1S4NA

Crystal structure of yeast alpha1,2-mannosyltransferase kre2p/mnt1p
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
339
structure length
337
Chain Sequence
KTTMDYITPSFKAGKPKACYVTLVRNKELKGLLSSIKYVENKINKKFPYPWVFLNDEPFTEEFKEAVTKAVSSEVKFGILPKEHWSYPEWINQTKAAEIRADAATKYIYGGSESYRHMCRYQSGFFWRHELLEEYDWYWRVEPDIKLYCDINYDVFKWMQENEKVYGFTVSIHEYEVTIPTLWQTSMDFIKKNPEYLDENNLMSFLSNDNGKTYNLCHFWSNFEIANLNLWRSPAYREYFDTLDHQGGFFYERWGDAPVHSIAAALFLPKDKIHYFSDIGYHHPPYDNCPLDKEVYNSNNCECDQGNDFTFQGYSCGKEYYDAQGLVKPKNWKKFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycolipid 2-alpha-mannosyltransferase
publication title Structure of Kre2p/Mnt1p: A YEAST {alpha}1,2-MANNOSYLTRANSFERASE INVOLVED IN MANNOPROTEIN BIOSYNTHESIS
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 126
structure length 337
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.4.1.131: GDP-Man:Man(3)GlcNAc(2)-PP-dolichol alpha-1,2-mannosyltransferase.
pdb deposition date 2004-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1s4nA00
2AH9A 1PZTA 5BXCA 5I1FA 3SXEA 3I0CA 1MP3A 2ZU8A 4ASYA 2VS5A 4Y7TA 3FOQA 4KC1A 1NKHB 2V0LA 2YQCA 4FRDA 1IINA 3R3IA 4HO9A 2GGQA 1G23A 4EEGA 2OEGA 1S4OA 3SXCA 3RSBA 1H5SC 4HO3A 1G2VA 3RMVA 3JUKA 1LL3A 4D0TA 2CU2A 1TW5A 2P6WA 1ZJ0A 3SXBA 5FU0A 3I0FA 2A8WA 1VH1A 4NAIA 5L6VA 4HO8A 3EE5A 2BO7A 1KWSA 4NALA 3E25A 1LZ0A 4AAWA 2AGDA 1ON8A 4MYBA 2YC5A 2VXLA 1VGTA 2AECA 2ZU7A 5DDTA 1LZ7A 3CGXA 1FR9A 1ZCYA 4Y62A 3T7OA 2O1HA 3V8ZA 5CMGX 4KC2A 1ZDFA 4FRLA 1G97A 1H7FA 1HM8A 4KNXA 1TVYA 2RJ5A 1JV1A 1QG8A 2XWMA 1H7QA 3SX8A 3U2UA 4B2XA 2XMHA 3IOIA 1GQ9A 1EYRA 4CJ8A 5FTSA 1R81A 5FUHA 2AM3A 1ZJ3A 4JISA 3OH0A 1ZI4A 2Y4LA 4JD0A 1O7QA 3IOHA 2W0VA 3OH4A 2Y4JA 3D5NA 3E26A 4IRQA 5JQQA 3SXGA 3HL3A 1WSZA 3V0MA 4Y9XA 1JVGA 5EIYA 3U2TA 2PA4A 4MNDA 4AYLA 1TZFA 3I0IX 2OI6A 4HO6A 4Y7UA 2OEFA 4FREA 1NHEB 2RJ6A 1H4CA 4G3QA 1VM8A 4BQHA 1EZIA 3ZGFA 1MP5A 5CMIA 2WVMA 2E8BA 1INIA 5FTVA 5C1LA 2RIXA 1WT3A 2P73A 4HO0A 2YCMA 1FXOA 2VXMA 2APCA 1H5RA 3V0PA 1IIMA 5C1HA 1O7OA 4B4BA 4FRPA 3TQDA 2I5KA 2Y4KA 3SXDA 4KNRA 1VZUA 4Y64A 5CMJA 2BO8A 1GA8A 4FRHA 2PGVA 3I0KA 4NANA 2D7RA 1VICA 4EE5A 4DE7A 2FFVA 1G0RA 1H5SA 3OKRA 5EJ1A 1R7TA 3I0LA 3DJ4A 4M28A 2WE9A 3K8DA 4Y63A 3RMWA 1HJJA 4R7PA 3O3PA 3NGWA 4EE3A 5C3AA 2I5EA 3OH1A 2QGIA 1ZCTA 1MP4A 3Q4SA 2YQSA 2YQJA 2FFUA 5AJNA 3USQA 4B5BA 2D0JA 1NF5B 2VSIA 1ZI5A 4KT7A 1H7GA 1JYLA 3QVBA 4K6RA 3ZLLA 2JCOA 4G3SA 4IRPA 5C4FA 4HO5A 4Y7GA 1S4NA 1SS9A 1ZIZA 4KXOA 5CMFX 5AJOA 1GWVA 4M2AA 2RJ1A 2QKXA 2OI5A 2I7BA 4D11C 3BCVA 1WT0A 4B4GA 5C3DA 3Q80A 1QGSA 5C36A 1ZJ2A 4FRBA 4HG6A 2V0KA 2RJ0A 1ZCVA 1I52A 2Z87A 1NQIB 1OMZA 4NAKA 5C3BA 1ZHJA 1R7YA 3PKPA 1FGGA 1JV3A 5C4DA 1GWWA 3I0HA 1FOAA 1LZIA 2O1GA 4ASJA 1G95A 2Y6PA 5C47A 5C49A 2Y4MA 4EEMA 3U2VA 3SPTA 4C2SA 3TZTA 2RJ4A 1GX4A 4YS8A 1YP2A 2VS3A 4M4KA 3CKOA 3LW6A 5J49A 3OH3A 2E3DA 5AJPA 4UEGA 3U0XA 1VGWA 2FYDB 2PGYA 1WT1A 5HS2A 3SX3A 1R80A 1VGZA 3POLA 2VFZA 4HOCA 3F1YA 2FYCB 1G3LA 3PNNA 3R2WA 2V0HA 2VS4A 5FU8A 5IDSA 5C4BA 2AE7A 2WAWA 1H5TB 4GBPA 2XWNA 1ZJ1A 5CQNX 4HCQA 1H5TA 2O1FA 3I0JA 4FCUA 1YROB 1H5RB 5C38A 4EVWA 1R7UA 1ZJPA 1FR8A 2VD4A 3N9WA 4EE4A 3T7NA 3JUJA 2X65A 4D48A 1G93A 2GGOA 4G87A 4KPXA 1FRWA 5CQLX 4XWIA 5FV9A 3OC9A 2VSHA 1H5SB 2BO6A 3T7MA 1ZJOA 4EEAA 4CJBA 4Y6NA 4E1KA 1G1LA 3PKQA 4D11A 4FRAA 4FQWA 4J18A 1HV9A 4FRQA 1LL2A 1V83A 2V0IA 3CKJA 2PX7A 4BMAA 2XWLA 1YP4A 5CMHA 4CJCA 5C1GA 2OI7A 4B42A 1GX0A 1VPAA 4EEOA 1ZDGA 2AESA 1QGQA 2Z86A 3IOJA 4G3PA 4LW3A 1LL0A 4KRVA 4LW6A 2X5ZA 1TW1A 2MZBA 1INJA 4ARWA 3OH2A 2BO4A 4FROA 3V91A 1V84A 1HJLA 3D98A 3ZLKA 4M2BA 1YP3A 2FY7A 4FRMA 4Y7VA 3CKVA 2Q4JA 1H7LA 5CQOA 3SXAA 2W0WA 4ECMA 1NMMB 3U0YA 3D8VA 2AM5A 3V8YA 3ZGGA 1G9RA 2RITA 2XMEA 2JCJA 5FYEA 1W77A 1H7TA 2RIYA 3DK5A 1W55A 1PZYB 1R82A 1OQMB 1FO8A 3K8EA 3ST8A 4KPZA 4Y7FA 2DPWA 5L6SA 1NWGB 1HM9A 4L41C 4FCEA 2FYBA 4P00A 3I0GA 2RIZA 3V0OA 1H3MA 4CVHA 1HM0A 4B4MA 1WT2A 1QWJA 4HO2A 1FZWA 2JCKA 1H5SD 2QH5A 2FYAA 3JTJA 2A8UA 2RJ9A 2WEEA 2UX8A 1H7HA 2YC3A 2YESA 3CU0A 1O0RA 1VZTA 5C4EA 4P02A 5C4CA 1GQCA 1JVDA 2ZU9A 5IFYA 4B3UA 1H7EA 2ICYA 3F1CA 3Q7UA 1ZI1A 1G8OA 1S4PA 1ZI3A 1WVCA 2RJ8A 1MC3A 1LVWA 1XHBA 1FG5N 1FXJA 4AYJA 2WVLA 3I0DA 3CKQA 3CKNA 3GUEA 3OGZA 4KC4A 4KQLA 1FO9A 1ZCUA 5CQMX 3U2XA 3V0LA 1LZJA 5DDVA 3USRA 2WGZA 5C48A 1VZXA 4B2WA 3U2WA 2Y7AA 2YQHA 2RJ7A 3SX5A 4DDZA 3FWWA 2AM4A 1E5KA 4D0ZA 3V90A 4HO4A 1OMXA 3SX7A 1VGUA 1H4DA 4DECA 1W57A 3ZF8A 1O23B 2X60A 3KIAA 5IDTA 1R7XA 2JCLA 5CQPA 1R7VA 2V0JA 2D7IA 1V82A 3I0EA 5EJZA 1FWYA 4Y6UA 1Z90A 2WVKA 4ZDQA 1ON6A 3OAMA 2ICXA 3BRKX 2X5SA 2NXVA 4AC3A 1JYKA 5C8RA 3V0QA 3DUVA 3V0NA 1K4VA 2P72A 1XZ6A 1H4EA 1VH3A 1FGXA
chains in the Genus database with same CATH superfamily
4Q7CA 2AH9A 4MIXA 1PZTA 5BXCA 5I1FA 3SXEA 3I0CA 1MP3A 2ZU8A 4ASYA 2VS5A 4Y7TA 3FOQA 4KC1A 1NKHB 2V0LA 2YQCA 4FRDA 1IINA 3R3IA 4HO9A 2GGQA 1G23A 4EEGA 2OEGA 1S4OA 3SXCA 3RSBA 1H5SC 4HO3A 1G2VA 3RMVA 3JUKA 1LL3A 4D0TA 2CU2A 1TW5A 2P6WA 1ZJ0A 3SXBA 5FU0A 3I0FA 2A8WA 2J0BA 1VH1A 4NAIA 5L6VA 4HO8A 3EE5A 2BO7A 1KWSA 4NALA 3E25A 1LZ0A 4AAWA 2AGDA 1ON8A 4MYBA 2YC5A 2VXLA 1VGTA 2AECA 2ZU7A 5DDTA 1LZ7A 3CGXA 1FR9A 1ZCYA 4Y62A 3T7OA 2O1HA 3V8ZA 5CMGX 4KC2A 1ZDFA 4FRLA 1G97A 1H7FA 1HM8A 4KNXA 1TVYA 2RJ5A 1JV1A 1QG8A 2XWMA 1H7QA 3SX8A 3U2UA 4B2XA 2XMHA 3IOIA 1GQ9A 1EYRA 4CJ8A 5FTSA 1R81A 5FUHA 2AM3A 1ZJ3A 4JISA 3OH0A 1ZI4A 2Y4LA 4JD0A 1O7QA 3IOHA 2W0VA 3OH4A 2Y4JA 3D5NA 3E26A 4IRQA 5JQQA 3SXGA 5D92A 3HL3A 1WSZA 3V0MA 4Y9XA 1JVGA 5EIYA 3U2TA 2PA4A 4MNDA 4AYLA 1TZFA 3I0IX 2OI6A 4HO6A 4Y7UA 2OEFA 4FREA 1NHEB 2RJ6A 1H4CA 4G3QA 1VM8A 4BQHA 1EZIA 3ZGFA 1MP5A 5CMIA 2WVMA 2E8BA 1INIA 5FTVA 5C1LA 2RIXA 1WT3A 2P73A 2VK9A 4HO0A 2YCMA 1FXOA 2VXMA 2APCA 1H5RA 3V0PA 1IIMA 5C1HA 1O7OA 4B4BA 4O6MA 4FRPA 3TQDA 2I5KA 2Y4KA 4FIXA 3SXDA 4KNRA 1VZUA 4Y64A 5CMJA 2BO8A 1GA8A 4FRHA 2PGVA 3I0KA 4NANA 2D7RA 1VICA 4EE5A 4DE7A 2FFVA 1G0RA 1H5SA 3OKRA 5EJ1A 1R7TA 3I0LA 3DJ4A 4M28A 2WE9A 3K8DA 4Y63A 3RMWA 1HJJA 4R7PA 3O3PA 3NGWA 4EE3A 5C3AA 2I5EA 3OH1A 2QGIA 1ZCTA 1MP4A 3Q4SA 2YQSA 2YQJA 2FFUA 5AJNA 3USQA 4B5BA 2D0JA 1NF5B 2VSIA 1ZI5A 4KT7A 1H7GA 1JYLA 3QVBA 4K6RA 3ZLLA 2JCOA 4G3SA 4IRPA 5C4FA 4HO5A 4Y7GA 1S4NA 1SS9A 1ZIZA 4KXOA 5CMFX 5AJOA 1GWVA 4M2AA 2RJ1A 2QKXA 2OI5A 2I7BA 4D11C 3BCVA 1WT0A 4B4GA 5C3DA 3Q80A 1QGSA 5C36A 1ZJ2A 4FRBA 4HG6A 2V0KA 2RJ0A 1ZCVA 1I52A 2Z87A 1NQIB 1OMZA 4NAKA 5C3BA 1ZHJA 1R7YA 3PKPA 1FGGA 1JV3A 5C4DA 1GWWA 4O6NA 3I0HA 1FOAA 1LZIA 2O1GA 4ASJA 1G95A 2Y6PA 5C47A 5C49A 2Y4MA 4EEMA 3U2VA 3SPTA 4C2SA 3TZTA 2RJ4A 1GX4A 4YS8A 1YP2A 2VS3A 4M4KA 3CKOA 3LW6A 5J49A 3OH3A 2E3DA 5AJPA 4UEGA 3U0XA 1VGWA 2FYDB 2PGYA 1WT1A 5HS2A 3SX3A 1R80A 1VGZA 3POLA 2VFZA 4HOCA 3F1YA 2FYCB 1G3LA 3PNNA 3R2WA 2V0HA 2VS4A 5FU8A 5IDSA 5C4BA 2AE7A 2WAWA 1H5TB 4GBPA 2XWNA 1ZJ1A 5CQNX 4HCQA 1H5TA 2O1FA 3I0JA 4FCUA 1YROB 1H5RB 5C38A 4EVWA 1R7UA 1ZJPA 1FR8A 2VD4A 3N9WA 4EE4A 3T7NA 3JUJA 2X65A 4D48A 1G93A 2GGOA 4G87A 4KPXA 1FRWA 5CQLX 4XWIA 5FV9A 3OC9A 2VSHA 1H5SB 2BO6A 3T7MA 1ZJOA 4EEAA 4CJBA 4Y6NA 4E1KA 1G1LA 3PKQA 4D11A 4FRAA 4FQWA 4J18A 1HV9A 4FRQA 1LL2A 1V83A 2V0IA 3CKJA 2PX7A 4BMAA 2XWLA 1YP4A 5CMHA 4CJCA 5C1GA 2OI7A 4B42A 1GX0A 1VPAA 4EEOA 1ZDGA 2AESA 1QGQA 2Z86A 3IOJA 4G3PA 4LW3A 1LL0A 4KRVA 4LW6A 2X5ZA 1TW1A 2MZBA 1INJA 4ARWA 3OH2A 2BO4A 4FROA 3V91A 1V84A 1HJLA 3D98A 3ZLKA 4M2BA 1YP3A 2FY7A 4FRMA 4Y7VA 3CKVA 2Q4JA 1H7LA 5CQOA 3SXAA 2W0WA 4ECMA 1NMMB 3U0YA 3D8VA 2AM5A 3V8YA 3ZGGA 1G9RA 2RITA 2XMEA 2JCJA 5FYEA 1W77A 1H7TA 2RIYA 3DK5A 1W55A 1PZYB 1R82A 1OQMB 1FO8A 3K8EA 3ST8A 4KPZA 4Y7FA 2DPWA 5L6SA 1NWGB 1HM9A 4L41C 4FCEA 2FYBA 4P00A 3I0GA 2RIZA 3V0OA 1H3MA 4CVHA 1HM0A 4B4MA 1WT2A 1QWJA 4HO2A 1FZWA 2JCKA 1H5SD 2QH5A 2FYAA 3JTJA 2A8UA 2RJ9A 2WEEA 2UX8A 1H7HA 2YC3A 2YESA 3CU0A 1O0RA 1VZTA 5C4EA 4P02A 5C4CA 1GQCA 1JVDA 2ZU9A 2C0NA 5IFYA 4B3UA 1H7EA 2ICYA 3F1CA 3Q7UA 1ZI1A 1G8OA 1S4PA 1ZI3A 1WVCA 2RJ8A 1MC3A 2J0AA 1LVWA 1XHBA 1FG5N 1FXJA 5D91A 4AYJA 2WVLA 3I0DA 4FIYA 3CKQA 3CKNA 3GUEA 3OGZA 4KC4A 4KQLA 1FO9A 1ZCUA 5CQMX 3U2XA 3V0LA 1LZJA 5DDVA 3USRA 2WGZA 5C48A 1VZXA 4B2WA 3U2WA 2Y7AA 2YQHA 2RJ7A 3SX5A 4DDZA 3FWWA 2AM4A 1E5KA 4D0ZA 3V90A 4HO4A 1OMXA 3SX7A 1VGUA 1H4DA 4DECA 1W57A 3ZF8A 1O23B 2X60A 3KIAA 5IDTA 1R7XA 2JCLA 5CQPA 1R7VA 2V0JA 2D7IA 1V82A 3I0EA 5EJZA 1FWYA 4Y6UA 1Z90A 2WVKA 4ZDQA 1ON6A 3OAMA 2ICXA 3BRKX 2X5SA 2NXVA 4AC3A 1JYKA 5C8RA 3V0QA 3DUVA 3V0NA 1K4VA 2P72A 1XZ6A 1H4EA 1VH3A 1FGXA
chains in the Genus database with same CATH topology
4Q7CA 2AH9A 4MIXA 1PZTA 5BXCA 5I1FA 3SXEA 3I0CA 1MP3A 2ZU8A 4ASYA 2VS5A 4Y7TA 3FOQA 4KC1A 1NKHB 2V0LA 2YQCA 4FRDA 1IINA 3R3IA 4HO9A 2GGQA 1G23A 4EEGA 2OEGA 1S4OA 3SXCA 3RSBA 1H5SC 4HO3A 1G2VA 3RMVA 3JUKA 1LL3A 4D0TA 2CU2A 1TW5A 2P6WA 1ZJ0A 3SXBA 5FU0A 3I0FA 2A8WA 2J0BA 1VH1A 4NAIA 5L6VA 4HO8A 3EE5A 2BO7A 1KWSA 4NALA 3E25A 1LZ0A 4AAWA 2AGDA 1ON8A 4MYBA 2YC5A 2VXLA 1VGTA 2AECA 2ZU7A 5DDTA 1LZ7A 3CGXA 1FR9A 1ZCYA 4Y62A 3T7OA 2O1HA 3V8ZA 5CMGX 4KC2A 1ZDFA 4FRLA 1G97A 1H7FA 1HM8A 4KNXA 1TVYA 2RJ5A 1JV1A 1QG8A 2XWMA 1H7QA 3SX8A 3U2UA 4B2XA 2XMHA 3IOIA 1GQ9A 1EYRA 4CJ8A 5FTSA 1R81A 5FUHA 2AM3A 1ZJ3A 4JISA 3OH0A 1ZI4A 2Y4LA 4JD0A 1O7QA 3IOHA 2W0VA 3OH4A 2Y4JA 3D5NA 3E26A 4IRQA 5JQQA 3SXGA 5D92A 3HL3A 1WSZA 3V0MA 4Y9XA 1JVGA 5EIYA 3U2TA 2PA4A 4MNDA 4AYLA 1TZFA 3I0IX 2OI6A 4HO6A 4Y7UA 2OEFA 4FREA 1NHEB 2RJ6A 1H4CA 4G3QA 1VM8A 4BQHA 1EZIA 3ZGFA 1MP5A 5CMIA 2WVMA 2E8BA 1INIA 5FTVA 5C1LA 2RIXA 1WT3A 2P73A 2VK9A 4HO0A 2YCMA 1FXOA 2VXMA 2APCA 1H5RA 3V0PA 1IIMA 5C1HA 1O7OA 4B4BA 4O6MA 4FRPA 3TQDA 2I5KA 2Y4KA 4FIXA 3SXDA 4KNRA 1VZUA 4Y64A 5CMJA 2BO8A 1GA8A 4FRHA 2PGVA 3I0KA 4NANA 2D7RA 1VICA 4EE5A 4DE7A 2FFVA 1G0RA 1H5SA 3OKRA 5EJ1A 1R7TA 3I0LA 3DJ4A 4M28A 2WE9A 3K8DA 4Y63A 3RMWA 1HJJA 4R7PA 3O3PA 3NGWA 4EE3A 5C3AA 2I5EA 3OH1A 2QGIA 1ZCTA 1MP4A 3Q4SA 2YQSA 2YQJA 2FFUA 5AJNA 3USQA 4B5BA 2D0JA 1NF5B 2VSIA 1ZI5A 4KT7A 1H7GA 1JYLA 3QVBA 4K6RA 3ZLLA 2JCOA 4G3SA 4IRPA 5C4FA 4HO5A 4Y7GA 1S4NA 1SS9A 1ZIZA 4KXOA 5CMFX 5AJOA 1GWVA 4M2AA 2RJ1A 2QKXA 2OI5A 2I7BA 4D11C 3BCVA 1WT0A 4B4GA 5C3DA 3Q80A 1QGSA 5C36A 1ZJ2A 4FRBA 4HG6A 2V0KA 2RJ0A 1ZCVA 1I52A 2Z87A 1NQIB 1OMZA 4NAKA 5C3BA 1ZHJA 1R7YA 3PKPA 1FGGA 1JV3A 5C4DA 1GWWA 4O6NA 3I0HA 1FOAA 1LZIA 2O1GA 4ASJA 1G95A 2Y6PA 5C47A 5C49A 2Y4MA 4EEMA 3U2VA 3SPTA 4C2SA 3TZTA 2RJ4A 1GX4A 4YS8A 1YP2A 2VS3A 4M4KA 3CKOA 3LW6A 5J49A 3OH3A 2E3DA 5AJPA 4UEGA 3U0XA 1VGWA 2FYDB 2PGYA 1WT1A 5HS2A 3SX3A 1R80A 1VGZA 3POLA 2VFZA 4HOCA 3F1YA 2FYCB 1G3LA 3PNNA 3R2WA 2V0HA 2VS4A 5FU8A 5IDSA 5C4BA 2AE7A 2WAWA 1H5TB 4GBPA 2XWNA 1ZJ1A 5CQNX 4HCQA 1H5TA 2O1FA 3I0JA 4FCUA 1YROB 1H5RB 5C38A 4EVWA 1R7UA 1ZJPA 1FR8A 2VD4A 3N9WA 4EE4A 3T7NA 3JUJA 2X65A 4D48A 1G93A 2GGOA 4G87A 4KPXA 1FRWA 5CQLX 4XWIA 5FV9A 3OC9A 2VSHA 1H5SB 2BO6A 3T7MA 1ZJOA 4EEAA 4CJBA 4Y6NA 4E1KA 1G1LA 3PKQA 4D11A 4FRAA 4FQWA 4J18A 1HV9A 4FRQA 1LL2A 1V83A 2V0IA 3CKJA 2PX7A 4BMAA 2XWLA 1YP4A 5CMHA 4CJCA 5C1GA 2OI7A 4B42A 1GX0A 1VPAA 4EEOA 1ZDGA 2AESA 1QGQA 2Z86A 3IOJA 4G3PA 4LW3A 1LL0A 4KRVA 4LW6A 2X5ZA 1TW1A 2MZBA 1INJA 4ARWA 3OH2A 2BO4A 4FROA 3V91A 1V84A 1HJLA 3D98A 3ZLKA 4M2BA 1YP3A 2FY7A 4FRMA 4Y7VA 3CKVA 2Q4JA 1H7LA 5CQOA 3SXAA 2W0WA 4ECMA 1NMMB 3U0YA 3D8VA 2AM5A 3V8YA 3ZGGA 1G9RA 2RITA 2XMEA 2JCJA 5FYEA 1W77A 1H7TA 2RIYA 3DK5A 1W55A 1PZYB 1R82A 1OQMB 1FO8A 3K8EA 3ST8A 4KPZA 4Y7FA 2DPWA 5L6SA 1NWGB 1HM9A 4L41C 4FCEA 2FYBA 4P00A 3I0GA 2RIZA 3V0OA 1H3MA 4CVHA 1HM0A 4B4MA 1WT2A 1QWJA 4HO2A 1FZWA 2JCKA 1H5SD 2QH5A 2FYAA 3JTJA 2A8UA 2RJ9A 2WEEA 2UX8A 1H7HA 2YC3A 2YESA 3CU0A 1O0RA 1VZTA 5C4EA 4P02A 5C4CA 1GQCA 1JVDA 2ZU9A 2C0NA 5IFYA 4B3UA 1H7EA 2ICYA 3F1CA 3Q7UA 1ZI1A 1G8OA 1S4PA 1ZI3A 1WVCA 2RJ8A 1MC3A 2J0AA 1LVWA 1XHBA 1FG5N 1FXJA 5D91A 4AYJA 2WVLA 3I0DA 4FIYA 3CKQA 3CKNA 3GUEA 3OGZA 4KC4A 4KQLA 1FO9A 1ZCUA 5CQMX 3U2XA 3V0LA 1LZJA 5DDVA 3USRA 2WGZA 5C48A 1VZXA 4B2WA 3U2WA 2Y7AA 2YQHA 2RJ7A 3SX5A 4DDZA 3FWWA 2AM4A 1E5KA 4D0ZA 3V90A 4HO4A 1OMXA 3SX7A 1VGUA 1H4DA 4DECA 1W57A 3ZF8A 1O23B 2X60A 3KIAA 5IDTA 1R7XA 2JCLA 5CQPA 1R7VA 2V0JA 2D7IA 1V82A 3I0EA 5EJZA 1FWYA 4Y6UA 1Z90A 2WVKA 4ZDQA 1ON6A 3OAMA 2ICXA 3BRKX 2X5SA 2NXVA 4AC3A 1JYKA 5C8RA 3V0QA 3DUVA 3V0NA 1K4VA 2P72A 1XZ6A 1H4EA 1VH3A 1FGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AH9 A;  1PZT A;  5BXC A;  5I1F A;  3SXE A;  3I0C A;  1MP3 A;  2ZU8 A;  4ASY A;  2VS5 A;  4Y7T A;  3FOQ A;  4KC1 A;  1NKH B;  2V0L A;  2YQC A;  4FRD A;  1IIN A;  3R3I A;  4HO9 A;  2GGQ A;  1G23 A;  4EEG A;  2OEG A;  1S4O A;  3SXC A;  3RSB A;  1H5S C;  4HO3 A;  1G2V A;  3RMV A;  3JUK A;  1LL3 A;  4D0T A;  2CU2 A;  1TW5 A;  2P6W A;  1ZJ0 A;  3SXB A;  5FU0 A;  3I0F A;  2A8W A;  1VH1 A;  4NAI A;  5L6V A;  4HO8 A;  3EE5 A;  2BO7 A;  1KWS A;  4NAL A;  3E25 A;  1LZ0 A;  4AAW A;  2AGD A;  1ON8 A;  4MYB A;  2YC5 A;  2VXL A;  1VGT A;  2AEC A;  2ZU7 A;  5DDT A;  1LZ7 A;  3CGX A;  1FR9 A;  1ZCY A;  4Y62 A;  3T7O A;  2O1H A;  3V8Z A;  5CMG X;  4KC2 A;  1ZDF A;  4FRL A;  1G97 A;  1H7F A;  1HM8 A;  4KNX A;  1TVY A;  2RJ5 A;  1JV1 A;  1QG8 A;  2XWM A;  1H7Q A;  3SX8 A;  3U2U A;  4B2X A;  2XMH A;  3IOI A;  1GQ9 A;  1EYR A;  4CJ8 A;  5FTS A;  1R81 A;  5FUH A;  2AM3 A;  1ZJ3 A;  4JIS A;  3OH0 A;  1ZI4 A;  2Y4L A;  4JD0 A;  1O7Q A;  3IOH A;  2W0V A;  3OH4 A;  2Y4J A;  3D5N A;  3E26 A;  4IRQ A;  5JQQ A;  3SXG A;  3HL3 A;  1WSZ A;  3V0M A;  4Y9X A;  1JVG A;  5EIY A;  3U2T A;  2PA4 A;  4MND A;  4AYL A;  1TZF A;  3I0I X;  2OI6 A;  4HO6 A;  4Y7U A;  2OEF A;  4FRE A;  1NHE B;  2RJ6 A;  1H4C A;  4G3Q A;  1VM8 A;  4BQH A;  1EZI A;  3ZGF A;  1MP5 A;  5CMI A;  2WVM A;  2E8B A;  1INI A;  5FTV A;  5C1L A;  2RIX A;  1WT3 A;  2P73 A;  4HO0 A;  2YCM A;  1FXO A;  2VXM A;  2APC A;  1H5R A;  3V0P A;  1IIM A;  5C1H A;  1O7O A;  4B4B A;  4FRP A;  3TQD A;  2I5K A;  2Y4K A;  3SXD A;  4KNR A;  1VZU A;  4Y64 A;  5CMJ A;  2BO8 A;  1GA8 A;  4FRH A;  2PGV A;  3I0K A;  4NAN A;  2D7R A;  1VIC A;  4EE5 A;  4DE7 A;  2FFV A;  1G0R A;  1H5S A;  3OKR A;  5EJ1 A;  1R7T A;  3I0L A;  3DJ4 A;  4M28 A;  2WE9 A;  3K8D A;  4Y63 A;  3RMW A;  1HJJ A;  4R7P A;  3O3P A;  3NGW A;  4EE3 A;  5C3A A;  2I5E A;  3OH1 A;  2QGI A;  1ZCT A;  1MP4 A;  3Q4S A;  2YQS A;  2YQJ A;  2FFU A;  5AJN A;  3USQ A;  4B5B A;  2D0J A;  1NF5 B;  2VSI A;  1ZI5 A;  4KT7 A;  1H7G A;  1JYL A;  3QVB A;  4K6R A;  3ZLL A;  2JCO A;  4G3S A;  4IRP A;  5C4F A;  4HO5 A;  4Y7G A;  1S4N A;  1SS9 A;  1ZIZ A;  4KXO A;  5CMF X;  5AJO A;  1GWV A;  4M2A A;  2RJ1 A;  2QKX A;  2OI5 A;  2I7B A;  4D11 C;  3BCV A;  1WT0 A;  4B4G A;  5C3D A;  3Q80 A;  1QGS A;  5C36 A;  1ZJ2 A;  4FRB A;  4HG6 A;  2V0K A;  2RJ0 A;  1ZCV A;  1I52 A;  2Z87 A;  1NQI B;  1OMZ A;  4NAK A;  5C3B A;  1ZHJ A;  1R7Y A;  3PKP A;  1FGG A;  1JV3 A;  5C4D A;  1GWW A;  3I0H A;  1FOA A;  1LZI A;  2O1G A;  4ASJ A;  1G95 A;  2Y6P A;  5C47 A;  5C49 A;  2Y4M A;  4EEM A;  3U2V A;  3SPT A;  4C2S A;  3TZT A;  2RJ4 A;  1GX4 A;  4YS8 A;  1YP2 A;  2VS3 A;  4M4K A;  3CKO A;  3LW6 A;  5J49 A;  3OH3 A;  2E3D A;  5AJP A;  4UEG A;  3U0X A;  1VGW A;  2FYD B;  2PGY A;  1WT1 A;  5HS2 A;  3SX3 A;  1R80 A;  1VGZ A;  3POL A;  2VFZ A;  4HOC A;  3F1Y A;  2FYC B;  1G3L A;  3PNN A;  3R2W A;  2V0H A;  2VS4 A;  5FU8 A;  5IDS A;  5C4B A;  2AE7 A;  2WAW A;  1H5T B;  4GBP A;  2XWN A;  1ZJ1 A;  5CQN X;  4HCQ A;  1H5T A;  2O1F A;  3I0J A;  4FCU A;  1YRO B;  1H5R B;  5C38 A;  4EVW A;  1R7U A;  1ZJP A;  1FR8 A;  2VD4 A;  3N9W A;  4EE4 A;  3T7N A;  3JUJ A;  2X65 A;  4D48 A;  1G93 A;  2GGO A;  4G87 A;  4KPX A;  1FRW A;  5CQL X;  4XWI A;  5FV9 A;  3OC9 A;  2VSH A;  1H5S B;  2BO6 A;  3T7M A;  1ZJO A;  4EEA A;  4CJB A;  4Y6N A;  4E1K A;  1G1L A;  3PKQ A;  4D11 A;  4FRA A;  4FQW A;  4J18 A;  1HV9 A;  4FRQ A;  1LL2 A;  1V83 A;  2V0I A;  3CKJ A;  2PX7 A;  4BMA A;  2XWL A;  1YP4 A;  5CMH A;  4CJC A;  5C1G A;  2OI7 A;  4B42 A;  1GX0 A;  1VPA A;  4EEO A;  1ZDG A;  2AES A;  1QGQ A;  2Z86 A;  3IOJ A;  4G3P A;  4LW3 A;  1LL0 A;  4KRV A;  4LW6 A;  2X5Z A;  1TW1 A;  2MZB A;  1INJ A;  4ARW A;  3OH2 A;  2BO4 A;  4FRO A;  3V91 A;  1V84 A;  1HJL A;  3D98 A;  3ZLK A;  4M2B A;  1YP3 A;  2FY7 A;  4FRM A;  4Y7V A;  3CKV A;  2Q4J A;  1H7L A;  5CQO A;  3SXA A;  2W0W A;  4ECM A;  1NMM B;  3U0Y A;  3D8V A;  2AM5 A;  3V8Y A;  3ZGG A;  1G9R A;  2RIT A;  2XME A;  2JCJ A;  5FYE A;  1W77 A;  1H7T A;  2RIY A;  3DK5 A;  1W55 A;  1PZY B;  1R82 A;  1OQM B;  1FO8 A;  3K8E A;  3ST8 A;  4KPZ A;  4Y7F A;  2DPW A;  5L6S A;  1NWG B;  1HM9 A;  4L41 C;  4FCE A;  2FYB A;  4P00 A;  3I0G A;  2RIZ A;  3V0O A;  1H3M A;  4CVH A;  1HM0 A;  4B4M A;  1WT2 A;  1QWJ A;  4HO2 A;  1FZW A;  2JCK A;  1H5S D;  2QH5 A;  2FYA A;  3JTJ A;  2A8U A;  2RJ9 A;  2WEE A;  2UX8 A;  1H7H A;  2YC3 A;  2YES A;  3CU0 A;  1O0R A;  1VZT A;  5C4E A;  4P02 A;  5C4C A;  1GQC A;  1JVD A;  2ZU9 A;  5IFY A;  4B3U A;  1H7E A;  2ICY A;  3F1C A;  3Q7U A;  1ZI1 A;  1G8O A;  1S4P A;  1ZI3 A;  1WVC A;  2RJ8 A;  1MC3 A;  1LVW A;  1XHB A;  1FG5 N;  1FXJ A;  4AYJ A;  2WVL A;  3I0D A;  3CKQ A;  3CKN A;  3GUE A;  3OGZ A;  4KC4 A;  4KQL A;  1FO9 A;  1ZCU A;  5CQM X;  3U2X A;  3V0L A;  1LZJ A;  5DDV A;  3USR A;  2WGZ A;  5C48 A;  1VZX A;  4B2W A;  3U2W A;  2Y7A A;  2YQH A;  2RJ7 A;  3SX5 A;  4DDZ A;  3FWW A;  2AM4 A;  1E5K A;  4D0Z A;  3V90 A;  4HO4 A;  1OMX A;  3SX7 A;  1VGU A;  1H4D A;  4DEC A;  1W57 A;  3ZF8 A;  1O23 B;  2X60 A;  3KIA A;  5IDT A;  1R7X A;  2JCL A;  5CQP A;  1R7V A;  2V0J A;  2D7I A;  1V82 A;  3I0E A;  5EJZ A;  1FWY A;  4Y6U A;  1Z90 A;  2WVK A;  4ZDQ A;  1ON6 A;  3OAM A;  2ICX A;  3BRK X;  2X5S A;  2NXV A;  4AC3 A;  1JYK A;  5C8R A;  3V0Q A;  3DUV A;  3V0N A;  1K4V A;  2P72 A;  1XZ6 A;  1H4E A;  1VH3 A;  1FGX A; 
#chains in the Genus database with same CATH topology
 4Q7C A;  2AH9 A;  4MIX A;  1PZT A;  5BXC A;  5I1F A;  3SXE A;  3I0C A;  1MP3 A;  2ZU8 A;  4ASY A;  2VS5 A;  4Y7T A;  3FOQ A;  4KC1 A;  1NKH B;  2V0L A;  2YQC A;  4FRD A;  1IIN A;  3R3I A;  4HO9 A;  2GGQ A;  1G23 A;  4EEG A;  2OEG A;  1S4O A;  3SXC A;  3RSB A;  1H5S C;  4HO3 A;  1G2V A;  3RMV A;  3JUK A;  1LL3 A;  4D0T A;  2CU2 A;  1TW5 A;  2P6W A;  1ZJ0 A;  3SXB A;  5FU0 A;  3I0F A;  2A8W A;  2J0B A;  1VH1 A;  4NAI A;  5L6V A;  4HO8 A;  3EE5 A;  2BO7 A;  1KWS A;  4NAL A;  3E25 A;  1LZ0 A;  4AAW A;  2AGD A;  1ON8 A;  4MYB A;  2YC5 A;  2VXL A;  1VGT A;  2AEC A;  2ZU7 A;  5DDT A;  1LZ7 A;  3CGX A;  1FR9 A;  1ZCY A;  4Y62 A;  3T7O A;  2O1H A;  3V8Z A;  5CMG X;  4KC2 A;  1ZDF A;  4FRL A;  1G97 A;  1H7F A;  1HM8 A;  4KNX A;  1TVY A;  2RJ5 A;  1JV1 A;  1QG8 A;  2XWM A;  1H7Q A;  3SX8 A;  3U2U A;  4B2X A;  2XMH A;  3IOI A;  1GQ9 A;  1EYR A;  4CJ8 A;  5FTS A;  1R81 A;  5FUH A;  2AM3 A;  1ZJ3 A;  4JIS A;  3OH0 A;  1ZI4 A;  2Y4L A;  4JD0 A;  1O7Q A;  3IOH A;  2W0V A;  3OH4 A;  2Y4J A;  3D5N A;  3E26 A;  4IRQ A;  5JQQ A;  3SXG A;  5D92 A;  3HL3 A;  1WSZ A;  3V0M A;  4Y9X A;  1JVG A;  5EIY A;  3U2T A;  2PA4 A;  4MND A;  4AYL A;  1TZF A;  3I0I X;  2OI6 A;  4HO6 A;  4Y7U A;  2OEF A;  4FRE A;  1NHE B;  2RJ6 A;  1H4C A;  4G3Q A;  1VM8 A;  4BQH A;  1EZI A;  3ZGF A;  1MP5 A;  5CMI A;  2WVM A;  2E8B A;  1INI A;  5FTV A;  5C1L A;  2RIX A;  1WT3 A;  2P73 A;  2VK9 A;  4HO0 A;  2YCM A;  1FXO A;  2VXM A;  2APC A;  1H5R A;  3V0P A;  1IIM A;  5C1H A;  1O7O A;  4B4B A;  4O6M A;  4FRP A;  3TQD A;  2I5K A;  2Y4K A;  4FIX A;  3SXD A;  4KNR A;  1VZU A;  4Y64 A;  5CMJ A;  2BO8 A;  1GA8 A;  4FRH A;  2PGV A;  3I0K A;  4NAN A;  2D7R A;  1VIC A;  4EE5 A;  4DE7 A;  2FFV A;  1G0R A;  1H5S A;  3OKR A;  5EJ1 A;  1R7T A;  3I0L A;  3DJ4 A;  4M28 A;  2WE9 A;  3K8D A;  4Y63 A;  3RMW A;  1HJJ A;  4R7P A;  3O3P A;  3NGW A;  4EE3 A;  5C3A A;  2I5E A;  3OH1 A;  2QGI A;  1ZCT A;  1MP4 A;  3Q4S A;  2YQS A;  2YQJ A;  2FFU A;  5AJN A;  3USQ A;  4B5B A;  2D0J A;  1NF5 B;  2VSI A;  1ZI5 A;  4KT7 A;  1H7G A;  1JYL A;  3QVB A;  4K6R A;  3ZLL A;  2JCO A;  4G3S A;  4IRP A;  5C4F A;  4HO5 A;  4Y7G A;  1S4N A;  1SS9 A;  1ZIZ A;  4KXO A;  5CMF X;  5AJO A;  1GWV A;  4M2A A;  2RJ1 A;  2QKX A;  2OI5 A;  2I7B A;  4D11 C;  3BCV A;  1WT0 A;  4B4G A;  5C3D A;  3Q80 A;  1QGS A;  5C36 A;  1ZJ2 A;  4FRB A;  4HG6 A;  2V0K A;  2RJ0 A;  1ZCV A;  1I52 A;  2Z87 A;  1NQI B;  1OMZ A;  4NAK A;  5C3B A;  1ZHJ A;  1R7Y A;  3PKP A;  1FGG A;  1JV3 A;  5C4D A;  1GWW A;  4O6N A;  3I0H A;  1FOA A;  1LZI A;  2O1G A;  4ASJ A;  1G95 A;  2Y6P A;  5C47 A;  5C49 A;  2Y4M A;  4EEM A;  3U2V A;  3SPT A;  4C2S A;  3TZT A;  2RJ4 A;  1GX4 A;  4YS8 A;  1YP2 A;  2VS3 A;  4M4K A;  3CKO A;  3LW6 A;  5J49 A;  3OH3 A;  2E3D A;  5AJP A;  4UEG A;  3U0X A;  1VGW A;  2FYD B;  2PGY A;  1WT1 A;  5HS2 A;  3SX3 A;  1R80 A;  1VGZ A;  3POL A;  2VFZ A;  4HOC A;  3F1Y A;  2FYC B;  1G3L A;  3PNN A;  3R2W A;  2V0H A;  2VS4 A;  5FU8 A;  5IDS A;  5C4B A;  2AE7 A;  2WAW A;  1H5T B;  4GBP A;  2XWN A;  1ZJ1 A;  5CQN X;  4HCQ A;  1H5T A;  2O1F A;  3I0J A;  4FCU A;  1YRO B;  1H5R B;  5C38 A;  4EVW A;  1R7U A;  1ZJP A;  1FR8 A;  2VD4 A;  3N9W A;  4EE4 A;  3T7N A;  3JUJ A;  2X65 A;  4D48 A;  1G93 A;  2GGO A;  4G87 A;  4KPX A;  1FRW A;  5CQL X;  4XWI A;  5FV9 A;  3OC9 A;  2VSH A;  1H5S B;  2BO6 A;  3T7M A;  1ZJO A;  4EEA A;  4CJB A;  4Y6N A;  4E1K A;  1G1L A;  3PKQ A;  4D11 A;  4FRA A;  4FQW A;  4J18 A;  1HV9 A;  4FRQ A;  1LL2 A;  1V83 A;  2V0I A;  3CKJ A;  2PX7 A;  4BMA A;  2XWL A;  1YP4 A;  5CMH A;  4CJC A;  5C1G A;  2OI7 A;  4B42 A;  1GX0 A;  1VPA A;  4EEO A;  1ZDG A;  2AES A;  1QGQ A;  2Z86 A;  3IOJ A;  4G3P A;  4LW3 A;  1LL0 A;  4KRV A;  4LW6 A;  2X5Z A;  1TW1 A;  2MZB A;  1INJ A;  4ARW A;  3OH2 A;  2BO4 A;  4FRO A;  3V91 A;  1V84 A;  1HJL A;  3D98 A;  3ZLK A;  4M2B A;  1YP3 A;  2FY7 A;  4FRM A;  4Y7V A;  3CKV A;  2Q4J A;  1H7L A;  5CQO A;  3SXA A;  2W0W A;  4ECM A;  1NMM B;  3U0Y A;  3D8V A;  2AM5 A;  3V8Y A;  3ZGG A;  1G9R A;  2RIT A;  2XME A;  2JCJ A;  5FYE A;  1W77 A;  1H7T A;  2RIY A;  3DK5 A;  1W55 A;  1PZY B;  1R82 A;  1OQM B;  1FO8 A;  3K8E A;  3ST8 A;  4KPZ A;  4Y7F A;  2DPW A;  5L6S A;  1NWG B;  1HM9 A;  4L41 C;  4FCE A;  2FYB A;  4P00 A;  3I0G A;  2RIZ A;  3V0O A;  1H3M A;  4CVH A;  1HM0 A;  4B4M A;  1WT2 A;  1QWJ A;  4HO2 A;  1FZW A;  2JCK A;  1H5S D;  2QH5 A;  2FYA A;  3JTJ A;  2A8U A;  2RJ9 A;  2WEE A;  2UX8 A;  1H7H A;  2YC3 A;  2YES A;  3CU0 A;  1O0R A;  1VZT A;  5C4E A;  4P02 A;  5C4C A;  1GQC A;  1JVD A;  2ZU9 A;  2C0N A;  5IFY A;  4B3U A;  1H7E A;  2ICY A;  3F1C A;  3Q7U A;  1ZI1 A;  1G8O A;  1S4P A;  1ZI3 A;  1WVC A;  2RJ8 A;  1MC3 A;  2J0A A;  1LVW A;  1XHB A;  1FG5 N;  1FXJ A;  5D91 A;  4AYJ A;  2WVL A;  3I0D A;  4FIY A;  3CKQ A;  3CKN A;  3GUE A;  3OGZ A;  4KC4 A;  4KQL A;  1FO9 A;  1ZCU A;  5CQM X;  3U2X A;  3V0L A;  1LZJ A;  5DDV A;  3USR A;  2WGZ A;  5C48 A;  1VZX A;  4B2W A;  3U2W A;  2Y7A A;  2YQH A;  2RJ7 A;  3SX5 A;  4DDZ A;  3FWW A;  2AM4 A;  1E5K A;  4D0Z A;  3V90 A;  4HO4 A;  1OMX A;  3SX7 A;  1VGU A;  1H4D A;  4DEC A;  1W57 A;  3ZF8 A;  1O23 B;  2X60 A;  3KIA A;  5IDT A;  1R7X A;  2JCL A;  5CQP A;  1R7V A;  2V0J A;  2D7I A;  1V82 A;  3I0E A;  5EJZ A;  1FWY A;  4Y6U A;  1Z90 A;  2WVK A;  4ZDQ A;  1ON6 A;  3OAM A;  2ICX A;  3BRK X;  2X5S A;  2NXV A;  4AC3 A;  1JYK A;  5C8R A;  3V0Q A;  3DUV A;  3V0N A;  1K4V A;  2P72 A;  1XZ6 A;  1H4E A;  1VH3 A;  1FGX A; 
#chains in the Genus database with same CATH homology
 4Q7C A;  2AH9 A;  4MIX A;  1PZT A;  5BXC A;  5I1F A;  3SXE A;  3I0C A;  1MP3 A;  2ZU8 A;  4ASY A;  2VS5 A;  4Y7T A;  3FOQ A;  4KC1 A;  1NKH B;  2V0L A;  2YQC A;  4FRD A;  1IIN A;  3R3I A;  4HO9 A;  2GGQ A;  1G23 A;  4EEG A;  2OEG A;  1S4O A;  3SXC A;  3RSB A;  1H5S C;  4HO3 A;  1G2V A;  3RMV A;  3JUK A;  1LL3 A;  4D0T A;  2CU2 A;  1TW5 A;  2P6W A;  1ZJ0 A;  3SXB A;  5FU0 A;  3I0F A;  2A8W A;  2J0B A;  1VH1 A;  4NAI A;  5L6V A;  4HO8 A;  3EE5 A;  2BO7 A;  1KWS A;  4NAL A;  3E25 A;  1LZ0 A;  4AAW A;  2AGD A;  1ON8 A;  4MYB A;  2YC5 A;  2VXL A;  1VGT A;  2AEC A;  2ZU7 A;  5DDT A;  1LZ7 A;  3CGX A;  1FR9 A;  1ZCY A;  4Y62 A;  3T7O A;  2O1H A;  3V8Z A;  5CMG X;  4KC2 A;  1ZDF A;  4FRL A;  1G97 A;  1H7F A;  1HM8 A;  4KNX A;  1TVY A;  2RJ5 A;  1JV1 A;  1QG8 A;  2XWM A;  1H7Q A;  3SX8 A;  3U2U A;  4B2X A;  2XMH A;  3IOI A;  1GQ9 A;  1EYR A;  4CJ8 A;  5FTS A;  1R81 A;  5FUH A;  2AM3 A;  1ZJ3 A;  4JIS A;  3OH0 A;  1ZI4 A;  2Y4L A;  4JD0 A;  1O7Q A;  3IOH A;  2W0V A;  3OH4 A;  2Y4J A;  3D5N A;  3E26 A;  4IRQ A;  5JQQ A;  3SXG A;  5D92 A;  3HL3 A;  1WSZ A;  3V0M A;  4Y9X A;  1JVG A;  5EIY A;  3U2T A;  2PA4 A;  4MND A;  4AYL A;  1TZF A;  3I0I X;  2OI6 A;  4HO6 A;  4Y7U A;  2OEF A;  4FRE A;  1NHE B;  2RJ6 A;  1H4C A;  4G3Q A;  1VM8 A;  4BQH A;  1EZI A;  3ZGF A;  1MP5 A;  5CMI A;  2WVM A;  2E8B A;  1INI A;  5FTV A;  5C1L A;  2RIX A;  1WT3 A;  2P73 A;  2VK9 A;  4HO0 A;  2YCM A;  1FXO A;  2VXM A;  2APC A;  1H5R A;  3V0P A;  1IIM A;  5C1H A;  1O7O A;  4B4B A;  4O6M A;  4FRP A;  3TQD A;  2I5K A;  2Y4K A;  4FIX A;  3SXD A;  4KNR A;  1VZU A;  4Y64 A;  5CMJ A;  2BO8 A;  1GA8 A;  4FRH A;  2PGV A;  3I0K A;  4NAN A;  2D7R A;  1VIC A;  4EE5 A;  4DE7 A;  2FFV A;  1G0R A;  1H5S A;  3OKR A;  5EJ1 A;  1R7T A;  3I0L A;  3DJ4 A;  4M28 A;  2WE9 A;  3K8D A;  4Y63 A;  3RMW A;  1HJJ A;  4R7P A;  3O3P A;  3NGW A;  4EE3 A;  5C3A A;  2I5E A;  3OH1 A;  2QGI A;  1ZCT A;  1MP4 A;  3Q4S A;  2YQS A;  2YQJ A;  2FFU A;  5AJN A;  3USQ A;  4B5B A;  2D0J A;  1NF5 B;  2VSI A;  1ZI5 A;  4KT7 A;  1H7G A;  1JYL A;  3QVB A;  4K6R A;  3ZLL A;  2JCO A;  4G3S A;  4IRP A;  5C4F A;  4HO5 A;  4Y7G A;  1S4N A;  1SS9 A;  1ZIZ A;  4KXO A;  5CMF X;  5AJO A;  1GWV A;  4M2A A;  2RJ1 A;  2QKX A;  2OI5 A;  2I7B A;  4D11 C;  3BCV A;  1WT0 A;  4B4G A;  5C3D A;  3Q80 A;  1QGS A;  5C36 A;  1ZJ2 A;  4FRB A;  4HG6 A;  2V0K A;  2RJ0 A;  1ZCV A;  1I52 A;  2Z87 A;  1NQI B;  1OMZ A;  4NAK A;  5C3B A;  1ZHJ A;  1R7Y A;  3PKP A;  1FGG A;  1JV3 A;  5C4D A;  1GWW A;  4O6N A;  3I0H A;  1FOA A;  1LZI A;  2O1G A;  4ASJ A;  1G95 A;  2Y6P A;  5C47 A;  5C49 A;  2Y4M A;  4EEM A;  3U2V A;  3SPT A;  4C2S A;  3TZT A;  2RJ4 A;  1GX4 A;  4YS8 A;  1YP2 A;  2VS3 A;  4M4K A;  3CKO A;  3LW6 A;  5J49 A;  3OH3 A;  2E3D A;  5AJP A;  4UEG A;  3U0X A;  1VGW A;  2FYD B;  2PGY A;  1WT1 A;  5HS2 A;  3SX3 A;  1R80 A;  1VGZ A;  3POL A;  2VFZ A;  4HOC A;  3F1Y A;  2FYC B;  1G3L A;  3PNN A;  3R2W A;  2V0H A;  2VS4 A;  5FU8 A;  5IDS A;  5C4B A;  2AE7 A;  2WAW A;  1H5T B;  4GBP A;  2XWN A;  1ZJ1 A;  5CQN X;  4HCQ A;  1H5T A;  2O1F A;  3I0J A;  4FCU A;  1YRO B;  1H5R B;  5C38 A;  4EVW A;  1R7U A;  1ZJP A;  1FR8 A;  2VD4 A;  3N9W A;  4EE4 A;  3T7N A;  3JUJ A;  2X65 A;  4D48 A;  1G93 A;  2GGO A;  4G87 A;  4KPX A;  1FRW A;  5CQL X;  4XWI A;  5FV9 A;  3OC9 A;  2VSH A;  1H5S B;  2BO6 A;  3T7M A;  1ZJO A;  4EEA A;  4CJB A;  4Y6N A;  4E1K A;  1G1L A;  3PKQ A;  4D11 A;  4FRA A;  4FQW A;  4J18 A;  1HV9 A;  4FRQ A;  1LL2 A;  1V83 A;  2V0I A;  3CKJ A;  2PX7 A;  4BMA A;  2XWL A;  1YP4 A;  5CMH A;  4CJC A;  5C1G A;  2OI7 A;  4B42 A;  1GX0 A;  1VPA A;  4EEO A;  1ZDG A;  2AES A;  1QGQ A;  2Z86 A;  3IOJ A;  4G3P A;  4LW3 A;  1LL0 A;  4KRV A;  4LW6 A;  2X5Z A;  1TW1 A;  2MZB A;  1INJ A;  4ARW A;  3OH2 A;  2BO4 A;  4FRO A;  3V91 A;  1V84 A;  1HJL A;  3D98 A;  3ZLK A;  4M2B A;  1YP3 A;  2FY7 A;  4FRM A;  4Y7V A;  3CKV A;  2Q4J A;  1H7L A;  5CQO A;  3SXA A;  2W0W A;  4ECM A;  1NMM B;  3U0Y A;  3D8V A;  2AM5 A;  3V8Y A;  3ZGG A;  1G9R A;  2RIT A;  2XME A;  2JCJ A;  5FYE A;  1W77 A;  1H7T A;  2RIY A;  3DK5 A;  1W55 A;  1PZY B;  1R82 A;  1OQM B;  1FO8 A;  3K8E A;  3ST8 A;  4KPZ A;  4Y7F A;  2DPW A;  5L6S A;  1NWG B;  1HM9 A;  4L41 C;  4FCE A;  2FYB A;  4P00 A;  3I0G A;  2RIZ A;  3V0O A;  1H3M A;  4CVH A;  1HM0 A;  4B4M A;  1WT2 A;  1QWJ A;  4HO2 A;  1FZW A;  2JCK A;  1H5S D;  2QH5 A;  2FYA A;  3JTJ A;  2A8U A;  2RJ9 A;  2WEE A;  2UX8 A;  1H7H A;  2YC3 A;  2YES A;  3CU0 A;  1O0R A;  1VZT A;  5C4E A;  4P02 A;  5C4C A;  1GQC A;  1JVD A;  2ZU9 A;  2C0N A;  5IFY A;  4B3U A;  1H7E A;  2ICY A;  3F1C A;  3Q7U A;  1ZI1 A;  1G8O A;  1S4P A;  1ZI3 A;  1WVC A;  2RJ8 A;  1MC3 A;  2J0A A;  1LVW A;  1XHB A;  1FG5 N;  1FXJ A;  5D91 A;  4AYJ A;  2WVL A;  3I0D A;  4FIY A;  3CKQ A;  3CKN A;  3GUE A;  3OGZ A;  4KC4 A;  4KQL A;  1FO9 A;  1ZCU A;  5CQM X;  3U2X A;  3V0L A;  1LZJ A;  5DDV A;  3USR A;  2WGZ A;  5C48 A;  1VZX A;  4B2W A;  3U2W A;  2Y7A A;  2YQH A;  2RJ7 A;  3SX5 A;  4DDZ A;  3FWW A;  2AM4 A;  1E5K A;  4D0Z A;  3V90 A;  4HO4 A;  1OMX A;  3SX7 A;  1VGU A;  1H4D A;  4DEC A;  1W57 A;  3ZF8 A;  1O23 B;  2X60 A;  3KIA A;  5IDT A;  1R7X A;  2JCL A;  5CQP A;  1R7V A;  2V0J A;  2D7I A;  1V82 A;  3I0E A;  5EJZ A;  1FWY A;  4Y6U A;  1Z90 A;  2WVK A;  4ZDQ A;  1ON6 A;  3OAM A;  2ICX A;  3BRK X;  2X5S A;  2NXV A;  4AC3 A;  1JYK A;  5C8R A;  3V0Q A;  3DUV A;  3V0N A;  1K4V A;  2P72 A;  1XZ6 A;  1H4E A;  1VH3 A;  1FGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...