 3R0JA 4GOXA 4WVFA 3REQA 4Z6KA 3HHEA 3P9CA 3KTAA 3FFAA 2PSFA 2XKBA 3JQ6A 4L5YA 4Z1MD 2NTNA 1E5XA 4KYTA 4BRSA 3HH8A 2CFIA 4J4TA 1F2UA 3WS7A 4EITA 5FAKA 2Q3LA 1KP3A 1JPNA 1E66A 4RL4A 4C76A 4YMVA 3LSYA 4V24A 1MMFB 2JRCA 3TINA 4AO8A 1UDRA 2ZJYA 3H5VA 3KYCA 2AXNA 4QBTA 1IU9A 1S96A 1VBNA 4V3CA 1F8FA 3BCSA 5J35A 1Z4NA 1RP7A 4OFXA 4TV9B 3ZWQA 4ARSA 2EP7A 3CCQB 3FHLA 3O26A 2G3YA 2P75A 3EZ7A 4J91A 2B0JA 2PVCA 3I72A 2BGRA 4N1AA 3FI9A 4DUGA 1V5GA 3E7FA 4HX5A 3E22A 4L78A 4AN4A 2IZ1A 3RCBA 5E9JA 5K0EA 3ENKA 4CTKA 2CJXA 1XMOB 4AKSA 5CD1A 3ZX5A 4A8JB 4W8OA 4L8JA 2PRKA 3TW4A 4JFAA 1TPYA 3ND5A 1TE2A 1CUIA 2Q3HA 4EABA 4R3UC 5DNCA 3HO1A 1IFXA 2MYPA 5KSOA 2Z1NA 5JNRA 1ZLYA 4J07A 4CL2A 2X9VA 2EF0A 3ICPA 4TLEA 1W85A 5ALFA 4QU0A 2AC4A 4PIPA 4RH0A 4JT2A 5TV2A 1T2VA 4PAQA 4PANA 1R8QA 4W1RA 2JANA 2V98A 4ZOBA 5FRDA 2AN5A 3KYJB 2EGUA 4MWEA 4MVJH 3KELA 1EGMB 4R2WA 4W9NC 4TWZA 4MHOA 1DXHA 3VJMA 3VO8A 3JYNA 1A9XA 1S7GA 2L18A 2RSLA 3IKLA 3CMMA 4ASUD 3T4EA 4CM6A 2ZJFA 1TYCA 2QIOA 3QBVA 2ZJAA 1G21E 5DNAA 5BORA 1GPJA 3JQEA 4BWYA 2M32A 3CRRA 1X8JA 4JP1A 2JJ1A 2ZL7A 2VYVA 3AJAA 2I4LA 3PXEA 4CG3A 1Y5NA 1NXOA 3SBEA 1ANKA 1K5PA 4HLNA 3LX6A 4UFOA 1N6OA 1CHNA 5B4UA 1MC1A 3GWZA 3HCBA 4QGHA 3ZHUA 4KGDA 2J4FA 1U1FA 3C7AA 1VL6A 1PO7A 1G8SA 2A1UB 4Q1BA 2HPVA 1AF7A 1EWVA 1YOBA 4TVBA 4FN5A 2O3JA 3LCUA 2QTVA 3VTAA 3QJYA 3QVGA 2CE7A 4D1YA 3KAJA 4YJFA 4CT4B 4XWWA 5LM3A 2EDCA 4PO9A 4X64B 4ARVA 2PO5A 4QFDA 1FTNA 3GNSA 1P0MA 3LRTA 4X6UA 1I1NA 1C7JA 1T2UA 2JLRA 4NZPA 2X8KA 4IXDA 1P4GA 5H70A 4C06A 1EXDA 3RBAA 5BPHA 3CRMA 2YVKA 2IJGX 4GG1A 1MOSA 5IXSA 3NKVA 2DC1A 4FLMA 4QBHA 5IJZA 3WBBA 1Z3IX 5LMNB 1M1UA 3OM1A 4JJFA 2J7KA 1CXZA 2P9BA 4JQOA 4BZZA 3EX7C 2P11A 1J24A 3ZEAA 3DMPA 1ZGBA 2VPPA 4FW8A 4MKFA 4RJTA 4JVSB 5TARA 4LY3A 1FMFA 4BJHB 4XW2A 2PDAA 4HEHA 1XVAA 2F1MA 1QWOA 3EAQA 3EGVA 3GI1A 4QYIB 3WWOA 4L4YA 3HBFA 1FMJA 4S1PA 3MMZA 4Z9YA 4PG8A 3A35A 1GGJA 2GETA 4LCJA 3E27A 2B8EA 4MW4A 1NXXA 2ZTVA 1G0NA 3E7XA 5DT9A 3PNSA 3DZFA 4HZUB 1B3RA 1M5TA 1XCMA 5KYKA 1GKKA 1NSTA 4BMOB 1TIBA 4Y98A 3GLFE 5KVQA 4QVIA 4JX9A 1JZQA 2JLCA 4KAJA 2PZ8A 3P9YA 3OJWA 5BVGB 3T15A 3TE7A 2RK6A 3M4JA 2YJ5A 5EHXA 3MAJA 2C4HA 3GN1A 1R10A 5KPDA 1KJQA 2VJAA 2XKAA 5EHQA 1KSFX 1NHGA 1AS3A 2H1WA 2H85A 2VXCA 3GJ5A 3T7RA 4LC0A 1L9XA 2YUIA 1S6YA 2LE0A 4S24A 5KNCD 2QRQA 3K9FC 2ZKLA 1RZ3A 2JH8A 1SQ6A 2O2EA 4O4LB 3U7IA 6PFKA 4PYMA 4R9RA 3DZIA 1DEHA 2XQVA 4TS1A 1TYZA 4FHEA 1NW3A 1PJLA 2GF2A 2OBSA 2GVNA 3WJ2A 5C5IA 3I3OA 3KOYA 3WL8A 4JVOA 4JV5B 4CQMA 3TIVA 3CNQS 4KX5A 2ZP1A 3UANA 3FYHA 1BCSA 1IZ9A 4QG7A 3STHA 2WA1A 5CLLA 4MUAA 2PK3A 4G7XA 2P7HA 3U3ZA 1YS7A 1CULC 2HRRA 4ANFA 1X15A 4URVR 2Y0PA 4TGLA 1FDUA 1F6BA 3DUFA 3G0DA 5TF0A 3AUXA 1LPPA 3E81A 2XF2A 4UHKA 1AKRA 4HTAA 4D8TA 1SMKA 5JXHA 5FPYA 3NIWA 1BAPA 1ZRNA 4RU1A 1NAIA 3C3YA 3IO3A 3OLZA 3R76A 1T4BA 3OQOA 4TS9A 2XCIA 3KXKA 4G5RA 3ZDEA 5AT1A 3KALA 3LPLA 5TMDA 1ZGAA 1MC4A 1NBWB 2HBYA 5EZYF 4Z7NB 3FPCA 3BTVA 2JFXA 1QXSA 2ZTLA 3CTPA 3S2FA 4TWBA 4Z7QB 1M8KA 2FFQA 2I87A 4YEDA 4EEKA 1KS9A 1T6BY 2ATIA 4W9RA 3CCJB 1L7MA 3EWNA 2BM8A 4IEEA 2A5YB 3H3FA 1V39A 4YMLA 4E21A 4YRRA 3R3YA 2DUWA 3VU8A 3K5IA 1UT6A 2PSJA 3EOAI 4YV0A 3U7FB 1T2NA 1OFGA 4KWTA 3I01M 1EK2A 5HX7A 3GRAA 3IBFA 2R87A 1HDXA 5JISA 3AFIA 2Z98A 1K9MD 4O4JA 3I9LA 3H2ZA 2IZ0A 1MVNA 4MVJI 3VR2A 2ZUEA 4P9NA 3PUNA 2BL4A 5A6SB 2FZCA 3I12A 4NC9A 3V4OA 3E5MA 4B8WA 5E4YA 3ZS8A 1YIJB 2X77A 2HW8A 1W9MA 3VHXB 4Y7CA 4BUCA 3WGGA 1M5UA 4OTZA 3Q10A 5H4HA 1W9XA 3EQ9A 5F78A 2OGTA 4K46A 1GTJ1 3AUUA 1H4VB 1L5HA 3GFRA 5IVDA 4TWIA 4A0SA 4PGMA 1RXWA 3EQ8A 1ID1A 1J23A 2NGRA 3ZCSA 3B1WA 5BMVF 1WMBA 4QDTA 1QIJA 4XDZA 3EEBA 3SU8A 2IITA 3I5YA 2AD5A 3KQSA 1GZUA 4B6SA 1NE7A 1PJTA 4IV0A 4V0NA 3GMSA 4MRAA 1VG8A 5EZ6B 1XI2A 3HCPA 3KJXA 4GXTA 4MR8B 4MVJG 3ROXA 3T3EA 1T5OA 3MCWA 3FTNA 2F55A 2OD7A 3GPBA 4PABA 1XMPA 2XLCA 2BMEA 2B78A 2IIVA 4I46A 4P3PA 4KE8A 5ESXA 3RHFA 4D5EA 1JHUA 1HORA 4TV8B 3A37A 4WZAE 1RCUA 1JKJB 1L5GB 4Q4HA 3SI7A 3UENA 2A9FA 1B43A 1TT5A 1IZ8A 3KR2A 2IEAA 3CC7B 3MUFA 4JUDX 5A62A 4DWVA 1S3SA 2IEIA 4H9GA 1Z4MA 1W0KA 3HS3A 5T41A 5EMNA 3NOQA 3PYMA 1AKUA 4N7RA 2ETVA 4C88A 4EWLA 5C8VA 1LBEA 2IXDA 4H31A 4NS4A 3SZRA 4CODB 2W90A 5CG1A 1C9MA 1QB8A 2A1IA 3BF8A 4PO3X 3U4MA 2IFTA 1CK4A 3MLBA 5KMGA 1DKOA 1GQFA 1LUAA 2W6IA 3C3JA 3EW9A 4N49A 1ZP6A 4HNAB 3PK0A 2CYAA 4XVQA 4ZN6A 5LFAA 4BMYA 3QU2A 3QU7A 4FYJA 4HGRA 3CA8A 4B0OA 3H1TA 3CSUA 1DPGA 2IZ7A 4GOOD 2C99A 2I66A 3AOGA 3TZ6A 2ZT7A 4H6VA 1BS9A 1T9BA 2XVAA 4BGIA 1N5KA 2V4MA 1VPVA 1UPAA 4MLCA 4IQGA 4IGAA 3H87A 1PQ4A 3A6LA 4MLDA 2NQ8A 1KI2A 2GD0A 1AQYA 1H05A 2WWHA 2Y71A 2AR9A 2QRJA 2H57A 2JCYA 4RF5A 1PYDA 1XXLA 4FMBB 3V7AA 3RIMA 2CV0A 2PZEA 3ZNNA 1JR3A 2Z56A 1BE0A 1VHDA 2Z2JA 3DWGA 3SGLA 3CLTD 3HWWA 4ZV4A 1Z06A 5G40A 3RC3A 1RYBA 1CQJB 1MDFA 3EZXA 4Y9TA 5GP1A 1CNMA 3UXMA 3QELB 4HNHA 3V34A 3E1SA 4DLUA 3PLAE 4YP7A 1PFQA 4I99A 1GPUA 2ZB7A 3TFOA 3N2IA 4HQOA 2CDRA 3O21A 1IPFA 5EMHA 3WK6A 1B6RA 4YCMA 1UXOA 3I6BA 1DC4A 2Q29A 4P0TA 1DKNA 2D54A 1X8LA 4KWEA 1CT9A 4Z51A 5ICGA 2AKAB 3IH5A 2DTXA 4A2QA 1AKYA 4GSLA 4DMUB 2R1UA 3DBOB 4OFBA 5FBRB 3D7NA 3FCCA 4X24A 3EFOA 3O92A 1Z0JA 4ILEA 4C5AA 3IB6A 1U3TA 1ATIA 1EUYA 4DUPA 1A4RA 3DLBA 3LOPA 1EQ2A 3EDMA 3PQEA 5AHOA 5ALVA 1ZBDA 2D8AA 2HBQA 2VUSA 3KFLA 4CW7A 1WPXA 3UGKA 1CJBA 1OU4A 4MYCA 3ZKAA 4MV8A 3UJPA 2YVQA 1ZU4A 3PCTA 3MRSA 4XM0A 1BHQ1 2VWPA 3Q88A 3ZK8A 5E6SB 5FNZA 2GXAA 2JD2A 3GLIA 1WIWA 3FPJA 4HH0A 2QB5A 1JA9A 4Z4CA 2P5UA 2JAOA 4EKGA 1I4OA 3K1ZA 1K98A 1R0SA 3SJZA 4OLJA 4EFNA 4KQ6A 4UVHA 2X5JO 1XLWA 2OK8A 1GNPA 2C4NA 3HGMA 4JYBA 2X86A 9LDBA 1CRWG 1U28C 1YK0A 5EAIA 5C3MA 3FOBA 1ULSA 4PYLA 4IDGA 2ZITA 1ZUNA 3O4IA 4WKNA 3WV5A 1MQAA 3F3KA 2FPWA 4PCUA 5E6RA 4R54A 4A0RA 3U44A 1J56A 1ISPA 4W4TA 1YHYA 4TMZA 1EK5A 1KXJA 1G4HA 3VNBA 4D9MA 4FZVA 3ZWMA 3HC7A 3EGOA 1RRMA 1FQOA 2KM1A 2R1VB 2D2XA 4GR4A 2ZSKA 2DPYA 4JLOA 4YRCA 5E7QA 3CNEA 4BO2A 3T5AA 1TVKB 2A9PA 3X2EA 4HD8A 4L50A 1NXQA 1YZTA 3DKIA 3Q0EA 1EJ6A 1IHMA 3D64A 4R05A 3DG9A 2ATEA 4QHYA 3Q4GA 2G8NA 4Q9JA 3KQPA 1W0JA 1XA4A 1FSZA 1I10A 4GOMD 3PBKA 4OEHA 5F3RA 3RS8A 3S8MA 3NTUA 1OVMA 4D0GA 2FRXA 4PAGA 4DJDC 3FBTA 3I6QA 3JYPA 3N2LA 2E6KA 5FULA 3W6NA 5BUSA 3ROPA 3SXJA 1RXCA 4H1VA 3E53A 1PLJA 4FQ7A 4V2UA 5F12A 2HHHB 1M67A 1IOWA 2TMKA 3L7DA 2CLMB 4D02A 3CCVB 2GZ3A 2Y6UA 1AKQA 3R40A 1HO3A 2O8EB 5KWVA 4RMGA 4F4UA 3H99A 2HNKA 4Y6PA 4IOLA 3S5JA 1UOEA 4JGIA 1HNWB 1ZVQA 5DI9A 1J2TA 2GM3A 4R2MA 4PPFA 2OXTA 4U2GA 1ZFNA 3R6LA 2J6CA 2V3VA 3P9ZA 3EUEA 4ERNA 4JU9A 4R9VA 5FBLB 1UMDA 3IVRA 4UHCA 4WRRA 2YC4C 4EL5A 4KKTA 4HNRA 2QZ4A 1ZW1A 4DANA 5TPWA 4HLUA 4JSTA 2J7PA 1ZJ5A 1RRFA 2C9BA 1XTUA 2DERA 1JEOA 4PEVA 1ZOOA 5PNTA 1S5PA 1TKRA 2ROQA 3WLHA 4FFDA 3TQFA 4AJ2A 1RRGA 4EMBA 3S3TA 4BJ3A 2ZT8A 3OKAA 2C9OA 3A9UA 3OUTA 4M0DA 4DCMA 1XZLA 2B61A 3CKLA 1JB1A 5E3JA 1J22A 3PFKA 4LWOA 2EWVA 4RPBA 5BN4B 4ZTUB 3V7YA 2E89A 2ADFA 1SVOA 2VPTA 4MR7B 2SCUA 3CSDA 4XYGA 4LOAA 3VV2A 3ZE9A 1NDHA 3M70A 1M2FA 5JZMA 2EZTA 2I7DA 4GLBA 1Y3HA 1UEIA 1ACJA 4NOMA 2ZXHA 4UBMA 1JFFA 1KI1A 3LW7A 4UNSA 2I6FA 4PONA 4BMVA 2B2XA 2HQOA 3B38A 2YXLA 4BNKA 2PD6A 3KHSA 2O7QA 1RBQA 3CIOA 4DQUA 4DDUA 2CRVA 3DEYX 2W6CX 3CLTC 2CHEA 4IF4A 2F1RA 1FEZA 4JLPA 4N8DA 3SMQA 2HDNB 1XD8A 3A9WA 4CZ2A 4L9RA 4ZCTA 1F8UA 3GNLA 3URMA 1BMQA 5YASA 4QGGA 1YXMA 3FPFA 2YJNA 2X1HA 2X42A 2YZNA 2GN4A 4WESA 2Z43A 5DTIA 3W7VA 4REMA 4RDKA 1TQDA 4MAAA 3QPBA 2OCGA 1C8LA 3K15A 5L7YA 4HK4A 4U8GA 1C5KA 2ZAOA 4IJUA 4LKOA 3NTRA 4LVNA 2WWTA 2DBZA 4KB5A 3WGVA 1JHYA 4HAZA 4RFVA 4X1YA 3TECE 2C7BA 3FNHA 1FNDA 2HWKA 2WWXA 3BAFA 3HXLA 3LE8A 4C7JA 5BT8A 1DIGA 1EG2A 3MWDB 1V8ZA 3SJPA 1IPEA 1LDGA 4PZ0A 1VBFA 1U4NA 3B5JA 3ZD8A 2ZUBA 4CL0A 4UTVA 5CVEA 5JPDA 2ACKA 4U7JA 5I47A 5JHHB 1QZUA 3TWOA 3KPWA 1CPYA 4WFQA 1RI4A 2FQ1A 3VQTA 4IH1A 1GFIA 3GIDA 1S7CA 2R11A 4MR9B 4PR0A 2NP7A 2J0EA 5JQGA 2V74B 3E05A 5JJLA 2Z9CA 1DXYA 4GLOA 3I5AA 3LPDA 5D8DA 2FQWA 1YR9A 2UKDA 3L02A 1JG3A 3E0XA 4RAQA 5FOSA 4IMIB 1R6AA 4Q7EA 4JUAA 5B6PA 3QEAZ 5FYQA 4DDHA 4EOGA 1JG7A 1M2HA 4K6OA 3QFFA 5KHAA 5CK5A 3TF5A 3BHIA 3WWZA 2GF9A 4CIXA 1QOPB 2H2FA 5KC9A 3EZNA 2YWBA 1OB5A 3WGUA 1X1BA 3Q72A 2WABA 4IKEA 4DZRA 2IW3A 2OAP1 3HKEA 2OGZA 1W59A 3ESBA 3AIKA 1FU4A 2C07A 2VHXA 4WADA 4WNAB 2GBGA 2J9RA 3L8HA 4GBJA 5JH7A 2GXSA 5C8YB 3NWPA 1M2VA 3OI7A 5B1HA 5BV8A 1Y1TA 2F3UA 4MMXB 2P6OA 5A9TA 1X7XA 2H1OA 1IOVA 4ND2A 3L41A 1XMIA 2JK1A 1WMEA 3FCXA 5DNDA 2YFQA 5AH0A 3TBHA 5F7XA 2A78A 1EFUA 1NN5A 5AUQA 3TQIA 4N76A 1UD8A 1GJRA 3GY0A 4WK4B 2GO7A 4EBFA 4EZEA 3IIEA 4EAQA 4QZVA 5KQPA 1ENYA 5AXDA 4MKZA 3RIHA 4YRNA 3O8CA 1TRKA 2F90A 1KQNA 3U60B 2J0VA 2PBRA 4ZI2A 3HV0A 2C9YA 1K97A 4U9UA 1XDSA 4IIJA 4EH1A 2WD7A 1T6XA 1JHVA 3WMFA 2AJTA 3OOSA 4FMDB 4TKLA 2X4GA 2Q3CA 3OEWA 4J0KA 4PO1A 2J67A 5CJPA 2PA0A 2PD4A 4MVJD 1GZ7A 3CESA 1CFJA 2Q8PA 1WKCA 3BQ9A 1L7OA 1HT0A 4QXOA 4TMYA 4HJXA 1AKNA 3IFSA 4TT3D 4Z9BA 1XEXB 3QE3A 1VE5A 1E94E 1JTVA 3GPCA 1RXVA 4X41A 4MPRA 5I5EA 3KXDA 2P3OA 2AQHA 4D9CA 3QEBZ 5AKIA 3A2LA 1QTNA 3JQPA 1FZTA 3S2GA 1QVVA 3RSZA 3EZFA 3WLJA 2FMIA 2N42A 4J0CA 4IFBA 3VGJA 1VQOB 2HSGA 1KBOA 1U98A 2HBRA 1U7WA 3ZD6A 1XAIA 3K0AA 4M9CA 3F73A 1LPAB 3U5TA 3I01A 3Q3EA 3NXKA 3WBFA 1NUHA 4MYTA 2VCYA 2ZRJA 3BJZA 3E18A 4M7RA 2OFPA 5ILGA 3NCTA 2FW0A 4IMPA 5FAXA 1CJVC 3C43A 3JQGB 3VH4A 1A76A 3UYLA 2IKQA 1IY0A 2BJHA 3WGHA 4B4VA 4E33A 3A04A 2UYQA 4B3TB 1K7SN 2BZ1A 2GYWA 3DMDA 3N0VA 1L5FA 3NU1A 2UV8A 3PHLA 1JSLA 2ZVJA 4JYPA 4YJ2F 4BVHA 4F6RB 3N6XA 3L1HA 2Z1MA 4RTPA 3COSA 2IA5A 1QV7A 1W46A 1QHFA 2VTKA 3KL9A 3TE6A 4BN0A 1FUYB 3KVVA 3G5LA 1Y8RA 3CJTA 1I5RA 4U7PB 1GUYA 4JU8A 4M38A 4ESOA 1Q50A 1H2YA 2QVYX 1WZIA 2OO7A 4WKBA 5JXWA 2DG2A 2XT0A 1O94A 4LRXA 2IPAB 2OMKA 5EGNA 2OCPA 3SY8A 1JT9A 4P0PB 1L7AA 2KLHA 1SC4A 4NTZA 3T1NA 1C3OB 2CXUA 4ZCSA 3PPXA 4LA4A 1U8FO 3OY7A 2X9QA 2IV7A 1UMBB 4Y8VA 4UATA 2Y68A 4IMJB 4QUDA 3TOXA 1K86A 1FRQA 2DQ4A 1QS0A 2JBWA 4HFMA 4BRWA 721PA 3NBAA 3A8JA 3M4XA 4WI1A 3UO8B 4YV7A 3ZI7A 3OEYA 4GIBA 4QASA 3NE5B 1T8SA 1Z0ZA 1ZUHA 1FRNA 3OOCA 3MILA 4NAUA 4R2XA 4GKJB 3NM6B 4M7OA 4QYTA 2QTMA 3CPXA 1RS0A 2QRVA 3TRJA 2G88A 4D3DA 2ZM6B 4AKHA 4N40A 3S99A 1AKTA 1Z73A 1HL7A 3A1UA 4B3FX 2C00A 1D4FA 1SVWA 1WMFA 1N6PA 2Q3EA 3KZCA 4EUSA 1NBMD 1MIOB 4JT8A 2R60A 3VKWA 1KAEA 2BC9A 2PRIA 4EK9A 3P4YA 1EUZA 1SVLA 1HLPA 1M6NA 1XV5A 4CLOB 4YCLA 3ZXXA 1WBBA 2XD4A 1VRCA 3LUFA 1C1DA 4F6LA 3G2PA 2EQAA 1T0UA 1QYXA 4ABTA 5FWYA 4H4EA 4D4KA 3EPKA 1OXBB 2BEVB 2HHAA 5A7GA 3D4LA 3OPXA 2G7MC 5JJIA 3MCAA 2PLAA 1HQKA 4YRTA 3I55B 1ZW6A 3QUQA 2VRCA 4ZDKA 1J00A 2HRCA 3ZVLA 4FS8A 1U0FA 3VR3D 3CZQA 13PKA 1CTQA 3D4IA 1SUWA 3ZXSA 4AJ4A 2DRIA 5A7FA 1XTIA 1LBQA 1P2TA 2IYSA 3AJDA 2PWZA 1DJPA 3BWEA 4JB8A 3F71A 3J81k 4LYGA 1FB5A 1CY7A 5F23A 3PL1A 2ONZA 4JLNA 3TZLA 4K6FA 2JJ2A 4R9NA 2I2XB 3ETLA 4GXQA 3CR3C 3KJQA 3P7MA 4FR2A 5B55A 5IZCA 3DAFA 4ND4A 3DV9A 3TKLA 3SHVA 3I0NA 1GFWA 5IYNA 1VIYA 1XJWA 1N8RD 2O48X 2OSVA 3KPVA 3GG2A 3C41J 4IKPA 4BMDA 5IYWA 1W52X 4EKEA 5I3CA 3MSCA 3GT4A 5FP0A 4IICA 4ZXPA 1DPFA 1VBKA 4ZIRB 4BNHA 1NMEA 4C3ZA 1O08A 5IYRA 4QQFA 4DN6A 2XNJA 1P72A 4KDFA 2X2EA 1W94A 4M37A 2M98A 1XNRB 3MSXA 1E2EA 3PNYA 2F4NA 3CFYA 3JRWA 4Q34A 4PYRA 4GMHA 1AXEA 4QFCA 5JANA 3IQZA 1NMSA 1PJCA 2JJYA 4Q4LA 5E1BA 3ZWPA 4G0UA 1WXHA 2ZYAA 2C5SA 5IYPA 2OCDA 2YJ4A 3HBMA 3Q7RA 3MK31 2OFFA 3V8BA 4B84A 4DBZA 4DBLE 5FUVA 3ZYZA 2W2KA 2O8EA 4Z49A 4IV5A 3DTVB 2GCOB 5EGSA 1EZ1A 2ZUUA 1UBSB 4MJ3A 5K2MA 4E1VA 2CDCA 5KNBA 1KRHA 2ZPAA 3BHJA 4HDNA 4IS3A 4JBHA 4N47A 3KQNA 1QU3A 3WA7A 2QEQA 3N2EA 3P19A 3KQQA 1TC1A 3RHZA 4C20A 4NE2A 2HFKA 4B9EA 4PZDA 1F06A 2AOUA 3UUEA 3K31A 4I5GA 2QGGA 5KKAA 3BMXA 1XLTC 2Y1KA 4Z4YA 2QX9A 2DKFA 5CHYA 4DIBA 5ITZB 1CRLA 3K73O 1AUPA 4JR1A 2ATCA 4ZU6X 2XOKD 3IIMA 2X19A 1SKAA 4I2VA 3ZY6A 3NBUA 4PQGA 3LYAA 3JQAA 4EG3A 1U1GA 4GMKA 4FGWA 2XMZA 2VF5X 1V3UA 1WTHD 1KO7A 2C88A 4RD6A 4EHFA 1N5DA 1OLUA 3JQQA 2PY6A 4NBTA 3H6HA 2FK7A 4MVWA 3VPDA 2C7GA 4K1XA 4NS1A 2PGOA 2FX3A 5T4BA 3ZZNA 4EY4A 1S89A 1XTQA 4Z7OB 3CMAB 3ADDA 3MAAC 4BATA 2Y66A 1JDBC 4Q24A 4IHQA 4POOA 3VBEA 2W00A 3KR0A 4BLOA 2IHZA 3UM9A 1SHKA 1C0KA 5DN6A 1BXZA 5FPTA 1NJFA 1PR2A 2JI9A 1W4BA 2PKQP 2VWQA 2IXAA 2X6TA 5U9CA 2RGDA 3TQQA 1ORIA 4A3SA 4QVAA 2POQX 3TDMA 1WB5A 1SEPA 1FRVA 1CUJA 1YZQA 1H6BA 3BM5A 3ST7A 4DHEA 4GS5A 4R84A 4MMYB 1YRYE 2PUCA 4EMTA 2X4DA 4DV7B 1V48A 1B8NA 1R6TA 2WHPB 4JT4A 1I14A 1P1KA 1LRJA 4JDPA 4Y9DA 5D5HA 1AQ6A 1IBCA 3U1BA 4DG9A 4JUIA 4CKWA 1YR3A 3G68A 3LKDA 3OCVA 4IDOA 5CPFA 3SF8B 5HZMA 4CNQA 1Z6TA 2R1TA 4WK2B 4LNUA 4JELA 4NG5A 1UXIA 4ZQFA 3BGOS 5FQNA 3V4SA 1KTIA 2IH2A 5J5VA 2J1LA 4H0CA 2I2AA 4B4DA 1AK1A 5M7EA 1O87A 2Z5VA 2IYQA 3ZJUA 4XB6B 1ZIDA 1RCFA 4P4NA 4BXOB 1L1QA 3NHJA 2FPOA 2C3OA 2D5LA 5EINA 3VO1A 2IS6A 3T0FA 3UWPA 1N36B 2ZRLA 3GJSA 2X22A 4HN2A 5DIFA 3HJFA 3IOBA 4BAZA 1A2QA 1P1FA 1UP6A 3M6XA 4G67A 3ZHXA 4C5BA 3FOZA 3GCDA 1HTBA 1LC3A 3AWIA 3B3FA 2QENA 3CU5A 1E9RA 4G9GA 1BX1A 2B4RO 3ED1A 3ROKA 2ZBRA 1P45A 5L40A 4TXNA 5AK6A 2FH5B 1UP4A 2Q0XA 5TRDA 4B4WA 4XX0A 1UANA 1H1DA 2XMPA 3AL2A 4MK4A 2WZQA 4PPGA 2RAVA 3B1FA 2H2IA 4N39A 5ITSA 1XGKA 1M73E 1JBKA 3WAGA 4F9EA 3PSHA 2YZKA 4LYAA 1RMQA 3P5BA 4BASA 1WW8A 2XYPA 1SBYA 1K7XB 1TLFA 2AW3A 5EQTA 5AIBA 4OK3A 2B7CA 1VPWA 3G6WA 4F97A 2XCUA 1CR2A 4Q0MA 1IHUA 1I9GA 1U2ZA 4MRPA 4RPCA 2P69A 1YVDA 5EWJB 1ML4A 5DGCA 3AV3A 5AW6A 1JU3A 1EVLA 2Z30A 2WV7A 1JWAB 1OX4B 4TOIA 1DFIA 4UHFA 5FPSA 1M0TA 3QIAA 4C4YA 4CR7A 1JVSA 5HZAA 5CTAA 4C4XA 4NU8X 1XPRA 1Y1LA 1EI9A 2QG6A 2VBSA 1BXRB 2D3WA 2GCPA 4MP3A 1IOLA 4YAEA 3INGA 2ERCA 3RC1A 3DBHA 2Z3ZA 3KQWA 3VSDA 4F4IA 3DDYA 1L4BA 1JEAA 1EX6A 2J3MA 4H7PA 4D4MA 4BLQA 3JQ7A 5IS2A 1VP3A 5EWLB 4D9IA 5HKBA 5K3EA 2OVBA 2OECA 1WUHS 3WYCA 4YCAA 1VECA 2W6NA 1OH5A 4UVDA 4BVBA 4YAOA 4F56A 2FZ4A 2JNWA 1V8DA 4MRMB 1LJUA 1O3YA 1DJOA 1DELA 3BJRA 1GQQA 5B1EA 1G8GA 5BMOA 1XZDA 1Z37A 4M1QA 5EMMA 1OKKD 1OBCA 4BX9A 4F5ZA 3PPVA 1PHPA 3DE0X 4C0AC 2IUTA 1DCKA 3Q7PA 1VCMA 1N5MA 2O0HA 3KSMA 2Q07A 4NAHA 3ZU4A 4G63A 2H6EA 2WIAA 1KWKA 3RADC 1KH3A 1O1YA 1GPKA 2ONKA 3IOMA 3ZJ4A 2C1ZA 3DE2X 4E3WA 1OTYA 4OHFA 1PZFA 2FZEA 2XVXA 4NZYA 1Z6QA 2XMBA 4ER5A 2XB8A 1WOPA 2I4OA 1VJDA 1ADJA 4L76A 1TM5E 2PZFA 1UBNA 4MW0A 4M1MA 5EXTA 1UD3A 4ARZB 1NJGA 1TC2A 4G37A 5A5DA 2IH4A 4LJ8A 4TWRA 4OM8A 2X58A 3QNWA 1QP7A 4HWGA 4F85A 1RYNA 4QECA 1N32B 4KR6A 1AHIA 4IGFA 5NLLA 1RQXA 2GFIA 2W2MA 2DSTA 3NHLA 3OWXA 4J0HA 2H1SA 3ORFA 3GC6A 3O8NA 1WULS 2G5GX 2ZPTX 1I8TA 2C8LA 4LHXA 4BZQA 4DLKA 1TL7C 2XTJA 2PZBA 4NBWA 1G5FA 1XAGA 4EHIA 3TOZA 3WIOA 5EIAA 4QQKA 2C9CA 1BJRE