1S5CD

Cholera holotoxin with an a-subunit y30s mutation, crystal form 1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase,toxin
molecule keywords Cholera enterotoxin, A chain
total genus 20
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s5cD00
1UNSA 2Z8LA 3EFXD 1V1OA 1G8ZD 1LT4D 1TS4A 1LTBD 4RFBA 1FNUA 2QEJC 1LT5D 1SXTA 1V1PA 1UUPA 2SEBD 1LT6D 1LTGD 1BXTA 1LTID 1CT1D 3BYTB 1S5FD 1SE4A 5D3DA 1PRTD 1PRTC 4OHJA 1KTKA 1TS5A 1CHPD 1CK1A 1SE2A 1B44D 1B1ZA 3URYA 3O13A 4Z9CB 1EEFD 1FNWA 1HA5A 1FGBD 4DXGA 5I4DA 1JCKB 1TS3A 4C56C 1ET9A 4TSSA 1TS2A 4RHSA 1LLRD 3BZDB 1S5ED 1LO5D 1JWSD 1GOZA 1MD2D 1PRTB 3R2TA 1CHQD 1STEA 4K6LA 2J4XA 1LT3D 3EA6A 1SBBB 1BCPC 1BCPD 1EU4A 1S5CD 4RGOS 5ELCA 4RCOA 1I4RA 4RHRA 3TSSA 1V1PB 2XNAC 2RDGA 3V05A 1ESFA 2XN9C 4L63B 1F77A 1PTOH 1JQYD 1XXGA 5ELEA 1QILA 2TSSA 3SEBA 1I4PA 1T5XD 1TY2A 3BYYB 3KLSX 4BWGB 1AN8A 2RDHA 2G9HD 1XTCD 1DJRD 2NTTA 1BCPB 1SEBD 1JR0D 1EWCA 1LTSD 3BVGA 1PZKD 1I4QA 1JWUD 1LTTD 1PZID 1PYWD 1JWMD 3DWPA 4UDUC 1M4VA 1S5DD 1PTOD 1PTOC 1RCVD 2XRQD 1HTLD 1L0YB 4RGTA 1KLUD 1SJED 3GP7A 1RD9D 1BCPF 1SJHD 5FKAC 1TY0A 1I4GA 1CQVA 2AQ2B 1ET6A 5D3IB 1PTOF 2IJ0A 1D5XC 2CHBD 1DYQA 5ELFA 2AQ1B 1HXYD 2WV6D 3BVMA 3BVZA 1LTAD 1I4HA 1EU3A 1L0XB 3DWAA 1LTRD 3R8BA 1S5BD 3MFGA 1D5MC 2IPKD 1PZJD 5TSSA 1PRTF 1PTOB 2NTSA 2XRSD 3W2DA 3R2IA 4RH6A 2R61A 1HQRD 4DXFA 1ENFA 1KLGD 1RF2D 5FK9C 4ZYSA 1D6EC 1SE3A 4L6TB 4O1NA 2AQ3B 1FNVA 1RDPD 3OWEB 2QILA 1I4XA 4RGMA 1AW7A 1EEID 3DWQA 2O2LD 5ELBA 2ICIA 3CHBD 4RGNA 5ELDA 1D5ZC 1EFID 1FD7D 3MC0B
chains in the Genus database with same CATH superfamily
2K01A 1MKHA 2P5ZX 1PDQA 1O7LA 1N9WA 3NELA 3F2DA 4P2CB 2JA6B 2JA7B 1TU2B 3M3YH 3PCOB 5C4HA 4KK7A 3MHBA 4JI1Q 4DFAA 1KIXA 2NVQB 1PFSA 3LWUA 1HFGA 5IGBA 5CGKA 1S5FD 3UDFA 1BO0A 3VYTA 4OHJA 2H1EA 4X3TA 1Y1WG 4RKBA 5JVH3 3NP8A 4U68A 4DV3Q 5C6AA 1I6HB 1U9RA 3T51B 1K3RA 2F0HA 1A0IA 4B3SQ 5KNDA 4NXMQ 1IW7D 2UUCL 1ASZA 4HJ5A 2Q2TA 4A3JB 1VCIA 4G57A 1BCPC 1YNJD 1PH5A 4RGOS 5FO7B 3TSSA 4KMUC 1G6PA 2WIIB 4H02A 1TWHH 1SFOB 1JQYD 1QVCA 4QCLA 1RL2A 3S17B 1Y8OB 5CV7A 3E0EA 4GN3B 2KQ3A 3CKIB 3HOYH 5E3FA 5M5XB 5I9PA 3KDFB 4Y52H 1EQRA 4NMZA 3GTMB 4QIWB 1UE5A 3J81E 3MXNB 2HUGA 3DEOA 1VDZA 2RVLA 2BE5C 4B3MQ 2KEDA 1D5XC 1DYQA 2L5TA 3RN5A 4DU9A 4OEMB 1CA6A 2NB0A 2B2UC 3PIOA 1SYFA 1GKHA 1S5BD 1X65A 4YIJA 2JA5B 2MQHA 1QNUA 1Q90A 3STBC 4HAEA 4A3CH 3NTHA 3NK9A 3QOJA 1WTOA 4LUOA 3ZYYX 5KNCA 1PA6A 1WTVA 2JA8G 5C4XB 5FLMH 1LYLA 1ZYRC 3UDXA 4HJ9A 2F0NA 2A69D 4KY7A 4LF6L 1I4XA 2QDBA 3P20A 5IYDG 3TP6A 5JJIA 2B2VA 1Q8IA 2Q2UA 1G2SA 4IUNA 1VQGA 4K0KQ 5HGTA 5KGUA 1WTWA 1PH4A 1D1KA 4DV4L 3OOCA 4JI3L 2IHFA 2V1CC 4JBKA 2JP1A 3FRPB 4KY6A 1LTGD 3JAML 3MEHA 2F3WA 2CKZB 1ESRA 1YEZA 1FL0A 2E2IH 5ELOA 1V1QA 1FGUA 2HCIA 1DM0B 5C0XG 3L3OC 1K83B 3NWTA 5KNBA 3KDFA 3KK7A 3MXGA 1Z6HA 1OO9B 4PMWA 4DXGA 4IJHA 1EYAA 4OELB 4TSSA 5LHY1 2K32A 4LF4L 1CUKA 4GN4B 2PQAB 2KCMA 1CHQD 4IFDH 4DK3C 3GTQB 2IX3A 4RCOA 1RIPA 4QIWE 4Q5VA 3K5OA 4X66Q 3E0JA 1J5EQ 1IKMA 2O5JC 2KEEA 3CPFA 3OPOA 5I6WA 2RHSB 4BY7B 1VF5C 5G3LF 2WB1G 1QE6A 1EZ8A 3S1QB 1N32L 1A2UA 1JWUD 4FF4A 4NXNL 5CYUA 3HOVB 3DM3A 1N36Q 4BY7G 3PF5A 3TP5A 1NNXA 1J9OA 1NBWA 4K5WA 3I4MH 2BA1A 4OO1I 3TP7A 1L1OC 3UDIA 2IJ0A 3AU7A 2PZUA 3NUCA 2IY5B 3QO2A 2NVTH 4B9WA 2X69A 1G6ZA 2K6AA 2WKDA 2VY3A 1JB3A 2QKIC 4LW1A 3K8AA 1F9SA 2DY8A 3RUZA 4HMJA 1LM0A 1B4OA 4DGZA 4E6IA 3PIO3 3H15A 3H3VC 2F0FA 4HCEA 4HN7A 4KHZA 1ZYRD 3WOFA 1E2VA 4EQ5A 1NE3A 4QF4A 2Z6KC 2VW9A 1KDBA 4POFA 2M00A 1WOCA 2JA7H 4BS9A 1P8LA 4LJZC 2B8GA 4K2KA 1EZ6A 3HFZB 2L0CA 1IYUA 2NN6G 3Q8DA 3WWVA 4Y7NB 4LF9Q 3Q24A 3GDEA 1ML0D 4UPAA 3I4NB 2PMZB 4DR7L 4JI4Q 1YIJA 4MTNA 2EVBA 2VQFQ 4KTAA 4FNFA 1OXSC 2F0DA 5DM63 4CKBA 1HZCA 1LUZA 3H3VI 3OMCA 4QQBX 3MZ5A 3QB3A 4A3GH 1NTGA 4A3IG 1AFPA 4CHTB 4DV2Q 2EPBA 1PRTC 4JOIA 4IN3A 5JJZA 2E74C 1M90C 4IFDJ 4B08A 4C2MB 1B50A 1HPCA 4QL5A 1CM9A 2MP1A 3I8ZA 1LLRD 1JB7A 5AJ3L 4L5RC 2OEOA 2KHIA 3MXPA 4PZ7A 4AIMA 3Q22A 3TS2A 2UXBL 4BBSH 1W6JA 3M7GA 2FMMA 1XPOA 1HFNA 4ILWA 1L2FA 1SYGA 1U0LA 3NBHA 4A3DH 4P75A 3S9WA 2JN4A 5G3LD 4DUZQ 1H9MA 4B3ML 1S5DD 2A5HA 2Y0SB 1VQ5A 1RCVD 4ABNA 4DR2Q 5GAHC 3VDYA 5M9OA 4OXPA 2NZ1D 1A3UA 1TY0A 1VQ4A 4M8AA 2CFMA 5I6YA 5A2QE 3BVMA 1M1KC 1EL0A 2ASBA 5E1FA 1XPRA 4J15A 1Z7TA 2BH2A 3WOEA 4KD4A 3A74A 5FJ8G 1YI2A 1G91A 2AUJD 4J6HA 2PQAA 2IPKD 1VQ6A 2PMZE 2VUMB 1K9MC 1VQ9A 1EY5A 4JI2L 1HNWL 3KF8A 3EROA 5C3WA 1NJIC 1SDFA 4RMFA 4KHPQ 2R92H 3FVQA 3NWSA 5ELBA 4RGNA 4X64L 2B3GA 3OYYA 2BDNA 3J81j 3HKSA 4DUYL 4IOAA 3GO5A 1GJXA 2CW0C 2O4XA 3R93A 1HNZL 1BNZA 1B2TA 4DV1Q 3KYHC 4JK1C 1J6QA 3AQQA 4BBRH 2EYMA 1SNDA 4KKUA 1ICFB 3NTKA 3HOXB 1VMCA 2WB1B 4TKOB 1CHPD 5AFWA 3V96A 1TWHB 1FJGQ 1VF7A 3ULJA 2LY7A 4C3HH 2PI2A 2F0IA 4XQQA 4AQYQ 5I4DA 1F2ZA 2K7VA 5BR8L 2A68C 4ID6A 5IOCA 4YY3Q 4LWCA 2NVYH 1K83H 5C44B 4CDDC 4DNTB 5E4WC 5M3FG 4DAPA 1C0AA 1JOQA 1X55A 5K36G 2E2DC 4ME3A 2F0SA 2XWBB 4PQXA 1EY7A 5M3MB 3CCVA 2JA8H 4A93B 1RHPA 1AZQA 1CKNA 4G7OC 3BYYB 3KBXA 3U9OA 2LKVA 3I70A 2B39A 2PYKA 4DV2L 2G9HD 3PSIA 4NW2A 2K5NA 4GKKQ 3BVGA 3ICEA 5C0XH 1HUMA 2PQEA 4JI0L 1KNAA 3E5SA 1M4VA 4KHPL 1PTOD 4HIKA 2OF1A 1SNQA 1VQCA 4ZUIA 2SOBA 3HOVG 3S1RH 3KJPA 2K03A 3PO3B 1I4GA 2F0VA 2CHBD 1KC8C 1R4QB 4UHVA 1DOKA 1SLJA 3MAQA 2D0PA 3DWAA 3EIVA 4G7ZC 4FF2A 1SNPA 4DK0A 3OTOL 4X64Q 1G51A 1PRTF 1SFOH 5IYBH 1V8QA 1EY6A 5EKLA 3CC2A 2SDFA 4TRDA 5BN5A 2BH8A 5JAVA 3JAMi 4IFDG 1HR0Q 1EEID 5D65A 2EQSA 4XYQA 2E2JH 5ELDA 3GTMH 3G71A 3S2HH 4EQNA 4PV1C 2HHHQ 3D6WA 3TDQA 1WJJA 4JI1L 1LT4D 1JICA 4DNRB 1F9QA 1BQQT 1SYCA 2CW0D 1NSNS 1LT5D 3CF5A 2E5LQ 4N9PA 2HQEA 1S40A 4DV0L 4FXDA 1IXRA 4X65Q 1VQAA 5BN3A 4JI8Q 4BBRG 2KA7A 3I4MG 1O7IA 2CH4W 2WINB 3M4OB 2Z0SA 4QUCA 1IZ6A 1Z47A 1VQNA 1PH7A 4LMQD 1U4MA 5LMUQ 4RHSA 2A68D 2EXDA 3S1MB 3S1QH 1L0WA 2NN6I 2JA6H 1LT3D 3A7AB 5GQOA 4OIKA 5DM73 5BN4A 2ZM6Q 1XJVA 2ZXOA 1KDCA 2B2YA 2L4NA 1DZ1A 1N34L 5M3FH 3K7UC 3J80i 1XXGA 4JI5L 4GS3A 4MZ9A 1U4RA 2B29A 1SROA 2NZOA 4OONA 3SEBA 4LF7Q 2UXDQ 4MN3A 4GNXC 5M5WH 4DPGA 2UU9Q 3PO3G 4LFCQ 1XTCD 1O80A 4IUPA 4XT3B 4CJ1B 1I94L 1RTNA 2I0QA 1JR0D 2E2HB 1FYCA 3G48A 4MNOA 4JOIC 4LFBL 2CWAA 1TQOA 1HZ9A 3SDZA 5EGTA 2R93B 1L0YB 1YNXA 3C1FA 2WKCA 3H09A 4KV6A 5CC4A 2UXCQ 1ZXTA 1ET6A 1J8IA 1PTOF 5EJWA 5KEEA 4BXXH 3C46A 1N34Q 1GUWA 1SMXA 2E76C 3I4LA 4BY1B 3CCMA 1VQEA 2F0UA 4IZ8A 3GTQH 2L15A 4R4IA 4FF1A 3K5LA 1XYIA 1YVCA 2VUMG 3KF6A 1HQRD 2UXCL 2JQOA 2N88A 4LFAL 3TRZA 2QGQA 3CU7A 3D31A 2VS1A 2WAQB 3T4AC 1CKNB 3C1EA 1XNQQ 4A3FB 2OQ0A 3NTIA 3QG1A 1PH6A 1UNSA 1ONLA 3H0GB 1V1OA 4XQNA 5JJKA 1TS4A 4KI0A 1XMOL 1GUTA 4O2DA 1QNKA 2Q8TA 2F4IA 2F03A 1SXTA 1E1OA 1CKMA 1V1PA 3IFDA 3HOXH 2RA4A 4NP5A 4AYBG 2MO1A 1HH2P 1AEXA 4K8IA 1BXTA 2RHQB 3TBIB 3UDGA 3PUYA 3PMFA 2L11A 4XQJA 3J81i 2QCPX 3CCEA 1H9JA 2EJMA 2HCCA 4HJAA 2EE1A 1H9SB 2R93H 1IBMQ 2D5DA 5JEAJ 4R4QA 4Z9CB 3RD4A 2AUKA 2LSSA 2JEBI 3TQYA 2WFWA 3A5UA 1TS3A 4H0LC 4RAUC 1IW7C 4BY1H 1PRTB 2E75C 1BVSA 1ZKOA 4DAYB 1YNJC 1QZHA 2ZTDA 3KLRA 3HOWH 1EYCA 3NBIA 5C44H 1ICWA 1NAPA 3M4YA 4UP7A 2OWOA 2IX0A 1O7ZA 3ONAB 1HUNA 2PNHA 2MUYA 4DR1L 2RSNA 2CH4A 4R8NA 1Q3LA 4UDUC 1VQ8A 2ZJRA 4OX9L 1IBKL 3D4DA 5HY6A 3TZDA 3K59A 2G5DA 1SYBA 1BCPF 2BE5D 5HGQA 4IPCA 2F4VL 1BR9A 2A6EC 2K28A 5A35A 4XT1B 1EOVA 3Q23A 1X3EA 3HOZH 1Y69U 1NY4A 1YZ6A 2L12A 3NQIA 1AE3A 4WJ3M 2MFIA 2OXPA 3FP9A 1D5MC 4BBSB 1JMCA 1Q8KA 3M9BA 1VQBA 3HKZG 3S16B 4FP5D 4GKJL 3JAME 3D3RA 4LF6Q 4QB4A 1YHQA 1RDPD 5IGDA 2A69C 1QUQB 1HNXL 4A3MG 2EY6A 4A3DB 3I4MB 4K2LA 2A74C 2FFKB 3J7AV 1WCMH 4QMGA 1SNCA 2R7DA 3MC0B 2CVRA 1SR3A 1K3BC 3NSWA 2IL8A 4A3KG 2K1BA 3AEVA 2QW7A 4JBMA 4NXNQ 2E2JB 3RZOH 3RZDH 1TWFH 3GTOH 1F2YA 4XIGS 1WTQA 2L1BA 2Y0SG 4DN4M 1IBLQ 1MSHA 1SE8A 1A3TA 1JE4A 4K14A 2ZJPA 4CBVA 2RQXA 2HIXA 1SNMA 3EVQA 1XNQL 1KTKA 2YU9B 1UEAB 1UE6A 4FYDA 1B44D 3T56B 1HR0L 2C35B 1ZEQX 5EQ0A 1ILPA 1JCKB 1EIYB 1GM5A 1TR5A 4GLVB 3VR5A 1QOHA 1A62A 1YNNC 3LNNA 3I4NH 1STEA 3BDOA 4HMIA 1GO3E 3ULPA 1YHAA 5C5MA 2XVSA 3CMEA 3T16A 4C3JH 1NMFA 3FKIH 4KJNA 5ELEA 3X3MA 1IBKQ 3KBGA 1QWYA 3EN2A 1AN8A 1L1OA 4BBRB 1MGSA 1DJRD 5C4XG 2SNMA 1KDAA 2SNSA 2KCCA 4JYAL 3E3XA 1IYVA 2V4DA 5JPMC 4B3TL 3GTPH 5E4XA 4ZLTF 1RD9D 5COYA 2Z1CA 3K7AH 2GA4B 4A3BB 4YWMA 3BDLA 4GNXB 2J0TD 2Z4IA 4J1MA 4YWLA 3HZXA 4LF7L 2UXDL 3OHXC 4TQUS 4DA2A 5HURA 2EIFA 3N6RA 4HCSA 5M3MH 2JA8B 1PTOB 3CW2C 4ZQ3A 4L5SA 3NENA 1RJTA 4JBWA 4L6TB 3TREA 2F4VQ 3FMCA 3OSOA 4RWSC 4GLAC 4A76A 2O2LD 2K05A 4FVMA 4POGA 4JI6L 1D5ZC 2MGSA 1EFWA 2YTYA 2L9HA 1GUGA 3IFTA 3K6OA 3QWNA 2EY2A 2QEJC 4MHEA 1JOKA 4A3KH 2JJQA 2K52A 3I3CA 5CV5A 3I7FA 4DV0Q 2NVXH 3S1MH 2I46A 2JSOA 2K5QA 1GUSA 1OXUA 2VUMH 2DUDA 4JI2Q 2DJFC 4B9XA 3OMGA 5FLXE 4KKSA 4HIOA 5M3FB 4O42A 3N52A 4KHVA 1DCZA 4LFCL 4OO1G 2DGYA 3E9HA 3BZKA 3G7LA 3RR5A 5C0XJ 5IGGA 1WTHA 1ENCA 4LK1C 3K81C 3K0XA 1YNND 1MD2D 2E2HH 1X3PA 1EU4A 4AYBB 2UUBL 2K14A 1I4RA 5E7NA 4GNXA 3SR1A 2XNAC 3HOXG 3CRKC 2UUAL 1PTOH 2JA5G 4IFDI 1DOMA 1B9NA 2F0PA 2GVAA 4F87A 1BDOA 1X3GA 1PH2A 4IJLA 2RDHA 2KCNA 3L0OA 3K5MA 1BCPB 4FDBA 1A15A 4DV5Q 1DONA 2KUMA 1OXTA 1WTRA 2HIVA 1HQMC 2Q8IB 2KENA 4HR7B 1TWCH 3DXJC 4KY5A 1XMQQ 4RGTA 4UY8C 3CXCA 2VB2X 3CRLC 5C3EH 2VZAA 2UUAQ 5T1IA 4LFAQ 3H94A 3IKJA 4JPBW 1I6VC 4A4IA 2B63G 2D62A 3J80L 4K6DA 2N8NA 4V0BA 2AHOB 3AYHB 1PMRA 2B2TA 4DK6C 5IODA 3G6JB 4DK1A 4YY3L 3P75A 5J1ZA 2R61A 1RODA 2OT2A 4H44C 2F0JA 3K0YA 1RF2D 4AYBE 2VQEQ 1SE3A 1C48A 1FNVA 2JK8A 1IL2A 4R8IA 2K4KA 3D8GA 3B6YA 2J7ZA 4YCWA 1I6HH 2PW5A 3M4PA 1D8LA 4R4OA 3J80c 1STGA 1Q7YC 2LMCB 2PPBC 2DNEA 4ZK9B 5I2XA 1WCMB 1O7YA 4IO9A 2SEBD 1JJ2A 2K33A 3HKZB 1TXYA 4BA1I 4YWKA 5IT9c 4A3IH 3CAMA 3CC4A 1IKLA 5CBAE 3A56A 1HHVA 4TVAB 2N55A 3GTKB 2VNUD 3RZOB 2BDOA 2R7FA 3DHQA 1GUOA 1DGSA 1TWFB 2X6GA 2RKSA 3NQTA 4LF5Q 2F0QA 1J5EL 3PQIA 4ZRZA 2B2YC 1HNWQ 1YBYA 1K8AC 4P74A 4WORA 4C56C 3PUWA 1WCMG 3DUZA 2ALYB 4FF3A 3GTGB 2KHSA 1JWSD 1P16A 3IRBA 3KJOA 2JXMB 1H9KA 2J4XA 4DV7L 1MIUA 1PH8A 3RLFA 2QDLA 4X66L 4C1NK 4B3RL 2EXZA 1BOSA 4GZYC 3H0GH 4A3EG 2RDGA 1CZWA 5DLQE 3V05A 4DV1L 4DAYA 1STYA 2NUCA 4JI8L 3J7A5 1OXXK 1CSPA 5FJ8H 2F3IA 1Y1WB 3SHLA 3RN2A 1T5EA 4AH6A 3A55A 3FEWX 3S2DH 1STHA 2NTTA 2JE6I 3SE0A 1EWCA 4X3UA 1NMGA 2NZHA 1BF4A 5C4XH 5GROA 1MJCA 3HKZE 1PTOC 3G4SA 2JA9A 1EIGA 4YHHQ 3A0JA 2F0MA 1NR4A 3PGZA 5FKAC 1B3QA 3VR2A 3OWFA 1A3VA 1PFMA 2Z6BA 1CSQA 1EIFA 4N8X1 3QJYA 4ZUJA 3GD7A 2AWOA 3HP3A 1CI3M 3GV6A 3JAMc 3S17H 4IPDA 1TWAH 1MHWC 5M5WB 4R9WA 4JC0A 4RG1A 4WFN3 3HOWB 2NTSA 3J7AF 4RCNA 4LF5L 4O0AA 3T1HQ 4HEDA 1PVOA 5LMNQ 4MIUA 4YHHL 4S3SA 2UUCQ 1KABA 3H91A 1OXVA 1WVLA 2DJGC 5IYCG 4DUZL 4JV5Q 3KF8B 2EY1A 3I55A 4OWWB 1G8ZD 2AWNA 4JI4L 5A2QL 3SVMA 1VMPA 4GOPB 2HQLA 3HOZB 5IGEA 4RA8A 4DV6Q 3S24A 4PG3A 5M3MG 5I2YA 1CT1D 1EQQA 5AJ3Q 3W3AA 2Z9HA 3TZUA 3GV3A 3S16H 4IOCA 1KRSA 5C4JH 1X32A 3HG9A 1Q82C 3CD6A 4P71A 5EBCA 5JPNC 2UUBQ 3RLOA 1X3FA 3BJUA 4A3LG 5K36H 1UWVA 3NHHA 2UXBQ 1S5CD 1RTOA 3RLNA 3S1NB 1TWAB 4IPHA 5FOBB 1UE7A 4PNYA 2K04A 4DAVA 2B2UA 3TP8A 1DD2A 4B3SL 2JEAI 3GTOB 1T5XD 4OX9Q 1X54A 2RCNA 3KLSX 2K5HA 5IE8A 3HGBA 5IP7G 1DOLA 2I5MX 2QF7A 3I4OA 5FO8B 2K50A 1EY4A 1F2LA 1PZID 3HOYG 5CORA 4IPGA 5JEAH 3HOUB 3EQLC 3E6ZX 2D9UA 1MSGA 3MXNA 4I65A 1C8CA 1VQHA 1HNXQ 4A93G 1VQKA 3BZCA 3S15B 3BVZA 4JI6Q 4H13C 3QOLA 2ZM6L 2X6LA 1B9MA 4L5QA 1HR0W 3KOJA 3R8BA 1KAAA 4ULLA 4JI5Q 2EY5A 1JE5A 3VYRA 3L7ZC 5TSSA 1PZJD 2XRSD 3FKIB 1B8AA 4RH6A 4XXEA 3L2PA 1Q86C 4LF8Q 5CV9A 1KHIA 2AQ3B 1CFMA 1U5KA 1SSOA 3T13A 4G4KA 1LABA 4P72A 3T1YL 1E2ZA 3SK5A 2ICIA 3TMEA 1JT8A 1X56A 3CMAA 2LFNA 1OTCA 3V2TA 1EYGA 2OTLA 1PV4A 1MBYA 3I73A 4F88A 4DR2L 2A73B 3U4VA 2RSOA 3PUZA 4JI3Q 4A3BH 3K5NA 4A3EB 1F9PA 2EOTA 1VQLA 2A6HD 1LT6D 3GQBA 2R7ZB 4C3IG 1LTID 1LTLA 4LF9L 5IY0A 4DR6L 1VQPA 4CKCA 2D0OA 1CQFA 2F0GA 4DR7Q 1BUVT 1QVFA 2WACA 1TS5A 5C3EG 1A63A 2A1AA 3L9AX 1C7YA 3F2BA 3E9IA 3CPWA 1K73C 4IUUA 2PZTA 3R2TA 4C3IB 3KF6B 5ELNA 5T1GA 5K5PA 3RZDB 4RHRA 3S2DB 1ASYA 3CCJA 4A3LH 1V1PB 4EGVA 2M9VA 3Q0AA 4NB3A 4DR3L 4DNIA 3PO3H 1HTPA 3PO2B 2QEXA 1TY2A 1Y14B 1D7QA 2MJ8A 1JOOA 2K5VA 4N8FA 2Z4HA 3TS0A 2E5LL 5IP7H 2KECA 3VYSA 1K8MA 3MVVA 2R7ZG 1Y1WH 3OW2A 4LUZA 1EUJA 2XRQD 1JJCB 1HTLD 2B2WC 1N36L 4A3FG 2FMCA 4BXXG 1V43A 2DY7A 2A6ED 4BY7H 1CQVA 4DKAC 3PIP3 1QB5D 2B2WA 5IIFA 1N32Q 1HXYD 1HJPA 4CJ0B 1YHBA 1MI2A 2Q8RE 4BY1G 1LTRD 5C5LA 1ENAA 5H1SE 3PIPA 1PLFA 3EBEA 1HA6A 2I5HA 3W2DA 5BR8Q 4HSVA 4ME5A 4JI7Q 4CGYB 1KL9A 3CCUA 5FO9B 1EY0A 2R93G 3LWEA 3KUPA 2ZJQA 3HRZC 4V190 1W6KA 1EWHA 1VQIA 4KKTA 1XNRQ 2WP8J 1TWGB 3D0FA 2LXKA 4C3HB 3DEPA 5CBEE 4KD3A 1CTMA 2IX1A 1EFID 1W2BA 1AH9A 1EYDA 2GVBA 5CR3A 5ISRA 3A5ZB 3IL8A 1X9NA 4K0KL 1PYBA 1PH9A 1H9SA 1UUPA 5IP9G 2A6HC 3HOWG 3I90A 3D4RA 3GTGH 2XSCA 5C44G 1QZGA 3PV0A 1TT2A 2EYFA 4FO2A 4XDXA 4A3CG 3CCLA 4IUVA 1SE4A 3GTLB 5FLMG 5I9OA 3I91A 1VQOA 5GAGC 2YTXA 2OQKA 1F9RA 2C5CA 1N33Q 1HA5A 5LMNL 1NR2A 3W1BA 2F3VA 2I5LX 1XPUA 1CKOA 2F0KA 4HJ8A 4A3MH 5DEHA 2A19A 1STBA 2HDLA 3MEFA 3F1ZA 1YJWA 4NXML 3FPUB 4DF7A 4A3KB 3HOZG 1TKWB 3S14B 1ESFA 5EPLA 5CMDA 1I3QH 3U50C 2K5DA 3M85A 5F2DA 1KXLA 3D6CA 2MO0A 1AZPA 3S1NH 4HJ7A 4A3IB 1C9OA 3T53B 3J81c 5IYCH 1VQDA 4K8JA 2YYZA 1S3OA 1HNZQ 3ERQA 3H6MA 3HOUG 4CJ2C 3U9SA 3SK6A 3GP7A 2Z6KA 3J7ZC 3C3LA 4IQZA 3T1HL 3M4QA 4X62L 5EBDA 1G2TA 1SJHD 4CKEA 2N49A 1FR3A 2AQ1B 1R9TH 3NPPA 1Y1VH 4FXKC 1FVIA 1B53A 3K58A 1U4LA 1EQVA 2VL6A 2H5XA 1KRTA 3STBD 1EWIA 1N8RC 2XTIA 3FDTA 3ND8A 2B2TC 3J81L 5JOBA 4ZYSA 3FKIG 5GADC 2RDFA 1EOTA 1LV9A 2EJFC 3OWEB 4KN4C 2VXWA 4X3KA 2WAQE 3SK4A 1E7ZA 2D2CC 2C9OA 4GOPC 2ZTEA 3TN2A 2EYLA 2KCTA 3UE1A 3U4ZA 2PO4A 4DR5L 3S14H 1SMYD 1XX8A 2RF4A 1IBLL 1LTBD 4RFBA 5J3BA 4JI0Q 3I56A 1S4ZA 2EDGA 3OIPA 2Q2HA 4C3JG 1QG7A 1WI5A 2ES2A 4L8JA 2XIWA 4OIJA 4A75A 4A3JG 2CQAA 2LS01 1D2BA 5JEAG 3BYTB 3QR8A 3A8IE 5D3DA 2F0WA 2F1MA 1TIID 3PUXA 1CK1A 1SE2A 1KD1C 2BA0A 5JVG3 1HZBA 2EYHA 4LNQA 3S2HB 3MTSA 4JBJA 3AFPA 3T1YQ 1C4QA 1H95A 1R9TB 3RMHA 1EY9A 3EA6A 3HS0C 2FINB 4Q0FA 1FJGL 4A3BG 2CCZA 3I2ZA 1U4PA 2XN9C 2PCFB 1BBXC 3PO2G 1K28A 4BBSG 4C3IH 4CDEC 1QILA 4IALA 5L37A 1YITA 1XMQL 1QCBD 4BWGB 2N78A 3NXWA 4DR1Q 2JA7G 3CQZH 4OGQC 1CA5A 4DV6L 1I4QA 4DR4Q 4A3DG 1IYJB 1Q1BA 1I94Q 4M1UB 5IWAQ 2GN5A 5C4JB 3NBHB 4A3FH 4LFBQ 3CP0A 4LUVA 1W3SA 3PF4A 1HCZA 1WFQA 2DN8A 2ENBA 1Y8NB 2NVQH 4JI7L 4YCUA 4LAAA 3OW7A 2BOSA 2O5IC 3H3VH 1CZGA 2AMCB 4LF4Q 1K8OA 3R2IA 3S1RB 3U58A 1VQ7A 1A8VA 1D6EC 2E2IB 2Y0SE 5EAYA 5IWAL 4DV3L 2R7ZH 2N3SA 2IW3A 2ZTCA 3LX0A 4IUTA 1SN8A 2KVMA 1PFNA 2MHVA 3OTOQ 1FD7D 4KJOA 4CDCC 3G6EA 2B63B 5EKIA 1SMYC 3I72A 1UE1A 2YV5A 4WJWA 3K80C 1TVXA 4ZKBB 1II3A 1JC7A 3CCRA 4P73A 1XTDA 4GKKL 5C0XI 3SGIA 5J22A 1PRTD 4DR3Q 5DAUA 1E0BA 4QUFA 4X6AH 3ND9A 2K75A 5IT9E 1Q12A 3IAYA 2ID0A 2RCFA 5KRUA 1B7YB 4DR5Q 3F8TA 4F8MA 1EEFD 1FNWA 2HT1A 1K0SA 4I7AA 3ZJYC 4C3HG 2H4OA 3C2PA 2NWGA 3SK8A 2FXQA 4FXGC 3VR3A 3AB9A 1I3QB 4OWTB 5IGCA 4K6LA 1E24A 1SBBB 2ATWA 1VQJA 2JA5H 1QJOA 1SNOA 1MJEA 1KNEA 2CQOA 2HD3A 3NE5B 1GD7A 4U673 1L1OB 1LACA 3M4OH 4HIDA 2QA4A 1F2MA 4A3MB 1Q1EA 1EIHA 1I50H 5LMUL 1I4PA 1WYDA 4KLKA 2R92G 2CWPA 5FLXc 1EQTA 1WTPA 1LTSD 4X3SA 1K0RA 4GOPA 2IWHA 1WD1A 2MPMA 4HIMA 4BA2I 2EZVA 3ERSX 1VQFA 1SJED 2M2LA 2B63H 4B3TQ 1JJGA 2B8FA 5KYIA 4H7BA 5IP9H 3GTJH 2UU9L 3MXUA 4UAIA 2F0LA 3VA7A 4DV4Q 2FJ2A 4GLXA 1TWGH 4IUQA 1I4HA 1E3PA 3VA5A 1XNRL 2WAQG 5CV6A 3D4WA 4JV5L 4DXFA 3ITPA 3BDCA 3FHWA 2HDMA 3PUVA 3MWYW 3WDNA 5LL6X 1T9HA 2I07B 2YU9H 4QY7A 2NVXB 2F0OA 1AE2A 1AW7A 3HOUH 4JCVE 3UI2A 3M3YB 4C2MH 5KIXA 3EFXD 4KN7C 3S15H 1STNA 4JG2A 5KYLA 1PH3A 4ZAIA 4R1JA 2E8GA 4OL7A 4R4CA 5EPKA 1FNUA 1BKBA 1VQMA 1Y1VG 2PI2E 4NKLA 4JYAQ 2R3ZA 4UP9A 4DAMA 2A8VA 3A8JE 4DUYQ 2FHTA 3CC7A 1GHKA 3P7JA 5IYBG 2EJGC 4WRDA 3HOVH 4UP8A 4APVA 4OO1H 3URYA 1QUQA 3O13A 1N33L 2ZXRA 1JORA 1ET9A 2EYJA 4B3RQ 2NVTB 4GKJQ 3J80E 3KFUA 1UEBA 1LO5D 1A2TA 1GOZA 3DMUA 3H0GG 4A3EH 4YCVA 2JA6G 2K5WA 1SYDA 2ZXPA 2L55A 1STAA 4X62Q 4I7ZC 5IT9L 2TSSA 4A3JH 2MNAA 1M8AA 5D14A 1B70B 3A8KE 4OWXB 1O78A 4PMCA 3OIQA 1Y1VB 4NPSA 1LTTD 3W5OA 1AP0A 1Y8PB 1PH1A 1H9RA 4JW0A 5EKKA 4ALPA 5M5YB 4DR6Q 4Y7NH 5M5XH 1PYSB 3CQZB 5JJLA 2ICEC 2AQ2B 5ELFA 3F2UA 2KBNA 1ILQA 2WV6D 5LMNW 3ER0A 1YJ9A 4N9TA 4JVZA 1E1TA 3M7NA 1L0XB 1SAPA 3AFQA 2EYOA 1X3QA 3PO2H 2OCEA 2KJXA 4AQYL 3NEMA 3JC66 4MTKA 3BG3A 1KLGD 2F0TA 4O1NA 1PFBA 1KAWA 3GTPB 1I5FA 2VQEL 2PW7A 1K8GA 2TMPA 2IHEA 2PZWA 3GTKH 5LL6S 5FLXL 4DR4L 3ULLA 3A54A 4HTHA 2XGTA 3W1GA 2DNCA 2Z8LA 2EYPA 3HEJA 4XYOA 4F7XA 3F2CA 3BU2A 3SXHA 3KLWA 5C3XA 3K57A 1WD0A 4J8QA 1BBUA 1E2WA 1Z9FA 1XMOQ 1Q46A 1DXMA 4A93H 1KQSA 4EVOA 3A7LA 3R3OA 3VR6A 4ZCKA 4PMBA 1B3AA 2JYOA 1Q81C 3EJIA 1NUCA 4L5TA 1HRJA 2IT1A 1B1ZA 5M5YH 1IHZA 1G291 4CDFC 3FPPA 1FGBD 1NCVA 1SRUA 3MA2B 1S72A 1TS2A 1IBML 2KHJA 3P1HA 3BZDB 2OTJA 1S5ED 3TEHB 4EQOA 1RKNA 3Q6SA 4A3GB 2R6GA 1GUNA 3QIAA 5DNFA 1BCPD 2ZT9C 5ELCA 5IGFA 3MFYA 3KLSA 4NDXA 4C1NI 5C4ZA 4K5XA 1HZAA 2NBFA 3I4NG 4RKLA 2PNRC 1F77A 4ODGA 3J7YW 2G9DA 1BBWA 4PZ8A 3CCSA 3GTLH 2AKWB 3BS1A 2BCOA 1SYEA 1UAPA 2NYZD 3RNUA 2HHHL 4XTCS 1SEBD 1IL8A 3VYUA 3LGJA 1PZKD 1QVGA 2R92B 2YTVA 4PZ6A 4IURA 1PYWD 1JWMD 2B2VC 1I50B 3DWPA 4A3GG 1EY8A 1R4PB 1A6XA 2RBMA 4EQPA 4G7HC 1KLUD 4C3JB 2WB1E 3X3NA 4DV5L 2KOLA 4X65L 1GXDC 5D3IB 1PHJA 4QJFA 2VQFL 2NN6H 4EX5A 5EPJA 4HSPA 3AMUA 3DM1A 2F52A 1LTAD 4ZKCB 2XWJB 1E22A 1EU3A 5J39A 5GAEC 2F0EA 1PXUA 1D1IA 4LF8L 3GTJB 4DV7Q 3MFGA 3VR4A 3DLLA 1WTXA 4K5VA 1GHJA 1ENFA 3K7AB 4WJ4A 5CV8A 5IYDH 5FK9C 1X6OA 4R4TA 1VS0A 1YJNA 1TWCB 5CV4A 1XWEA 2QILA 3HOYB 1V9PA 4RGMA 2VB3X 3CCQA 4GN5A 5C3EB 5NUCA 3DWQA 4QGUA 1GVPA 2NVYB 2Q2IA 3CHBD 4L63B 2LXJA 3UE0A
chains in the Genus database with same CATH topology
2K01A 1PDQA 1O7LA 4P2CB 2JA6B 2JA7B 1TU2B 5C4HA 4KK7A 3MHBA 4DFAA 2NVQB 3LWUA 1HFGA 5IGBA 5CGKA 1S5FD 1BO0A 3VYTA 4OHJA 2H1EA 4X3TA 4RKBA 5JVH3 3NP8A 4U68A 5C6AA 1I6HB 1U9RA 3T51B 2F0HA 5KNDA 1IW7D 4A3JB 1VCIA 4G57A 1BCPC 1YNJD 4RGOS 5FO7B 3TSSA 4KMUC 2WIIB 1SFOB 1JQYD 4QCLA 3S17B 1Y8OB 5CV7A 2KQ3A 3CKIB 5E3FA 5M5XB 5I9PA 4NMZA 3GTMB 4QIWB 3J81E 2HUGA 3DEOA 1VDZA 2RVLA 2BE5C 2KEDA 1D5XC 1DYQA 2L5TA 4DU9A 1CA6A 2NB0A 2B2UC 1SYFA 1S5BD 4YIJA 2JA5B 1QNUA 1Q90A 4HAEA 3NTHA 3NK9A 3QOJA 1WTOA 3ZYYX 5KNCA 1WTVA 5C4XB 1ZYRC 2F0NA 2A69D 4KY7A 1I4XA 2QDBA 3P20A 3TP6A 2B2VA 1Q8IA 1G2SA 4IUNA 5HGTA 5KGUA 1WTWA 1D1KA 3OOCA 2JP1A 3FRPB 4KY6A 1LTGD 3JAML 3MEHA 2F3WA 1ESRA 2HCIA 1DM0B 5C0XG 3L3OC 1K83B 3NWTA 5KNBA 3KK7A 3MXGA 1Z6HA 1OO9B 4PMWA 4DXGA 1EYAA 5LHY1 4TSSA 2K32A 1CHQD 4IFDH 3GTQB 2IX3A 4RCOA 4Q5VA 3K5OA 3E0JA 1IKMA 2O5JC 2KEEA 3OPOA 5I6WA 4BY7B 1VF5C 5G3LF 1QE6A 1EZ8A 3S1QB 1A2UA 1JWUD 4FF4A 5CYUA 3HOVB 3TP5A 1J9OA 4K5WA 2BA1A 4OO1I 3TP7A 2IJ0A 3AU7A 2PZUA 3NUCA 3QO2A 4B9WA 2X69A 1G6ZA 2K6AA 2WKDA 1JB3A 2QKIC 1F9SA 2DY8A 3RUZA 4HMJA 4DGZA 1B4OA 4E6IA 3PIO3 3H3VC 2F0FA 4HCEA 4HN7A 4KHZA 1ZYRD 3WOFA 1E2VA 4QF4A 1KDBA 2M00A 4BS9A 4LJZC 2B8GA 4K2KA 1EZ6A 2L0CA 1IYUA 2NN6G 4Y7NB 3Q24A 1ML0D 3I4NB 2PMZB 2EVBA 4KTAA 4FNFA 1OXSC 2F0DA 5DM63 4CKBA 3OMCA 3MZ5A 3QB3A 1AFPA 4CHTB 2EPBA 1PRTC 4IN3A 5JJZA 2E74C 4IFDJ 4B08A 4C2MB 1B50A 1HPCA 1CM9A 2MP1A 3I8ZA 1LLRD 2OEOA 3MXPA 3Q22A 1W6JA 3M7GA 2FMMA 1HFNA 4ILWA 1SYGA 3NBHA 3S9WA 5G3LD 1H9MA 1S5DD 2A5HA 2Y0SB 1RCVD 4ABNA 5M9OA 2NZ1D 1A3UA 1TY0A 4M8AA 5I6YA 5A2QE 3BVMA 1EL0A 5E1FA 1Z7TA 3WOEA 4KD4A 1G91A 2AUJD 4J6HA 2IPKD 2VUMB 1EY5A 3KF8A 3EROA 5C3WA 1SDFA 3FVQA 3NWSA 5ELBA 4RGNA 2BDNA 3GO5A 1GJXA 2CW0C 2O4XA 3R93A 1BNZA 1B2TA 4JK1C 2EYMA 1SNDA 4KKUA 3NTKA 3HOXB 1VMCA 2WB1B 4TKOB 1CHPD 5AFWA 3V96A 1TWHB 1VF7A 2LY7A 2F0IA 4XQQA 5I4DA 1F2ZA 2K7VA 2A68C 4ID6A 5IOCA 5C44B 4DNTB 5E4WC 4DAPA 1JOQA 5K36G 2E2DC 2F0SA 2XWBB 4PQXA 1EY7A 5M3MB 4A93B 1RHPA 1AZQA 4G7OC 3BYYB 3KBXA 3U9OA 2LKVA 3I70A 2B39A 2PYKA 2G9HD 4NW2A 3BVGA 5C0XH 1HUMA 2PQEA 1KNAA 3E5SA 1M4VA 1PTOD 2OF1A 1SNQA 4ZUIA 2SOBA 2K03A 3PO3B 1I4GA 2F0VA 2CHBD 1R4QB 3MAQA 1DOKA 3DWAA 4G7ZC 4FF2A 1SNPA 4DK0A 1PRTF 1V8QA 1EY6A 5EKLA 2SDFA 4TRDA 5BN5A 5JAVA 4IFDG 1EEID 5D65A 4XYQA 5ELDA 4EQNA 4PV1C 3D6WA 3TDQA 1LT4D 1JICA 4DNRB 1F9QA 1BQQT 1SYCA 2CW0D 1NSNS 1LT5D 4N9PA 2HQEA 4FXDA 5BN3A 2KA7A 2WINB 3M4OB 4QUCA 1Z47A 4LMQD 1U4MA 4RHSA 2A68D 3S1MB 2NN6I 1LT3D 3A7AB 4OIKA 5DM73 5BN4A 2ZXOA 1KDCA 2B2YA 2L4NA 1DZ1A 1XXGA 1U4RA 3SEBA 4MN3A 1XTCD 1O80A 4IUPA 4XT3B 4CJ1B 1RTNA 1JR0D 2E2HB 1FYCA 1TQOA 3SDZA 5EGTA 2R93B 1L0YB 3C1FA 2WKCA 3H09A 4KV6A 5CC4A 1ZXTA 1ET6A 1J8IA 1PTOF 5EJWA 5KEEA 3C46A 1GUWA 2E76C 3I4LA 4BY1B 2F0UA 4IZ8A 4FF1A 3K5LA 1XYIA 1HQRD 2N88A 3CU7A 3D31A 2WAQB 3T4AC 3C1EA 4A3FB 3NTIA 3QG1A 1UNSA 1ONLA 3H0GB 1V1OA 4XQNA 1TS4A 4KI0A 1GUTA 1QNKA 2Q8TA 2F4IA 2F03A 1SXTA 1V1PA 3IFDA 2RA4A 4NP5A 1AEXA 4K8IA 1BXTA 3TBIB 3PUYA 3PMFA 2L11A 4XQJA 2QCPX 1H9JA 2EJMA 2HCCA 2EE1A 1H9SB 2D5DA 5JEAJ 4Z9CB 3RD4A 2AUKA 2JEBI 1TS3A 4H0LC 4RAUC 1IW7C 1PRTB 2E75C 1ZKOA 1YNJC 3KLRA 1EYCA 3NBIA 1ICWA 1NAPA 3M4YA 2IX0A 1O7ZA 3ONAB 1HUNA 2MUYA 2RSNA 4R8NA 1Q3LA 4UDUC 3D4DA 3TZDA 3K59A 1SYBA 1BCPF 2BE5D 1BR9A 2A6EC 2K28A 5A35A 4XT1B 3Q23A 1Y69U 2L12A 3NQIA 2OXPA 1D5MC 4BBSB 3S16B 4FP5D 3JAME 3D3RA 4QB4A 1RDPD 5IGDA 2A69C 2EY6A 4A3DB 3I4MB 4K2LA 2A74C 2FFKB 3J7AV 4QMGA 1SNCA 3MC0B 2CVRA 3NSWA 2IL8A 2K1BA 2E2JB 1F2YA 4XIGS 1WTQA 2L1BA 4DN4M 1MSHA 4K14A 1A3TA 1JE4A 4CBVA 2RQXA 1SNMA 3EVQA 1KTKA 2YU9B 1UEAB 4FYDA 1B44D 3T56B 1ZEQX 5EQ0A 1ILPA 1JCKB 1TR5A 3VR5A 1QOHA 1YNNC 3LNNA 1STEA 3BDOA 4HMIA 5C5MA 2XVSA 3T16A 4KJNA 5ELEA 3X3MA 3KBGA 1QWYA 1AN8A 4BBRB 1MGSA 1DJRD 2SNMA 1KDAA 2SNSA 2KCCA 1IYVA 2V4DA 5JPMC 5E4XA 4ZLTF 1RD9D 5COYA 2Z1CA 2GA4B 4A3BB 3BDLA 2J0TD 2Z4IA 4J1MA 3HZXA 3OHXC 4TQUS 4DA2A 5HURA 3N6RA 4HCSA 2JA8B 1PTOB 4ZQ3A 1RJTA 4JBWA 4L6TB 3FMCA 3OSOA 4RWSC 2O2LD 2K05A 4FVMA 1D5ZC 2MGSA 2L9HA 1GUGA 3IFTA 3K6OA 3QWNA 2EY2A 2QEJC 4MHEA 1JOKA 3I3CA 5CV5A 2I46A 2JSOA 2K5QA 1GUSA 1OXUA 4B9XA 3OMGA 5FLXE 4KKSA 5M3FB 4O42A 3N52A 4KHVA 1DCZA 4OO1G 3G7LA 5C0XJ 5IGGA 1ENCA 4LK1C 1YNND 1MD2D 1X3PA 1EU4A 4AYBB 1I4RA 3SR1A 2XNAC 3CRKC 1PTOH 4IFDI 1DOMA 1B9NA 2F0PA 4F87A 1BDOA 2RDHA 2KCNA 3K5MA 1BCPB 1A15A 1DONA 2KUMA 1OXTA 1WTRA 1HQMC 2Q8IB 4HR7B 3DXJC 4KY5A 4RGTA 2VB2X 3CRLC 5T1IA 3H94A 3IKJA 1I6VC 2D62A 3J80L 4K6DA 4V0BA 1PMRA 2B2TA 5IODA 3G6JB 4DK1A 3P75A 5J1ZA 2R61A 1RODA 2OT2A 3K0YA 2F0JA 4H44C 1RF2D 1SE3A 1C48A 1FNVA 4R8IA 3D8GA 2J7ZA 2PW5A 1STGA 2LMCB 2PPBC 2DNEA 4ZK9B 5I2XA 1WCMB 1O7YA 2SEBD 2K33A 3HKZB 4BA1I 1IKLA 5CBAE 3A56A 1HHVA 2N55A 3GTKB 2VNUD 3RZOB 2BDOA 3DHQA 1GUOA 1TWFB 2X6GA 2RKSA 3NQTA 2F0QA 4ZRZA 2B2YC 4WORA 4C56C 3PUWA 3DUZA 4FF3A 3GTGB 2KHSA 1JWSD 2JXMB 1H9KA 2J4XA 3RLFA 4GZYC 4C1NK 2EXZA 1BOSA 2RDGA 1CZWA 3V05A 4DAYA 1STYA 2NUCA 1OXXK 1Y1WB 3SHLA 1T5EA 3A55A 3FEWX 1STHA 2NTTA 2JE6I 3SE0A 1EWCA 4X3UA 1BF4A 1PTOC 1EIGA 2F0MA 1NR4A 5FKAC 3VR2A 3OWFA 1A3VA 1PFMA 3QJYA 4ZUJA 3GD7A 2AWOA 3HP3A 1CI3M 3GV6A 5M5WB 4R9WA 4WFN3 3HOWB 2NTSA 3J7AF 4RCNA 4HEDA 4MIUA 4S3SA 1KABA 3H91A 1OXVA 1WVLA 2EY1A 1G8ZD 2AWNA 5A2QL 3SVMA 1VMPA 3HOZB 5IGEA 4RA8A 5I2YA 1CT1D 3W3AA 3TZUA 3GV3A 1X32A 3HG9A 5EBCA 5JPNC 5K36H 3NHHA 1S5CD 1RTOA 3S1NB 1TWAB 5FOBB 4PNYA 2K04A 4DAVA 2B2UA 3TP8A 1DD2A 2JEAI 3GTOB 1T5XD 3KLSX 3HGBA 1DOLA 2QF7A 5FO8B 1EY4A 1F2LA 1PZID 5CORA 5JEAH 3HOUB 3EQLC 3E6ZX 2D9UA 1MSGA 3MXNA 4I65A 1C8CA 3S15B 3BVZA 4H13C 3QOLA 2X6LA 1B9MA 3R8BA 1KAAA 4ULLA 2EY5A 3VYRA 3L7ZC 5TSSA 1PZJD 2XRSD 3FKIB 4RH6A 4XXEA 5CV9A 2AQ3B 1CFMA 1SSOA 3T13A 4G4KA 1LABA 1E2ZA 3SK5A 2ICIA 3TMEA 2LFNA 3V2TA 1MBYA 3I73A 4F88A 2A73B 2RSOA 3PUZA 3K5NA 4A3EB 1F9PA 2EOTA 2A6HD 1LT6D 3GQBA 2R7ZB 4C3IG 1LTID 4CKCA 1CQFA 2F0GA 1BUVT 2WACA 1TS5A 3L9AX 4IUUA 2PZTA 3R2TA 4C3IB 5T1GA 5K5PA 3RZDB 4RHRA 3S2DB 1V1PB 4EGVA 2M9VA 3Q0AA 1HTPA 3PO2B 1TY2A 2MJ8A 1JOOA 2Z4HA 2KECA 3VYSA 1K8MA 3MVVA 2XRQD 1HTLD 2B2WC 2FMCA 1V43A 2DY7A 2A6ED 1CQVA 3PIP3 1QB5D 2B2WA 5IIFA 1HXYD 4CJ0B 1MI2A 2Q8RE 1LTRD 5C5LA 1ENAA 1PLFA 1HA6A 3W2DA 4HSVA 4ME5A 4CGYB 5FO9B 1EY0A 3LWEA 3KUPA 3HRZC 4V190 1W6KA 1EWHA 4KKTA 2WP8J 1TWGB 4C3HB 3DEPA 5CBEE 4KD3A 1CTMA 2IX1A 1EFID 1EYDA 5CR3A 5ISRA 3IL8A 1H9SA 1UUPA 2A6HC 3I90A 3D4RA 2XSCA 3PV0A 1TT2A 2EYFA 4FO2A 4XDXA 4IUVA 1SE4A 3GTLB 5I9OA 3I91A 1F9RA 2C5CA 1HA5A 1NR2A 2F3VA 2F0KA 5DEHA 1STBA 2HDLA 3FPUB 4DF7A 4A3KB 1TKWB 3S14B 1ESFA 5EPLA 5CMDA 2K5DA 3M85A 5F2DA 3D6CA 1AZPA 4A3IB 3T53B 4K8JA 2YYZA 3ERQA 3H6MA 4CJ2C 3U9SA 3SK6A 3GP7A 3C3LA 4IQZA 5EBDA 1G2TA 1SJHD 4CKEA 1FR3A 2AQ1B 3NPPA 4FXKC 1B53A 3K58A 1U4LA 1EQVA 3FDTA 3ND8A 2B2TC 3J81L 5JOBA 4ZYSA 2RDFA 1EOTA 1LV9A 2EJFC 3OWEB 4KN4C 2VXWA 4X3KA 3SK4A 2D2CC 2C9OA 3TN2A 2EYLA 2PO4A 1SMYD 1XX8A 1LTBD 4RFBA 1S4ZA 2EDGA 3OIPA 4C3JG 1QG7A 4L8JA 2XIWA 4OIJA 2CQAA 2LS01 1D2BA 5JEAG 3BYTB 3A8IE 5D3DA 2F0WA 2F1MA 1TIID 3PUXA 1CK1A 1SE2A 2BA0A 5JVG3 2EYHA 3S2HB 3MTSA 1C4QA 1R9TB 3RMHA 1EY9A 3EA6A 3HS0C 2FINB 4Q0FA 1U4PA 2XN9C 2PCFB 1BBXC 1QILA 4IALA 1QCBD 4BWGB 3NXWA 4OGQC 1CA5A 1I4QA 1Q1BA 4M1UB 5C4JB 1HCZA 2DN8A 2ENBA 1Y8NB 4LAAA 3OW7A 2BOSA 2O5IC 1CZGA 1K8OA 3R2IA 3S1RB 1D6EC 2E2IB 2IW3A 3LX0A 4IUTA 2KVMA 1PFNA 2MHVA 1FD7D 4KJOA 2B63B 5EKIA 1SMYC 3I72A 4WJWA 1TVXA 4ZKBB 1II3A 1JC7A 5C0XI 5J22A 1PRTD 5DAUA 1E0BA 4QUFA 3ND9A 5IT9E 1Q12A 3IAYA 2ID0A 5KRUA 4F8MA 1EEFD 1FNWA 4C3HG 2H4OA 3C2PA 2NWGA 3SK8A 4FXGC 3VR3A 3AB9A 1I3QB 5IGCA 4K6LA 1SBBB 1QJOA 1SNOA 1KNEA 3NE5B 4U673 1LACA 1F2MA 4A3MB 1Q1EA 1EIHA 1I4PA 1EQTA 1WTPA 1LTSD 4X3SA 4BA2I 2IWHA 1WD1A 2MPMA 2EZVA 1SJED 2M2LA 2B8FA 5KYIA 4H7BA 3MXUA 4UAIA 2F0LA 3VA7A 2FJ2A 4IUQA 1I4HA 3VA5A 5CV6A 3D4WA 4DXFA 3ITPA 3BDCA 2HDMA 3PUVA 3MWYW 3WDNA 5LL6X 2I07B 2NVXB 2F0OA 1AW7A 3UI2A 3M3YB 5KIXA 3EFXD 4KN7C 1STNA 5KYLA 4ZAIA 4OL7A 5EPKA 1FNUA 4NKLA 2R3ZA 3A8JE 2FHTA 1GHKA 3P7JA 2EJGC 4WRDA 4OO1H 3URYA 3O13A 2ZXRA 1JORA 1ET9A 2EYJA 2NVTB 3J80E 1LO5D 1A2TA 1GOZA 3DMUA 2K5WA 1SYDA 2ZXPA 2L55A 1STAA 4I7ZC 5IT9L 2TSSA 1M8AA 5D14A 3A8KE 1O78A 4PMCA 3OIQA 1Y1VB 1LTTD 1AP0A 1Y8PB 1H9RA 5EKKA 5M5YB 3CQZB 2ICEC 2AQ2B 5ELFA 3F2UA 1ILQA 2WV6D 4N9TA 3M7NA 1L0XB 1SAPA 2EYOA 1X3QA 2KJXA 3BG3A 1KLGD 2F0TA 4O1NA 1PFBA 3GTPB 2PW7A 2TMPA 2PZWA 5LL6S 5FLXL 3A54A 4HTHA 2DNCA 2Z8LA 2EYPA 3HEJA 4XYOA 4F7XA 3SXHA 5C3XA 3K57A 1WD0A 4J8QA 1E2WA 1DXMA 4EVOA 3A7LA 3R3OA 3VR6A 4PMBA 1B3AA 2JYOA 3EJIA 1NUCA 1HRJA 2IT1A 1B1ZA 1IHZA 1G291 3FPPA 1FGBD 1NCVA 3MA2B 1TS2A 3P1HA 3BZDB 1S5ED 4EQOA 1RKNA 3Q6SA 4A3GB 2R6GA 1GUNA 3QIAA 5DNFA 1BCPD 2ZT9C 5ELCA 5IGFA 3MFYA 3KLSA 4NDXA 4C1NI 5C4ZA 4K5XA 2NBFA 4RKLA 2PNRC 1F77A 4ODGA 3J7YW 2G9DA 3BS1A 2BCOA 1SYEA 1UAPA 2NYZD 4XTCS 1SEBD 1IL8A 3VYUA 1PZKD 2R92B 4IURA 1PYWD 1JWMD 2B2VC 1I50B 3DWPA 1EY8A 1R4PB 1A6XA 2RBMA 4EQPA 4G7HC 1KLUD 4C3JB 3X3NA 2KOLA 1GXDC 5D3IB 2NN6H 5EPJA 4HSPA 3AMUA 3DM1A 1LTAD 5J39A 2XWJB 4ZKCB 1EU3A 2F0EA 1PXUA 1D1IA 3GTJB 3MFGA 3VR4A 1WTXA 4K5VA 1GHJA 1ENFA 3K7AB 5CV8A 5FK9C 5CV4A 1TWCB 1XWEA 2QILA 3HOYB 4RGMA 2VB3X 5C3EB 5NUCA 3DWQA 2NVYB 3CHBD 4L63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNS A;  2Z8L A;  3EFX D;  1V1O A;  1G8Z D;  1LT4 D;  1TS4 A;  1LTB D;  4RFB A;  1FNU A;  2QEJ C;  1LT5 D;  1SXT A;  1V1P A;  1UUP A;  2SEB D;  1LT6 D;  1LTG D;  1BXT A;  1LTI D;  1CT1 D;  3BYT B;  1S5F D;  1SE4 A;  5D3D A;  1PRT D;  1PRT C;  4OHJ A;  1KTK A;  1TS5 A;  1CHP D;  1CK1 A;  1SE2 A;  1B44 D;  1B1Z A;  3URY A;  3O13 A;  4Z9C B;  1EEF D;  1FNW A;  1HA5 A;  1FGB D;  4DXG A;  5I4D A;  1JCK B;  1TS3 A;  4C56 C;  1ET9 A;  4TSS A;  1TS2 A;  4RHS A;  1LLR D;  3BZD B;  1S5E D;  1LO5 D;  1JWS D;  1GOZ A;  1MD2 D;  1PRT B;  3R2T A;  1CHQ D;  1STE A;  4K6L A;  2J4X A;  1LT3 D;  3EA6 A;  1SBB B;  1BCP C;  1BCP D;  1EU4 A;  1S5C D;  4RGO S;  5ELC A;  4RCO A;  1I4R A;  4RHR A;  3TSS A;  1V1P B;  2XNA C;  2RDG A;  3V05 A;  1ESF A;  2XN9 C;  4L63 B;  1F77 A;  1PTO H;  1JQY D;  1XXG A;  5ELE A;  1QIL A;  2TSS A;  3SEB A;  1I4P A;  1T5X D;  1TY2 A;  3BYY B;  3KLS X;  4BWG B;  1AN8 A;  2RDH A;  2G9H D;  1XTC D;  1DJR D;  2NTT A;  1BCP B;  1SEB D;  1JR0 D;  1EWC A;  1LTS D;  3BVG A;  1PZK D;  1I4Q A;  1JWU D;  1LTT D;  1PZI D;  1PYW D;  1JWM D;  3DWP A;  4UDU C;  1M4V A;  1S5D D;  1PTO D;  1PTO C;  1RCV D;  2XRQ D;  1HTL D;  1L0Y B;  4RGT A;  1KLU D;  1SJE D;  3GP7 A;  1RD9 D;  1BCP F;  1SJH D;  5FKA C;  1TY0 A;  1I4G A;  1CQV A;  2AQ2 B;  1ET6 A;  5D3I B;  1PTO F;  2IJ0 A;  1D5X C;  2CHB D;  1DYQ A;  5ELF A;  2AQ1 B;  1HXY D;  2WV6 D;  3BVM A;  3BVZ A;  1LTA D;  1I4H A;  1EU3 A;  1L0X B;  3DWA A;  1LTR D;  3R8B A;  1S5B D;  3MFG A;  1D5M C;  2IPK D;  1PZJ D;  5TSS A;  1PRT F;  1PTO B;  2NTS A;  2XRS D;  3W2D A;  3R2I A;  4RH6 A;  2R61 A;  1HQR D;  4DXF A;  1ENF A;  1KLG D;  1RF2 D;  5FK9 C;  4ZYS A;  1D6E C;  1SE3 A;  4L6T B;  4O1N A;  2AQ3 B;  1FNV A;  1RDP D;  3OWE B;  2QIL A;  1I4X A;  4RGM A;  1AW7 A;  1EEI D;  3DWQ A;  2O2L D;  5ELB A;  2ICI A;  3CHB D;  4RGN A;  5ELD A;  1D5Z C;  1EFI D;  1FD7 D;  3MC0 B; 
#chains in the Genus database with same CATH topology
 2K01 A;  1MKH A;  2P5Z X;  1PDQ A;  1O7L A;  1N9W A;  3NEL A;  3F2D A;  4P2C B;  2JA6 B;  2JA7 B;  1TU2 B;  3M3Y H;  3PCO B;  5C4H A;  4KK7 A;  3MHB A;  4JI1 Q;  4DFA A;  1KIX A;  2NVQ B;  1PFS A;  3LWU A;  1HFG A;  5IGB A;  5CGK A;  1S5F D;  3UDF A;  1BO0 A;  3VYT A;  4OHJ A;  2H1E A;  4X3T A;  1Y1W G;  4RKB A;  5JVH 3;  3NP8 A;  4U68 A;  4DV3 Q;  5C6A A;  1I6H B;  1U9R A;  3T51 B;  1K3R A;  2F0H A;  1A0I A;  4B3S Q;  5KND A;  4NXM Q;  1IW7 D;  2UUC L;  1ASZ A;  4HJ5 A;  2Q2T A;  4A3J B;  1VCI A;  4G57 A;  1BCP C;  1YNJ D;  1PH5 A;  4RGO S;  5FO7 B;  3TSS A;  4KMU C;  1G6P A;  2WII B;  4H02 A;  1TWH H;  1SFO B;  1JQY D;  1QVC A;  4QCL A;  1RL2 A;  3S17 B;  1Y8O B;  5CV7 A;  3E0E A;  4GN3 B;  2KQ3 A;  3CKI B;  3HOY H;  5E3F A;  5M5X B;  5I9P A;  3KDF B;  4Y52 H;  1EQR A;  4NMZ A;  3GTM B;  4QIW B;  1UE5 A;  3J81 E;  3MXN B;  2HUG A;  3DEO A;  1VDZ A;  2RVL A;  2BE5 C;  4B3M Q;  2KED A;  1D5X C;  1DYQ A;  2L5T A;  3RN5 A;  4DU9 A;  4OEM B;  1CA6 A;  2NB0 A;  2B2U C;  3PIO A;  1SYF A;  1GKH A;  1S5B D;  1X65 A;  4YIJ A;  2JA5 B;  2MQH A;  1QNU A;  1Q90 A;  3STB C;  4HAE A;  4A3C H;  3NTH A;  3NK9 A;  3QOJ A;  1WTO A;  4LUO A;  3ZYY X;  5KNC A;  1PA6 A;  1WTV A;  2JA8 G;  5C4X B;  5FLM H;  1LYL A;  1ZYR C;  3UDX A;  4HJ9 A;  2F0N A;  2A69 D;  4KY7 A;  4LF6 L;  1I4X A;  2QDB A;  3P20 A;  5IYD G;  3TP6 A;  5JJI A;  2B2V A;  1Q8I A;  2Q2U A;  1G2S A;  4IUN A;  1VQG A;  4K0K Q;  5HGT A;  5KGU A;  1WTW A;  1PH4 A;  1D1K A;  4DV4 L;  3OOC A;  4JI3 L;  2IHF A;  2V1C C;  4JBK A;  2JP1 A;  3FRP B;  4KY6 A;  1LTG D;  3JAM L;  3MEH A;  2F3W A;  2CKZ B;  1ESR A;  1YEZ A;  1FL0 A;  2E2I H;  5ELO A;  1V1Q A;  1FGU A;  2HCI A;  1DM0 B;  5C0X G;  3L3O C;  1K83 B;  3NWT A;  5KNB A;  3KDF A;  3KK7 A;  3MXG A;  1Z6H A;  1OO9 B;  4PMW A;  4DXG A;  4IJH A;  1EYA A;  4OEL B;  4TSS A;  5LHY 1;  2K32 A;  4LF4 L;  1CUK A;  4GN4 B;  2PQA B;  2KCM A;  1CHQ D;  4IFD H;  4DK3 C;  3GTQ B;  2IX3 A;  4RCO A;  1RIP A;  4QIW E;  4Q5V A;  3K5O A;  4X66 Q;  3E0J A;  1J5E Q;  1IKM A;  2O5J C;  2KEE A;  3CPF A;  3OPO A;  5I6W A;  2RHS B;  4BY7 B;  1VF5 C;  5G3L F;  2WB1 G;  1QE6 A;  1EZ8 A;  3S1Q B;  1N32 L;  1A2U A;  1JWU D;  4FF4 A;  4NXN L;  5CYU A;  3HOV B;  3DM3 A;  1N36 Q;  4BY7 G;  3PF5 A;  3TP5 A;  1NNX A;  1J9O A;  1NBW A;  4K5W A;  3I4M H;  2BA1 A;  4OO1 I;  3TP7 A;  1L1O C;  3UDI A;  2IJ0 A;  3AU7 A;  2PZU A;  3NUC A;  2IY5 B;  3QO2 A;  2NVT H;  4B9W A;  2X69 A;  1G6Z A;  2K6A A;  2WKD A;  2VY3 A;  1JB3 A;  2QKI C;  4LW1 A;  3K8A A;  1F9S A;  2DY8 A;  3RUZ A;  4HMJ A;  1LM0 A;  1B4O A;  4DGZ A;  4E6I A;  3PIO 3;  3H15 A;  3H3V C;  2F0F A;  4HCE A;  4HN7 A;  4KHZ A;  1ZYR D;  3WOF A;  1E2V A;  4EQ5 A;  1NE3 A;  4QF4 A;  2Z6K C;  2VW9 A;  1KDB A;  4POF A;  2M00 A;  1WOC A;  2JA7 H;  4BS9 A;  1P8L A;  4LJZ C;  2B8G A;  4K2K A;  1EZ6 A;  3HFZ B;  2L0C A;  1IYU A;  2NN6 G;  3Q8D A;  3WWV A;  4Y7N B;  4LF9 Q;  3Q24 A;  3GDE A;  1ML0 D;  4UPA A;  3I4N B;  2PMZ B;  4DR7 L;  4JI4 Q;  1YIJ A;  4MTN A;  2EVB A;  2VQF Q;  4KTA A;  4FNF A;  1OXS C;  2F0D A;  5DM6 3;  4CKB A;  1HZC A;  1LUZ A;  3H3V I;  3OMC A;  4QQB X;  3MZ5 A;  3QB3 A;  4A3G H;  1NTG A;  4A3I G;  1AFP A;  4CHT B;  4DV2 Q;  2EPB A;  1PRT C;  4JOI A;  4IN3 A;  5JJZ A;  2E74 C;  1M90 C;  4IFD J;  4B08 A;  4C2M B;  1B50 A;  1HPC A;  4QL5 A;  1CM9 A;  2MP1 A;  3I8Z A;  1LLR D;  1JB7 A;  5AJ3 L;  4L5R C;  2OEO A;  2KHI A;  3MXP A;  4PZ7 A;  4AIM A;  3Q22 A;  3TS2 A;  2UXB L;  4BBS H;  1W6J A;  3M7G A;  2FMM A;  1XPO A;  1HFN A;  4ILW A;  1L2F A;  1SYG A;  1U0L A;  3NBH A;  4A3D H;  4P75 A;  3S9W A;  2JN4 A;  5G3L D;  4DUZ Q;  1H9M A;  4B3M L;  1S5D D;  2A5H A;  2Y0S B;  1VQ5 A;  1RCV D;  4ABN A;  4DR2 Q;  5GAH C;  3VDY A;  5M9O A;  4OXP A;  2NZ1 D;  1A3U A;  1TY0 A;  1VQ4 A;  4M8A A;  2CFM A;  5I6Y A;  5A2Q E;  3BVM A;  1M1K C;  1EL0 A;  2ASB A;  5E1F A;  1XPR A;  4J15 A;  1Z7T A;  2BH2 A;  3WOE A;  4KD4 A;  3A74 A;  5FJ8 G;  1YI2 A;  1G91 A;  2AUJ D;  4J6H A;  2PQA A;  2IPK D;  1VQ6 A;  2PMZ E;  2VUM B;  1K9M C;  1VQ9 A;  1EY5 A;  4JI2 L;  1HNW L;  3KF8 A;  3ERO A;  5C3W A;  1NJI C;  1SDF A;  4RMF A;  4KHP Q;  2R92 H;  3FVQ A;  3NWS A;  5ELB A;  4RGN A;  4X64 L;  2B3G A;  3OYY A;  2BDN A;  3J81 j;  3HKS A;  4DUY L;  4IOA A;  3GO5 A;  1GJX A;  2CW0 C;  2O4X A;  3R93 A;  1HNZ L;  1BNZ A;  1B2T A;  4DV1 Q;  3KYH C;  4JK1 C;  1J6Q A;  3AQQ A;  4BBR H;  2EYM A;  1SND A;  4KKU A;  1ICF B;  3NTK A;  3HOX B;  1VMC A;  2WB1 B;  4TKO B;  1CHP D;  5AFW A;  3V96 A;  1TWH B;  1FJG Q;  1VF7 A;  3ULJ A;  2LY7 A;  4C3H H;  2PI2 A;  2F0I A;  4XQQ A;  4AQY Q;  5I4D A;  1F2Z A;  2K7V A;  5BR8 L;  2A68 C;  4ID6 A;  5IOC A;  4YY3 Q;  4LWC A;  2NVY H;  1K83 H;  5C44 B;  4CDD C;  4DNT B;  5E4W C;  5M3F G;  4DAP A;  1C0A A;  1JOQ A;  1X55 A;  5K36 G;  2E2D C;  4ME3 A;  2F0S A;  2XWB B;  4PQX A;  1EY7 A;  5M3M B;  3CCV A;  2JA8 H;  4A93 B;  1RHP A;  1AZQ A;  1CKN A;  4G7O C;  3BYY B;  3KBX A;  3U9O A;  2LKV A;  3I70 A;  2B39 A;  2PYK A;  4DV2 L;  2G9H D;  3PSI A;  4NW2 A;  2K5N A;  4GKK Q;  3BVG A;  3ICE A;  5C0X H;  1HUM A;  2PQE A;  4JI0 L;  1KNA A;  3E5S A;  1M4V A;  4KHP L;  1PTO D;  4HIK A;  2OF1 A;  1SNQ A;  1VQC A;  4ZUI A;  2SOB A;  3HOV G;  3S1R H;  3KJP A;  2K03 A;  3PO3 B;  1I4G A;  2F0V A;  2CHB D;  1KC8 C;  1R4Q B;  4UHV A;  1DOK A;  1SLJ A;  3MAQ A;  2D0P A;  3DWA A;  3EIV A;  4G7Z C;  4FF2 A;  1SNP A;  4DK0 A;  3OTO L;  4X64 Q;  1G51 A;  1PRT F;  1SFO H;  5IYB H;  1V8Q A;  1EY6 A;  5EKL A;  3CC2 A;  2SDF A;  4TRD A;  5BN5 A;  2BH8 A;  5JAV A;  3JAM i;  4IFD G;  1HR0 Q;  1EEI D;  5D65 A;  2EQS A;  4XYQ A;  2E2J H;  5ELD A;  3GTM H;  3G71 A;  3S2H H;  4EQN A;  4PV1 C;  2HHH Q;  3D6W A;  3TDQ A;  1WJJ A;  4JI1 L;  1LT4 D;  1JIC A;  4DNR B;  1F9Q A;  1BQQ T;  1SYC A;  2CW0 D;  1NSN S;  1LT5 D;  3CF5 A;  2E5L Q;  4N9P A;  2HQE A;  1S40 A;  4DV0 L;  4FXD A;  1IXR A;  4X65 Q;  1VQA A;  5BN3 A;  4JI8 Q;  4BBR G;  2KA7 A;  3I4M G;  1O7I A;  2CH4 W;  2WIN B;  3M4O B;  2Z0S A;  4QUC A;  1IZ6 A;  1Z47 A;  1VQN A;  1PH7 A;  4LMQ D;  1U4M A;  5LMU Q;  4RHS A;  2A68 D;  2EXD A;  3S1M B;  3S1Q H;  1L0W A;  2NN6 I;  2JA6 H;  1LT3 D;  3A7A B;  5GQO A;  4OIK A;  5DM7 3;  5BN4 A;  2ZM6 Q;  1XJV A;  2ZXO A;  1KDC A;  2B2Y A;  2L4N A;  1DZ1 A;  1N34 L;  5M3F H;  3K7U C;  3J80 i;  1XXG A;  4JI5 L;  4GS3 A;  4MZ9 A;  1U4R A;  2B29 A;  1SRO A;  2NZO A;  4OON A;  3SEB A;  4LF7 Q;  2UXD Q;  4MN3 A;  4GNX C;  5M5W H;  4DPG A;  2UU9 Q;  3PO3 G;  4LFC Q;  1XTC D;  1O80 A;  4IUP A;  4XT3 B;  4CJ1 B;  1I94 L;  1RTN A;  2I0Q A;  1JR0 D;  2E2H B;  1FYC A;  3G48 A;  4MNO A;  4JOI C;  4LFB L;  2CWA A;  1TQO A;  1HZ9 A;  3SDZ A;  5EGT A;  2R93 B;  1L0Y B;  1YNX A;  3C1F A;  2WKC A;  3H09 A;  4KV6 A;  5CC4 A;  2UXC Q;  1ZXT A;  1ET6 A;  1J8I A;  1PTO F;  5EJW A;  5KEE A;  4BXX H;  3C46 A;  1N34 Q;  1GUW A;  1SMX A;  2E76 C;  3I4L A;  4BY1 B;  3CCM A;  1VQE A;  2F0U A;  4IZ8 A;  3GTQ H;  2L15 A;  4R4I A;  4FF1 A;  3K5L A;  1XYI A;  1YVC A;  2VUM G;  3KF6 A;  1HQR D;  2UXC L;  2JQO A;  2N88 A;  4LFA L;  3TRZ A;  2QGQ A;  3CU7 A;  3D31 A;  2VS1 A;  2WAQ B;  3T4A C;  1CKN B;  3C1E A;  1XNQ Q;  4A3F B;  2OQ0 A;  3NTI A;  3QG1 A;  1PH6 A;  1UNS A;  1ONL A;  3H0G B;  1V1O A;  4XQN A;  5JJK A;  1TS4 A;  4KI0 A;  1XMO L;  1GUT A;  4O2D A;  1QNK A;  2Q8T A;  2F4I A;  2F03 A;  1SXT A;  1E1O A;  1CKM A;  1V1P A;  3IFD A;  3HOX H;  2RA4 A;  4NP5 A;  4AYB G;  2MO1 A;  1HH2 P;  1AEX A;  4K8I A;  1BXT A;  2RHQ B;  3TBI B;  3UDG A;  3PUY A;  3PMF A;  2L11 A;  4XQJ A;  3J81 i;  2QCP X;  3CCE A;  1H9J A;  2EJM A;  2HCC A;  4HJA A;  2EE1 A;  1H9S B;  2R93 H;  1IBM Q;  2D5D A;  5JEA J;  4R4Q A;  4Z9C B;  3RD4 A;  2AUK A;  2LSS A;  2JEB I;  3TQY A;  2WFW A;  3A5U A;  1TS3 A;  4H0L C;  4RAU C;  1IW7 C;  4BY1 H;  1PRT B;  2E75 C;  1BVS A;  1ZKO A;  4DAY B;  1YNJ C;  1QZH A;  2ZTD A;  3KLR A;  3HOW H;  1EYC A;  3NBI A;  5C44 H;  1ICW A;  1NAP A;  3M4Y A;  4UP7 A;  2OWO A;  2IX0 A;  1O7Z A;  3ONA B;  1HUN A;  2PNH A;  2MUY A;  4DR1 L;  2RSN A;  2CH4 A;  4R8N A;  1Q3L A;  4UDU C;  1VQ8 A;  2ZJR A;  4OX9 L;  1IBK L;  3D4D A;  5HY6 A;  3TZD A;  3K59 A;  2G5D A;  1SYB A;  1BCP F;  2BE5 D;  5HGQ A;  4IPC A;  2F4V L;  1BR9 A;  2A6E C;  2K28 A;  5A35 A;  4XT1 B;  1EOV A;  3Q23 A;  1X3E A;  3HOZ H;  1Y69 U;  1NY4 A;  1YZ6 A;  2L12 A;  3NQI A;  1AE3 A;  4WJ3 M;  2MFI A;  2OXP A;  3FP9 A;  1D5M C;  4BBS B;  1JMC A;  1Q8K A;  3M9B A;  1VQB A;  3HKZ G;  3S16 B;  4FP5 D;  4GKJ L;  3JAM E;  3D3R A;  4LF6 Q;  4QB4 A;  1YHQ A;  1RDP D;  5IGD A;  2A69 C;  1QUQ B;  1HNX L;  4A3M G;  2EY6 A;  4A3D B;  3I4M B;  4K2L A;  2A74 C;  2FFK B;  3J7A V;  1WCM H;  4QMG A;  1SNC A;  2R7D A;  3MC0 B;  2CVR A;  1SR3 A;  1K3B C;  3NSW A;  2IL8 A;  4A3K G;  2K1B A;  3AEV A;  2QW7 A;  4JBM A;  4NXN Q;  2E2J B;  3RZO H;  3RZD H;  1TWF H;  3GTO H;  1F2Y A;  4XIG S;  1WTQ A;  2L1B A;  2Y0S G;  4DN4 M;  1IBL Q;  1MSH A;  1SE8 A;  1A3T A;  1JE4 A;  4K14 A;  2ZJP A;  4CBV A;  2RQX A;  2HIX A;  1SNM A;  3EVQ A;  1XNQ L;  1KTK A;  2YU9 B;  1UEA B;  1UE6 A;  4FYD A;  1B44 D;  3T56 B;  1HR0 L;  2C35 B;  1ZEQ X;  5EQ0 A;  1ILP A;  1JCK B;  1EIY B;  1GM5 A;  1TR5 A;  4GLV B;  3VR5 A;  1QOH A;  1A62 A;  1YNN C;  3LNN A;  3I4N H;  1STE A;  3BDO A;  4HMI A;  1GO3 E;  3ULP A;  1YHA A;  5C5M A;  2XVS A;  3CME A;  3T16 A;  4C3J H;  1NMF A;  3FKI H;  4KJN A;  5ELE A;  3X3M A;  1IBK Q;  3KBG A;  1QWY A;  3EN2 A;  1AN8 A;  1L1O A;  4BBR B;  1MGS A;  1DJR D;  5C4X G;  2SNM A;  1KDA A;  2SNS A;  2KCC A;  4JYA L;  3E3X A;  1IYV A;  2V4D A;  5JPM C;  4B3T L;  3GTP H;  5E4X A;  4ZLT F;  1RD9 D;  5COY A;  2Z1C A;  3K7A H;  2GA4 B;  4A3B B;  4YWM A;  3BDL A;  4GNX B;  2J0T D;  2Z4I A;  4J1M A;  4YWL A;  3HZX A;  4LF7 L;  2UXD L;  3OHX C;  4TQU S;  4DA2 A;  5HUR A;  2EIF A;  3N6R A;  4HCS A;  5M3M H;  2JA8 B;  1PTO B;  3CW2 C;  4ZQ3 A;  4L5S A;  3NEN A;  1RJT A;  4JBW A;  4L6T B;  3TRE A;  2F4V Q;  3FMC A;  3OSO A;  4RWS C;  4GLA C;  4A76 A;  2O2L D;  2K05 A;  4FVM A;  4POG A;  4JI6 L;  1D5Z C;  2MGS A;  1EFW A;  2YTY A;  2L9H A;  1GUG A;  3IFT A;  3K6O A;  3QWN A;  2EY2 A;  2QEJ C;  4MHE A;  1JOK A;  4A3K H;  2JJQ A;  2K52 A;  3I3C A;  5CV5 A;  3I7F A;  4DV0 Q;  2NVX H;  3S1M H;  2I46 A;  2JSO A;  2K5Q A;  1GUS A;  1OXU A;  2VUM H;  2DUD A;  4JI2 Q;  2DJF C;  4B9X A;  3OMG A;  5FLX E;  4KKS A;  4HIO A;  5M3F B;  4O42 A;  3N52 A;  4KHV A;  1DCZ A;  4LFC L;  4OO1 G;  2DGY A;  3E9H A;  3BZK A;  3G7L A;  3RR5 A;  5C0X J;  5IGG A;  1WTH A;  1ENC A;  4LK1 C;  3K81 C;  3K0X A;  1YNN D;  1MD2 D;  2E2H H;  1X3P A;  1EU4 A;  4AYB B;  2UUB L;  2K14 A;  1I4R A;  5E7N A;  4GNX A;  3SR1 A;  2XNA C;  3HOX G;  3CRK C;  2UUA L;  1PTO H;  2JA5 G;  4IFD I;  1DOM A;  1B9N A;  2F0P A;  2GVA A;  4F87 A;  1BDO A;  1X3G A;  1PH2 A;  4IJL A;  2RDH A;  2KCN A;  3L0O A;  3K5M A;  1BCP B;  4FDB A;  1A15 A;  4DV5 Q;  1DON A;  2KUM A;  1OXT A;  1WTR A;  2HIV A;  1HQM C;  2Q8I B;  2KEN A;  4HR7 B;  1TWC H;  3DXJ C;  4KY5 A;  1XMQ Q;  4RGT A;  4UY8 C;  3CXC A;  2VB2 X;  3CRL C;  5C3E H;  2VZA A;  2UUA Q;  5T1I A;  4LFA Q;  3H94 A;  3IKJ A;  4JPB W;  1I6V C;  4A4I A;  2B63 G;  2D62 A;  3J80 L;  4K6D A;  2N8N A;  4V0B A;  2AHO B;  3AYH B;  1PMR A;  2B2T A;  4DK6 C;  5IOD A;  3G6J B;  4DK1 A;  4YY3 L;  3P75 A;  5J1Z A;  2R61 A;  1ROD A;  2OT2 A;  4H44 C;  2F0J A;  3K0Y A;  1RF2 D;  4AYB E;  2VQE Q;  1SE3 A;  1C48 A;  1FNV A;  2JK8 A;  1IL2 A;  4R8I A;  2K4K A;  3D8G A;  3B6Y A;  2J7Z A;  4YCW A;  1I6H H;  2PW5 A;  3M4P A;  1D8L A;  4R4O A;  3J80 c;  1STG A;  1Q7Y C;  2LMC B;  2PPB C;  2DNE A;  4ZK9 B;  5I2X A;  1WCM B;  1O7Y A;  4IO9 A;  2SEB D;  1JJ2 A;  2K33 A;  3HKZ B;  1TXY A;  4BA1 I;  4YWK A;  5IT9 c;  4A3I H;  3CAM A;  3CC4 A;  1IKL A;  5CBA E;  3A56 A;  1HHV A;  4TVA B;  2N55 A;  3GTK B;  2VNU D;  3RZO B;  2BDO A;  2R7F A;  3DHQ A;  1GUO A;  1DGS A;  1TWF B;  2X6G A;  2RKS A;  3NQT A;  4LF5 Q;  2F0Q A;  1J5E L;  3PQI A;  4ZRZ A;  2B2Y C;  1HNW Q;  1YBY A;  1K8A C;  4P74 A;  4WOR A;  4C56 C;  3PUW A;  1WCM G;  3DUZ A;  2ALY B;  4FF3 A;  3GTG B;  2KHS A;  1JWS D;  1P16 A;  3IRB A;  3KJO A;  2JXM B;  1H9K A;  2J4X A;  4DV7 L;  1MIU A;  1PH8 A;  3RLF A;  2QDL A;  4X66 L;  4C1N K;  4B3R L;  2EXZ A;  1BOS A;  4GZY C;  3H0G H;  4A3E G;  2RDG A;  1CZW A;  5DLQ E;  3V05 A;  4DV1 L;  4DAY A;  1STY A;  2NUC A;  4JI8 L;  3J7A 5;  1OXX K;  1CSP A;  5FJ8 H;  2F3I A;  1Y1W B;  3SHL A;  3RN2 A;  1T5E A;  4AH6 A;  3A55 A;  3FEW X;  3S2D H;  1STH A;  2NTT A;  2JE6 I;  3SE0 A;  1EWC A;  4X3U A;  1NMG A;  2NZH A;  1BF4 A;  5C4X H;  5GRO A;  1MJC A;  3HKZ E;  1PTO C;  3G4S A;  2JA9 A;  1EIG A;  4YHH Q;  3A0J A;  2F0M A;  1NR4 A;  3PGZ A;  5FKA C;  1B3Q A;  3VR2 A;  3OWF A;  1A3V A;  1PFM A;  2Z6B A;  1CSQ A;  1EIF A;  4N8X 1;  3QJY A;  4ZUJ A;  3GD7 A;  2AWO A;  3HP3 A;  1CI3 M;  3GV6 A;  3JAM c;  3S17 H;  4IPD A;  1TWA H;  1MHW C;  5M5W B;  4R9W A;  4JC0 A;  4RG1 A;  4WFN 3;  3HOW B;  2NTS A;  3J7A F;  4RCN A;  4LF5 L;  4O0A A;  3T1H Q;  4HED A;  1PVO A;  5LMN Q;  4MIU A;  4YHH L;  4S3S A;  2UUC Q;  1KAB A;  3H91 A;  1OXV A;  1WVL A;  2DJG C;  5IYC G;  4DUZ L;  4JV5 Q;  3KF8 B;  2EY1 A;  3I55 A;  4OWW B;  1G8Z D;  2AWN A;  4JI4 L;  5A2Q L;  3SVM A;  1VMP A;  4GOP B;  2HQL A;  3HOZ B;  5IGE A;  4RA8 A;  4DV6 Q;  3S24 A;  4PG3 A;  5M3M G;  5I2Y A;  1CT1 D;  1EQQ A;  5AJ3 Q;  3W3A A;  2Z9H A;  3TZU A;  3GV3 A;  3S16 H;  4IOC A;  1KRS A;  5C4J H;  1X32 A;  3HG9 A;  1Q82 C;  3CD6 A;  4P71 A;  5EBC A;  5JPN C;  2UUB Q;  3RLO A;  1X3F A;  3BJU A;  4A3L G;  5K36 H;  1UWV A;  3NHH A;  2UXB Q;  1S5C D;  1RTO A;  3RLN A;  3S1N B;  1TWA B;  4IPH A;  5FOB B;  1UE7 A;  4PNY A;  2K04 A;  4DAV A;  2B2U A;  3TP8 A;  1DD2 A;  4B3S L;  2JEA I;  3GTO B;  1T5X D;  4OX9 Q;  1X54 A;  2RCN A;  3KLS X;  2K5H A;  5IE8 A;  3HGB A;  5IP7 G;  1DOL A;  2I5M X;  2QF7 A;  3I4O A;  5FO8 B;  2K50 A;  1EY4 A;  1F2L A;  1PZI D;  3HOY G;  5COR A;  4IPG A;  5JEA H;  3HOU B;  3EQL C;  3E6Z X;  2D9U A;  1MSG A;  3MXN A;  4I65 A;  1C8C A;  1VQH A;  1HNX Q;  4A93 G;  1VQK A;  3BZC A;  3S15 B;  3BVZ A;  4JI6 Q;  4H13 C;  3QOL A;  2ZM6 L;  2X6L A;  1B9M A;  4L5Q A;  1HR0 W;  3KOJ A;  3R8B A;  1KAA A;  4ULL A;  4JI5 Q;  2EY5 A;  1JE5 A;  3VYR A;  3L7Z C;  5TSS A;  1PZJ D;  2XRS D;  3FKI B;  1B8A A;  4RH6 A;  4XXE A;  3L2P A;  1Q86 C;  4LF8 Q;  5CV9 A;  1KHI A;  2AQ3 B;  1CFM A;  1U5K A;  1SSO A;  3T13 A;  4G4K A;  1LAB A;  4P72 A;  3T1Y L;  1E2Z A;  3SK5 A;  2ICI A;  3TME A;  1JT8 A;  1X56 A;  3CMA A;  2LFN A;  1OTC A;  3V2T A;  1EYG A;  2OTL A;  1PV4 A;  1MBY A;  3I73 A;  4F88 A;  4DR2 L;  2A73 B;  3U4V A;  2RSO A;  3PUZ A;  4JI3 Q;  4A3B H;  3K5N A;  4A3E B;  1F9P A;  2EOT A;  1VQL A;  2A6H D;  1LT6 D;  3GQB A;  2R7Z B;  4C3I G;  1LTI D;  1LTL A;  4LF9 L;  5IY0 A;  4DR6 L;  1VQP A;  4CKC A;  2D0O A;  1CQF A;  2F0G A;  4DR7 Q;  1BUV T;  1QVF A;  2WAC A;  1TS5 A;  5C3E G;  1A63 A;  2A1A A;  3L9A X;  1C7Y A;  3F2B A;  3E9I A;  3CPW A;  1K73 C;  4IUU A;  2PZT A;  3R2T A;  4C3I B;  3KF6 B;  5ELN A;  5T1G A;  5K5P A;  3RZD B;  4RHR A;  3S2D B;  1ASY A;  3CCJ A;  4A3L H;  1V1P B;  4EGV A;  2M9V A;  3Q0A A;  4NB3 A;  4DR3 L;  4DNI A;  3PO3 H;  1HTP A;  3PO2 B;  2QEX A;  1TY2 A;  1Y14 B;  1D7Q A;  2MJ8 A;  1JOO A;  2K5V A;  4N8F A;  2Z4H A;  3TS0 A;  2E5L L;  5IP7 H;  2KEC A;  3VYS A;  1K8M A;  3MVV A;  2R7Z G;  1Y1W H;  3OW2 A;  4LUZ A;  1EUJ A;  2XRQ D;  1JJC B;  1HTL D;  2B2W C;  1N36 L;  4A3F G;  2FMC A;  4BXX G;  1V43 A;  2DY7 A;  2A6E D;  4BY7 H;  1CQV A;  4DKA C;  3PIP 3;  1QB5 D;  2B2W A;  5IIF A;  1N32 Q;  1HXY D;  1HJP A;  4CJ0 B;  1YHB A;  1MI2 A;  2Q8R E;  4BY1 G;  1LTR D;  5C5L A;  1ENA A;  5H1S E;  3PIP A;  1PLF A;  3EBE A;  1HA6 A;  2I5H A;  3W2D A;  5BR8 Q;  4HSV A;  4ME5 A;  4JI7 Q;  4CGY B;  1KL9 A;  3CCU A;  5FO9 B;  1EY0 A;  2R93 G;  3LWE A;  3KUP A;  2ZJQ A;  3HRZ C;  4V19 0;  1W6K A;  1EWH A;  1VQI A;  4KKT A;  1XNR Q;  2WP8 J;  1TWG B;  3D0F A;  2LXK A;  4C3H B;  3DEP A;  5CBE E;  4KD3 A;  1CTM A;  2IX1 A;  1EFI D;  1W2B A;  1AH9 A;  1EYD A;  2GVB A;  5CR3 A;  5ISR A;  3A5Z B;  3IL8 A;  1X9N A;  4K0K L;  1PYB A;  1PH9 A;  1H9S A;  1UUP A;  5IP9 G;  2A6H C;  3HOW G;  3I90 A;  3D4R A;  3GTG H;  2XSC A;  5C44 G;  1QZG A;  3PV0 A;  1TT2 A;  2EYF A;  4FO2 A;  4XDX A;  4A3C G;  3CCL A;  4IUV A;  1SE4 A;  3GTL B;  5FLM G;  5I9O A;  3I91 A;  1VQO A;  5GAG C;  2YTX A;  2OQK A;  1F9R A;  2C5C A;  1N33 Q;  1HA5 A;  5LMN L;  1NR2 A;  3W1B A;  2F3V A;  2I5L X;  1XPU A;  1CKO A;  2F0K A;  4HJ8 A;  4A3M H;  5DEH A;  2A19 A;  1STB A;  2HDL A;  3MEF A;  3F1Z A;  1YJW A;  4NXM L;  3FPU B;  4DF7 A;  4A3K B;  3HOZ G;  1TKW B;  3S14 B;  1ESF A;  5EPL A;  5CMD A;  1I3Q H;  3U50 C;  2K5D A;  3M85 A;  5F2D A;  1KXL A;  3D6C A;  2MO0 A;  1AZP A;  3S1N H;  4HJ7 A;  4A3I B;  1C9O A;  3T53 B;  3J81 c;  5IYC H;  1VQD A;  4K8J A;  2YYZ A;  1S3O A;  1HNZ Q;  3ERQ A;  3H6M A;  3HOU G;  4CJ2 C;  3U9S A;  3SK6 A;  3GP7 A;  2Z6K A;  3J7Z C;  3C3L A;  4IQZ A;  3T1H L;  3M4Q A;  4X62 L;  5EBD A;  1G2T A;  1SJH D;  4CKE A;  2N49 A;  1FR3 A;  2AQ1 B;  1R9T H;  3NPP A;  1Y1V H;  4FXK C;  1FVI A;  1B53 A;  3K58 A;  1U4L A;  1EQV A;  2VL6 A;  2H5X A;  1KRT A;  3STB D;  1EWI A;  1N8R C;  2XTI A;  3FDT A;  3ND8 A;  2B2T C;  3J81 L;  5JOB A;  4ZYS A;  3FKI G;  5GAD C;  2RDF A;  1EOT A;  1LV9 A;  2EJF C;  3OWE B;  4KN4 C;  2VXW A;  4X3K A;  2WAQ E;  3SK4 A;  1E7Z A;  2D2C C;  2C9O A;  4GOP C;  2ZTE A;  3TN2 A;  2EYL A;  2KCT A;  3UE1 A;  3U4Z A;  2PO4 A;  4DR5 L;  3S14 H;  1SMY D;  1XX8 A;  2RF4 A;  1IBL L;  1LTB D;  4RFB A;  5J3B A;  4JI0 Q;  3I56 A;  1S4Z A;  2EDG A;  3OIP A;  2Q2H A;  4C3J G;  1QG7 A;  1WI5 A;  2ES2 A;  4L8J A;  2XIW A;  4OIJ A;  4A75 A;  4A3J G;  2CQA A;  2LS0 1;  1D2B A;  5JEA G;  3BYT B;  3QR8 A;  3A8I E;  5D3D A;  2F0W A;  2F1M A;  1TII D;  3PUX A;  1CK1 A;  1SE2 A;  1KD1 C;  2BA0 A;  5JVG 3;  1HZB A;  2EYH A;  4LNQ A;  3S2H B;  3MTS A;  4JBJ A;  3AFP A;  3T1Y Q;  1C4Q A;  1H95 A;  1R9T B;  3RMH A;  1EY9 A;  3EA6 A;  3HS0 C;  2FIN B;  4Q0F A;  1FJG L;  4A3B G;  2CCZ A;  3I2Z A;  1U4P A;  2XN9 C;  2PCF B;  1BBX C;  3PO2 G;  1K28 A;  4BBS G;  4C3I H;  4CDE C;  1QIL A;  4IAL A;  5L37 A;  1YIT A;  1XMQ L;  1QCB D;  4BWG B;  2N78 A;  3NXW A;  4DR1 Q;  2JA7 G;  3CQZ H;  4OGQ C;  1CA5 A;  4DV6 L;  1I4Q A;  4DR4 Q;  4A3D G;  1IYJ B;  1Q1B A;  1I94 Q;  4M1U B;  5IWA Q;  2GN5 A;  5C4J B;  3NBH B;  4A3F H;  4LFB Q;  3CP0 A;  4LUV A;  1W3S A;  3PF4 A;  1HCZ A;  1WFQ A;  2DN8 A;  2ENB A;  1Y8N B;  2NVQ H;  4JI7 L;  4YCU A;  4LAA A;  3OW7 A;  2BOS A;  2O5I C;  3H3V H;  1CZG A;  2AMC B;  4LF4 Q;  1K8O A;  3R2I A;  3S1R B;  3U58 A;  1VQ7 A;  1A8V A;  1D6E C;  2E2I B;  2Y0S E;  5EAY A;  5IWA L;  4DV3 L;  2R7Z H;  2N3S A;  2IW3 A;  2ZTC A;  3LX0 A;  4IUT A;  1SN8 A;  2KVM A;  1PFN A;  2MHV A;  3OTO Q;  1FD7 D;  4KJO A;  4CDC C;  3G6E A;  2B63 B;  5EKI A;  1SMY C;  3I72 A;  1UE1 A;  2YV5 A;  4WJW A;  3K80 C;  1TVX A;  4ZKB B;  1II3 A;  1JC7 A;  3CCR A;  4P73 A;  1XTD A;  4GKK L;  5C0X I;  3SGI A;  5J22 A;  1PRT D;  4DR3 Q;  5DAU A;  1E0B A;  4QUF A;  4X6A H;  3ND9 A;  2K75 A;  5IT9 E;  1Q12 A;  3IAY A;  2ID0 A;  2RCF A;  5KRU A;  1B7Y B;  4DR5 Q;  3F8T A;  4F8M A;  1EEF D;  1FNW A;  2HT1 A;  1K0S A;  4I7A A;  3ZJY C;  4C3H G;  2H4O A;  3C2P A;  2NWG A;  3SK8 A;  2FXQ A;  4FXG C;  3VR3 A;  3AB9 A;  1I3Q B;  4OWT B;  5IGC A;  4K6L A;  1E24 A;  1SBB B;  2ATW A;  1VQJ A;  2JA5 H;  1QJO A;  1SNO A;  1MJE A;  1KNE A;  2CQO A;  2HD3 A;  3NE5 B;  1GD7 A;  4U67 3;  1L1O B;  1LAC A;  3M4O H;  4HID A;  2QA4 A;  1F2M A;  4A3M B;  1Q1E A;  1EIH A;  1I50 H;  5LMU L;  1I4P A;  1WYD A;  4KLK A;  2R92 G;  2CWP A;  5FLX c;  1EQT A;  1WTP A;  1LTS D;  4X3S A;  1K0R A;  4GOP A;  2IWH A;  1WD1 A;  2MPM A;  4HIM A;  4BA2 I;  2EZV A;  3ERS X;  1VQF A;  1SJE D;  2M2L A;  2B63 H;  4B3T Q;  1JJG A;  2B8F A;  5KYI A;  4H7B A;  5IP9 H;  3GTJ H;  2UU9 L;  3MXU A;  4UAI A;  2F0L A;  3VA7 A;  4DV4 Q;  2FJ2 A;  4GLX A;  1TWG H;  4IUQ A;  1I4H A;  1E3P A;  3VA5 A;  1XNR L;  2WAQ G;  5CV6 A;  3D4W A;  4JV5 L;  4DXF A;  3ITP A;  3BDC A;  3FHW A;  2HDM A;  3PUV A;  3MWY W;  3WDN A;  5LL6 X;  1T9H A;  2I07 B;  2YU9 H;  4QY7 A;  2NVX B;  2F0O A;  1AE2 A;  1AW7 A;  3HOU H;  4JCV E;  3UI2 A;  3M3Y B;  4C2M H;  5KIX A;  3EFX D;  4KN7 C;  3S15 H;  1STN A;  4JG2 A;  5KYL A;  1PH3 A;  4ZAI A;  4R1J A;  2E8G A;  4OL7 A;  4R4C A;  5EPK A;  1FNU A;  1BKB A;  1VQM A;  1Y1V G;  2PI2 E;  4NKL A;  4JYA Q;  2R3Z A;  4UP9 A;  4DAM A;  2A8V A;  3A8J E;  4DUY Q;  2FHT A;  3CC7 A;  1GHK A;  3P7J A;  5IYB G;  2EJG C;  4WRD A;  3HOV H;  4UP8 A;  4APV A;  4OO1 H;  3URY A;  1QUQ A;  3O13 A;  1N33 L;  2ZXR A;  1JOR A;  1ET9 A;  2EYJ A;  4B3R Q;  2NVT B;  4GKJ Q;  3J80 E;  3KFU A;  1UEB A;  1LO5 D;  1A2T A;  1GOZ A;  3DMU A;  3H0G G;  4A3E H;  4YCV A;  2JA6 G;  2K5W A;  1SYD A;  2ZXP A;  2L55 A;  1STA A;  4X62 Q;  4I7Z C;  5IT9 L;  2TSS A;  4A3J H;  2MNA A;  1M8A A;  5D14 A;  1B70 B;  3A8K E;  4OWX B;  1O78 A;  4PMC A;  3OIQ A;  1Y1V B;  4NPS A;  1LTT D;  3W5O A;  1AP0 A;  1Y8P B;  1PH1 A;  1H9R A;  4JW0 A;  5EKK A;  4ALP A;  5M5Y B;  4DR6 Q;  4Y7N H;  5M5X H;  1PYS B;  3CQZ B;  5JJL A;  2ICE C;  2AQ2 B;  5ELF A;  3F2U A;  2KBN A;  1ILQ A;  2WV6 D;  5LMN W;  3ER0 A;  1YJ9 A;  4N9T A;  4JVZ A;  1E1T A;  3M7N A;  1L0X B;  1SAP A;  3AFQ A;  2EYO A;  1X3Q A;  3PO2 H;  2OCE A;  2KJX A;  4AQY L;  3NEM A;  3JC6 6;  4MTK A;  3BG3 A;  1KLG D;  2F0T A;  4O1N A;  1PFB A;  1KAW A;  3GTP B;  1I5F A;  2VQE L;  2PW7 A;  1K8G A;  2TMP A;  2IHE A;  2PZW A;  3GTK H;  5LL6 S;  5FLX L;  4DR4 L;  3ULL A;  3A54 A;  4HTH A;  2XGT A;  3W1G A;  2DNC A;  2Z8L A;  2EYP A;  3HEJ A;  4XYO A;  4F7X A;  3F2C A;  3BU2 A;  3SXH A;  3KLW A;  5C3X A;  3K57 A;  1WD0 A;  4J8Q A;  1BBU A;  1E2W A;  1Z9F A;  1XMO Q;  1Q46 A;  1DXM A;  4A93 H;  1KQS A;  4EVO A;  3A7L A;  3R3O A;  3VR6 A;  4ZCK A;  4PMB A;  1B3A A;  2JYO A;  1Q81 C;  3EJI A;  1NUC A;  4L5T A;  1HRJ A;  2IT1 A;  1B1Z A;  5M5Y H;  1IHZ A;  1G29 1;  4CDF C;  3FPP A;  1FGB D;  1NCV A;  1SRU A;  3MA2 B;  1S72 A;  1TS2 A;  1IBM L;  2KHJ A;  3P1H A;  3BZD B;  2OTJ A;  1S5E D;  3TEH B;  4EQO A;  1RKN A;  3Q6S A;  4A3G B;  2R6G A;  1GUN A;  3QIA A;  5DNF A;  1BCP D;  2ZT9 C;  5ELC A;  5IGF A;  3MFY A;  3KLS A;  4NDX A;  4C1N I;  5C4Z A;  4K5X A;  1HZA A;  2NBF A;  3I4N G;  4RKL A;  2PNR C;  1F77 A;  4ODG A;  3J7Y W;  2G9D A;  1BBW A;  4PZ8 A;  3CCS A;  3GTL H;  2AKW B;  3BS1 A;  2BCO A;  1SYE A;  1UAP A;  2NYZ D;  3RNU A;  2HHH L;  4XTC S;  1SEB D;  1IL8 A;  3VYU A;  3LGJ A;  1PZK D;  1QVG A;  2R92 B;  2YTV A;  4PZ6 A;  4IUR A;  1PYW D;  1JWM D;  2B2V C;  1I50 B;  3DWP A;  4A3G G;  1EY8 A;  1R4P B;  1A6X A;  2RBM A;  4EQP A;  4G7H C;  1KLU D;  4C3J B;  2WB1 E;  3X3N A;  4DV5 L;  2KOL A;  4X65 L;  1GXD C;  5D3I B;  1PHJ A;  4QJF A;  2VQF L;  2NN6 H;  4EX5 A;  5EPJ A;  4HSP A;  3AMU A;  3DM1 A;  2F52 A;  1LTA D;  4ZKC B;  2XWJ B;  1E22 A;  1EU3 A;  5J39 A;  5GAE C;  2F0E A;  1PXU A;  1D1I A;  4LF8 L;  3GTJ B;  4DV7 Q;  3MFG A;  3VR4 A;  3DLL A;  1WTX A;  4K5V A;  1GHJ A;  1ENF A;  3K7A B;  4WJ4 A;  5CV8 A;  5IYD H;  5FK9 C;  1X6O A;  4R4T A;  1VS0 A;  1YJN A;  1TWC B;  5CV4 A;  1XWE A;  2QIL A;  3HOY B;  1V9P A;  4RGM A;  2VB3 X;  3CCQ A;  4GN5 A;  5C3E B;  5NUC A;  3DWQ A;  4QGU A;  1GVP A;  2NVY B;  2Q2I A;  3CHB D;  4L63 B;  2LXJ A;  3UE0 A; 
#chains in the Genus database with same CATH homology
 2K01 A;  1PDQ A;  1O7L A;  4P2C B;  2JA6 B;  2JA7 B;  1TU2 B;  5C4H A;  4KK7 A;  3MHB A;  4DFA A;  2NVQ B;  3LWU A;  1HFG A;  5IGB A;  5CGK A;  1S5F D;  1BO0 A;  3VYT A;  4OHJ A;  2H1E A;  4X3T A;  4RKB A;  5JVH 3;  3NP8 A;  4U68 A;  5C6A A;  1I6H B;  1U9R A;  3T51 B;  2F0H A;  5KND A;  1IW7 D;  4A3J B;  1VCI A;  4G57 A;  1BCP C;  1YNJ D;  4RGO S;  5FO7 B;  3TSS A;  4KMU C;  2WII B;  1SFO B;  1JQY D;  4QCL A;  3S17 B;  1Y8O B;  5CV7 A;  2KQ3 A;  3CKI B;  5E3F A;  5M5X B;  5I9P A;  4NMZ A;  3GTM B;  4QIW B;  3J81 E;  2HUG A;  3DEO A;  1VDZ A;  2RVL A;  2BE5 C;  2KED A;  1D5X C;  1DYQ A;  2L5T A;  4DU9 A;  1CA6 A;  2NB0 A;  2B2U C;  1SYF A;  1S5B D;  4YIJ A;  2JA5 B;  1QNU A;  1Q90 A;  4HAE A;  3NTH A;  3NK9 A;  3QOJ A;  1WTO A;  3ZYY X;  5KNC A;  1WTV A;  5C4X B;  1ZYR C;  2F0N A;  2A69 D;  4KY7 A;  1I4X A;  2QDB A;  3P20 A;  3TP6 A;  2B2V A;  1Q8I A;  1G2S A;  4IUN A;  5HGT A;  5KGU A;  1WTW A;  1D1K A;  3OOC A;  2JP1 A;  3FRP B;  4KY6 A;  1LTG D;  3JAM L;  3MEH A;  2F3W A;  1ESR A;  2HCI A;  1DM0 B;  5C0X G;  3L3O C;  1K83 B;  3NWT A;  5KNB A;  3KK7 A;  3MXG A;  1Z6H A;  1OO9 B;  4PMW A;  4DXG A;  1EYA A;  5LHY 1;  4TSS A;  2K32 A;  1CHQ D;  4IFD H;  3GTQ B;  2IX3 A;  4RCO A;  4Q5V A;  3K5O A;  3E0J A;  1IKM A;  2O5J C;  2KEE A;  3OPO A;  5I6W A;  4BY7 B;  1VF5 C;  5G3L F;  1QE6 A;  1EZ8 A;  3S1Q B;  1A2U A;  1JWU D;  4FF4 A;  5CYU A;  3HOV B;  3TP5 A;  1J9O A;  4K5W A;  2BA1 A;  4OO1 I;  3TP7 A;  2IJ0 A;  3AU7 A;  2PZU A;  3NUC A;  3QO2 A;  4B9W A;  2X69 A;  1G6Z A;  2K6A A;  2WKD A;  1JB3 A;  2QKI C;  1F9S A;  2DY8 A;  3RUZ A;  4HMJ A;  4DGZ A;  1B4O A;  4E6I A;  3PIO 3;  3H3V C;  2F0F A;  4HCE A;  4HN7 A;  4KHZ A;  1ZYR D;  3WOF A;  1E2V A;  4QF4 A;  1KDB A;  2M00 A;  4BS9 A;  4LJZ C;  2B8G A;  4K2K A;  1EZ6 A;  2L0C A;  1IYU A;  2NN6 G;  4Y7N B;  3Q24 A;  1ML0 D;  3I4N B;  2PMZ B;  2EVB A;  4KTA A;  4FNF A;  1OXS C;  2F0D A;  5DM6 3;  4CKB A;  3OMC A;  3MZ5 A;  3QB3 A;  1AFP A;  4CHT B;  2EPB A;  1PRT C;  4IN3 A;  5JJZ A;  2E74 C;  4IFD J;  4B08 A;  4C2M B;  1B50 A;  1HPC A;  1CM9 A;  2MP1 A;  3I8Z A;  1LLR D;  2OEO A;  3MXP A;  3Q22 A;  1W6J A;  3M7G A;  2FMM A;  1HFN A;  4ILW A;  1SYG A;  3NBH A;  3S9W A;  5G3L D;  1H9M A;  1S5D D;  2A5H A;  2Y0S B;  1RCV D;  4ABN A;  5M9O A;  2NZ1 D;  1A3U A;  1TY0 A;  4M8A A;  5I6Y A;  5A2Q E;  3BVM A;  1EL0 A;  5E1F A;  1Z7T A;  3WOE A;  4KD4 A;  1G91 A;  2AUJ D;  4J6H A;  2IPK D;  2VUM B;  1EY5 A;  3KF8 A;  3ERO A;  5C3W A;  1SDF A;  3FVQ A;  3NWS A;  5ELB A;  4RGN A;  2BDN A;  3GO5 A;  1GJX A;  2CW0 C;  2O4X A;  3R93 A;  1BNZ A;  1B2T A;  4JK1 C;  2EYM A;  1SND A;  4KKU A;  3NTK A;  3HOX B;  1VMC A;  2WB1 B;  4TKO B;  1CHP D;  5AFW A;  3V96 A;  1TWH B;  1VF7 A;  2LY7 A;  2F0I A;  4XQQ A;  5I4D A;  1F2Z A;  2K7V A;  2A68 C;  4ID6 A;  5IOC A;  5C44 B;  4DNT B;  5E4W C;  4DAP A;  1JOQ A;  5K36 G;  2E2D C;  2F0S A;  2XWB B;  4PQX A;  1EY7 A;  5M3M B;  4A93 B;  1RHP A;  1AZQ A;  4G7O C;  3BYY B;  3KBX A;  3U9O A;  2LKV A;  3I70 A;  2B39 A;  2PYK A;  2G9H D;  4NW2 A;  3BVG A;  5C0X H;  1HUM A;  2PQE A;  1KNA A;  3E5S A;  1M4V A;  1PTO D;  2OF1 A;  1SNQ A;  4ZUI A;  2SOB A;  2K03 A;  3PO3 B;  1I4G A;  2F0V A;  2CHB D;  1R4Q B;  3MAQ A;  1DOK A;  3DWA A;  4G7Z C;  4FF2 A;  1SNP A;  4DK0 A;  1PRT F;  1V8Q A;  1EY6 A;  5EKL A;  2SDF A;  4TRD A;  5BN5 A;  5JAV A;  4IFD G;  1EEI D;  5D65 A;  4XYQ A;  5ELD A;  4EQN A;  4PV1 C;  3D6W A;  3TDQ A;  1LT4 D;  1JIC A;  4DNR B;  1F9Q A;  1BQQ T;  1SYC A;  2CW0 D;  1NSN S;  1LT5 D;  4N9P A;  2HQE A;  4FXD A;  5BN3 A;  2KA7 A;  2WIN B;  3M4O B;  4QUC A;  1Z47 A;  4LMQ D;  1U4M A;  4RHS A;  2A68 D;  3S1M B;  2NN6 I;  1LT3 D;  3A7A B;  4OIK A;  5DM7 3;  5BN4 A;  2ZXO A;  1KDC A;  2B2Y A;  2L4N A;  1DZ1 A;  1XXG A;  1U4R A;  3SEB A;  4MN3 A;  1XTC D;  1O80 A;  4IUP A;  4XT3 B;  4CJ1 B;  1RTN A;  1JR0 D;  2E2H B;  1FYC A;  1TQO A;  3SDZ A;  5EGT A;  2R93 B;  1L0Y B;  3C1F A;  2WKC A;  3H09 A;  4KV6 A;  5CC4 A;  1ZXT A;  1ET6 A;  1J8I A;  1PTO F;  5EJW A;  5KEE A;  3C46 A;  1GUW A;  2E76 C;  3I4L A;  4BY1 B;  2F0U A;  4IZ8 A;  4FF1 A;  3K5L A;  1XYI A;  1HQR D;  2N88 A;  3CU7 A;  3D31 A;  2WAQ B;  3T4A C;  3C1E A;  4A3F B;  3NTI A;  3QG1 A;  1UNS A;  1ONL A;  3H0G B;  1V1O A;  4XQN A;  1TS4 A;  4KI0 A;  1GUT A;  1QNK A;  2Q8T A;  2F4I A;  2F03 A;  1SXT A;  1V1P A;  3IFD A;  2RA4 A;  4NP5 A;  1AEX A;  4K8I A;  1BXT A;  3TBI B;  3PUY A;  3PMF A;  2L11 A;  4XQJ A;  2QCP X;  1H9J A;  2EJM A;  2HCC A;  2EE1 A;  1H9S B;  2D5D A;  5JEA J;  4Z9C B;  3RD4 A;  2AUK A;  2JEB I;  1TS3 A;  4H0L C;  4RAU C;  1IW7 C;  1PRT B;  2E75 C;  1ZKO A;  1YNJ C;  3KLR A;  1EYC A;  3NBI A;  1ICW A;  1NAP A;  3M4Y A;  2IX0 A;  1O7Z A;  3ONA B;  1HUN A;  2MUY A;  2RSN A;  4R8N A;  1Q3L A;  4UDU C;  3D4D A;  3TZD A;  3K59 A;  1SYB A;  1BCP F;  2BE5 D;  1BR9 A;  2A6E C;  2K28 A;  5A35 A;  4XT1 B;  3Q23 A;  1Y69 U;  2L12 A;  3NQI A;  2OXP A;  1D5M C;  4BBS B;  3S16 B;  4FP5 D;  3JAM E;  3D3R A;  4QB4 A;  1RDP D;  5IGD A;  2A69 C;  2EY6 A;  4A3D B;  3I4M B;  4K2L A;  2A74 C;  2FFK B;  3J7A V;  4QMG A;  1SNC A;  3MC0 B;  2CVR A;  3NSW A;  2IL8 A;  2K1B A;  2E2J B;  1F2Y A;  4XIG S;  1WTQ A;  2L1B A;  4DN4 M;  1MSH A;  4K14 A;  1A3T A;  1JE4 A;  4CBV A;  2RQX A;  1SNM A;  3EVQ A;  1KTK A;  2YU9 B;  1UEA B;  4FYD A;  1B44 D;  3T56 B;  1ZEQ X;  5EQ0 A;  1ILP A;  1JCK B;  1TR5 A;  3VR5 A;  1QOH A;  1YNN C;  3LNN A;  1STE A;  3BDO A;  4HMI A;  5C5M A;  2XVS A;  3T16 A;  4KJN A;  5ELE A;  3X3M A;  3KBG A;  1QWY A;  1AN8 A;  4BBR B;  1MGS A;  1DJR D;  2SNM A;  1KDA A;  2SNS A;  2KCC A;  1IYV A;  2V4D A;  5JPM C;  5E4X A;  4ZLT F;  1RD9 D;  5COY A;  2Z1C A;  2GA4 B;  4A3B B;  3BDL A;  2J0T D;  2Z4I A;  4J1M A;  3HZX A;  3OHX C;  4TQU S;  4DA2 A;  5HUR A;  3N6R A;  4HCS A;  2JA8 B;  1PTO B;  4ZQ3 A;  1RJT A;  4JBW A;  4L6T B;  3FMC A;  3OSO A;  4RWS C;  2O2L D;  2K05 A;  4FVM A;  1D5Z C;  2MGS A;  2L9H A;  1GUG A;  3IFT A;  3K6O A;  3QWN A;  2EY2 A;  2QEJ C;  4MHE A;  1JOK A;  3I3C A;  5CV5 A;  2I46 A;  2JSO A;  2K5Q A;  1GUS A;  1OXU A;  4B9X A;  3OMG A;  5FLX E;  4KKS A;  5M3F B;  4O42 A;  3N52 A;  4KHV A;  1DCZ A;  4OO1 G;  3G7L A;  5C0X J;  5IGG A;  1ENC A;  4LK1 C;  1YNN D;  1MD2 D;  1X3P A;  1EU4 A;  4AYB B;  1I4R A;  3SR1 A;  2XNA C;  3CRK C;  1PTO H;  4IFD I;  1DOM A;  1B9N A;  2F0P A;  4F87 A;  1BDO A;  2RDH A;  2KCN A;  3K5M A;  1BCP B;  1A15 A;  1DON A;  2KUM A;  1OXT A;  1WTR A;  1HQM C;  2Q8I B;  4HR7 B;  3DXJ C;  4KY5 A;  4RGT A;  2VB2 X;  3CRL C;  5T1I A;  3H94 A;  3IKJ A;  1I6V C;  2D62 A;  3J80 L;  4K6D A;  4V0B A;  1PMR A;  2B2T A;  5IOD A;  3G6J B;  4DK1 A;  3P75 A;  5J1Z A;  2R61 A;  1ROD A;  2OT2 A;  3K0Y A;  2F0J A;  4H44 C;  1RF2 D;  1SE3 A;  1C48 A;  1FNV A;  4R8I A;  3D8G A;  2J7Z A;  2PW5 A;  1STG A;  2LMC B;  2PPB C;  2DNE A;  4ZK9 B;  5I2X A;  1WCM B;  1O7Y A;  2SEB D;  2K33 A;  3HKZ B;  4BA1 I;  1IKL A;  5CBA E;  3A56 A;  1HHV A;  2N55 A;  3GTK B;  2VNU D;  3RZO B;  2BDO A;  3DHQ A;  1GUO A;  1TWF B;  2X6G A;  2RKS A;  3NQT A;  2F0Q A;  4ZRZ A;  2B2Y C;  4WOR A;  4C56 C;  3PUW A;  3DUZ A;  4FF3 A;  3GTG B;  2KHS A;  1JWS D;  2JXM B;  1H9K A;  2J4X A;  3RLF A;  4GZY C;  4C1N K;  2EXZ A;  1BOS A;  2RDG A;  1CZW A;  3V05 A;  4DAY A;  1STY A;  2NUC A;  1OXX K;  1Y1W B;  3SHL A;  1T5E A;  3A55 A;  3FEW X;  1STH A;  2NTT A;  2JE6 I;  3SE0 A;  1EWC A;  4X3U A;  1BF4 A;  1PTO C;  1EIG A;  2F0M A;  1NR4 A;  5FKA C;  3VR2 A;  3OWF A;  1A3V A;  1PFM A;  3QJY A;  4ZUJ A;  3GD7 A;  2AWO A;  3HP3 A;  1CI3 M;  3GV6 A;  5M5W B;  4R9W A;  4WFN 3;  3HOW B;  2NTS A;  3J7A F;  4RCN A;  4HED A;  4MIU A;  4S3S A;  1KAB A;  3H91 A;  1OXV A;  1WVL A;  2EY1 A;  1G8Z D;  2AWN A;  5A2Q L;  3SVM A;  1VMP A;  3HOZ B;  5IGE A;  4RA8 A;  5I2Y A;  1CT1 D;  3W3A A;  3TZU A;  3GV3 A;  1X32 A;  3HG9 A;  5EBC A;  5JPN C;  5K36 H;  3NHH A;  1S5C D;  1RTO A;  3S1N B;  1TWA B;  5FOB B;  4PNY A;  2K04 A;  4DAV A;  2B2U A;  3TP8 A;  1DD2 A;  2JEA I;  3GTO B;  1T5X D;  3KLS X;  3HGB A;  1DOL A;  2QF7 A;  5FO8 B;  1EY4 A;  1F2L A;  1PZI D;  5COR A;  5JEA H;  3HOU B;  3EQL C;  3E6Z X;  2D9U A;  1MSG A;  3MXN A;  4I65 A;  1C8C A;  3S15 B;  3BVZ A;  4H13 C;  3QOL A;  2X6L A;  1B9M A;  3R8B A;  1KAA A;  4ULL A;  2EY5 A;  3VYR A;  3L7Z C;  5TSS A;  1PZJ D;  2XRS D;  3FKI B;  4RH6 A;  4XXE A;  5CV9 A;  2AQ3 B;  1CFM A;  1SSO A;  3T13 A;  4G4K A;  1LAB A;  1E2Z A;  3SK5 A;  2ICI A;  3TME A;  2LFN A;  3V2T A;  1MBY A;  3I73 A;  4F88 A;  2A73 B;  2RSO A;  3PUZ A;  3K5N A;  4A3E B;  1F9P A;  2EOT A;  2A6H D;  1LT6 D;  3GQB A;  2R7Z B;  4C3I G;  1LTI D;  4CKC A;  1CQF A;  2F0G A;  1BUV T;  2WAC A;  1TS5 A;  3L9A X;  4IUU A;  2PZT A;  3R2T A;  4C3I B;  5T1G A;  5K5P A;  3RZD B;  4RHR A;  3S2D B;  1V1P B;  4EGV A;  2M9V A;  3Q0A A;  1HTP A;  3PO2 B;  1TY2 A;  2MJ8 A;  1JOO A;  2Z4H A;  2KEC A;  3VYS A;  1K8M A;  3MVV A;  2XRQ D;  1HTL D;  2B2W C;  2FMC A;  1V43 A;  2DY7 A;  2A6E D;  1CQV A;  3PIP 3;  1QB5 D;  2B2W A;  5IIF A;  1HXY D;  4CJ0 B;  1MI2 A;  2Q8R E;  1LTR D;  5C5L A;  1ENA A;  1PLF A;  1HA6 A;  3W2D A;  4HSV A;  4ME5 A;  4CGY B;  5FO9 B;  1EY0 A;  3LWE A;  3KUP A;  3HRZ C;  4V19 0;  1W6K A;  1EWH A;  4KKT A;  2WP8 J;  1TWG B;  4C3H B;  3DEP A;  5CBE E;  4KD3 A;  1CTM A;  2IX1 A;  1EFI D;  1EYD A;  5CR3 A;  5ISR A;  3IL8 A;  1H9S A;  1UUP A;  2A6H C;  3I90 A;  3D4R A;  2XSC A;  3PV0 A;  1TT2 A;  2EYF A;  4FO2 A;  4XDX A;  4IUV A;  1SE4 A;  3GTL B;  5I9O A;  3I91 A;  1F9R A;  2C5C A;  1HA5 A;  1NR2 A;  2F3V A;  2F0K A;  5DEH A;  1STB A;  2HDL A;  3FPU B;  4DF7 A;  4A3K B;  1TKW B;  3S14 B;  1ESF A;  5EPL A;  5CMD A;  2K5D A;  3M85 A;  5F2D A;  3D6C A;  1AZP A;  4A3I B;  3T53 B;  4K8J A;  2YYZ A;  3ERQ A;  3H6M A;  4CJ2 C;  3U9S A;  3SK6 A;  3GP7 A;  3C3L A;  4IQZ A;  5EBD A;  1G2T A;  1SJH D;  4CKE A;  1FR3 A;  2AQ1 B;  3NPP A;  4FXK C;  1B53 A;  3K58 A;  1U4L A;  1EQV A;  3FDT A;  3ND8 A;  2B2T C;  3J81 L;  5JOB A;  4ZYS A;  2RDF A;  1EOT A;  1LV9 A;  2EJF C;  3OWE B;  4KN4 C;  2VXW A;  4X3K A;  3SK4 A;  2D2C C;  2C9O A;  3TN2 A;  2EYL A;  2PO4 A;  1SMY D;  1XX8 A;  1LTB D;  4RFB A;  1S4Z A;  2EDG A;  3OIP A;  4C3J G;  1QG7 A;  4L8J A;  2XIW A;  4OIJ A;  2CQA A;  2LS0 1;  1D2B A;  5JEA G;  3BYT B;  3A8I E;  5D3D A;  2F0W A;  2F1M A;  1TII D;  3PUX A;  1CK1 A;  1SE2 A;  2BA0 A;  5JVG 3;  2EYH A;  3S2H B;  3MTS A;  1C4Q A;  1R9T B;  3RMH A;  1EY9 A;  3EA6 A;  3HS0 C;  2FIN B;  4Q0F A;  1U4P A;  2XN9 C;  2PCF B;  1BBX C;  1QIL A;  4IAL A;  1QCB D;  4BWG B;  3NXW A;  4OGQ C;  1CA5 A;  1I4Q A;  1Q1B A;  4M1U B;  5C4J B;  1HCZ A;  2DN8 A;  2ENB A;  1Y8N B;  4LAA A;  3OW7 A;  2BOS A;  2O5I C;  1CZG A;  1K8O A;  3R2I A;  3S1R B;  1D6E C;  2E2I B;  2IW3 A;  3LX0 A;  4IUT A;  2KVM A;  1PFN A;  2MHV A;  1FD7 D;  4KJO A;  2B63 B;  5EKI A;  1SMY C;  3I72 A;  4WJW A;  1TVX A;  4ZKB B;  1II3 A;  1JC7 A;  5C0X I;  5J22 A;  1PRT D;  5DAU A;  1E0B A;  4QUF A;  3ND9 A;  5IT9 E;  1Q12 A;  3IAY A;  2ID0 A;  5KRU A;  4F8M A;  1EEF D;  1FNW A;  4C3H G;  2H4O A;  3C2P A;  2NWG A;  3SK8 A;  4FXG C;  3VR3 A;  3AB9 A;  1I3Q B;  5IGC A;  4K6L A;  1SBB B;  1QJO A;  1SNO A;  1KNE A;  3NE5 B;  4U67 3;  1LAC A;  1F2M A;  4A3M B;  1Q1E A;  1EIH A;  1I4P A;  1EQT A;  1WTP A;  1LTS D;  4X3S A;  4BA2 I;  2IWH A;  1WD1 A;  2MPM A;  2EZV A;  1SJE D;  2M2L A;  2B8F A;  5KYI A;  4H7B A;  3MXU A;  4UAI A;  2F0L A;  3VA7 A;  2FJ2 A;  4IUQ A;  1I4H A;  3VA5 A;  5CV6 A;  3D4W A;  4DXF A;  3ITP A;  3BDC A;  2HDM A;  3PUV A;  3MWY W;  3WDN A;  5LL6 X;  2I07 B;  2NVX B;  2F0O A;  1AW7 A;  3UI2 A;  3M3Y B;  5KIX A;  3EFX D;  4KN7 C;  1STN A;  5KYL A;  4ZAI A;  4OL7 A;  5EPK A;  1FNU A;  4NKL A;  2R3Z A;  3A8J E;  2FHT A;  1GHK A;  3P7J A;  2EJG C;  4WRD A;  4OO1 H;  3URY A;  3O13 A;  2ZXR A;  1JOR A;  1ET9 A;  2EYJ A;  2NVT B;  3J80 E;  1LO5 D;  1A2T A;  1GOZ A;  3DMU A;  2K5W A;  1SYD A;  2ZXP A;  2L55 A;  1STA A;  4I7Z C;  5IT9 L;  2TSS A;  1M8A A;  5D14 A;  3A8K E;  1O78 A;  4PMC A;  3OIQ A;  1Y1V B;  1LTT D;  1AP0 A;  1Y8P B;  1H9R A;  5EKK A;  5M5Y B;  3CQZ B;  2ICE C;  2AQ2 B;  5ELF A;  3F2U A;  1ILQ A;  2WV6 D;  4N9T A;  3M7N A;  1L0X B;  1SAP A;  2EYO A;  1X3Q A;  2KJX A;  3BG3 A;  1KLG D;  2F0T A;  4O1N A;  1PFB A;  3GTP B;  2PW7 A;  2TMP A;  2PZW A;  5LL6 S;  5FLX L;  3A54 A;  4HTH A;  2DNC A;  2Z8L A;  2EYP A;  3HEJ A;  4XYO A;  4F7X A;  3SXH A;  5C3X A;  3K57 A;  1WD0 A;  4J8Q A;  1E2W A;  1DXM A;  4EVO A;  3A7L A;  3R3O A;  3VR6 A;  4PMB A;  1B3A A;  2JYO A;  3EJI A;  1NUC A;  1HRJ A;  2IT1 A;  1B1Z A;  1IHZ A;  1G29 1;  3FPP A;  1FGB D;  1NCV A;  3MA2 B;  1TS2 A;  3P1H A;  3BZD B;  1S5E D;  4EQO A;  1RKN A;  3Q6S A;  4A3G B;  2R6G A;  1GUN A;  3QIA A;  5DNF A;  1BCP D;  2ZT9 C;  5ELC A;  5IGF A;  3MFY A;  3KLS A;  4NDX A;  4C1N I;  5C4Z A;  4K5X A;  2NBF A;  4RKL A;  2PNR C;  1F77 A;  4ODG A;  3J7Y W;  2G9D A;  3BS1 A;  2BCO A;  1SYE A;  1UAP A;  2NYZ D;  4XTC S;  1SEB D;  1IL8 A;  3VYU A;  1PZK D;  2R92 B;  4IUR A;  1PYW D;  1JWM D;  2B2V C;  1I50 B;  3DWP A;  1EY8 A;  1R4P B;  1A6X A;  2RBM A;  4EQP A;  4G7H C;  1KLU D;  4C3J B;  3X3N A;  2KOL A;  1GXD C;  5D3I B;  2NN6 H;  5EPJ A;  4HSP A;  3AMU A;  3DM1 A;  1LTA D;  5J39 A;  2XWJ B;  4ZKC B;  1EU3 A;  2F0E A;  1PXU A;  1D1I A;  3GTJ B;  3MFG A;  3VR4 A;  1WTX A;  4K5V A;  1GHJ A;  1ENF A;  3K7A B;  5CV8 A;  5FK9 C;  5CV4 A;  1TWC B;  1XWE A;  2QIL A;  3HOY B;  4RGM A;  2VB3 X;  5C3E B;  5NUC A;  3DWQ A;  2NVY B;  3CHB D;  4L63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...