1S4NA

Crystal structure of yeast alpha1,2-mannosyltransferase kre2p/mnt1p
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
339
structure length
337
Chain Sequence
KTTMDYITPSFKAGKPKACYVTLVRNKELKGLLSSIKYVENKINKKFPYPWVFLNDEPFTEEFKEAVTKAVSSEVKFGILPKEHWSYPEWINQTKAAEIRADAATKYIYGGSESYRHMCRYQSGFFWRHELLEEYDWYWRVEPDIKLYCDINYDVFKWMQENEKVYGFTVSIHEYEVTIPTLWQTSMDFIKKNPEYLDENNLMSFLSNDNGKTYNLCHFWSNFEIANLNLWRSPAYREYFDTLDHQGGFFYERWGDAPVHSIAAALFLPKDKIHYFSDIGYHHPPYDNCPLDKEVYNSNNCECDQGNDFTFQGYSCGKEYYDAQGLVKPKNWKKFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Kre2p/Mnt1p: A YEAST {alpha}1,2-MANNOSYLTRANSFERASE INVOLVED IN MANNOPROTEIN BIOSYNTHESIS
pubmed doi rcsb
molecule keywords Glycolipid 2-alpha-mannosyltransferase
molecule tags Transferase
source organism Saccharomyces cerevisiae
total genus 126
structure length 337
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.4.1.131: GDP-Man:Man(3)GlcNAc(2)-PP-dolichol alpha-1,2-mannosyltransferase.
pdb deposition date 2004-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1s4nA00
2BO7A 5C38A 3PKPA 5CMIA 1XHBA 1WVCA 2RJ1A 2Y6PA 4LW3A 1H5SD 2RITA 1FZWA 2O1FA 2VSIA 3D98A 1VPAA 4E1KA 1SS9A 1PZTA 1PZYB 4FRLA 4M2BA 4D0TA 2RJ5A 3SXAA 4FRPA 1H7TA 4P02A 2Z86A 5AJPA 5FV9A 2V0IA 2OI5A 3NGWA 4EEOA 3SXBA 1V84A 3I0JA 1FXOA 2FFUA 5CQMX 1V83A 5CQNX 3POLA 3V0LA 1VGZA 1LZJA 4B4GA 4Y7GA 2YQJA 1VH1A 1I52A 4YS8A 3I0IX 1JV1A 5C47A 3Q4SA 3CKNA 1LL2A 3V91A 3I0KA 3SX5A 4B4MA 3CKJA 5DDVA 2AECA 2E3DA 4GBPA 1HJLA 1JYKA 2DPWA 3U2TA 2PGYA 4MYBA 1H4CA 3K8DA 4Y7FA 3RSBA 1R82A 1GQCA 4D11A 1ZJOA 5C4CA 2I7BA 2NXVA 2X5ZA 5I1FA 1YROB 1G2VA 2YC5A 1ZDFA 4FRMA 1GQ9A 5C4FA 1EZIA 4CJBA 2OI6A 1GA8A 3RMWA 1H4DA 4L41C 3U2UA 1NF5B 3E25A 5HS2A 3Q80A 1WT0A 1GWWA 1FO9A 1OMZA 2ZU7A 2VFZA 2BO8A 3U0XA 1VGUA 1TZFA 3SPTA 3SXDA 2AE7A 5CQLX 2CU2A 4KNRA 3SXCA 2YCMA 4FRDA 3SXGA 2VS4A 3RMVA 3GUEA 4FRQA 1H5RA 1H5TA 4FRAA 1G97A 1V82A 3OH2A 1QGQA 2OEGA 1TW5A 1S4OA 1H7LA 3DJ4A 1VZTA 4FRHA 1NKHB 3I0LA 5CMHA 4EVWA 4HO6A 4G3PA 1MC3A 1LZ0A 2VD4A 3ZF8A 2QGIA 1FGXA 3V0QA 2WAWA 3U2VA 3V0NA 5C3AA 4JD0A 4Y62A 3FWWA 2AESA 1R80A 3IOIA 3SX3A 1JVDA 3V0OA 5EIYA 1VM8A 2FYCB 4EEAA 2BO6A 1W57A 2Y4JA 4Y7VA 1E5KA 2PX7A 4EEMA 5CQOA 3ZGGA 5CMJA 1ZJ3A 1O7OA 1R7VA 1FO8A 4Y9XA 1GX0A 2ICYA 1IINA 3PNNA 3Q7UA 1XZ6A 1JYLA 4NAIA 4Y63A 1ZI3A 5L6SA 1G0RA 4R7PA 1R81A 4LW6A 4CVHA 4ECMA 2VXLA 3T7MA 4FREA 1NHEB 3ZLKA 3R3IA 3N9WA 1WT2A 4JISA 3U0YA 1G8OA 1ZCUA 2MZBA 2RJ0A 1G23A 4NALA 3USQA 4C2SA 2AM4A 4AYLA 3OH4A 1ZHJA 4ZDQA 5JQQA 5EJZA 1ZCVA 4B42A 1NMMB 4M28A 1H5SB 4G3SA 2APCA 5FTVA 1OQMB 5FTSA 4B3UA 2P73A 1VGWA 3HL3A 3TZTA 1O23B 4BMAA 3TQDA 3PKQA 4UEGA 4BQHA 5DDTA 5CMFX 4DECA 4IRPA 4KC2A 1EYRA 5IDSA 4FCEA 1ZI4A 2YQCA 1ZJ0A 4B4BA 1QWJA 1ZCTA 1ZI1A 1G9RA 2RIYA 2BO4A 1LZIA 2FFVA 3R2WA 1HV9A 5C1LA 5AJOA 3U2XA 1H4EA 1H7QA 3V90A 4IRQA 1R7XA 1O7QA 2WVLA 4Y6NA 1H5SC 3F1CA 3I0DA 2QH5A 4Y6UA 1ZDGA 5CMGX 1OMXA 3USRA 2I5KA 3BRKX 3FOQA 1ZCYA 2V0JA 2X65A 4ARWA 2O1HA 2YQHA 1TVYA 2Z87A 4AC3A 1YP3A 5IDTA 1ZJ2A 2D0JA 4XWIA 2I5EA 2O1GA 1FRWA 1O0RA 1ZJPA 3JUJA 3DK5A 2UX8A 3D5NA 4DE7A 4ASYA 5C3BA 4NAKA 5C48A 3V0PA 2RJ9A 5C8RA 1WSZA 2Y7AA 1MP3A 4J18A 4AYJA 4Y7UA 4KRVA 1ZI5A 3D8VA 2E8BA 2JCLA 2Y4LA 3V8YA 2OEFA 3JUKA 2WEEA 4KQLA 3I0EA 2RJ4A 2GGOA 2RIXA 3LW6A 3O3PA 4HO3A 5AJNA 5CQPA 1S4PA 1JVGA 2PGVA 2GGQA 4FROA 3DUVA 1ZIZA 1FWYA 4EE5A 1R7UA 4MNDA 1FXJA 2FYAA 1ON8A 5C1HA 4KXOA 4KT7A 2FYBA 3ZLLA 1K4VA 4ASJA 4HO5A 4HO2A 2PA4A 2Y4KA 3ST8A 5L6VA 2WVKA 3I0FA 4HO0A 4G3QA 4EE3A 1INIA 3CKQA 4FRBA 1R7YA 1JV3A 3OH0A 2VS3A 4KPXA 2JCJA 3OGZA 3V8ZA 1HM9A 1GX4A 5C3DA 4FCUA 2AH9A 1YP2A 1H3MA 1LL3A 1HJJA 4D48A 1H7HA 3OC9A 2QKXA 4NANA 4HO4A 1H7EA 3I0GA 4KNXA 1G93A 2RJ6A 2WGZA 4B2WA 4EEGA 1WT3A 5IFYA 3QVBA 1NWGB 2X60A 1VICA 4DDZA 2XWLA 2VSHA 1FR9A 3OH1A 3E26A 2XMEA 1G95A 1VH3A 1H5RB 1H5TB 4FQWA 5EJ1A 5C4DA 2ZU8A 2ICXA 5C4EA 1HM8A 1IIMA 1TW1A 1W55A 4HOCA 2FYDB 1YP4A 1MP4A 3CGXA 3ZGFA 2WE9A 1G1LA 2X5SA 1FGGA 1MP5A 5J49A 1VZUA 2XWMA 4D11C 5C1GA 2D7RA 2P6WA 3JTJA 1ZJ1A 1KWSA 1VZXA 2D7IA 4HO9A 1FOAA 3EE5A 4KPZA 5FU8A 2Y4MA 2YQSA 3I0HA 3SX7A 1VGTA 1H5SA 2AM5A 4AAWA 2Q4JA 3BCVA 5FU0A 4M2AA 3CU0A 3OAMA 1NQIB 3CKVA 2OI7A 3KIAA 3U2WA 3IOHA 4CJCA 4M4KA 2WVMA 3T7OA 5C4BA 2P72A 1INJA 2A8WA 2V0HA 2W0VA 1G3LA 2V0LA 2AGDA 2W0WA 4HO8A 2JCKA 1W77A 5FYEA 2RJ7A 1FG5N 4G87A 3SX8A 4HG6A 1QGSA 1H7FA 4P00A 5FUHA 4D0ZA 4EE4A 4Y64A 1R7TA 2RIZA 1LL0A 2ZU9A 2FY7A 3OH3A 1Z90A 1S4NA 3OKRA 1GWVA 3SXEA 1LZ7A 1H7GA 4CJ8A 4HCQA 3I0CA 1FR8A 4KC1A 2VS5A 2YC3A 4B5BA 2AM3A 1LVWA 2JCOA 4K6RA 3T7NA 5C49A 1ON6A 2VXMA 5C36A 3CKOA 2YESA 3V0MA 3F1YA 4KC4A 3K8EA 2XWNA 4Y7TA 2RJ8A 3IOJA 2XMHA 1QG8A 4B2XA 5BXCA 2V0KA 1WT1A 2A8UA 1HM0A
chains in the Genus database with same CATH superfamily
2BO7A 5C38A 3PKPA 5CMIA 1XHBA 1WVCA 2RJ1A 2Y6PA 4FIYA 4LW3A 1H5SD 2RITA 2VK9A 1FZWA 2O1FA 2VSIA 3D98A 1VPAA 4E1KA 1SS9A 1PZTA 1PZYB 4FRLA 4M2BA 4D0TA 2RJ5A 3SXAA 4FRPA 1H7TA 4P02A 2Z86A 5AJPA 5FV9A 2V0IA 2OI5A 3NGWA 4EEOA 3SXBA 1V84A 3I0JA 1FXOA 2FFUA 5CQMX 1V83A 5CQNX 3POLA 3V0LA 1VGZA 1LZJA 4B4GA 4Y7GA 2YQJA 1VH1A 1I52A 4YS8A 3I0IX 1JV1A 5C47A 3Q4SA 3CKNA 1LL2A 3V91A 3I0KA 3SX5A 4B4MA 3CKJA 5DDVA 2AECA 2E3DA 4GBPA 1HJLA 1JYKA 2DPWA 3U2TA 2PGYA 4MYBA 1H4CA 3K8DA 4Y7FA 3RSBA 1R82A 1GQCA 4D11A 1ZJOA 5C4CA 2I7BA 2NXVA 2X5ZA 5I1FA 1YROB 1G2VA 2YC5A 1ZDFA 4FRMA 1GQ9A 5C4FA 1EZIA 4CJBA 2OI6A 1GA8A 3RMWA 1H4DA 5D92A 4L41C 3U2UA 1NF5B 3E25A 5HS2A 3Q80A 1WT0A 1GWWA 1FO9A 1OMZA 2ZU7A 2VFZA 2BO8A 3U0XA 1VGUA 1TZFA 3SPTA 3SXDA 2AE7A 5CQLX 2CU2A 4KNRA 3SXCA 2YCMA 4FRDA 3SXGA 2VS4A 3RMVA 3GUEA 4FRQA 1H5RA 1H5TA 4FRAA 1G97A 1V82A 3OH2A 1QGQA 2OEGA 1TW5A 1S4OA 1H7LA 3DJ4A 1VZTA 4FRHA 1NKHB 3I0LA 5CMHA 4EVWA 4HO6A 4G3PA 1MC3A 1LZ0A 2VD4A 3ZF8A 2QGIA 1FGXA 4O6MA 3V0QA 2WAWA 3U2VA 3V0NA 5C3AA 4JD0A 4Y62A 3FWWA 2AESA 1R80A 3IOIA 3SX3A 1JVDA 3V0OA 5EIYA 1VM8A 2FYCB 4EEAA 2BO6A 1W57A 2Y4JA 4Y7VA 1E5KA 2PX7A 4EEMA 5CQOA 3ZGGA 5CMJA 1ZJ3A 1O7OA 1R7VA 1FO8A 4Y9XA 1GX0A 2ICYA 1IINA 3PNNA 3Q7UA 1XZ6A 1JYLA 4NAIA 4Y63A 1ZI3A 5L6SA 1G0RA 4R7PA 1R81A 4LW6A 4CVHA 4ECMA 2VXLA 3T7MA 4FREA 1NHEB 3ZLKA 3R3IA 3N9WA 1WT2A 4JISA 3U0YA 1G8OA 1ZCUA 2MZBA 2RJ0A 1G23A 4NALA 3USQA 4C2SA 2AM4A 4AYLA 3OH4A 1ZHJA 4ZDQA 5JQQA 5EJZA 1ZCVA 4B42A 1NMMB 4M28A 1H5SB 4G3SA 2APCA 5FTVA 1OQMB 5FTSA 4B3UA 2P73A 1VGWA 3HL3A 3TZTA 1O23B 4BMAA 3TQDA 3PKQA 4UEGA 4BQHA 5DDTA 5CMFX 4DECA 4IRPA 4KC2A 1EYRA 5IDSA 4FCEA 1ZI4A 2YQCA 1ZJ0A 4B4BA 1QWJA 1ZCTA 1ZI1A 1G9RA 2RIYA 2BO4A 1LZIA 2FFVA 3R2WA 1HV9A 5C1LA 5AJOA 3U2XA 1H4EA 1H7QA 3V90A 4IRQA 1R7XA 1O7QA 2WVLA 4Y6NA 1H5SC 3F1CA 3I0DA 2QH5A 4Y6UA 1ZDGA 5CMGX 1OMXA 3USRA 2I5KA 2J0AA 3BRKX 3FOQA 1ZCYA 2V0JA 2X65A 4ARWA 2O1HA 2YQHA 1TVYA 2Z87A 4AC3A 1YP3A 5IDTA 1ZJ2A 2D0JA 4XWIA 2I5EA 2O1GA 1FRWA 1O0RA 1ZJPA 3JUJA 3DK5A 2UX8A 3D5NA 4DE7A 4ASYA 5C3BA 4NAKA 5C48A 3V0PA 2RJ9A 5C8RA 1WSZA 2Y7AA 1MP3A 4J18A 4AYJA 4Y7UA 4KRVA 1ZI5A 3D8VA 2E8BA 2JCLA 2Y4LA 3V8YA 2OEFA 3JUKA 2WEEA 4KQLA 5D91A 3I0EA 2RJ4A 2GGOA 2RIXA 3LW6A 3O3PA 4HO3A 5AJNA 5CQPA 1S4PA 1JVGA 2PGVA 2GGQA 4FROA 3DUVA 1ZIZA 1FWYA 4EE5A 1R7UA 4MNDA 1FXJA 2FYAA 1ON8A 5C1HA 4KXOA 4KT7A 2FYBA 3ZLLA 1K4VA 4ASJA 4HO5A 4HO2A 2PA4A 2Y4KA 3ST8A 5L6VA 2WVKA 3I0FA 4HO0A 4G3QA 4EE3A 1INIA 3CKQA 4FRBA 1R7YA 1JV3A 3OH0A 2VS3A 4KPXA 2JCJA 3OGZA 3V8ZA 1HM9A 1GX4A 5C3DA 4FCUA 2AH9A 1YP2A 1H3MA 1LL3A 1HJJA 4D48A 1H7HA 3OC9A 2QKXA 4NANA 4HO4A 1H7EA 3I0GA 4KNXA 1G93A 2RJ6A 2WGZA 4B2WA 4EEGA 1WT3A 5IFYA 3QVBA 1NWGB 2X60A 1VICA 4DDZA 2XWLA 4FIXA 2VSHA 1FR9A 3OH1A 3E26A 2XMEA 1G95A 1VH3A 1H5RB 1H5TB 4FQWA 5EJ1A 5C4DA 2ZU8A 2ICXA 5C4EA 1HM8A 1IIMA 1TW1A 1W55A 4HOCA 2FYDB 1YP4A 1MP4A 3CGXA 3ZGFA 2WE9A 1G1LA 2X5SA 1FGGA 1MP5A 5J49A 1VZUA 4Q7CA 2XWMA 4D11C 5C1GA 2D7RA 2P6WA 3JTJA 2J0BA 1ZJ1A 1KWSA 1VZXA 2D7IA 4HO9A 1FOAA 3EE5A 4KPZA 5FU8A 4MIXA 2Y4MA 2YQSA 3I0HA 4O6NA 3SX7A 1VGTA 1H5SA 2AM5A 4AAWA 2Q4JA 3BCVA 5FU0A 4M2AA 3CU0A 3OAMA 1NQIB 3CKVA 2OI7A 3KIAA 3U2WA 3IOHA 4CJCA 4M4KA 2WVMA 3T7OA 5C4BA 2P72A 1INJA 2A8WA 2V0HA 2W0VA 1G3LA 2V0LA 2AGDA 2W0WA 4HO8A 2JCKA 1W77A 5FYEA 2RJ7A 1FG5N 4G87A 3SX8A 4HG6A 1QGSA 1H7FA 4P00A 5FUHA 4D0ZA 4EE4A 4Y64A 1R7TA 2RIZA 1LL0A 2ZU9A 2FY7A 3OH3A 1Z90A 1S4NA 3OKRA 1GWVA 3SXEA 1LZ7A 1H7GA 4CJ8A 4HCQA 3I0CA 1FR8A 4KC1A 2VS5A 2YC3A 4B5BA 2AM3A 1LVWA 2C0NA 2JCOA 4K6RA 3T7NA 5C49A 1ON6A 2VXMA 5C36A 3CKOA 2YESA 3V0MA 3F1YA 4KC4A 3K8EA 2XWNA 4Y7TA 2RJ8A 3IOJA 2XMHA 1QG8A 4B2XA 5BXCA 2V0KA 1WT1A 2A8UA 1HM0A
chains in the Genus database with same CATH topology
2BO7A 5C38A 3PKPA 5CMIA 1XHBA 1WVCA 2RJ1A 2Y6PA 4FIYA 4LW3A 1H5SD 2RITA 2VK9A 1FZWA 2O1FA 2VSIA 3D98A 1VPAA 4E1KA 1SS9A 1PZTA 1PZYB 4FRLA 4M2BA 4D0TA 2RJ5A 3SXAA 4FRPA 1H7TA 4P02A 2Z86A 5AJPA 5FV9A 2V0IA 2OI5A 3NGWA 4EEOA 3SXBA 1V84A 3I0JA 1FXOA 2FFUA 5CQMX 1V83A 5CQNX 3POLA 3V0LA 1VGZA 1LZJA 4B4GA 4Y7GA 2YQJA 1VH1A 1I52A 4YS8A 3I0IX 1JV1A 5C47A 3Q4SA 3CKNA 1LL2A 3V91A 3I0KA 3SX5A 4B4MA 3CKJA 5DDVA 2AECA 2E3DA 4GBPA 1HJLA 1JYKA 2DPWA 3U2TA 2PGYA 4MYBA 1H4CA 3K8DA 4Y7FA 3RSBA 1R82A 1GQCA 4D11A 1ZJOA 5C4CA 2I7BA 2NXVA 2X5ZA 5I1FA 1YROB 1G2VA 2YC5A 1ZDFA 4FRMA 1GQ9A 5C4FA 1EZIA 4CJBA 2OI6A 1GA8A 3RMWA 1H4DA 5D92A 4L41C 3U2UA 1NF5B 3E25A 5HS2A 3Q80A 1WT0A 1GWWA 1FO9A 1OMZA 2ZU7A 2VFZA 2BO8A 3U0XA 1VGUA 1TZFA 3SPTA 3SXDA 2AE7A 5CQLX 2CU2A 4KNRA 3SXCA 2YCMA 4FRDA 3SXGA 2VS4A 3RMVA 3GUEA 4FRQA 1H5RA 1H5TA 4FRAA 1G97A 1V82A 3OH2A 1QGQA 2OEGA 1TW5A 1S4OA 1H7LA 3DJ4A 1VZTA 4FRHA 1NKHB 3I0LA 5CMHA 4EVWA 4HO6A 4G3PA 1MC3A 1LZ0A 2VD4A 3ZF8A 2QGIA 1FGXA 4O6MA 3V0QA 2WAWA 3U2VA 3V0NA 5C3AA 4JD0A 4Y62A 3FWWA 2AESA 1R80A 3IOIA 3SX3A 1JVDA 3V0OA 5EIYA 1VM8A 2FYCB 4EEAA 2BO6A 1W57A 2Y4JA 4Y7VA 1E5KA 2PX7A 4EEMA 5CQOA 3ZGGA 5CMJA 1ZJ3A 1O7OA 1R7VA 1FO8A 4Y9XA 1GX0A 2ICYA 1IINA 3PNNA 3Q7UA 1XZ6A 1JYLA 4NAIA 4Y63A 1ZI3A 5L6SA 1G0RA 4R7PA 1R81A 4LW6A 4CVHA 4ECMA 2VXLA 3T7MA 4FREA 1NHEB 3ZLKA 3R3IA 3N9WA 1WT2A 4JISA 3U0YA 1G8OA 1ZCUA 2MZBA 2RJ0A 1G23A 4NALA 3USQA 4C2SA 2AM4A 4AYLA 3OH4A 1ZHJA 4ZDQA 5JQQA 5EJZA 1ZCVA 4B42A 1NMMB 4M28A 1H5SB 4G3SA 2APCA 5FTVA 1OQMB 5FTSA 4B3UA 2P73A 1VGWA 3HL3A 3TZTA 1O23B 4BMAA 3TQDA 3PKQA 4UEGA 4BQHA 5DDTA 5CMFX 4DECA 4IRPA 4KC2A 1EYRA 5IDSA 4FCEA 1ZI4A 2YQCA 1ZJ0A 4B4BA 1QWJA 1ZCTA 1ZI1A 1G9RA 2RIYA 2BO4A 1LZIA 2FFVA 3R2WA 1HV9A 5C1LA 5AJOA 3U2XA 1H4EA 1H7QA 3V90A 4IRQA 1R7XA 1O7QA 2WVLA 4Y6NA 1H5SC 3F1CA 3I0DA 2QH5A 4Y6UA 1ZDGA 5CMGX 1OMXA 3USRA 2I5KA 2J0AA 3BRKX 3FOQA 1ZCYA 2V0JA 2X65A 4ARWA 2O1HA 2YQHA 1TVYA 2Z87A 4AC3A 1YP3A 5IDTA 1ZJ2A 2D0JA 4XWIA 2I5EA 2O1GA 1FRWA 1O0RA 1ZJPA 3JUJA 3DK5A 2UX8A 3D5NA 4DE7A 4ASYA 5C3BA 4NAKA 5C48A 3V0PA 2RJ9A 5C8RA 1WSZA 2Y7AA 1MP3A 4J18A 4AYJA 4Y7UA 4KRVA 1ZI5A 3D8VA 2E8BA 2JCLA 2Y4LA 3V8YA 2OEFA 3JUKA 2WEEA 4KQLA 5D91A 3I0EA 2RJ4A 2GGOA 2RIXA 3LW6A 3O3PA 4HO3A 5AJNA 5CQPA 1S4PA 1JVGA 2PGVA 2GGQA 4FROA 3DUVA 1ZIZA 1FWYA 4EE5A 1R7UA 4MNDA 1FXJA 2FYAA 1ON8A 5C1HA 4KXOA 4KT7A 2FYBA 3ZLLA 1K4VA 4ASJA 4HO5A 4HO2A 2PA4A 2Y4KA 3ST8A 5L6VA 2WVKA 3I0FA 4HO0A 4G3QA 4EE3A 1INIA 3CKQA 4FRBA 1R7YA 1JV3A 3OH0A 2VS3A 4KPXA 2JCJA 3OGZA 3V8ZA 1HM9A 1GX4A 5C3DA 4FCUA 2AH9A 1YP2A 1H3MA 1LL3A 1HJJA 4D48A 1H7HA 3OC9A 2QKXA 4NANA 4HO4A 1H7EA 3I0GA 4KNXA 1G93A 2RJ6A 2WGZA 4B2WA 4EEGA 1WT3A 5IFYA 3QVBA 1NWGB 2X60A 1VICA 4DDZA 2XWLA 4FIXA 2VSHA 1FR9A 3OH1A 3E26A 2XMEA 1G95A 1VH3A 1H5RB 1H5TB 4FQWA 5EJ1A 5C4DA 2ZU8A 2ICXA 5C4EA 1HM8A 1IIMA 1TW1A 1W55A 4HOCA 2FYDB 1YP4A 1MP4A 3CGXA 3ZGFA 2WE9A 1G1LA 2X5SA 1FGGA 1MP5A 5J49A 1VZUA 4Q7CA 2XWMA 4D11C 5C1GA 2D7RA 2P6WA 3JTJA 2J0BA 1ZJ1A 1KWSA 1VZXA 2D7IA 4HO9A 1FOAA 3EE5A 4KPZA 5FU8A 4MIXA 2Y4MA 2YQSA 3I0HA 4O6NA 3SX7A 1VGTA 1H5SA 2AM5A 4AAWA 2Q4JA 3BCVA 5FU0A 4M2AA 3CU0A 3OAMA 1NQIB 3CKVA 2OI7A 3KIAA 3U2WA 3IOHA 4CJCA 4M4KA 2WVMA 3T7OA 5C4BA 2P72A 1INJA 2A8WA 2V0HA 2W0VA 1G3LA 2V0LA 2AGDA 2W0WA 4HO8A 2JCKA 1W77A 5FYEA 2RJ7A 1FG5N 4G87A 3SX8A 4HG6A 1QGSA 1H7FA 4P00A 5FUHA 4D0ZA 4EE4A 4Y64A 1R7TA 2RIZA 1LL0A 2ZU9A 2FY7A 3OH3A 1Z90A 1S4NA 3OKRA 1GWVA 3SXEA 1LZ7A 1H7GA 4CJ8A 4HCQA 3I0CA 1FR8A 4KC1A 2VS5A 2YC3A 4B5BA 2AM3A 1LVWA 2C0NA 2JCOA 4K6RA 3T7NA 5C49A 1ON6A 2VXMA 5C36A 3CKOA 2YESA 3V0MA 3F1YA 4KC4A 3K8EA 2XWNA 4Y7TA 2RJ8A 3IOJA 2XMHA 1QG8A 4B2XA 5BXCA 2V0KA 1WT1A 2A8UA 1HM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BO7 A;  5C38 A;  3PKP A;  5CMI A;  1XHB A;  1WVC A;  2RJ1 A;  2Y6P A;  4LW3 A;  1H5S D;  2RIT A;  1FZW A;  2O1F A;  2VSI A;  3D98 A;  1VPA A;  4E1K A;  1SS9 A;  1PZT A;  1PZY B;  4FRL A;  4M2B A;  4D0T A;  2RJ5 A;  3SXA A;  4FRP A;  1H7T A;  4P02 A;  2Z86 A;  5AJP A;  5FV9 A;  2V0I A;  2OI5 A;  3NGW A;  4EEO A;  3SXB A;  1V84 A;  3I0J A;  1FXO A;  2FFU A;  5CQM X;  1V83 A;  5CQN X;  3POL A;  3V0L A;  1VGZ A;  1LZJ A;  4B4G A;  4Y7G A;  2YQJ A;  1VH1 A;  1I52 A;  4YS8 A;  3I0I X;  1JV1 A;  5C47 A;  3Q4S A;  3CKN A;  1LL2 A;  3V91 A;  3I0K A;  3SX5 A;  4B4M A;  3CKJ A;  5DDV A;  2AEC A;  2E3D A;  4GBP A;  1HJL A;  1JYK A;  2DPW A;  3U2T A;  2PGY A;  4MYB A;  1H4C A;  3K8D A;  4Y7F A;  3RSB A;  1R82 A;  1GQC A;  4D11 A;  1ZJO A;  5C4C A;  2I7B A;  2NXV A;  2X5Z A;  5I1F A;  1YRO B;  1G2V A;  2YC5 A;  1ZDF A;  4FRM A;  1GQ9 A;  5C4F A;  1EZI A;  4CJB A;  2OI6 A;  1GA8 A;  3RMW A;  1H4D A;  4L41 C;  3U2U A;  1NF5 B;  3E25 A;  5HS2 A;  3Q80 A;  1WT0 A;  1GWW A;  1FO9 A;  1OMZ A;  2ZU7 A;  2VFZ A;  2BO8 A;  3U0X A;  1VGU A;  1TZF A;  3SPT A;  3SXD A;  2AE7 A;  5CQL X;  2CU2 A;  4KNR A;  3SXC A;  2YCM A;  4FRD A;  3SXG A;  2VS4 A;  3RMV A;  3GUE A;  4FRQ A;  1H5R A;  1H5T A;  4FRA A;  1G97 A;  1V82 A;  3OH2 A;  1QGQ A;  2OEG A;  1TW5 A;  1S4O A;  1H7L A;  3DJ4 A;  1VZT A;  4FRH A;  1NKH B;  3I0L A;  5CMH A;  4EVW A;  4HO6 A;  4G3P A;  1MC3 A;  1LZ0 A;  2VD4 A;  3ZF8 A;  2QGI A;  1FGX A;  3V0Q A;  2WAW A;  3U2V A;  3V0N A;  5C3A A;  4JD0 A;  4Y62 A;  3FWW A;  2AES A;  1R80 A;  3IOI A;  3SX3 A;  1JVD A;  3V0O A;  5EIY A;  1VM8 A;  2FYC B;  4EEA A;  2BO6 A;  1W57 A;  2Y4J A;  4Y7V A;  1E5K A;  2PX7 A;  4EEM A;  5CQO A;  3ZGG A;  5CMJ A;  1ZJ3 A;  1O7O A;  1R7V A;  1FO8 A;  4Y9X A;  1GX0 A;  2ICY A;  1IIN A;  3PNN A;  3Q7U A;  1XZ6 A;  1JYL A;  4NAI A;  4Y63 A;  1ZI3 A;  5L6S A;  1G0R A;  4R7P A;  1R81 A;  4LW6 A;  4CVH A;  4ECM A;  2VXL A;  3T7M A;  4FRE A;  1NHE B;  3ZLK A;  3R3I A;  3N9W A;  1WT2 A;  4JIS A;  3U0Y A;  1G8O A;  1ZCU A;  2MZB A;  2RJ0 A;  1G23 A;  4NAL A;  3USQ A;  4C2S A;  2AM4 A;  4AYL A;  3OH4 A;  1ZHJ A;  4ZDQ A;  5JQQ A;  5EJZ A;  1ZCV A;  4B42 A;  1NMM B;  4M28 A;  1H5S B;  4G3S A;  2APC A;  5FTV A;  1OQM B;  5FTS A;  4B3U A;  2P73 A;  1VGW A;  3HL3 A;  3TZT A;  1O23 B;  4BMA A;  3TQD A;  3PKQ A;  4UEG A;  4BQH A;  5DDT A;  5CMF X;  4DEC A;  4IRP A;  4KC2 A;  1EYR A;  5IDS A;  4FCE A;  1ZI4 A;  2YQC A;  1ZJ0 A;  4B4B A;  1QWJ A;  1ZCT A;  1ZI1 A;  1G9R A;  2RIY A;  2BO4 A;  1LZI A;  2FFV A;  3R2W A;  1HV9 A;  5C1L A;  5AJO A;  3U2X A;  1H4E A;  1H7Q A;  3V90 A;  4IRQ A;  1R7X A;  1O7Q A;  2WVL A;  4Y6N A;  1H5S C;  3F1C A;  3I0D A;  2QH5 A;  4Y6U A;  1ZDG A;  5CMG X;  1OMX A;  3USR A;  2I5K A;  3BRK X;  3FOQ A;  1ZCY A;  2V0J A;  2X65 A;  4ARW A;  2O1H A;  2YQH A;  1TVY A;  2Z87 A;  4AC3 A;  1YP3 A;  5IDT A;  1ZJ2 A;  2D0J A;  4XWI A;  2I5E A;  2O1G A;  1FRW A;  1O0R A;  1ZJP A;  3JUJ A;  3DK5 A;  2UX8 A;  3D5N A;  4DE7 A;  4ASY A;  5C3B A;  4NAK A;  5C48 A;  3V0P A;  2RJ9 A;  5C8R A;  1WSZ A;  2Y7A A;  1MP3 A;  4J18 A;  4AYJ A;  4Y7U A;  4KRV A;  1ZI5 A;  3D8V A;  2E8B A;  2JCL A;  2Y4L A;  3V8Y A;  2OEF A;  3JUK A;  2WEE A;  4KQL A;  3I0E A;  2RJ4 A;  2GGO A;  2RIX A;  3LW6 A;  3O3P A;  4HO3 A;  5AJN A;  5CQP A;  1S4P A;  1JVG A;  2PGV A;  2GGQ A;  4FRO A;  3DUV A;  1ZIZ A;  1FWY A;  4EE5 A;  1R7U A;  4MND A;  1FXJ A;  2FYA A;  1ON8 A;  5C1H A;  4KXO A;  4KT7 A;  2FYB A;  3ZLL A;  1K4V A;  4ASJ A;  4HO5 A;  4HO2 A;  2PA4 A;  2Y4K A;  3ST8 A;  5L6V A;  2WVK A;  3I0F A;  4HO0 A;  4G3Q A;  4EE3 A;  1INI A;  3CKQ A;  4FRB A;  1R7Y A;  1JV3 A;  3OH0 A;  2VS3 A;  4KPX A;  2JCJ A;  3OGZ A;  3V8Z A;  1HM9 A;  1GX4 A;  5C3D A;  4FCU A;  2AH9 A;  1YP2 A;  1H3M A;  1LL3 A;  1HJJ A;  4D48 A;  1H7H A;  3OC9 A;  2QKX A;  4NAN A;  4HO4 A;  1H7E A;  3I0G A;  4KNX A;  1G93 A;  2RJ6 A;  2WGZ A;  4B2W A;  4EEG A;  1WT3 A;  5IFY A;  3QVB A;  1NWG B;  2X60 A;  1VIC A;  4DDZ A;  2XWL A;  2VSH A;  1FR9 A;  3OH1 A;  3E26 A;  2XME A;  1G95 A;  1VH3 A;  1H5R B;  1H5T B;  4FQW A;  5EJ1 A;  5C4D A;  2ZU8 A;  2ICX A;  5C4E A;  1HM8 A;  1IIM A;  1TW1 A;  1W55 A;  4HOC A;  2FYD B;  1YP4 A;  1MP4 A;  3CGX A;  3ZGF A;  2WE9 A;  1G1L A;  2X5S A;  1FGG A;  1MP5 A;  5J49 A;  1VZU A;  2XWM A;  4D11 C;  5C1G A;  2D7R A;  2P6W A;  3JTJ A;  1ZJ1 A;  1KWS A;  1VZX A;  2D7I A;  4HO9 A;  1FOA A;  3EE5 A;  4KPZ A;  5FU8 A;  2Y4M A;  2YQS A;  3I0H A;  3SX7 A;  1VGT A;  1H5S A;  2AM5 A;  4AAW A;  2Q4J A;  3BCV A;  5FU0 A;  4M2A A;  3CU0 A;  3OAM A;  1NQI B;  3CKV A;  2OI7 A;  3KIA A;  3U2W A;  3IOH A;  4CJC A;  4M4K A;  2WVM A;  3T7O A;  5C4B A;  2P72 A;  1INJ A;  2A8W A;  2V0H A;  2W0V A;  1G3L A;  2V0L A;  2AGD A;  2W0W A;  4HO8 A;  2JCK A;  1W77 A;  5FYE A;  2RJ7 A;  1FG5 N;  4G87 A;  3SX8 A;  4HG6 A;  1QGS A;  1H7F A;  4P00 A;  5FUH A;  4D0Z A;  4EE4 A;  4Y64 A;  1R7T A;  2RIZ A;  1LL0 A;  2ZU9 A;  2FY7 A;  3OH3 A;  1Z90 A;  1S4N A;  3OKR A;  1GWV A;  3SXE A;  1LZ7 A;  1H7G A;  4CJ8 A;  4HCQ A;  3I0C A;  1FR8 A;  4KC1 A;  2VS5 A;  2YC3 A;  4B5B A;  2AM3 A;  1LVW A;  2JCO A;  4K6R A;  3T7N A;  5C49 A;  1ON6 A;  2VXM A;  5C36 A;  3CKO A;  2YES A;  3V0M A;  3F1Y A;  4KC4 A;  3K8E A;  2XWN A;  4Y7T A;  2RJ8 A;  3IOJ A;  2XMH A;  1QG8 A;  4B2X A;  5BXC A;  2V0K A;  1WT1 A;  2A8U A;  1HM0 A; 
#chains in the Genus database with same CATH topology
 2BO7 A;  5C38 A;  3PKP A;  5CMI A;  1XHB A;  1WVC A;  2RJ1 A;  2Y6P A;  4FIY A;  4LW3 A;  1H5S D;  2RIT A;  2VK9 A;  1FZW A;  2O1F A;  2VSI A;  3D98 A;  1VPA A;  4E1K A;  1SS9 A;  1PZT A;  1PZY B;  4FRL A;  4M2B A;  4D0T A;  2RJ5 A;  3SXA A;  4FRP A;  1H7T A;  4P02 A;  2Z86 A;  5AJP A;  5FV9 A;  2V0I A;  2OI5 A;  3NGW A;  4EEO A;  3SXB A;  1V84 A;  3I0J A;  1FXO A;  2FFU A;  5CQM X;  1V83 A;  5CQN X;  3POL A;  3V0L A;  1VGZ A;  1LZJ A;  4B4G A;  4Y7G A;  2YQJ A;  1VH1 A;  1I52 A;  4YS8 A;  3I0I X;  1JV1 A;  5C47 A;  3Q4S A;  3CKN A;  1LL2 A;  3V91 A;  3I0K A;  3SX5 A;  4B4M A;  3CKJ A;  5DDV A;  2AEC A;  2E3D A;  4GBP A;  1HJL A;  1JYK A;  2DPW A;  3U2T A;  2PGY A;  4MYB A;  1H4C A;  3K8D A;  4Y7F A;  3RSB A;  1R82 A;  1GQC A;  4D11 A;  1ZJO A;  5C4C A;  2I7B A;  2NXV A;  2X5Z A;  5I1F A;  1YRO B;  1G2V A;  2YC5 A;  1ZDF A;  4FRM A;  1GQ9 A;  5C4F A;  1EZI A;  4CJB A;  2OI6 A;  1GA8 A;  3RMW A;  1H4D A;  5D92 A;  4L41 C;  3U2U A;  1NF5 B;  3E25 A;  5HS2 A;  3Q80 A;  1WT0 A;  1GWW A;  1FO9 A;  1OMZ A;  2ZU7 A;  2VFZ A;  2BO8 A;  3U0X A;  1VGU A;  1TZF A;  3SPT A;  3SXD A;  2AE7 A;  5CQL X;  2CU2 A;  4KNR A;  3SXC A;  2YCM A;  4FRD A;  3SXG A;  2VS4 A;  3RMV A;  3GUE A;  4FRQ A;  1H5R A;  1H5T A;  4FRA A;  1G97 A;  1V82 A;  3OH2 A;  1QGQ A;  2OEG A;  1TW5 A;  1S4O A;  1H7L A;  3DJ4 A;  1VZT A;  4FRH A;  1NKH B;  3I0L A;  5CMH A;  4EVW A;  4HO6 A;  4G3P A;  1MC3 A;  1LZ0 A;  2VD4 A;  3ZF8 A;  2QGI A;  1FGX A;  4O6M A;  3V0Q A;  2WAW A;  3U2V A;  3V0N A;  5C3A A;  4JD0 A;  4Y62 A;  3FWW A;  2AES A;  1R80 A;  3IOI A;  3SX3 A;  1JVD A;  3V0O A;  5EIY A;  1VM8 A;  2FYC B;  4EEA A;  2BO6 A;  1W57 A;  2Y4J A;  4Y7V A;  1E5K A;  2PX7 A;  4EEM A;  5CQO A;  3ZGG A;  5CMJ A;  1ZJ3 A;  1O7O A;  1R7V A;  1FO8 A;  4Y9X A;  1GX0 A;  2ICY A;  1IIN A;  3PNN A;  3Q7U A;  1XZ6 A;  1JYL A;  4NAI A;  4Y63 A;  1ZI3 A;  5L6S A;  1G0R A;  4R7P A;  1R81 A;  4LW6 A;  4CVH A;  4ECM A;  2VXL A;  3T7M A;  4FRE A;  1NHE B;  3ZLK A;  3R3I A;  3N9W A;  1WT2 A;  4JIS A;  3U0Y A;  1G8O A;  1ZCU A;  2MZB A;  2RJ0 A;  1G23 A;  4NAL A;  3USQ A;  4C2S A;  2AM4 A;  4AYL A;  3OH4 A;  1ZHJ A;  4ZDQ A;  5JQQ A;  5EJZ A;  1ZCV A;  4B42 A;  1NMM B;  4M28 A;  1H5S B;  4G3S A;  2APC A;  5FTV A;  1OQM B;  5FTS A;  4B3U A;  2P73 A;  1VGW A;  3HL3 A;  3TZT A;  1O23 B;  4BMA A;  3TQD A;  3PKQ A;  4UEG A;  4BQH A;  5DDT A;  5CMF X;  4DEC A;  4IRP A;  4KC2 A;  1EYR A;  5IDS A;  4FCE A;  1ZI4 A;  2YQC A;  1ZJ0 A;  4B4B A;  1QWJ A;  1ZCT A;  1ZI1 A;  1G9R A;  2RIY A;  2BO4 A;  1LZI A;  2FFV A;  3R2W A;  1HV9 A;  5C1L A;  5AJO A;  3U2X A;  1H4E A;  1H7Q A;  3V90 A;  4IRQ A;  1R7X A;  1O7Q A;  2WVL A;  4Y6N A;  1H5S C;  3F1C A;  3I0D A;  2QH5 A;  4Y6U A;  1ZDG A;  5CMG X;  1OMX A;  3USR A;  2I5K A;  2J0A A;  3BRK X;  3FOQ A;  1ZCY A;  2V0J A;  2X65 A;  4ARW A;  2O1H A;  2YQH A;  1TVY A;  2Z87 A;  4AC3 A;  1YP3 A;  5IDT A;  1ZJ2 A;  2D0J A;  4XWI A;  2I5E A;  2O1G A;  1FRW A;  1O0R A;  1ZJP A;  3JUJ A;  3DK5 A;  2UX8 A;  3D5N A;  4DE7 A;  4ASY A;  5C3B A;  4NAK A;  5C48 A;  3V0P A;  2RJ9 A;  5C8R A;  1WSZ A;  2Y7A A;  1MP3 A;  4J18 A;  4AYJ A;  4Y7U A;  4KRV A;  1ZI5 A;  3D8V A;  2E8B A;  2JCL A;  2Y4L A;  3V8Y A;  2OEF A;  3JUK A;  2WEE A;  4KQL A;  5D91 A;  3I0E A;  2RJ4 A;  2GGO A;  2RIX A;  3LW6 A;  3O3P A;  4HO3 A;  5AJN A;  5CQP A;  1S4P A;  1JVG A;  2PGV A;  2GGQ A;  4FRO A;  3DUV A;  1ZIZ A;  1FWY A;  4EE5 A;  1R7U A;  4MND A;  1FXJ A;  2FYA A;  1ON8 A;  5C1H A;  4KXO A;  4KT7 A;  2FYB A;  3ZLL A;  1K4V A;  4ASJ A;  4HO5 A;  4HO2 A;  2PA4 A;  2Y4K A;  3ST8 A;  5L6V A;  2WVK A;  3I0F A;  4HO0 A;  4G3Q A;  4EE3 A;  1INI A;  3CKQ A;  4FRB A;  1R7Y A;  1JV3 A;  3OH0 A;  2VS3 A;  4KPX A;  2JCJ A;  3OGZ A;  3V8Z A;  1HM9 A;  1GX4 A;  5C3D A;  4FCU A;  2AH9 A;  1YP2 A;  1H3M A;  1LL3 A;  1HJJ A;  4D48 A;  1H7H A;  3OC9 A;  2QKX A;  4NAN A;  4HO4 A;  1H7E A;  3I0G A;  4KNX A;  1G93 A;  2RJ6 A;  2WGZ A;  4B2W A;  4EEG A;  1WT3 A;  5IFY A;  3QVB A;  1NWG B;  2X60 A;  1VIC A;  4DDZ A;  2XWL A;  4FIX A;  2VSH A;  1FR9 A;  3OH1 A;  3E26 A;  2XME A;  1G95 A;  1VH3 A;  1H5R B;  1H5T B;  4FQW A;  5EJ1 A;  5C4D A;  2ZU8 A;  2ICX A;  5C4E A;  1HM8 A;  1IIM A;  1TW1 A;  1W55 A;  4HOC A;  2FYD B;  1YP4 A;  1MP4 A;  3CGX A;  3ZGF A;  2WE9 A;  1G1L A;  2X5S A;  1FGG A;  1MP5 A;  5J49 A;  1VZU A;  4Q7C A;  2XWM A;  4D11 C;  5C1G A;  2D7R A;  2P6W A;  3JTJ A;  2J0B A;  1ZJ1 A;  1KWS A;  1VZX A;  2D7I A;  4HO9 A;  1FOA A;  3EE5 A;  4KPZ A;  5FU8 A;  4MIX A;  2Y4M A;  2YQS A;  3I0H A;  4O6N A;  3SX7 A;  1VGT A;  1H5S A;  2AM5 A;  4AAW A;  2Q4J A;  3BCV A;  5FU0 A;  4M2A A;  3CU0 A;  3OAM A;  1NQI B;  3CKV A;  2OI7 A;  3KIA A;  3U2W A;  3IOH A;  4CJC A;  4M4K A;  2WVM A;  3T7O A;  5C4B A;  2P72 A;  1INJ A;  2A8W A;  2V0H A;  2W0V A;  1G3L A;  2V0L A;  2AGD A;  2W0W A;  4HO8 A;  2JCK A;  1W77 A;  5FYE A;  2RJ7 A;  1FG5 N;  4G87 A;  3SX8 A;  4HG6 A;  1QGS A;  1H7F A;  4P00 A;  5FUH A;  4D0Z A;  4EE4 A;  4Y64 A;  1R7T A;  2RIZ A;  1LL0 A;  2ZU9 A;  2FY7 A;  3OH3 A;  1Z90 A;  1S4N A;  3OKR A;  1GWV A;  3SXE A;  1LZ7 A;  1H7G A;  4CJ8 A;  4HCQ A;  3I0C A;  1FR8 A;  4KC1 A;  2VS5 A;  2YC3 A;  4B5B A;  2AM3 A;  1LVW A;  2C0N A;  2JCO A;  4K6R A;  3T7N A;  5C49 A;  1ON6 A;  2VXM A;  5C36 A;  3CKO A;  2YES A;  3V0M A;  3F1Y A;  4KC4 A;  3K8E A;  2XWN A;  4Y7T A;  2RJ8 A;  3IOJ A;  2XMH A;  1QG8 A;  4B2X A;  5BXC A;  2V0K A;  1WT1 A;  2A8U A;  1HM0 A; 
#chains in the Genus database with same CATH homology
 2BO7 A;  5C38 A;  3PKP A;  5CMI A;  1XHB A;  1WVC A;  2RJ1 A;  2Y6P A;  4FIY A;  4LW3 A;  1H5S D;  2RIT A;  2VK9 A;  1FZW A;  2O1F A;  2VSI A;  3D98 A;  1VPA A;  4E1K A;  1SS9 A;  1PZT A;  1PZY B;  4FRL A;  4M2B A;  4D0T A;  2RJ5 A;  3SXA A;  4FRP A;  1H7T A;  4P02 A;  2Z86 A;  5AJP A;  5FV9 A;  2V0I A;  2OI5 A;  3NGW A;  4EEO A;  3SXB A;  1V84 A;  3I0J A;  1FXO A;  2FFU A;  5CQM X;  1V83 A;  5CQN X;  3POL A;  3V0L A;  1VGZ A;  1LZJ A;  4B4G A;  4Y7G A;  2YQJ A;  1VH1 A;  1I52 A;  4YS8 A;  3I0I X;  1JV1 A;  5C47 A;  3Q4S A;  3CKN A;  1LL2 A;  3V91 A;  3I0K A;  3SX5 A;  4B4M A;  3CKJ A;  5DDV A;  2AEC A;  2E3D A;  4GBP A;  1HJL A;  1JYK A;  2DPW A;  3U2T A;  2PGY A;  4MYB A;  1H4C A;  3K8D A;  4Y7F A;  3RSB A;  1R82 A;  1GQC A;  4D11 A;  1ZJO A;  5C4C A;  2I7B A;  2NXV A;  2X5Z A;  5I1F A;  1YRO B;  1G2V A;  2YC5 A;  1ZDF A;  4FRM A;  1GQ9 A;  5C4F A;  1EZI A;  4CJB A;  2OI6 A;  1GA8 A;  3RMW A;  1H4D A;  5D92 A;  4L41 C;  3U2U A;  1NF5 B;  3E25 A;  5HS2 A;  3Q80 A;  1WT0 A;  1GWW A;  1FO9 A;  1OMZ A;  2ZU7 A;  2VFZ A;  2BO8 A;  3U0X A;  1VGU A;  1TZF A;  3SPT A;  3SXD A;  2AE7 A;  5CQL X;  2CU2 A;  4KNR A;  3SXC A;  2YCM A;  4FRD A;  3SXG A;  2VS4 A;  3RMV A;  3GUE A;  4FRQ A;  1H5R A;  1H5T A;  4FRA A;  1G97 A;  1V82 A;  3OH2 A;  1QGQ A;  2OEG A;  1TW5 A;  1S4O A;  1H7L A;  3DJ4 A;  1VZT A;  4FRH A;  1NKH B;  3I0L A;  5CMH A;  4EVW A;  4HO6 A;  4G3P A;  1MC3 A;  1LZ0 A;  2VD4 A;  3ZF8 A;  2QGI A;  1FGX A;  4O6M A;  3V0Q A;  2WAW A;  3U2V A;  3V0N A;  5C3A A;  4JD0 A;  4Y62 A;  3FWW A;  2AES A;  1R80 A;  3IOI A;  3SX3 A;  1JVD A;  3V0O A;  5EIY A;  1VM8 A;  2FYC B;  4EEA A;  2BO6 A;  1W57 A;  2Y4J A;  4Y7V A;  1E5K A;  2PX7 A;  4EEM A;  5CQO A;  3ZGG A;  5CMJ A;  1ZJ3 A;  1O7O A;  1R7V A;  1FO8 A;  4Y9X A;  1GX0 A;  2ICY A;  1IIN A;  3PNN A;  3Q7U A;  1XZ6 A;  1JYL A;  4NAI A;  4Y63 A;  1ZI3 A;  5L6S A;  1G0R A;  4R7P A;  1R81 A;  4LW6 A;  4CVH A;  4ECM A;  2VXL A;  3T7M A;  4FRE A;  1NHE B;  3ZLK A;  3R3I A;  3N9W A;  1WT2 A;  4JIS A;  3U0Y A;  1G8O A;  1ZCU A;  2MZB A;  2RJ0 A;  1G23 A;  4NAL A;  3USQ A;  4C2S A;  2AM4 A;  4AYL A;  3OH4 A;  1ZHJ A;  4ZDQ A;  5JQQ A;  5EJZ A;  1ZCV A;  4B42 A;  1NMM B;  4M28 A;  1H5S B;  4G3S A;  2APC A;  5FTV A;  1OQM B;  5FTS A;  4B3U A;  2P73 A;  1VGW A;  3HL3 A;  3TZT A;  1O23 B;  4BMA A;  3TQD A;  3PKQ A;  4UEG A;  4BQH A;  5DDT A;  5CMF X;  4DEC A;  4IRP A;  4KC2 A;  1EYR A;  5IDS A;  4FCE A;  1ZI4 A;  2YQC A;  1ZJ0 A;  4B4B A;  1QWJ A;  1ZCT A;  1ZI1 A;  1G9R A;  2RIY A;  2BO4 A;  1LZI A;  2FFV A;  3R2W A;  1HV9 A;  5C1L A;  5AJO A;  3U2X A;  1H4E A;  1H7Q A;  3V90 A;  4IRQ A;  1R7X A;  1O7Q A;  2WVL A;  4Y6N A;  1H5S C;  3F1C A;  3I0D A;  2QH5 A;  4Y6U A;  1ZDG A;  5CMG X;  1OMX A;  3USR A;  2I5K A;  2J0A A;  3BRK X;  3FOQ A;  1ZCY A;  2V0J A;  2X65 A;  4ARW A;  2O1H A;  2YQH A;  1TVY A;  2Z87 A;  4AC3 A;  1YP3 A;  5IDT A;  1ZJ2 A;  2D0J A;  4XWI A;  2I5E A;  2O1G A;  1FRW A;  1O0R A;  1ZJP A;  3JUJ A;  3DK5 A;  2UX8 A;  3D5N A;  4DE7 A;  4ASY A;  5C3B A;  4NAK A;  5C48 A;  3V0P A;  2RJ9 A;  5C8R A;  1WSZ A;  2Y7A A;  1MP3 A;  4J18 A;  4AYJ A;  4Y7U A;  4KRV A;  1ZI5 A;  3D8V A;  2E8B A;  2JCL A;  2Y4L A;  3V8Y A;  2OEF A;  3JUK A;  2WEE A;  4KQL A;  5D91 A;  3I0E A;  2RJ4 A;  2GGO A;  2RIX A;  3LW6 A;  3O3P A;  4HO3 A;  5AJN A;  5CQP A;  1S4P A;  1JVG A;  2PGV A;  2GGQ A;  4FRO A;  3DUV A;  1ZIZ A;  1FWY A;  4EE5 A;  1R7U A;  4MND A;  1FXJ A;  2FYA A;  1ON8 A;  5C1H A;  4KXO A;  4KT7 A;  2FYB A;  3ZLL A;  1K4V A;  4ASJ A;  4HO5 A;  4HO2 A;  2PA4 A;  2Y4K A;  3ST8 A;  5L6V A;  2WVK A;  3I0F A;  4HO0 A;  4G3Q A;  4EE3 A;  1INI A;  3CKQ A;  4FRB A;  1R7Y A;  1JV3 A;  3OH0 A;  2VS3 A;  4KPX A;  2JCJ A;  3OGZ A;  3V8Z A;  1HM9 A;  1GX4 A;  5C3D A;  4FCU A;  2AH9 A;  1YP2 A;  1H3M A;  1LL3 A;  1HJJ A;  4D48 A;  1H7H A;  3OC9 A;  2QKX A;  4NAN A;  4HO4 A;  1H7E A;  3I0G A;  4KNX A;  1G93 A;  2RJ6 A;  2WGZ A;  4B2W A;  4EEG A;  1WT3 A;  5IFY A;  3QVB A;  1NWG B;  2X60 A;  1VIC A;  4DDZ A;  2XWL A;  4FIX A;  2VSH A;  1FR9 A;  3OH1 A;  3E26 A;  2XME A;  1G95 A;  1VH3 A;  1H5R B;  1H5T B;  4FQW A;  5EJ1 A;  5C4D A;  2ZU8 A;  2ICX A;  5C4E A;  1HM8 A;  1IIM A;  1TW1 A;  1W55 A;  4HOC A;  2FYD B;  1YP4 A;  1MP4 A;  3CGX A;  3ZGF A;  2WE9 A;  1G1L A;  2X5S A;  1FGG A;  1MP5 A;  5J49 A;  1VZU A;  4Q7C A;  2XWM A;  4D11 C;  5C1G A;  2D7R A;  2P6W A;  3JTJ A;  2J0B A;  1ZJ1 A;  1KWS A;  1VZX A;  2D7I A;  4HO9 A;  1FOA A;  3EE5 A;  4KPZ A;  5FU8 A;  4MIX A;  2Y4M A;  2YQS A;  3I0H A;  4O6N A;  3SX7 A;  1VGT A;  1H5S A;  2AM5 A;  4AAW A;  2Q4J A;  3BCV A;  5FU0 A;  4M2A A;  3CU0 A;  3OAM A;  1NQI B;  3CKV A;  2OI7 A;  3KIA A;  3U2W A;  3IOH A;  4CJC A;  4M4K A;  2WVM A;  3T7O A;  5C4B A;  2P72 A;  1INJ A;  2A8W A;  2V0H A;  2W0V A;  1G3L A;  2V0L A;  2AGD A;  2W0W A;  4HO8 A;  2JCK A;  1W77 A;  5FYE A;  2RJ7 A;  1FG5 N;  4G87 A;  3SX8 A;  4HG6 A;  1QGS A;  1H7F A;  4P00 A;  5FUH A;  4D0Z A;  4EE4 A;  4Y64 A;  1R7T A;  2RIZ A;  1LL0 A;  2ZU9 A;  2FY7 A;  3OH3 A;  1Z90 A;  1S4N A;  3OKR A;  1GWV A;  3SXE A;  1LZ7 A;  1H7G A;  4CJ8 A;  4HCQ A;  3I0C A;  1FR8 A;  4KC1 A;  2VS5 A;  2YC3 A;  4B5B A;  2AM3 A;  1LVW A;  2C0N A;  2JCO A;  4K6R A;  3T7N A;  5C49 A;  1ON6 A;  2VXM A;  5C36 A;  3CKO A;  2YES A;  3V0M A;  3F1Y A;  4KC4 A;  3K8E A;  2XWN A;  4Y7T A;  2RJ8 A;  3IOJ A;  2XMH A;  1QG8 A;  4B2X A;  5BXC A;  2V0K A;  1WT1 A;  2A8U A;  1HM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...