1S4MA

Crystal structure of flavin binding to fad synthetase from thermotoga maritina
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
277
Chain Sequence
MVVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVHKFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRPTDARNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKFDSIEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of flavin binding to FAD synthetase of Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 82
structure length 277
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1s4mA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1s4mA01
3N8HA 2DUMA 5TGTA 4ZT6A 3P52A 1H3FA 1K4MA 1BS2A 1IFXA 1Q9SA 2CUZA 3MLBA 5DEOA 3SDBA 5FO1A 1N2HA 4PBTA 1NSYA 2ZUEA 1M8PA 2WQ6A 1QNFA 2ZP1A 1B6TA 1GPMA 3A05A 2ZUFA 2AG6A 3KT3A 4NZPA 1NZJA 1N2IA 1NP7A 1UFVA 1JZSA 2A1TR 1P7PA 1ULHA 4I6JA 4J75A 1OWLA 3CLUD 3G59A 4RPIA 2JAXA 3COVA 1OWMA 5JBNA 4EF6A 4NAHA 4CDMA 1YULA 4KR7A 4I6EA 4ARCA 3L93A 3KT0A 2A4MA 5TEVA 1OBCA 4DE5A 2Z09A 4MUGA 3RJZA 1JEDA 4EGAA 1QRTA 2DERA 4YP6A 1KQNA 1V8FA 2DXIA 4G5FA 4K03A 4NDAA 2RE8A 3F3MA 4MWBA 4DDHA 1WY5A 3VGJA 1N05A 1K4KA 3U1VA 3PRHA 2YXNA 2EJCA 5J58A 1F9AA 1QRSA 2D54A 1NUQA 4MUJA 3DO8A 1MAWA 2QUHA 1N2JA 4F4HA 5KHAA 1KP2A 4PY2A 3CLRC 1QU2A 2P3MA 1KAMA 1JZQA 1PFVA 1YI8A 3PXUA 1MC1A 3UC5A 3UMVA 4CDNA 5LFAA 5A89A 5HUHA 1O6BA 2CFOA 3TS1A 1N2GA 2GM3A 2GKSA 3N2YA 3PNYA 1O97D 4ZT7A 4AQ7A 2R5WA 1JEEA 4ND7A 3IVXA 2A7XA 2CYCA 2OYNA 1T9GS 2DETA 1H3NA 4QBTA 4NAUA 2X1LA 2QJOA 3ZXSA 2HMAA 3LCJA 4HJXA 1NUPA 4MQ6A 1EJ2A 4MUFA 4U8HA 3K32A 1PFYA 3DV2A 1EXDA 4XSVA 4EG5A 1RQGA 5F23A 4MWEA 2PXHA 2CV2A 2VBSA 2QJFA 3INNA 2Z08A 1JGTA 1JIKA 3IOCA 3CVYA 5H7XA 2AKEA 1T6YA 1VL2A 1G8HA 3COYA 5TEWA 4MW9A 2J08A 3A04A 1PFWA 1GTRA 2O8VA 1TYCA 1S4MA 3FDXA 1EFVB 1G59A 3TQIA 3BL5A 2JA2A 3Q10A 3ZGZA 1ZJWA 3UK2A 2VXOA 1H1TA 1IRXA 4E1AA 1M8FA 4WNYA 1TFUA 2E89A 2TS1A 4PBSA 3X1MA 3BNWA 4MUHA 5LM3A 1TEZA 4MW1A 4XFDA 1KP3A 1MJHA 3CLUC 1FYDA 3PNVA 4UZFA 5FO0A 4Q93A 5A8AA 1Q11A 3A4IA 1VBKA 2YY5A 1M8GA 2QJTA 3IUEA 1MB2A 1O94D 1OWNA 1M8KA 1TYBE 3NV7A 4QRDA 4EFKA 1N07A 2I1LA 3CR8A 4ZT3A 3CVXA 1IQUA 5KWVA 5A88A 1JMVA 1M83A 1N2EA 1VBNA 4EG4A 4AS1A 1EE1A 2YWBA 3RFFA 1QJCA 3FI0A 3M5WA 1N08A 1WKBA 2E21A 3H05A 2PZ8A 5DK4A 3OP1A 2VBTA 4ZCQA 1GAXA 2BTEA 1HYBA 2YWCA 3IUBA 1T6XA 3VU8A 2IELA 3RK0A 3N9IA 1D2RA 3HV0A 1WOYA 1KAQA 3SEZA 4G5YA 4PBRA 1KH1A 1WXIA 2O5RA 4MW4A 4HPWA 2PIDA 2J09A 2E0IA 3MXTA 3HMQA 1N1DA 3TZLA 3FG9A 2A84A 2PG3A 1YUNA 1I6LA 2IJGX 3GMIA 3D6VA 3ZIUA 2A88A 1N78A 1O97C 2PZAA 4MW7A 1TYDE 1J20A 2CT8A 3FWKA 2CSXA 1R6TA 2DPLA 3IOBA 3ZJTA 1EFPB 4ZT5A 3KFLA 4MW5A 2H2AA 1K97A 4DJAA 2OQ2A 4L2IB 4P2BA 4MUKA 1NUSA 2BYTA 3GLVA 4L2IA 1LW7A 1NI5A 3H99A 4MUNA 1IH8A 4OUDB 5DB4A 3ND7A 1F4LA 1KH2A 4R2MA 3CLSD 2D13A 1OBHA 4A91A 4JZYA 4EG6A 1IHOA 1WXHA 4EG8A 1R6XA 3QTBA 2XRZA 4MUEA 4ZT2A 3C8ZA 1O95D 2EL7A 4MUIA 2V0CA 3TNJA 1NB9A 2QTRA 5J59A 1QQTA 3S3TA 4MVCA 3UOWA 2E18A 4U63A 3QTTA 4GU5A 1YIAA 1J09A 1JILA 3NBAA 1JIIA 1M1ZA 4KKVA 1WQ4A 3IVCA 4KPUB 3IOEA 1LI7A 5HUJA 2CYAA 4KPUA 3CLTD 3CA8A 3JXEA 3ZXIA 1OWOA 3RK1A 2A1TS 1WXFA 1WJGA 3KT8A 3MLAA 1EUQA 1M8JA 1H3EA 1P4MA 3X1KA 3ISJA 4YP5A 3DLAA 4JXXA 2JANA 3COWA 4KR6A 2QTMA 3ZJUA 3ZJVA 3COZA 3QE4A 3CTAA 1QRUA 1EFVA 1Q19A 2QTNA 1U0BB 1O94C 2G36A 4RUKA 4YBRA 1U3CA 2QUIA 3IMEA 2X0KA 3ILVA 1K92A 3CVWA 5FNZA 3FNRA 4U7JA 3AFHA 4I6GA 4ZCRA 1J1UA 3FETA 3P0JA 1MRZA 4EG7A 1KH3A 3Q12A 4MVWA 4MVYA 1N2OA 1X6VA 1ZUNA 2VTBB 1WZ2A 2DEUA 1CT9A 4TS1A 2VTBA 1YIDA 5BNZA 3AKZA 3AG5A 3P0IA 3FOCA 1XJQA 3RBAA 3DPIA 1KKUA 1ILEA 3ZUGA 1I2DA 1JIJA 1NURA 1X8XA 3MUEA 4R0NA 4MLPA 2J07A 1V47A 3E27A 4ZCPA 4KR9A 3K9WA 5AHWA 2HGZA 4UZEA 3Q4GA 2V0GA 3L92A 1T9GR 1VLHA 4ARIA 3CVUA 2PZBA 3AIIA 2A86A 2WQ7A 4Q16A 3D6UA 4NATA 2XRYA 1XNGA 1ZH0A 3RHSA 2OV4A 2VBUA 1KORA 1OD6A 4R2LA 4G6ZA 1J70A 2DR2A 3FY4A 5IHXA 1N77A 3SP1A 1FFYA 1N2BA 3IDFA 4CT0A 2CV0A 3OTWA 4FZJA 3PNBA 1OWPA 2GOYA 1U7XA 1COZA 4NX2A 3CLSC 1JHDA 1WQ3A 2VBVA 1GN8A 1GZUA 5TRDA 4JYZA 1TQ8A 1GLNA 1O95C 3ND5A 1VBMA 3G5AA 3CVVA 3LOQA 2HZ7A 5LLTA 1MOPA 3FH0A 3H9BA 1EFPA 3H97A 1MAUA 5K0SA 1G8FA 1KQOA 4JFAA 3SZ3A 3VRHA 2RD2A 2CV1A 1Q77A 1SURA 5TS2A 1QTQA 3SZGA 1Y42X 1G8GA 4J76A 4OUDA 3TZEA 3TQOA 4JXZA 3I05A 1O5TA 1PG0A 1IQRA 1XNJA 3GUZA 3CLTC 5H16A 3HFJA 3IMGA 4MVXA 1TYAE 5DASA 1N06A 2Z3VA 2WSIA 4QREA 1O0CA 3AG6A 1ZH6A 1I6MA 2J5BA 3HL4A 2QUJA 4ZCSA 2QUKA 1NUTA 2B7LA 4CQNA 1JECA 4F3RA 3X1JA 2PFSA 1O96B 3SEQA 1U7DA 2J4DA 4XFJA 1O96A 4HK4A 4MAFA 1U3DA 2X1MA 4MW2A 1QU3A 3A2KA 4DNXA 2D5BA 1J21A 1NYLA 3IVGA 3G6KA 1EUYA 4DDKA 1T6ZA 4EG1A 2AZXA 1GTSA 3LE8A 1NB0A 3KT6A 3UY4A 1R6UA 4MW0A 1O0BA 1IVSA 4X0EA 3HGMA 3N05A 1F7UA 1N75A 2DLCX 3SYTA 2NSYA 1DNPA 2WB2A 2NZ2A 4WSOA 3CLRD 1WXGA 4EG3A 3IMCA 3FIUA 3H9CA 1XNHA 3IH5A 4H3SA 4ND6A 1PFUA 5EKDA 5KCMA 1N3LA 1LI5A 4MWDA 4BWVA 5IJXA 2X3FA 2IP1A 1F7VA 4K0RA 3AL0C 4MWCA 1MB9A 4MW6A 2CYBA 1MBZA 4S1OA 1WXEA 3HZRA 3ND6A 4ZT4A 2A1UB 3P0HA 1Q15A 4DDMA 1IQ0A 2H29A 4YMIA 2A1UA 1PG2A 4YP7A 1KQPA 5K0TA 4ZCTA 4DLPA 1I6KA 3NBKA 1NUUA 4GRIA 2C5SA 1YUMA 5HG0A 3ELBA 3MMXA 1A8HA 3IODA 4MULA 1J1ZA 4HJRA 1KR2A 5J5AA 3FHJA 4OJMX
chains in the Genus database with same CATH superfamily
1KC3A 4ZRNA 2WIDA 4GSKA 1WE2A 1Y4SA 1ESNA 4D9KA 4WGGA 4AJOA 1ID8A 1LLDA 4CM1A 2GFQA 1PL8A 4RTPA 2B2XA 4P4SA 1IFXA 3PFWO 1ZN2A 5EQTA 3MT8A 3M4YA 3T8YA 3F98A 3NJ4A 2EFCB 2Q4EA 5HKOA 1WPRA 1YR9A 2EXXA 3JYQA 1M8PA 4DT1A 1FU7A 2FEWB 1HL3A 2HEGA 3DMHA 3K5WA 4XCVA 3SYKA 2XE4A 1J7JA 1VXOA 2YHAA 3A05A 4KYIB 1WX1A 1YB4A 2X9NA 1MO2A 4IH9A 4O2BF 1N2IA 4EYGA 5CDYA 5I8WA 1ZOOA 2EDAA 5KBYA 1UFVA 2AMLA 1EXMA 4P36A 1TK2A 4F3TA 3UMFA 4L8YA 4ENSA 2PGNA 3AR7A 4L72A 4MTCA 1L4HA 5CH8A 4DKXA 3RADC 3DMNA 4LZNA 4EBFA 1XMOB 2OBTA 3CP2A 4YLYA 2IHYA 3B60A 1FTQA 3CF4A 4GKBA 1LH0A 5IYWA 4PAOA 4JVOA 2OBSA 3B6KA 3FWHA 5FR2A 3RTBA 5IXYA 1A9XA 1ISIA 2JJQA 2ZIVB 2EFYA 2RHCA 3HCFA 4A15A 2ZAYA 3C6KA 2Z09A 1R5JA 2GK6A 1JEDA 3NFYA 4MUGA 4ZQCB 3ZTTA 5JW6A 1YDFA 3EZFA 1LDMA 2W8BA 3FYSA 1HZZA 1MA3A 3G6WA 3Q9NA 1JQLB 4KXLA 2PH3A 1D1TA 2ZB8A 3INYA 4GI1A 4W5HA 1EDBA 2P0EA 1U8TA 3THOA 5EJ6A 1IOLA 4FEGA 4IDCA 3B78A 3CX4A 2JIPA 1OI7A 3SQWA 3NRBA 4A8PA 4JUAA 1M6HA 2BDUA 4IGFA 3SSAA 4DA9A 3I32A 2R8YA 5IYRA 3PHCA 1CUSA 1HETA 3NVAA 3V80A 4CDRA 4BKRA 3L6EA 1OFIA 4A6DA 1CJVC 2FRDA 3AI1A 2OXIA 4JOCA 2G67A 3WYAA 2ESRA 1V6CA 2QV0A 3OZTA 4GICA 1EFCA 1V8ZA 1PYGA 1VLZA 2A9FA 2FEAA 2HJSA 2Q0SA 4QPZA 2BT4A 3UK1A 1TECE 4ZV7A 3B9BA 3OECA 4GXRA 4X54A 1LQUA 4JL5A 1A9RA 2J31A 1JQEA 4N0EA 4PG7A 4F4HA 5E38A 2Q99A 3MRVA 5CLHA 4B17A 2X8KA 1OH5A 3TZHA 4B4UA 1CUCA 1GTJ1 1YQTA 4JN6B 1Z4QA 2LW7A 2C78A 2Z6QA 1S3IA 1SVOA 3TS1A 4AJPA 4FWTA 1J0DA 2GKSA 2B1QA 1MDFA 2LIVA 4AQ7A 2QN6A 1MEEA 2WHXA 2R7LA 4YQYA 2CC2A 1JZTA 4C30A 1AQ6A 1HYEA 3KZ1E 2QZ4A 3S2FA 1W87A 4BO2A 2UZ3A 3X44A 2J9GA 4MCAA 3VH2A 5AW8A 4Y6GB 3PCXA 4K3UA 3KYDA 3H8VA 1GIAA 1BDHA 3GJTA 2AQHA 4B7AA 3PXAA 2ZBEA 3T41A 4I1VA 5JZSA 3H19A 2VQ3A 2ASVA 1AO3A 3PG5A 2ZANA 5FPQA 1W59A 4XJVA 4LE0A 1DJOA 2R86A 4A0RA 2XDYA 4X84A 1RZUA 5IT5A 1NSFA 1T1JA 5IRCD 3AL3A 1RYYA 2HA7A 4P1VA 3L02A 4RHCA 4DMHA 1JR3A 1S0UA 3CJQA 5CCXA 3TX2A 2NYAA 4HAYA 4EVSA 1IEWA 2R65A 4AZVA 3EPLA 3GUCA 3P2IA 3PB3A 3HG7A 2WZDA 1Y48E 1TQDA 2WWTA 3QMVA 5CVEA 1PLLA 2HU8A 2JCYA 4JVMA 5BR7A 1I4DD 3K16A 4QG7A 5BUZA 3HXMA 4IJVA 2P2DA 1Z83A 3QU5A 4HWKA 4OHPA 5DHPA 2OTJB 1TCVA 2G77B 1R4MA 1K9VF 3R5HA 3JVEA 4H1UA 4JC5A 3LFTA 2QW1A 5HDQA 1QJ4A 5K8UA 1ECFA 4ZYUA 2XEDA 4G63A 3R5JA 3UPDA 3ASPA 1VQ5B 1N6OA 2VZ8A 3GQBB 3LX4A 3X1MA 2ZIZA 5JEEA 4M99A 1H0HA 2HXYA 1L7RA 4U7HA 1P72A 3O3OB 3TINA 3UJCA 4TMFA 1R9MA 1TO2E 4RBNA 4Y30A 1E6MA 3U39A 5B1EA 3WGHA 4OBBA 3DM5A 1WCIB 1JDJA 5KVVA 5J5CA 3PKJA 3EA4A 4CEHA 4LK3A 4O4IF 4V1CI 4F5YA 4WZKA 3VJMA 3FN4A 2OK7A 1RADA 1VF7A 2O3RA 3IUEA 3GLFB 3QOWA 4Q66C 4Y9RA 4KQ1A 4YB8A 4DZRA 1EFHA 1N0WA 1L7VC 2XA1A 3KYBA 3P0RA 2I1LA 2OECA 2YS7A 3CR8A 4M88A 4UHCA 3VZPA 4OD0A 4KQCA 2IPNA 5B1SA 3KHUA 2MSEB 3ZU2A 1M83A 3QFRA 2IUSA 1HV8A 4XPIB 4EG4A 4Z4IA 4P4UA 1FFDA 4OTZA 3DM9B 4GWLA 4N8SA 1QDUA 2NQ2C 4FINA 5TXGA 3ZHOA 3VVBA 3K2BA 5CLFA 4UAUA 5FXMA 3RYCA 3H2SA 5E2IA 3TDMA 2PT6A 4U7WA 1PK7A 1M5TA 2GK3A 5ICMA 4G65A 3VYTB 3HHEA 4WZLA 3K71B 1T6XA 3FPPA 1RQ7A 2GAFA 4WW0A 2Z6AA 3A7DA 3GHYA 3ILSA 3HVIA 2X6YA 2H4WA 1TTHA 4GBGA 5JQWA 5IM4A 2YKGA 2OB2A 2MU1A 4JJAA 3TOSA 2ARKA 2QR3A 4DCSA 4RVFA 3AO0B 1H1DA 2ZTNA 3PI7A 1WOYA 4IMIB 1FP4A 4MVJI 4A27A 2WJYA 4US0R 4W5JA 3BFKA 3OJLA 1V95A 3VU1A 2JPDA 4JYMA 5JPDA 1G8KA 2GEJA 3OKCA 2OCAA 2O8CB 3WZ2A 1ZCZA 5AK4A 1IUOA 1UBSB 2C57A 3BAFA 3R09A 4M9UA 4RLFA 1NULA 4EKIA 2I2FA 1KBOA 3NHJA 1OYYA 1OXXK 4LDJA 3ONNA 1VJSA 4BP3A 3OFVA 4IUBS 1RHJA 4LXTA 4D0LB 2O54A 4YCBA 3STVA 4OOVA 5G0VA 1GUZA 1Q21A 1TT5B 3I55B 3KDAA 2C9CA 1M2OA 3D4BA 3L0BA 3VAYA 4XZ3A 3FPJA 4L2IB 1M67A 2ZOSA 3DCNA 3KZOA 3E7WA 2I91A 3ME5A 2HREA 4ZAZA 3ESAA 1OB5A 4NJEB 4GLOA 1T25A 4EUEA 3L7YA 5HOQA 1ZYUA 5DSZA 3L41A 3V3KA 3HDHA 1K6MA 3N07A 3WGYA 1N32B 5EEHA 4HS4A 1WA5A 2VF8A 1I9GA 2IDJA 4CQMA 5C0OE 1FDIA 4EG8A 4OY3A 5GM2A 2IYZA 2GBFA 1GQOA 1RWMA 5TQJA 3C1TA 4B76A 1DMRA 5E4JA 6LDHA 3SZUA 4DIEA 3LVQE 4ZJUA 1HT0A 5BUQA 3GCGA 3WISA 3GAZA 1NB9A 3ONDA 4AY4A 2BGWA 4BQSA 4QDUA 3RSOA 4KNWA 3UOWA 1N9GB 3FOEC 3JPWA 2UYCA 5TC4A 2J46A 4U63A 2BSXA 5JBQA 4TL9A 3JQRA 1TEXA 5AI0A 5AVQA 2WNSA 2DX7A 3NUZA 2NVUB 3T5PA 3PA8A 3D6FA 3DDCA 3NBAA 4M1MA 2NMVA 5AXAA 4QU9A 4U2FA 3A2NA 3LW8A 1IXKA 2HF7A 2CYAA 4HGYA 3SZMA 3R4VA 5I7HA 1ZQ1A 3ZNQA 5JSHA 3HKBB 3R5SA 2XNHA 4RFVA 2P3LA 1KJQA 4P31A 5CLGA 3AL0C 3F4KA 1WF6A 4HNUA 4JVSB 1G21A 3KT8A 2IYOA 4PZDA 3UHOA 3U09A 1X70A 1P4MA 5F76A 1RAHA 2JIBA 1JWLA 3ICVA 1WVMA 3NI2A 4UZUA 3RD5A 3E5RA 3ZVRA 1NXWA 4FDTA 5EQDA 5A6VA 1VSTA 4MPTA 3RU2A 1TKBA 4JDPA 2ZSUA 3K53A 4XKJA 3VR0A 4YR7A 4UNSA 2VKQA 4O25A 4M55A 1CDZA 3QEAZ 3AM1A 2OD9A 5DHSA 1YZNA 1XXLA 5FCDA 5BQPA 3P0JA 1E6WA 4YJFA 3ECAA 2I2AA 4IKPA 3UA4A 4FVTA 2NO7A 3FRHA 4C2TA 2DSTA 2HMSA 4BO9A 4A26A 1XVTA 1CJSA 4DQXA 3FPCA 1XMXA 2QTAA 1AXGA 4BMNA 1EFLA 1WLYA 3EOAI 4TYPA 2PUCA 2J7PD 1NN3A 3HJHA 1YIDA 1XQVA 2CFTA 1KFCB 4WCVA 3CCVB 1D0SA 2HJGA 4II2A 5E4FA 2XF8A 5PNTA 2ZJ8A 5HZMA 4QO8A 4XL9A 4DA7A 3K0BA 4B6JA 1KQSB 3MRSA 2IU0A 2H4FA 3EZYA 5KNLA 3DCIA 2XBUA 3KB8A 2A3NA 5IVPA 1VSVA 4GM1A 4V1CA 1SULA 3KZKA 1ICEA 2CT8A 4R9NA 1Y8RB 2PMFA 3EGDB 3HA5A 1GPUA 3U16A 3ZDBA 3WLSA 5KMGB 2OXEA 3OKPA 4P08A 2IGBA 2NO4A 3JZFA 1XD2B 3AY3A 4ABTA 1V16B 1Z0KA 2ZIXB 4FDAA 5FI3A 3ZX4A 1AUVA 5LXTB 1JG7A 2F2TA 3QLUC 2CHEA 1BYIA 4OXRA 1I8DA 5E6UA 1RRVA 4X20B 3UB2A 4DR5B 3CY6A 3E9ZA 1OFUX 2ZB7A 5EGSA 3N0WA 3P2EA 1E3LA 4M1KA 2JG3A 2ALJA 1II0A 2YNMD 5KYGA 2PKYX 2QZSA 3AP3A 2I4LA 3IGFA 2PGAA 2OENG 5FWDA 3H1GA 2BFDA 1FNBA 1GNTA 4RZHA 3ENZA 4ZHQA 3DDSA 1QYCA 3WDMA 1WTCA 3WLOA 2XMRA 4BOYA 1W19A 4RZXA 4XQ9A 2OLJA 2GJAA 1CFZA 3IJPA 2EEZA 2LUOA 2R8RA 1JSRA 2EU8A 2J9RA 2MMGA 4KMMA 4MVJA 4PSUA 4JI6B 1DAHA 2X6QA 3DVRX 5AW3A 1OWPA 3ZU6A 3WDLA 1NVGA 3WFIA 2OHGA 1W88B 2VJMA 4Q1AA 3RUCA 1VE9A 5E9AA 2X0JA 3EDOA 5AKGA 1Q2UA 4LDRA 1U02A 2O8EA 1WOMA 4WY5A 3IJEB 3TRHA 3VO8A 3M1AA 3AIMA 1OLUB 3IXMA 4Z4VA 5FYQA 1UK7A 2B1RA 4C4YA 3PKZA 1MXFA 4G5OA 1U3UA 4WFKA 4GP9A 4EMTA 1DO8A 1T8YA 4FYKA 3PDUA 4PX3A 3VC2A 3OZVA 3RH0A 1V37A 4LHVA 4ZJYA 2J3IA 2PU5A 5LA6F 1HZJA 1G60A 1MO6A 2N1BA 4ZOLA 4Z4GA 4BN0A 3TEFA 3GAMA 2PK3A 4RZIA 3E2MA 4TV9A 2DT5A 1XDDA 4C0SA 2NPOA 5M3BA 5LYJF 2RD2A 2PUHA 4DB4A 1E66A 1ECLA 5CXSA 4DIOA 5ARBA 5LQKA 1Y42X 1Y1RA 2YOGA 1Z6XA 3LCRA 2XUAA 1L5FA 4V0MA 4EY4A 3I61A 2XTMA 3I05A 5FULA 4CT4B 1ZGGA 1X86B 2FX2A 2ZAMA 2H52A 1HSOA 2QL5A 1SHKA 1ZVKA 3G6EB 3F7MA 2MSLA 4E0BA 3FKSD 1TYAE 2C00A 2QM8A 2V7WA 1U0NA 2V7TA 1MIOB 3AK4A 4OGKA 1YBFA 2HSGA 5JCJD 1HUQA 4PAGA 4C05A 3D31A 4POOA 4F6CA 4G8DA 3TOXA 4JP1A 2BGKA 2QUKA 1YJNB 3S0JA 16PKA 4CQNA 1O4VA 3FKQA 4Y7CA 2BR5A 3WYGA 3X1JA 1IONA 1O0SA 5JARA 4NXMB 1YL7A 4JIGA 3FGPA 4RDLA 1J4AA 1M1YA 1QF9A 1YONA 3L0SA 1GKIA 5EP3A 5EYPA 2X1MA 5JMTA 3I4CA 1GFZA 3NIBA 4L8GA 4R8SA 2X0RA 3T1HB 2VBGA 1A7UA 5AT1A 2RHBA 2IF0A 5F21A 3N87A 5G53C 5TGDA 1HE5A 1YB2A 1CEEA 2CFSA 3KT6A 4KIGA 2GCOA 1POWA 3AQ4A 1Q81D 4F4IA 5BWOA 3O8CA 2FW0A 3AY6A 5EZYB 1U28A 2Q8PA 2P7HA 2QZ9A 4GPBA 1JSCA 3RR2A 3W6OA 3DLCA 4TLBA 5B1DA 3Q9LA 3BQMB 4MUBA 3RHZA 1LFDB 5H9VA 1CY7A 1G7CA 1NDQA 4RF4A 5H4HA 5TSDA 4EBBA 3GCDA 1PFUA 1YFZA 2HCRA 4BJ3A 4EW1A 2XYPA 5KHLB 1SG0A 3HDYA 4WZEA 1UL1X 1DG9A 1H8ED 1QFXA 2ZULA 3H9EO 3I0MA 2YCBA 3BXOA 4HNAB 3L7KA 4EKEA 1BRMA 3C3AA 3BB1A 3GD7A 2Q6IA 3ESRA 2AW5A 3U9SA 1A0OA 2OSVA 3JATA 4MW6A 4U1RA 4DDTA 1ST3A 1FTYA 3DDUA 4FBGA 5TRTA 5J4HA 2OCXA 2DUWA 3AKYA 2QUZA 4GOKA 2KE5A 4PAQA 3TLJA 2PUFA 1UJMA 1VBFA 3EZLA 1K08A 1OIXA 3WICA 1II9A 1OIWA 4NZZA 4MAAA 3DYIA 4DCGA 1NUUA 3DD1A 3AEYA 4LOIA 3RUPA 2ZI4A 1KSJA 3TD6A 2SKCA 4BTVA 5CBPB 3N86A 3ZCXA 2RK6A 1D4OA 2ZPUA 3PUVA 4ZRDA 4EY3A 3DE7X 4KC0A 1TB4A 1Z5VA 1M7BA 3MERA 3P4XA 3QIAA 4MQBA 3ERCA 2NVWA 4GYYA 4Q15A 3ZGYA 3NO4A 4NESA 1VLQA 2C77A 3PZBA 3CN7A 4Z7JA 1TUIA 1E2UA 1EGHA 3HLYA 1UJ4A 4WWVA 1G2OA 2BSAA 4BQIA 4UFPA 3KKLA 5LWQA 1J0XO 1PZEA 4HEJA 1ZVVA 4DLWA 4QPNA 5LZ7A 5T4HA 4ZAFA 1PWHA 5DYGA 5DEOA 3PT5A 3EXFB 4BFUA 4BVAA 4Q1EA 2DC1A 1XFAA 3DHWC 1PQPA 2B4RO 4JI5B 4BGUA 1A71A 3KR1A 3KJFA 3PNOA 3SFVA 2HYIC 2HRQA 1C29B 2IYUA 2AG6A 1Q1QA 2HFKA 1NZJA 4YNBA 1NP7A 3WGLA 4D8VA 1PJ7A 2QVGA 2Q6TA 3KEFA 4P7JA 5FT9A 4RM0A 3QVSA 1L4MA 1OXSC 3G59A 5TPWB 3MW8A 3PLAE 5C7YA 4QEZA 2B1JA 4EF6A 4EI9A 1LDBA 3ORYA 1P9RA 1TK3A 3TQHA 5JS8A 1IZYA 3EUFA 3HB7A 4U7DA 3OZSA 4AZWA 1DTWB 1J8YF 1Z8HA 5MN5A 3FHCB 1W8DA 4UPDA 3D6NB 3G2JA 3S2EA 2RAVA 4P7FA 4B44A 5JQGB 4AWBA 1K0UA 2IOQA 3G3EA 4TKMA 4AI6A 2XTZA 3I37X 3I1FA 4WINA 2X5XA 2QGGA 1N5MA 2ACKA 1BU8A 3G0IA 1NQTA 4LGCA 3R7SA 3RJZA 4D0GA 2DFLA 3PPWA 4LVOA 2KLHA 3DT6A 3GFQA 2EBFX 4TTRA 4Q7QA 1KQNA 2WDZA 1MOSA 1UPCA 3TZCA 3ZV3A 3CEPB 3CSSA 1WY5A 2P9YA 1E63A 2YHIA 1EFKA 2D0OB 1LV7A 2ZRNA 4WK6A 3U7IA 3VDNB 4FB5A 3ZWQA 5IP5A 1KKLA 4HF7A 3ZVLA 1XX6A 5ADWA 2QTTA 2QAJA 3NTUA 4RV4A 3E15A 2V1XA 4LGMA 2XAUA 2C4HA 4Z51A 2Y1KA 1E1YA 3EZ9A 1FZTA 3A6JA 2O57A 1EAMA 4I5DA 4M8IA 4NH4A 5IULC 1MAWA 3PHIA 3CEAA 1UBGA 1O4WA 2ZYIA 3OHMA 1A4RA 3EOBI 1N2JA 2X8WA 4U7TB 4WLOA 2FPGA 4KRYA 3T06B 1WG8A 1LV8A 2EFJA 1QU2A 3B5JA 5L3QA 2ZU6A 1B8OA 2JFXA 5LFAA 2PLRA 4JLSA 4PAWA 4PX9A 2FPOA 1Y9DA 4B87A 3ABOB 5C8DA 3U4MA 3OTQA 3PEEA 1JSXA 5K6AC 3HWWA 2JHFA 4P4NA 1Z82A 4WL0A 1X7ZA 3QKRB 1F4VA 1DQNA 5I9BA 1XEXB 4FTWA 4XVRA 1EVKA 1L5ZA 3BGDA 3QVWA 4FMBB 1XTIA 3QW2A 3V4OA 4EW3A 3D81A 1ZZGA 4L15A 3NNNA 4W8OA 1QMPA 2IV2X 1DG3A 2ZZFA 3ZXSA 3AUXA 2B7BA 3AINA 2MCFA 2FPWA 2VHTA 3IHTA 3LCJA 4W8GA 3QBDA 1HDGO 1WSDA 3TB6A 3W90A 4PPYA 1M34A 3NAQA 4WZBB 4HDAA 3HV2A 3OMXA 4DPKA 4RGVA 2VP0A 3R6JA 2GJRA 1ORWA 4JX8A 5F23A 5I9LA 4M8SA 2V9ZA 2QRQA 3G4SB 2QRMA 5KQMA 1KFKB 2XUGA 2ZI6A 5CFZA 1V45E 3M6MD 1UFKA 4OLFA 4H7DA 1U99A 3EPRA 1GQYA 4UEKA 2YZGA 3OCUA 3L43A 4WRRA 1EI9A 3PVDA 2BR3A 2RCYA 4HXYA 3VU9A 3FLAA 2ATIA 3COYA 3GZ4A 3FJOA 1VE3A 2PSHA 4MW9A 3COPA 3OU6A 4P86A 4PXYA 3A6DA 1C5KA 3EWIA 2O20A 4P4GA 3ZLTA 3QA3E 3I01M 3TECE 3NOVA 4L5JA 1T5LA 2JA2A 4BFLA 2P3QA 3ZGZA 4M89A 1Y4DE 2H11A 3VUEA 4EO4A 2JIDA 2DFTA 1KAOA 2Q3MA 3AR5A 1R12A 3AM4A 1S9HA 3TUJC 4ES6A 1UKAA 3BK1A 3B9RA 3P71T 4WNYA 4LF5B 3HBMA 1CK4A 1MFZA 4EI7A 4QOIA 4AK9A 4U0JA 1DO2A 3IBSA 2Q8QA 5FWAA 3GF4A 1K5DA 3A4TA 5EIEA 5JWOA 3H6HA 3LC2O 3P0EA 4MW1A 4M53A 1A4UA 1UKVY 1XDGA 2LTAA 4RPGA 3ZWKA 3PFBA 5LKAA 2WPNA 4QVIA 1JEQA 2H8KA 4UZFA 3O38A 1JIXA 3PX3A 4MXDA 1PYOA 2EFEB 2I7VA 2JEYA 2V5AA 3DVAA 1P0FA 3H5WA 3N53A 3TXAA 3V9AA 3PD1A 1ZD1A 4M6WB 4R7GA 3H4MA 4Q12A 1SPBS 3GZNA 2WJHA 1LX6A 3PC4A 2CDBA 2ONKA 4ECAA 1X14A 2FR1A 3Q7EA 1XRQA 1GN9A 1O5OA 3FB1A 1O1YA 1I6WA 2O05A 4IFBA 4TYNA 5IARA 5C1IA 3F7OA 3H4TA 5CLIA 1B93A 3GVKA 3VNVA 1OXKB 1HT1E 1SBTA 1OB2A 1UBLS 3HRKA 3HVKA 3ZNOA 4DCTA 1PKXA 5I7SA 5KJCA 4JODA 3ESZA 3RROA 4URFA 1TZMA 2BTOA 4YRLA 3ZEAA 1PJ5A 2UV8A 3UBMA 3HK2A 1F6WA 4ND2A 2C2WA 1PUJA 4LJYA 4R3NA 1G2IA 1QHFA 4CTNA 5B2FA 2J9YB 1YVPA 4WI1A 3ER8A 1GAXA 1SQ6A 4CGYA 3B70A 4YMLA 2PWAA 3K15A 3SG0A 2PKCA 1FFCA 2FZKA 4DNTB 3DBHA 2YDXA 2BZ1A 5GGYA 1Q0PA 3WWPA 2Y8EA 2X13A 2WMNB 1Q7EA 3DOHA 1GARA 3ETNA 3I2HA 4HDSA 3U7JA 4D5GA 4DM7A 2A0KA 2Z9BA 4G5YA 4EX6A 4TXJA 1KH1A 3IPXA 5K0NA 2PR2A 3SOZA 4HPWA 2AZMA 4O8CA 1YJ9B 4CM9D 4EY8A 1CCWA 5DI9A 1J24A 1YSCA 2QNIA 2RHGB 1K27A 4QQNA 3TMAA 1LLUA 2AN3A 2Q3EA 4MZXA 4XWOA 1MW8X 4RWZA 4KLRA 4HY3A 1BJKA 4G26A 3R8XA 5K0FA 2ACWA 2XB8A 3ZIUA 5BSUA 1H22A 2F17A 2QROA 2QY9A 3A9VA 1GL7A 1Z6AA 5SICE 2X6XA 1T91A 3USES 4YJDA 1H9AA 2G17A 2FCAA 4N5MA 2FCRA 3L8GA 4LQLA 1C3OA 3AVOA 4TV8F 3CZ5A 3ZNNA 2NZXA 1SQ0A 3UB4A 1NT2A 1O9BA 1EP2B 2H2AA 1B74A 2F7SA 1YQDA 2BHSA 2V03A 4ITUA 4WKBA 3QP9A 1M6WA 2FMFA 1BXZA 3L0OA 3NHRA 4MCJA 4ZYZA 3BX1A 3TAUA 1S2LA 3SR4A 1ONPA 3ZHTA 2FMHA 1CV2A 2O3SA 2VYCA 1E7RA 4YRAA 4OOXA 3ELUA 3Q72A 4L9SA 4EYKA 4LSMA 2PUVA 5K8JB 1JE1A 1WXHA 1V96A 1RC0A 2EFHB 3ACCA 3IKJA 5EVCA 5HZGA 1J2UA 4TKOB 1OF1A 5LQNA 3HI6A 2ECPA 3THRA 4KKTA 3K9CA 4P2GA 2EYQA 5ALVA 1DOZA 1YK1A 1RWXA 3SSOA 1T5BA 2PYZA 2IWRA 3I0ZA 3CCSB 3CIOA 4MIOA 2VDMB 2XZOA 4I5GA 1P8AA 5ESDA 4J2OA 4IAOA 1Y4UA 5BN5B 1BMFD 2FX5A 4GX2A 3RU7A 4TZ0A 5EIWA 3B51X 3VR6A 2QYOA 3RJ5A 1NI3A 3RYFB 1PJBA 1G3UA 2ZJ7A 2R00C 1M1ZA 3WGQA 1IJBA 1XLTA 4JDUA 1VE6A 1C2YA 5GWXA 1YHYA 2A78A 4OPOA 2OCKA 1AUXA 3V9PA 2J5XA 3A8TA 3T5DA 1RHRA 2CLHB 3EXHC 3LECA 3GFGA 3HUUA 3CCQB 3MMZA 5C8VA 4AKGA 3PIDA 3WQSB 1OGYA 3I2FA 4CG3A 5DBIA 4B48A 3MFQA 4LOHA 2E5LB 2V96A 3MLAA 2AZTA 2HY7A 4HAIA 1JXMA 2RBGA 4FW9A 5HXBA 4QIHA 3FFTA 4KREA 1L8QA 4FFMA 1Q7GA 2YVUA 3GT0A 5LLDA 4KR6A 3MOIA 2ZYTX 1T8RA 2AGVA 2AXPA 2P27A 3EH2A 4DQ0A 3LF2A 4LIPD 3FOZA 1UM9B 5F9HA 1H85A 5JZBA 4HNSA 2AJCA 2ATVA 2LVBA 1PNTA 1HRDA 2AQKA 3CZMA 3NWBA 4JBGA 4LMPA 4JFRA 4Y2UA 1SFRA 5BN4B 3TLXA 3PXGA 3TRDA 1Z6GA 2P7IA 3LSTA 1KGDA 2ZYWX 3X1YA 1YDGA 3G5UA 4YV2A 1CG6A 3AP2A 4GE0A 4KWHA 1ADGA 2OFWA 3DTNA 4Q3EA 4BZXA 2BGGA 3MTIA 4EVIA 4JSYA 2LCFA 1PFGA 4IIHA 1X7GA 5ALEA 3WFJA 4JITA 4DLRA 2ZBVA 2QEXB 1DS6A 1H5UA 2OGWA 4NOLA 2ZDHA 1PU2A 3B1VA 3HCAA 4NH0A 4EB6A 1NXSA 2XBLA 3RBAA 1OR8A 1ILEA 5CIQA 3ZUGA 4V0KA 4MWSA 2AL7A 1FRZA 2R1ZA 1OFGA 1CDEA 3DMPA 2EWVA 3BICA 3F49S 2XHEA 3I9KA 1ZW6A 3NTQA 4JB0A 4MLPA 4MOWA 1JAHA 4B7UA 4KQXA 4BJ1A 3WOVA 3ILXA 4BO4A 4KTVE 5BSVA 4L6CA 4BIIA 1XZPA 1AC5A 2P69A 1F0PA 1NUHA 2SECE 2AOXA 2ZJ5A 3R41A 4INZA 3F4BA 4RPJA 9ABPA 4NNOA 5JC8A 3H17A 5JXIA 4OOEA 3QU9A 4DSOA 4AJHA 4H1HA 3WRXC 4X64B 3KB2A 4FQ8A 3RT9A 2R6CA 2PZBA 4I3GA 4JK3A 2AFVA 4AJ4A 3IL2A 1SQGA 5FNVB 1LDNA 4YUVA 4A6PA 5BUCA 2ZXUA 1UMDA 2EFGA 1Z8DA 1HNZB 2FWRA 3PEWA 3THYA 3ANLA 2GXSA 5JAZA 3KVYA 1OTXA 3IUJA 5HGXA 4ZFNA 1Z36A 3HBAA 3GLKA 1DHRA 5SZJA 2DOGA 5IHXA 2NWQA 4P22A 3SP1A 3IPLA 4V2UA 3T7TA 1LLCA 1S4QA 2GFIA 4IDGA 1U04A 4IV5A 2WIFA 4K2AA 3PNBA 5JY6A 3JSXA 4BMPB 1HNXB 4QULA 5DTQA 2X3YA 3JQFA 1VKHA 1S01A 4X94A 4O2AB 2HBYA 4ZU1X 4KE9A 4YXFA 3WLKX 2C3PA 5JZOA 1E3IA 4KOAA 4F1WA 2WFMA 4E46A 2FW6A 3ZHBA 4FNOA 3LD9A 2YW2A 4XQFA 1QCZA 2VEDA 3IUPA 1ZEJA 1TCAA 1PD1A 3Q7TA 1UD3A 1P9OA 2OORA 1TM4E 4Q03A 4TLCA 2P75A 1AGPA 1N5JA 3O4VA 4KVGA 4A0FA 2C8LA 4GR9A 3EC7A 3Q98A 3CVVA 1H0RA 3LOQA 3D7LA 1SXIA 3UJ3X 1UANA 2A0WA 1KO5A 5BSMA 1N6KA 4B6EA 3JY6A 5JDCA 2PRSA 1XD8A 2VTDA 4OYYA 2QMUA 2MSWA 4QTXA 1N5RA 3C1AA 4O4JF 1RRCA 1TW3A 2HRDA 3BE5A 5B1YA 1ENPA 3D6MA 2H48A 2X1HA 1VJDA 4X8HA 1OLSA 1GRRA 3TQOA 1US8A 3M3DA 4B5LA 2NUTB 4OGLA 1IQRA 3D9QX 4F46A 3GDFA 4NG5A 1L5QA 1UBMS 3OE7D 5ILGA 3A9CA 1OHHD 5K3EA 2C5AA 4CMBA 4D9FA 1U0LA 5DWVA 4O5OA 4NBRA 2H85A 5EP2A 4M9RA 1BN6A 2CKDA 1T3LA 4RM2A 4AG6A 7YASA 2WZNA 4KQHA 1QH1B 1QZ3A 5DASA 2Z3VA 1MABB 2QRHA 3MF4A 3JAKA 3Q6MA 4J43A 8ATCA 3U19A 3W7BA 4RVSA 3NWPA 4ERNA 3W4IA 4MQMA 2JRLA 2A7QA 2AOUA 1IN1A 2C82A 3NNSA 3PYMA 4LNUB 3SX4A 3BMNB 5CB4F 4ZTBA 1E0JA 3BXHA 2WT9A 1JDUA 3CW2A 1J39A 5AI5A 3IQEA 1CS0A 3RW9A 5JC1A 2FAXA 1WCV1 4B75A 1W2BB 3AEKB 4GPAA 3N2KB 2BH2A 1P0PA 1EM8B 2HA5A 1SVKA 3H6GA 4KAJA 1UBFA 3T7JA 4BNVA 4G9GA 4KKUA 2FMXA 2QNRA 2WHRA 4AU1A 4F5DA 1N36B 3ZWAA 4G0PA 4CTOA 5F77A 3D8NA 4GT1A 2O5EA 3I04M 1UK6A 3IVGA 3KQOA 5CLJA 2M2IA 2KS6A 1OVMA 1JN0A 4EPXA 3S7TA 4NNJA 3TQQA 3M5DA 4HOYA 5DNYB 1XU7A 3SCZA 4B3MB 4WNAB 1N33B 1A77A 1G3QA 2UYYA 4IXMA 2RBKA 4UU7A 4MWGA 3K9NA 2VZEA 2VSFA 4AZ3A 3RFVA 2X8JB 3FVWA 1GUYA 1D5WA 3R6KA 2OP1A 3RUFA 1UAAA 2OL4A 1UK9A 3VHXA 4BPBA 3VKGA 2AEJA 3K8QA 3LT4A 1FXWA 4IYJA 3PPXA 3QPBA 4RABA 2ZRJA 1JV2B 1X1DA 1ZIXA 3PDIA 3M83A 4H3SA 1QKKA 2J6HA 3SGLA 5B4TA 1EZ4A 5FF9A 1DELA 1SB8A 4I4TB 4M1SA 3GRCA 4NZOA 5K99A 4DV0B 4IJ6A 4HAVA 1G8MA 3WK9A 3HDQA 3FPBA 4M0MA 1OB0A 1G8AA 1EG2A 3DNPA 5LP6F 3OW7A 2WWYA 1V2HE 1U63A 3WAGA 2B4KA 3EFOB 1MB4A 1Q15A 1MPXA 4OXXA 5LDHA 2FEXA 3AR2A 4RTOA 9MHTA 2CEAA 4Q4HA 1GTZA 1KQPA 1VQ1A 2JGDB 3QITA 1GSIA 1GPYA 3ZGLA 3J7AC 4GH5A 1T26A 4OATA 3EUAA 1TIBA 3HKEB 3OX3A 1HTTA 2QRJA 1ENZA 4KAAA 2CJPA 4LC1A 1HFJA 1RYZA 1S3FA 2BN4A 1A8HA 3ZDCA 2O2XA 4M0KA 3TIFA 4BV2A 3W5AA 1H2HA 2HQSA 4FGWA 1XHFA 1XV5A 2CXHA 2FW8A 2HMWA 2PS9A 3N8HA 4MV6A 3OKFA 2EZTA 1YOBA 3JW8A 3MWDB 4TQAA 4QDZA 2GZAA 4CV1A 3IX7A 3B53X 1UD8A 3BHMA 5TB5A 1UZUA 3NS7A 2X1VA 5I51A 3UAYA 3KQHA 2CVOA 1ISJA 1QDEA 4XB2A 3CCBA 1X7WA 3OX2A 4LRQA 3PD0A 4V3BA 3PUYA 1QTRA 1ZY2A 1W5FA 2B8TA 2GPJA 1CB7A 3WQQA 1UBUS 5LB4A 8ABPA 2AF3C 3GLHB 4J75A 4ADSG 3QYFA 5JJ5A 2WF6A 2PZKA 1MCZA 1HQDA 1H0KA 5E0OA 2O0HA 3DGFC 3COVA 3VKFA 3H1TA 2QAIA 1E7SA 4Y1RA 3V4VB 2VNIA 4PN3A 3IHKA 3WXMA 3GQVA 2K6GA 2NTVA 3OJXA 1JG3A 3KWJA 4HRXA 2I66A 2PT9A 3M5CA 3C6MA 3DG9A 5IABA 3RRNA 5J2UF 1OREA 3DE3X 3PHHA 4YCAA 3K3PA 1PL7A 2J0QA 4G8BA 1NI4A 2E4AA 5HWSA 1GTVA 3C6XA 3OD1A 5JT1A 4ASUA 4XD7A 2V7BA 3VBEA 2H1CA 4C03A 1MTOA 1NMZA 5JO9A 1S2NA 3LDAA 2G07A 4Z3KA 4JWTA 4QODA 2GJPA 2ZYRA 5AP9A 2JASA 3WKEA 3KQNA 1Z22A 4G5FA 1C0EA 1YGYA 1U3VA 1YNOA 4N54A 5KTOA 2ZUWA 2UU9B 1HEUA 2CE7A 1ZS9A 3LBIA 1Z15A 4OJNA 4R2KA 1VYUA 2WR8A 2MYUA 4NLLA 4XVQA 2IBSA 2AG1A 4RETA 3H3FA 1KZLA 1OJLA 3PQ8A 3IJ5A 2WHQA 5CD9A 2AVNA 4Y2JA 1JW9B 2QX4A 4NS1A 5EWMA 1F0NA 5BQFA 3O4FA 2ZYAA 4HUQB 3EXIA 1FF9A 1ZNQO 2G4CA 3CEMA 4AJLA 4EY6A 4IEFB 4Y0VA 4M7RA 2JLQA 3MYYA 4B8YA 4CHGA 5CNMA 4ZO7A 1HYGA 3J81A 3H5RA 1HXHA 4OYLA 1R4AA 5LZ9A 1UKBA 3KK0A 2IPAB 1CY8A 4R16A 1X1CA 2OHIA 1DUSA 1G6OA 3CLRC 3DB1A 5CR9A 4RMGA 1QORA 4KITB 1VPDA 3UC5A 2A35A 4Z7NB 2ZJ2A 3P7MA 3B38A 2VHUA 3G1UA 4XGQA 1QMGA 1M0SA 3L18A 1F48A 4F2HA 5BVGB 5BT8A 1VJ5A 2IDZA 2V6BA 3EK2A 4MI1A 1ISFA 1E1QA 4QVJA 1JEEA 2EW8A 2NSDA 3CX6A 3IVXA 4DCMA 2JLWA 1AKWA 1UMCB 2Z98A 4XSGA 3N7AA 4P92A 2XDAA 5ELMA 1GCAA 1WSWA 2IDKA 4MVJM 1VOTA 1OMOA 4QBTA 4F3KA 4ZZIA 2A5LA 5BSFA 3R7LA 1V43A 5JO0A 2IK8A 5B1IA 4JJ7A 1KDRA 3HR8A 3OWXA 3MJSA 4MV8A 2OSBA 4ZOBA 3NT5A 1GG9A 1W1WA 4HJXA 2FG6C 4KYUA 4ZDJA 5CDFA 2QRPA 1F5SA 4LJSA 2CE2X 4LYHA 2I8CA 2PS3A 3EZ7A 1UDBA 1ISRA 1NY5A 1WMDA 3HNOA 1RYEA 1MGPA 4YAWA 2PXHA 3F3YA 2FA9A 1DDGA 4QUKA 5COQA 2HWKA 3GWZA 3CMCO 2QK4A 4EUHA 3S5UA 4DYDA 4EX7A 1L7EA 3O2QB 1L4YA 5T8KC 5K0CA 1DLIA 5AVKA 3CNHA 4RD6A 1E5VA 4NQZA 1M6YA 5FUVA 3Q85A 2CB9A 1VP3A 1VL2A 4W99A 5HVNA 3HPRA 1FJXA 3T0FA 1SEPA 2QMEA 3ZWYA 2X0IA 4LXGA 1C4WA 1ZRMA 2O8VA 3RU3A 3AV3A 1UAGA 4QATA 1G59A 4J8PA 5JHGB 3CGWA 1MX1A 3QMWA 2G0AA 4XCQA 3OY7A 4B74A 5LD2B 1YJBA 2GBPA 3SKVA 4HQOA 2PBFA 4PO3X 2FZGA 4QGHA 3WQRA 3R0VA 1M2JA 3V42A 2QG4A 3SC3A 5BSEA 3O75A 2V0NA 1OZFA 3EVFA 2IHVA 1UFRA 1EXVA 5J1SB 1KJZA 1EQ2A 1OBVA 4FXOA 1JB9A 4Q24A 3QEJA 2ZSHA 4BNGA 5AVZA 4E7OA 4NU5A 3MIIA 4H3HB 2VPIA 5EIOA 4FYHA 1SKBA 2DG2A 1KP3A 3TIGA 4RAQA 2OFXA 3D5TA 4J29A 3U3XA 4EP1A 2SCUB 2Y76A 1J8DA 4DJEC 2WEKA 1Z2OX 3H9UA 3HJBA 1AKUA 2OZLA 1WUIS 3OLWA 1HLDA 3PDCA 4B9AA 4HVCA 1DOAA 3OZUA 1R0LA 3HY6A 4RH3A 5IX8A 5DN6A 1JJFA 5DS0A 4ZGNB 3IEPA 1Q3HA 5KOHB 1U8ZA 2XMSA 1X38A 4G41A 2YVQA 4GIBA 4JYZA 1NV9A 2YRXA 1TYBE 1MAHA 2Z6BD 3H2BA 3TLEA 1GZ6A 3AERA 3IMFA 4DRXB 4PYQA 4TMKA 3MTQA 3DP7A 2WYWA 3I1JA 5BV7A 5BVHA 2WJIA 4M8KA 3GCWA 5J40A 2J9ZB 2R8PA 3BFJA 1BKSB 3LUHA 3GLIA 3T0IA 3MFYA 1VJ1A 4CZ2A 5GJBA 4UFNA 5JNWA 2F1LA 1NM5C 2N46A 4NHOA 4U5XA 3UPUA 3ROZA 2BFMA 4RJKA 2WM8A 2FGJA 1YQWA 4GKKB 3VYVA 1EBBA 1USWA 2ZIWB 4L75A 5EI5A 4U2BA 4A1OA 5LU8A 1KOGA 3L8CA 2BEVB 2HDOA 3VU8A 2UVQA 1OLXA 1R8QA 5IXSA 1WZCA 5G0TA 4BJHB 5HIMA 3Q0EA 4LRTB 2REBA 4WACA 3VNRA 4JGGA 4PGFA 5FOTA 1R00A 5IYPA 3QH4A 4CFZA 1MC4A 2Z2JA 3HXTA 4IM7A 1BWRA 1IPEA 4FU0A 5JSQA 5A1TA 2J09A 3S5JA 3A6ZA 2C9OA 5IEJA 2VTVA 4WFIA 2F3RA 3GUYA 3WJ1A 4P0QB 3IESA 3A6HA 4UHFA 1SU4A 2CNNA 2QQEA 3KR9A 2A84A 2QHXA 1T6BY 3D3WA 3TTWA 1E7YA 2AFHA 2CXUA 2Z5LA 5CDTA 1T3SA 2DM6A 4MI6A 2EJBA 1B23P 4RC9A 3COSA 5GV8A 3OY2A 4RMIA 2XWJI 4PXAA 1TYDE 4KBFA 2XYQA 4EFLA 1L8AA 4E2XA 4RTNA 5K0GA 1NBHA 2G4LA 1ESCA 4L6AA 5G4KA 1Q0QA 3GMSA 2WSBA 5CIYA 3F71A 4DABA 1AOXA 1O6CA 2CVFA 3ZU5A 3D7RA 3U3RA 6Q21A 1D7AA 3KSMA 2PUAA 3GLVA 5LBUA 1NI5A 4Y9TA 3VNAA 3WB2A 4IKEA 1ATZA 1C1YA 3D4NA 4HDNB 1VL1A 4MUNA 4OQPA 2VT2A 3PTZA 2C5EA 4ED9A 4BXOB 1E1DA 4OL9A 4YH1A 1JJAA 1DTEA 4MPRA 2FMUA 2XRFA 4JZYA 3LGSA 5E6RB 1H66A 4DYHA 4DMGA 1GNQA 3ZCVA 5HR5A 3QEBZ 1GOTA 4DSNA 2XJ9A 3QTBA 4A1FA 1XZMA 4KUHA 4F92B 2ZT8A 1LY1A 2G28A 2FLVA 1HDYA 4P5DA 1ZQ9A 3DDWA 4OI1A 4TKLA 5SY4A 1EM6A 1P2DA 3C6YA 3CZCA 3WHLA 3RS0A 5TV2A 1GG8A 3QLVC 4CN9A 2KQUA 4AWAA 1ATIA 2ZJZA 1G4HA 2FFHA 2B1GA 1M72A 3ZZMA 3D59A 1BX1A 1GHTA 1JIIA 3SS7X 2M9MA 1NE2A 3ETDA 2H0AA 3OSUA 1AZLA 3WG9A 2ETVA 3C14C 5BWCA 5TPZD 3TF5A 4OKIA 3CC7B 4UCXA 3BXEA 3BKXA 2J3QA 3L8YA 4N49A 5INTA 3VR2D 4JJIA 3AC0A 4EUFA 3S68A 8ADHA 1SA0A 2OV6A 2W00A 5JDIC 3EN0A 3CB4A 2A1TS 2BHRA 2GBLC 1W9XA 3TW8B 1PNQA 4B43A 4ALLA 4DREA 2OP0A 4DLZA 1XO1A 1TUGA 1NYTA 3A37A 4IHJA 4GLJA 1K8QA 1UP6A 3X2SA 2LE0A 5HM6A 2XXAA 1Q1NA 2PNJA 3K0FA 3UJPA 4E0FA 3BJMA 2QN8A 4KXNA 4EJMA 2PFGA 3PFKA 3MWEA 3U31A 1SUIA 1U0BB 3O47A 4MYHA 1XF1A 3EXEA 3TSCA 1L0BA 1U2TA 3JTMA 1DC6A 1BCSA 3BUSA 3Q2IA 4QECA 3FETA 2ORYA 5GJCA 2BAGA 3G89A 3L7AA 5BSWA 2GD2A 3PXEA 4J9VA 3I6QA 2DLNA 3BEDA 3BGVA 1ZUNA 5H5JA 2XUIA 3K6KA 1JR2A 1SIBE 2QS9A 4MV4A 4Q9NA 4R3UC 1E43A 2HSEA 4HATA 2V1UA 4B46A 4K1LA 5CT8A 1E6EA 1XTZA 2P0YA 2Y1GA 3BSYA 3IERA 4ZV4A 1F0YA 1JF8A 3L7MA 3PI6A 4ZARA 2W6MA 3IOMA 1SY7A 3DULA 5F7OA 2W71A 2DH6A 3D26A 1FL9A 3WNCA 3GRUA 1JHAA 3NATA 3DPIA 4OFBA 4YRDA 2NTEA 3NYQA 1PT9A 1UEJA 1JIJA 1Z5UA 4F56A 1U0JA 3FMPB 1MXHA 1MTZA 1RKXA 3T7KA 4IEIA 4R0NA 3FZYA 3Q7RA 5DPMA 1XTPA 4PC2A 3WO0A 3OBIA 3AJ8A 4J07A 1IK6A 1TJ4A 2X2EA 2PL9A 4L4ZA 2HGZA 4X9XA 5IBPA 3H86A 1G42A 4HUJA 1F0KA 2F43B 2KPOA 3C48A 1ML3A 1TQ4A 1N1MA 1L8LA 1ZJJA 3L1KA 5NULA 4HB2A 2W43A 3EFBA 4IIYA 3RVBA 3DHNA 4PX5A 3C1OA 1U0TA 1XMJA 4CLXA 4F93B 3RRYA 3C8UA 4OLJA 3Q2OA 4BQQA 2YZMA 2C4NA 2WYHA 2J5QA 3HVUA 4RF2A 2BFBA 2C9DA 1NU8A 3C15C 5THQA 1E9SA 4PZUA 5ULLA 2HOQA 3S2UA 2V6GA 1J7KA 1J70A 3B36A 3DZGA 2H7YA 1ZESA 1N2BA 5CG2A 2FWBA 1PDVA 2C3UA 4HQRA 4JA2A 3A9UA 3I2IA 5LC1A 1MQ8B 2SKDA 5G2OA 3HXQA 1PNOA 5F1YA 4OJQA 2D5CA 3Q8LA 3EDYA 3EASA 4YEDA 1FYWA 1P91A 4HAWA 4L5CA 3VSBA 4EPTA 3D4OA 1WZUA 1MB3A 3L8DA 4O2LA 1E2HA 3FPGA 3ZV4A 3NPMA 4CGZA 5JR3A 5DTJA 3IA7A 4EECA 1BKDR 2IOFK 4OK6A 2BMVA 1CU1A 3DONA 1OW3B 3K0HA 5FL7A 4I5IA 2R4UA 3NOOA 4I99A 4FQ5A 5KAPA 1QYWA 4NRDA 3PTLA 1RI1A 3C1UA 2FP4A 3P19A 5AJUA 5DNEA 4YI5A 3JZMA 3M4XA 3T1NA 2Q7OE 2C0PA 3MJCA 1YBHA 3FROA 4XLCA 2AJTA 1N3BA 3ZDQA 5TMBA 3SZ3A 2G9UA 3VRHA 1FUKA 1UP7A 3H1EA 3UVEA 4DMKA 1Q77A 1GT6A 2OCLA 3FTPA 4WXMA 5I48A 4F8EA 4RHYA 3SOPA 5HZHA 4RH0A 2VDWA 3EFHA 3LRPA 2PKXA 4ESEA 1QOPB 2JJYA 2LZJA 2Y1WA 5ELXA 4MMYB 1VSQA 3V5NA 4MRVA 4RKEA 4KIFA 4MA5A 4FFWA 3PBKA 4RIIA 5L6LB 1BFKA 3O1HB 1LC3A 1PWXA 1X1RA 4MKIA 1ZGJA 1YQ9A 2XD4A 2BJVA 3RUIA 4P98A 1KI2A 1L5WA 3GLSA 3QE3A 1W2GA 2FK7A 2YH2A 3B48A 3I9V1 4F9FA 3IVMA 6AT1A 2D00A 2FQYA 2R6AA 4QUGA 2C9BA 4Y1EA 5L7WA 2CK3D 2D2VA 4S35A 2JAQA 1NC3A 5LQAA 4C7KA 2QTGA 5C2JB 2NO5A 4Y7DA 1IDOA 4RLSA 3WMWA 1FSPA 1JPJA 4DVJA 5IJ0B 5IJ9A 5AI6A 4DR2B 3TLGB 1GTL1 4EELA 3NJRA 2JIZA 3KTOA 2QD3A 2DFDA 1QU3A 3B9QA 3CCLB 1OBFO 3L8ZA 4LC9A 1DIAA 5DHQA 2HX1A 3V4SA 4XDYA 4LXQA 1RZVA 4HWOA 4RADA 4YRSA 2Q5JA 1AJEA 3VPHA 1ZI8A 5IYZF 4LKOA 4UHEA 1R6UA 4HE6A 3INTA 1PJ6A 1VG8A 1DCFA 4BFXA 4R2IA 1PLKA 4KOEC 2XEXA 4YQEA 1SCNE 5C37A 3V33A 2QLNA 1WW2A 3PNPA 4UQPA 3FPLA 1TJ3A 5E6SB 3P94A 3CLRD 1WXGA 2G5PA 1D2MA 3L7DA 1QCYA 2H54A 2IUTA 3A3OA 1ZNWA 1IBCA 3HLTA 1XCOA 1ZIDA 1CQWA 4J0CA 1IY8A 2FWNA 2PRIA 4HVLA 2Q21A 1G6HA 3CB2A 1Z4MA 2GRAA 5DYWA 2W6OA 1KK1A 2VYVA 2I34A 3BZUA 5H83A 4URVR 4KPFC 3TSAA 4Z4HA 3OUZA 5KNDD 4UATA 1H6DA 4BX8A 3ML1A 3E0QA 4MGKR 3H84A 3THXA 2XYGA 2AX4A 1E61A 3LQ2A 2NUBA 4KI7A 5ALRA 1G4AE 2GZHA 3ONVA 4UHDA 1SWVA 2H29A 3QOYA 1P1RA 1E4YA 1XWWA 5L45A 3FYUA 4QTUB 1PGQA 1I0IA 3BULA 5AKXA 2I6UA 4B31A 5LOVB 5DM4A 4Y2YA 4MQ5A 4FUTA 4HH3C 1JRLA 2WLSA 1QVRA 4BFTA 4N3BA 3R5FA 5DX8A 4Q3KA 4EOGA 1X9HA 1MO4A 1UEXC 1Z0DA 5D1NA 4UE6A 3KS9A 1JAIA 5EERA 2BBTA 5JD4A 3GRPA 5U9CA 1AM4D 4OJMX 4I66A 1QK5A 3JQGA 2A5GA 2H9IA 3N0XA 1E32A 3DL2A 3QK7A 4S1WA 3TTXA 4DOMA 5AQ1A 3A3KA 1DGQA 5TGZA 4FGLA 4B5KA 3D8HA 5JRJA 2JGNA 1NPTO 4DM4A 1Q7TA 3RRMA 2EBUA 3N2IA 3UKJA 4AECA 1JIVA 2G1KA 3EQ7A 2E6KA 2OCGA 4L95C 2JFBA 1QVZA 1ZN8A 2ECKA 5C8YA 4EF5A 1VKJA 4UUAA 1QUFA 1I4TD 4H4DA 1L4LA 3GBVA 1ZRNA 3K5IA 1GA6A 1UUFA 4I1UA 1QZTA 4I9GA 5IBRA 2P2GA 2JHCA 4RK1A 3CHYA 3HJUA 3QUTA 2H5LA 4OBWA 3HDTA 5DNWA 1IJKA 3WRYC 5H9WA 3UG6A 2O3UA 5AUNB 1W36C 4AP6A 1EWVA 4HQFA 2P4UA 3PRYA 4BVFA 4DUPA 4JUDX 2H3HA 4WQMA 3VPCA 1I8TA 2PM8A 2JFWA 3AEUA 1A5AB 2IU4A 1SVMA 1TRHA 2B98A 4OBEA 3PFFA 3T6KA 3ESXA 3G8AA 2OZKA 1WHSB 2OYCA 1QLWA 2ZGVA 3ETEA 3W2FA 4Y2PA 4IDEA 4Q4LA 2UUPA 4Y0NA 2P9GA 5DM2A 5JNTA 5MN6A 2I7TA 1LK7A 1XWIA 2P8SA 3MHPA 2LKCA 4E5VA 1XYVA 2W4QA 4BO7A 3C6QA 4R1MA 4WV3A 3IPAA 2FWIA 2C96A 1X0VA 4U5QA 5CVCA 4FFLA 4ER0A 1X3LA 3DAYA 1T8PA 1PZFA 1OA0A 3BIFA 3U44B 1FVXA 1QPZA 2UYHA 4PZAA 3ROQA 4OOSA 1R66A 2NSHA 4ZZ3A 3MHTA 2HU7A 1JSZA 4O29A 1Z07A 1ZMBA 3Q3JB 3PE3A 3REQA 3IV7A 3DV0B 4TSKA 4CM6A 3FHTA 1E98A 2NNWB 5DJ5A 5DT2A 1Z4NA 2GSWA 2QRUA 4UUNA 4CQMB 5CDUA 3V76A 2G71A 3IEVA 2C2GA 1Q82D 3EVZA 1KI6B 2ZSEA 4MLZA 2R8BA 4P38A 3SEAA 3O94A 2N3ZA 1CR1A 1H05A 2BKUA 1L5OA 2CXXA 2UVPB 1IY0A 2J9FB 3D6AA 3MS4A 3R3UA 5FBRB 1L9KA 1PSWA 5EWLA 3UT5A 4FOPA 4BJ6A 5AICA 3MILA 2JD2A 4IDAA 2B94A 4PNZA 3OT1A 2P3MA 5E1BA 1FJGB 3PXUA 1E5QA 1YI8A 2QT1A 2PO5A 2Y0DA 3PR2B 4WNIA 3ZWWA 4IG9A 3U40A 2JCVA 4TWZA 3S27A 1YITB 2NUPA 3OPYB 4XGNA 3TJZA 1DVRA 1VMKA 3O8QA 4MVJE 4REQA 3FJ1A 4UNIA 4RHXA 4WA8A 3G2HA 1ZKMA 4YAEA 2WTAA 2PAFA 3ULKA 4BNWA 4UEQA 3GGSA 2FETA 4YRJA 3L4BA 4PCVA 1CQJA 1PNVA 2GDJA 2VHYA 3TCKA 1TVCA 3UPTA 2IH4A 2H5IA 2D1TA 2ZBUA 2OESA 5B36A 2XTJA 5AJYA 1SCUB 1N0UA 1C1DB 2ZIUB 3KLMX 3O9MA 2YHSA 4B4DA 2XTNA 5EFOA 2NZYA 2C7VA 1QVAA 4U8HA 2PX4A 1M1NB 2R4QA 1WP9A 4YN3A 3RRJA 2QP9X 1QB8A 3G0BA 3SI7A 3I28A 4B82A 4I1YA 3SZOA 1NW6A 5BOVA 1QG0A 4B3BA 4JLVA 3HMKA 4D9NA 4E2WA 2JFGA 1QLJA 2ZL6A 4GHWA 3E22A 3GMTA 3TX6A 2ILTA 1K63A 2FZ4A 3LA6A 4IWNA 4D57A 4QBHA 2PV7A 2I4OA 3KRTA 1HX7A 3TL6A 2VATA 4MYUA 4C01A 2DKOA 1YRAA 5TEWA 2QWXA 3Q40A 2WF5A 4V0ME 4DMUB 4EHBA 3F7NA 1WL8A 1WUKS 3AI7A 4RDCA 6REQB 4C76A 2J0VA 3AR6A 4Z9AA 5D3QA 1YRWA 4WJZA 4MS3A 3WFZA 3Q10A 1ZK2A 3D64A 3EISA 3UK2A 3DQQA 4AY2A 2VXOA 4G0UA 4LZOA 1M54A 5CLLA 1PS8A 1EX9A 4UUBA 3ZX5A 1E7QA 1DIHA 2ZJ0A 4KRGA 1XHLA 4B9EA 2ERXA 3CPJB 4PNEA 3EUWA 5JI3E 5F4JA 1KIFA 1YRHA 2YICA 2XBMA 4K6KA 4KMOA 2WZQA 3VZBA 1BCRB 2I54A 5FA8A 4KUGA 4GI7A 5DYYA 4NCKA 2P4EA 3G0OA 3EZXA 3KXPA 1R0RE 1ZM2A 1IOZA 1NJ2A 2XQVA 4Y6OA 5ALTA 1VCMA 2JJ2D 3AJAA 5EJFA 1YA6A 1K2VN 4I14A 5KTMA 3MTDA 4KAFA 4KQ6A 4EF4A 1M1YE 1IE3A 1VQ6B 1T5DX 3IT0A 3QA9A 1Q11A 4KH0A 4QOGA 1YJAA 2G04A 4TRMA 3RS4A 3UWDA 1BEZA 3HE3A 2AN1A 4C0WA 4K9RA 5K0JA 1M8KA 1ZU5A 3CS3A 4MQLA 1U0FA 2BW0A 4YRFA 1TIKA 1VHJA 3IXQA 1N4AA 5LMCA 4I8XA 1EE1A 2JJMA 3WE7A 4E07A 2Q5HA 3RWBA 2EQ5A 4LQCA 5KTSA 4AMZA 3PC8A 3LYHA 4B6PA 1ST2A 2ET6A 2J5KA 2XOXA 1UPUA 3K2IA 4JY7A 5CYOA 4U4AA 5ALKA 4QVGA 3HM2A 1PJLA 4NWIA 4ZCQA 4HSGA 2YOHA 2CN1A 2J5RA 2YC4C 5IT9A 3HSYA 1XMVA 1W93A 1APBA 5KNDH 4J4TA 4LOKA 1XGKA 3H0KA 3RAEC 3OO1A 1BH6A 5JY1A 2PZLA 2HW8A 4DA6A 4QAQA 4LCJA 1TQ2A 4IMRA 1S7GA 3T9CA 3QKTA 1XQWA 5KOIA 3IDSA 4MAMA 1PF7E 3VOTA 2QVYX 4F9TA 5BV8A 3MXTA 4DQDA 1CPYA 2PX6A 2WA1A 5FL3A 2GA9A 1Q1EA 4FYIA 4L85A 3ETGA 4YRCA 4D9CA 3KAQA 3AB3A 3SNKA 1BVUA 1QTIA 3CUEF 4Q1FA 3R9XB 1O97C 2D0DA 2GYWA 3L84A 4PFQA 2P4SA 2UZ0A 4UZSA 3CH5A 4AMYA 4A36A 1E1RD 1J20A 5JV5A 1P9NA 1I36A 2H2WA 3LUPA 3ZJTA 2XGJA 5E3IA 4O8ZA 2VT6A 3NDJA 4HGQA 4NTZA 3SPXA 4EYSA 3VSEA 3KNZA 3QLEA 4OF4A 2Q41A 1M5UA 2A3RA 2FFAA 3F8TA 3SHWA 3GPBA 5DI3A 2XYRA 3KKEA 4OUDB 2GD6A 5I5GA 1ZD5A 5ED0A 3K0AB 2X7XA 2E5FA 2XE7A 1HLPA 2CXQA 3CJRA 2WQZA 3ND7A 4GEKA 4H6VA 4JELA 1GTG1 3BQNB 5JXWA 1PX2A 5GM1A 1E5XA 3ZVNA 3FTQA 1Q0SA 3UCFA 3OIGA 4JLPA 4TVKA 5MHTA 4XFKA 3RYCB 2QMZA 2IY7A 1CJKC 4AUKA 3BSWA 5DP2A 3T4UA 4RXMA 4BP8A 3TMYA 2FPPA 3EG5A 1SRRA 3D3QA 1YTLA 5TVKA 3VDRA 4D4HA 1X2BA 4J0IA 5LMNB 3QTTA 2HDNB 1Z17A 3NIGB 2WWIA 3W5SA 2HJ9A 2C54A 2P68A 3WGTA 3PENA 1UKCA 1R7RA 1Q84A 1BIFA 1ZK1A 2IW1A 1YS9A 3NVDA 5AK5A 3LBHA 4KB5A 3CWQA 3LP8A 3U3KA 2D3TA 3MCWA 4ZVQA 4KPUA 4F4CA 1HYHA 2QR5A 1WQ1R 4E14A 5DT9A 3UB3A 1RCTE 4JJ4A 3CNLA 2OT3B 2Z83A 5ELLA 1OV6A 3DWIA 4QOFA 3WAJA 3P27A 2XCTB 5B58T 4B3CA 6NULA 1YB1A 3MA0A 1M8JA 2J8ZA 3WMFA 1H3EA 2VTKA 5MDHA 3FPAA 1BE0A 4UU1A 2GNOA 4XR6A 1U6KA 3V8EA 3LUBA 5IVDA 5DX1A 1XMPA 3FUCA 2Z2ZA 4YCCA 1EUCB 2A5YB 1ZMOA 1IHXA 1U0SY 2MJLA 3A1NA 1RWKA 2WPDA 1K2WA 4GRDA 4NS4A 2XMDA 1LQTA 3U3OA 4J1TA 4LVUA 4NI5A 1Y1LA 1N5DA 5JHHB 1WW3A 2B9VA 5FNZA 3AHHA 4HADA 3RANA 2B0JA 3IQXA 2FXIA 4GI2A 4Z8YA 5JPIA 4DNRB 2IC5A 1MAAA 5GZ6A 1KY3A 5TS3A 3G85A 3DFUA 2VEOA 3KZNA 4EGFA 3RVDA 1PR2A 3GQBA 1DAGA 1R2QA 1N2OA 5AVVA 3S1SA 4LDPA 1WZ2A 2PVCA 4XGKA 4QBGB 1IBSA 4NZ9A 3BM5A 4Q7EA 2SBTA 3GA7A 2I7XA 1XTUA 2B92A 3ENNA 2OV8A 4J1NA 3A28A 3PQ4A 4BE4A 5HQ3B 2GGSA 1EP1B 2HUPA 3AG5A 4N6OA 2CMDA 3EVGA 4N0DA 4NCJA 4PWYA 4BBZA 4CM4B 2MYNA 3DFIA 4N6NA 2REQA 1IMJA 3AWIA 3EA0A 4M0DA 2B83A 3E8SA 3ZCSA 4BFYA 4KQEA 4EHFA 2WSSD 4QGGA 1VMIA 4EY7A 1NURA 1VIDA 5EJEA 3A1UA 3BIXA 1VHDA 2WJVA 2QENA 2XZTA 5A3SA 3E27A 3NT2A 5FUQA 4KODA 1L5VA 3EXHB 2H2GA 3HY3A 5I3CA 4XPIA 3IBYA 3KHTA 3VC3A 1EBUA 4C1BA 5DBFA 3ROKA 4KGDA 4URWR 1A9YA 2DHCA 2DY1A 2Y6VA 4I4LA 3U4CA 2Q50A 3NEYA 5KCZA 4XYLA 4JUFA 1TM3E 1M34E 2XDQB 1ZNYA 3Q6IA 4UJ5A 5EAIA 4M0LA 4YRZA 2YOFA 4AROA 4Z49A 4J03A 3D6UA 2ADOA 2B8JA 2AMFA 2H06A 3VM6A 4Q7LA 1ONOA 4P81A 4PQYA 3X2EA 5BNWA 4ZOAA 2JEOA 1R0WA 1U4SA 2ZIAA 1EFAA 4AJ1A 2XB4A 1LK0A 2FEPA 2OYSA 1CRWG 1U2QA 4FZJA 1QK4A 3K6SB 1IZ8A 4GC5A 4HN2A 2MR6A 1BOFA 4ISBA 3ZC3A 3CWZA 5H80A 1E3TA 5D85A 5KNCD 3FGOA 4KPEC 4ONEA 5L9AA 2IQ5A 2WU3A 4Q1VA 3WLIA 2O8CA 3HP7A 3C5VA 1TU0A 1DKPA 1SG9A 1T8WA 3TRJA 1INLA 1JHDA 3O74A 4PO8A 2JGFA 2JLXA 3PR3A 4Q3NA 2CZGA 3BK2A 4D9IA 3PUKA 5EWJB 3RVMA 1DWPA 4ROSA 3BSSA 1QO9A 3G8CA 1ORHA 1V6SA 5FBVB 2BCEA 1U7PA 4RD0A 1J0EA 3X1XA 5SYAA 4CIBA 2ZTVA 2HZ7A 1J90A 2CHVA 1TT5A 1THTA 4X7RA 3HY4A 4FT4A 1AUQA 3OFNA 1O08A 1RXCA 1EZZA 2I3GA 2FVGA 2Y1XA 1U94A 3ILHA 1Z73A 3I8XA 2R25B 3GEBA 5KTRA 3THWB 5TQ0A 5DOVA 1G0OA 1VZ3A 4LSGA 4RKYA 4WEQA 3TIIA 5CB0A 2IW3A 3UO8B 1AMNA 1W36D 1KS9A 4HQNA 3S2GA 1CUUA 3PE6A 4B4KA 1R0XA 1BZYA 2YXBA 1ZA1A 2P4HX 2ETXA 1EUDB 2JC3A 3OKAA 4JNKA 4W7SA 2PRJA 3ORSA 3TGWA 3MCAA 3IJRA 5FQOA 4H4EA 2OAGA 2WA2A 5DGHA 2F3UA 5ALXA 3BRQA 4QOSA 3TYXA 4NXNB 3L07A 5TJHA 4DQLA 3OMLA 4U6NA 2XCIA 1XA4A 4B40A 4UTNA 4A16A 4KXWA 2VWGA 5AW0A 1TAQA 4YAJA 1XJCA 2Q1YA 1M74A 1U7ZA 3W6ZA 1M2VA 4OHYA 1FXSA 4JR1A 3C7CB 1ZM3A 4L16A 4PLTA 4OCZA 3WP0A 5EQJB 2CCKA 2ZAGA 4NKRA 4PSCA 5B3JC 3WYCA 1W0JD 4LJ4A 3RJTA 4AO8A 5HRUA 5B2EA 2WJJA 4BKUA 1OFVA 2DWPA 1TTTA 3PK0A 3WA7A 3KB1A 3HJTA 1PGNA 1BGWA 2WAMA 3NIWA 3W4KA 4LF4B 1SIOA 2JH9A 4X1IB 1QGDA 1SKQA 1E0SA 4G4SO 1H2ZA 4M87A 4EW6A 4S2EA 3PSAA 4G0ZA 2BP7A 4TUYB 5I4CA 3HKDB 1LPNA 3BS4A 3SYTA 4HXEB 3U7HB 2IUYA 2QAGC 1ONBA 4WSOA 1D6JA 1ZI9A 1X1QA 2C92A 1FP2A 2PUTA 4ACAA 3DXFA 1HGXA 2EDCA 3LKDA 2HIAA 3T3MB 3WYFA 4Z1MD 3I56B 4EG3A 3BCDA 1VIMA 4H7IA 2QM0A 2QN7A 2O1WA 3OT4A 8MHTA 4C0XA 3IEUA 3JWPA 5CVUA 13PKA 2WJPA 3EQ9A 1MR3F 3OCCA 2F90A 3RLIA 1AK2A 1DZ3A 5GADl 1QP8A 1X8JA 2G7MC 4D9HA 3PYXA 2V3VA 1F7VA 2VP4A 3JQ9C 5LMZA 2FHPA 4ZOQI 5JAOA 4E5UA 2PN1A 5BN3B 4RULA 3W2GA 1MB9A 5LPNA 5COBA 4YQFA 4R2JA 5FPTA 4H27A 1CUDA 1CTQA 1NBAA 3PXCX 4IRMA 5FWNA 1Z2EA 2ZM6B 4UNQA 3UJHA 1F2TB 2NYRA 2A1UA 3ACDA 2QIPA 3P45A 4MYCA 2AD5A 1YC2A 4OYHA 4RZUA 5HE8A 2QBYB 1Y8RA 3OW2B 4IHJF 4NENB 2M6KA 5AW4A 3KL2A 1DT3A 3KOXA 3IKMB 3FYCA 2C7BA 3QGMA 1SZDA 1NNLA 4J3JA 1DPFA 1UZLA 1XJ5A 2ZIXA 3TGPA 4UHHA 2P65A 2Q07A 4I4IA 3KELA 4Q7MB 5LXTA 2D2FA 4UHJA 2GPWA 5I8PA 2WKWA 1PW5A 1Z0SA 3U0BA 2DE0X 1UJ2A 4XI9A 3HNPA 2JI6A 3L6OO 5EUBA 4ZT6A 4XJXA 1ZOLA 1YACA 2BFAA 4EGSA 1QIDA 1XZNA 2XODA 4FQ7A 3D2CA 4P0PB 1FNDA 3KAJA 3GIWA 1SJ9A 8GPBA 2PS1A 3JVDA 3RUEA 4DBLE 4E6PA 1KNQA 2VAMA 5M04A 4GP6A 4B3FX 1LWNA 5JNRA 5HZBA 1U8FO 3FWYA 2Q5IA 4RJLA 4MB2A 5FLXA 3E9EA 1XDUA 1D07A 1H6CA 2FQWA 4K6OA 1JMKC 4WNCA 4RDJA 3VPBA 2BMAA 1AS0A 3NJ8A 2VJKA 2WIGA 3GK3A 3NDIA 1PTJA 2BUCA 5HJ7A 2RONA 4LXIA 1SXHA 2FUKA 3B7WA 3P9CA 2V55B 4EHAA 3WBJA 1NKVA 5FOVA 2YQZA 5BV2P 5E9WA 2X3UA 1JA1A 5ALOA 4P1ZA 1DARA 1EK6A 3OO0A 2MR5A 3AUKA 5FB3A 1CF9A 4N6GA 3GUVA 4HR7A 1W8IA 2Z30A 4QUEA 2EARA 3WMRA 4ABYA 1Z56C 1XQBA 2YQ4A 3IHWA 4B3SB 3CRNA 3GFVA 1G5FA 3KT0A 2WTBA 3GLGB 4XD2A 2IIQA 4Y1FA 1IBRA 3BF7A 4EGAA 2F1HA 4YP6A 5EJMA 3IP5A 1C7IA 2Y1OA 3FR8A 2RE8A 1X7DA 3PP8A 2PV0A 3A1DA 1U0EA 4GZMA 4HZUB 4K9OA 2AKAB 5ER6A 2XXBA 4EJSB 1TX4B 3BIWA 4DDHA 3D1LA 3VNQA 2REOA 4EPYA 1LBSA 3MRTA 3SN6A 1FK8A 4MS4B 4L28A 3UJ8A 2O5CA 3NGLA 2ZRBA 3T34A 3WWDA 4M9QA 3GV0A 1CZKA 1IUNA 1CY2A 3LVFO 1TXGA 2G70A 3NP9A 4HO1X 4L51A 4P3YA 4ZQEA 3SVTA 4XRRA 1YE3A 2IA5A 3FLBA 3DC7A 4W1RA 3ZY4A 4G0NA 1T9HA 3Q3VA 3DFFA 4MUJA 1MIOA 4QM7A 1Y1PA 1R5BA 4NMWA 5BORA 5HIIA 4X06A 4D26A 2FPMA 2OZVA 4F1KA 1PN3A 5DNVA 3OBBA 3W34A 3NHSA 5BMOA 2V7QA 1VQMB 2WUVA 1JHRA 3C3EA 4PY2A 2FRVA 2AVDA 5JAPA 1KPGA 3OM0A 4OL0A 4AKEA 3QEOA 4J4BA 4KV9A 4KYTA 2P9EA 1MEJA 3MG9A 3L4JA 5BXYA 3N2EA 1CIVA 5I7VA 5KNCH 3WA6A 1O97D 4HBGA 2E3JA 2VPPA 3EJWA 2WNHA 3QWAA 1KBQA 1CUBA 1HKUA 3PQCA 4UAVA 1GYPA 4TLEA 1KMCA 5KYUB 2VF4X 1B8UA 1CYDA 3JCZA 4KLZA 5DBEX 5AM0A 3ZBQA 4DRYA 1QYVA 1TMOA 4QXMA 4B83A 1YB5A 3NORA 3DDHA 4ZI7A 3HWRA 2ZWVA 3BGOS 3SE7A 1O95A 1IBLB 1L7AA 2Z0MA 1JAZA 2BMWA 2P3OA 4KN5A 4P80A 4XARA 1MVNA 5EZYA 3MM4A 3AW8A 1A8PA 3LKVA 4ETWA 4EG5A 5LQCA 2GBGA 4CRWB 3JSAA 1VE1A 4OK3A 3LA8A 4FONA 5DGIA 3LNNA 1MVLA 2C83A 2COEA 2GXUA 2RHTA 1CD5A 3DGEC 1U9IC 3FBWA 3GRRA 3FMGA 3G02A 2Q3HA 3OC6A 2OQIA 4PQEA 3S55A 3W1VA 4GOMD 4BDTA 5DV9A 4N39A 4BS9A 2MINB 3NHPA 1YS1X 3GBSA 3M33A 4HDMB 3L6RA 4JMQA 3QJYA 4D41A 5DCUA 5I3ZA 4HNTA 3ZTWA 1LSJA 1VECA 1X7YA 3ADBA 3KQVA 1MC8A 4HNAA 3A04A 4UARA 3I2KA 5F1PA 4B33A 4YMHA 4TROA 2R96A 1EFVB 5KHOC 2JD0A 2O0LA 4AUMA 4UEWA 2VHVA 4JT8A 5BV1A 1H2AS 1F8UA 3AZOA 2CWWA 3CO0S 5HK9A 1UPXA 1BHSA 2Q7DA 3AF2A 1H1TA 5M7EA 1QH0A 3FSEA 1I2AA 3WLLA 4HNQA 1GNRA 2VJIA 2E89A 2J3LA 3IDOA 3L8MA 4M83A 5EVJA 4E5YA 4CI0B 1C3XA 1E3EA 4BMYA 2DTDA 3EOZA 3DBOB 3ANMA 3E70C 3H0CA 3NTXA 2UXBB 1ZHFA 1WBBA 3VNBA 5BMVB 1SHTX 3D7NA 5JTTA 4LDQA 3RV4A 2R5FA 5HW0A 2CNDA 3C4JA 4LV8B 2F1MA 3IS3A 5TF0A 4E5DA 4PFSA 5AKLA 3BGIA 3L82B 4KN6A 1P7VA 2RFLA 4DWVA 4TRJA 2INGX 1E2JA 3OCXA 4MRMB 3IUYA 3UGKA 4W7HA 4EM6A 5AVJA 3G7SA 2BIFA 4QYIB 2FE4A 5FA5A 5IMBA 2C2YA 2P5SA 4ZGQB 1N6PA 2JK0A 2JH8A 3N1UA 1BGVA 1JALA 1GL3A 5EJGA 2XB9A 3EXFA 2FSVC 2CJWB 2BUBA 3O3NB 3ZY5A 3TTUA 1IHMA 4JLDA 2Q2NA 2HBQA 3KO8A 2YWBA 3M1LA 3OQOA 1NVMB 4XAQA 1A7AA 1FDUA 1U7WA 3LQYA 4IX1A 4TSFA 3T38A 1DAMA 4V39A 1UBTS 2KSQA 3ELWA 4JXJA 5IM5A 2V5UA 3SEJA 4KFUA 3TW4A 3EQ8A 4D0RA 1M2WA 1W0CA 2O14A 2XQKA 4PG6A 3MOGA 1YUBA 1R6BX 4BMXA 5FA6A 4N0PA 5GVRA 4NCBA 2HC9A 3W5CA 1TUBB 2FH5B 1DTWA 4OHBA 1JNYA 3GP8A 2GPAA 3O9ZA 5EJ9A 3Q3CA 3G2PA 1GDHA 3JQAD 5IK2D 3TB4A 2K7FA 4HQLA 5JQGA 9LDBA 2WYUA 3CFYA 5AOAA 3L7IA 4FD2A 4F2GA 4YXWD 5BN1A 5LNK6 2O8FB 2PIDA 4JP2A 1CIJA 3PLRA 1ZUWA 3ZDDA 1SOUA 2CL7X 4E21A 5KJ1A 1M0TA 2IEDA 5LP6C 2G88A 2F48A 2X7HA 2XMQA 3OZIA 4I08A 3BQ9A 3QOXA 1E2NA 2BFEB 4IGEA 4Q4JB 4GMKA 3BORA 3CM0A 4L50A 2IJGX 5HMMA 3OM8A 5B37A 3VJRA 3SQLA 3D6VA 2OD2A 4JJ8A 1K5PA 2OO5C 3UV3A 4FR0A 4WZTA 1R15A 3H4VA 2CXNA 4FMCB 4U00A 4E22A 3PUZA 1NWCA 2V7XA 2JI8A 2Q45A 3EXG1 1MU0A 3BL8A 5DISB 2YHUA 1BDMA 1XVUA 3ENVA 3Q11A 1U9JA 2VPTA 3CO5A 3E61A 4IVPA 3HGQA 4PZ9A 3WLNA 5J2TA 1XTBA 1XZKA 4KFRA 4D8XA 3NRCA 1F4LA 2Y1DA 5C1OA 3AM3A 5IASA 4RK0A 1K3FA 1M75A 3V7FA 3RC1A 4W82A 3RFCA 1VPWA 2XY4A 5GGXA 4JU9A 4PHFA 2MSKA 4EMUA 1XPUA 2B25A 1EBFA 1UXKA 2OAP1 1XRRA 1RI4A 1MG5A 2PHZA 4QWMA 1QRDA 1NNI1 4FOTA 2RAUA 3FHLA 4H7EA 4GP7A 4UEJA 4W6ZA 5JG7A 4CM8A 5L7TA 3QKRA 3ISXA 4IDNA 2GCPA 1MV8A 1P5FA 2IY8A 1XEXA 2RGWA 2J85A 2Q5OA 1QQTA 5HIJA 3TFOA 4EJ2A 4DKJA 3KYCA 3CIFA 3WIUA 4EZBA 2DQYA 2FZLA 4UNPA