1S5DD

Cholera holotoxin with an a-subunit y30s mutation, crystal form 2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase,toxin
molecule keywords Cholera enterotoxin, A chain
total genus 25
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s5dD00
2NTSA 4RHSA 1SXTA 1I4XA 3DWPA 1JWUD 1SBBB 1XXGA 3BVZA 5D3DA 1B1ZA 1PRTD 4C56C 4RCOA 1SJHD 1LTID 1SJED 1TS5A 5ELBA 1HTLD 1FNUA 4RH6A 3W2DA 1LT4D 1HXYD 1D5ZC 4RGOS 1RF2D 4RGNA 1JWSD 2O2LD 1LTSD 1PTOF 3R2IA 1LTAD 1TS4A 1XTCD 4L6TB 4RGTA 4ZYSA 1S5CD 1RCVD 4DXFA 2G9HD 2AQ2B 1S5DD 1CQVA 1LTTD 1PRTF 1BCPF 1S5ED 5D3IB 1MD2D 1G8ZD 2RDHA 1LT3D 3MFGA 1LT5D 1SE4A 2XRQD 4DXGA 1QILA 2XN9C 1FD7D 3BYTB 1PTOC 1TY2A 2CHBD 2XNAC 1I4PA 3OWEB 3URYA 1PZKD 4RHRA 1JQYD 2IJ0A 1I4GA 1TS2A 1PRTC 1S5FD 1LT6D 1PZJD 3BYYB 1SE3A 1JCKB 1BCPD 1I4QA 1ET6A 2TSSA 2R61A 4TSSA 3V05A 1LTGD 2RDGA 1KLUD 1V1OA 3EFXD 5ELFA 1BCPB 1GOZA 1PRTB 1EU4A 1RD9D 1B44D 1S5BD 5FK9C 4K6LA 2NTTA 4RGMA 3EA6A 4RFBA 1FNWA 1D6EC 1D5XC 3O13A 5FKAC 2ICIA 2SEBD 5ELDA 1EEFD 1ET9A 1D5MC 1KTKA 1BCPC 1HA5A 1LTRD 1FGBD 1CHQD 1HQRD 1PTOH 3DWAA 3TSSA 1I4RA 1EEID 3GP7A 1ENFA 4O1NA 3DWQA 2AQ3B 1AN8A 2J4XA 1LTBD 1EWCA 3CHBD 1SEBD 1DJRD 3BVMA 3MC0B 3SEBA 1I4HA 1V1PA 1EFID 2IPKD 5ELEA 4BWGB 1TS3A 3R8BA 3BVGA 1UNSA 3BZDB 1PTOD 1CT1D 1L0XB 1PYWD 1TY0A 2WV6D 1LLRD 3R2TA 1AW7A 1L0YB 1PTOB 1SE2A 1T5XD 1UUPA 2QILA 2Z8LA 3KLSX 4OHJA 1ESFA 4Z9CB 2XRSD 5ELCA 1CK1A 1CHPD 2AQ1B 1DYQA 1V1PB 2QEJC 1JR0D 1LO5D 1STEA 5TSSA 4L63B 1RDPD 1FNVA 4UDUC 1BXTA 1F77A 1EU3A 1JWMD 5I4DA 1PZID 1KLGD 1M4VA
chains in the Genus database with same CATH superfamily
5I6WA 1B53A 3D4RA 4ZUJA 4GOPA 3HOVB 1PH8A 1SJED 5C4JH 3U9OA 3W2DA 4G4KA 4MN3A 5M3MH 3RLOA 4RGNA 3OMCA 1TIID 3VA5A 2UUCL 2DJGC 1CZWA 3SHLA 4BY7G 1PFBA 4K0KL 1TR5A 3I4LA 4LF8L 2F0PA 3M4YA 4LF8Q 4U68A 3PUYA 1D2BA 4B3RQ 1ZEQX 2KHJA 1LT5D 1X3FA 3KLWA 4IOAA 1SSOA 4AIMA 3QJYA 3GO5A 4FYDA 1ESRA 4ID6A 1JQYD 2K04A 1GUWA 3K0XA 1B9NA 2Q2TA 1LV9A 1KNAA 1PZJD 5CBEE 1SMXA 4XT1B 1Y1VH 3DEPA 3V05A 1N8RC 5F2DA 3H09A 4KV6A 1K83H 3J81E 2IHEA 4JI6Q 3J81c 1KRTA 1VDZA 3BJUA 2NTTA 2ZTCA 1WD1A 1D6EC 3BZKA 4A3BB 4DR4Q 4DAYA 2E5LL 1NMFA 3S17B 2F0KA 5G3LF 4DNRB 3MVVA 1IL8A 2CWPA 5IIFA 5DM63 2HD3A 4IN3A 5CV7A 4DR3Q 2RSOA 2R7FA 4C3JH 5C3EG 3MTSA 2MPMA 3D31A 1CT1D 1L0XB 1RKNA 1ZYRD 3SK8A 4APVA 2A8VA 4XQJA 1S40A 1BR9A 4MTNA 3R2TA 1L0YB 5IYDH 3ER0A 4CKCA 4LF7L 1SFOH 2PZWA 3LNNA 4Q5VA 3H0GH 4X3TA 3PUVA 1ESFA 5AFWA 1GVPA 4K2LA 2A6EC 5KYLA 4L63B 4XYQA 3HOXG 3VDYA 4TRDA 1QVCA 4IUTA 2Y0SG 1CSQA 4HCSA 3JAMc 1VQOA 2Q2UA 2EOTA 2ZTDA 4PV1C 4WRDA 4L5SA 2XTIA 3H6MA 1B1ZA 4C56C 3VYUA 4RCOA 5A2QE 4DR2L 1VQ8A 2AWNA 2XSCA 4HEDA 3KDFB 1CKMA 5BN4A 4MIUA 3A54A 1JWSD 4BBRG 5C44G 4X6AH 1X55A 4A4IA 4ZKCB 2SDFA 5BN3A 5J1ZA 2BA0A 1JOQA 2F0DA 4IURA 3MHBA 1P8LA 3E0JA 1LTTD 3F2CA 1I3QH 5D3IB 3KOJA 3KBGA 4KTAA 1LT3D 3W5OA 3AFQA 1FD7D 1SYEA 2YTXA 3GTJH 4UY8C 3J80i 3QWNA 3URYA 4POGA 2KCTA 1EQQA 1N33L 4LJZC 1SMYD 1LACA 1S5FD 3E9HA 1I4QA 3CP0A 2JEAI 1E2VA 1QUQA 2R61A 4N8FA 2JA6B 4JI3Q 4X65Q 1GOZA 4NXMQ 3GD7A 4A3DB 3VYTA 1F2MA 3C1FA 1HHVA 5JJLA 4AYBB 4LK1C 3M7NA 2AMCB 3K57A 3EVQA 1CA5A 3IKJA 2WAQE 3GV3A 2A5HA 1GD7A 1PTOH 2GVBA 1EEID 3SGIA 1O80A 1AN8A 3SXHA 3K7UC 3MZ5A 2O4XA 5C4ZA 4MTKA 2IPKD 2X69A 5IT9E 3BVGA 3N52A 1STBA 1HNWL 3TS0A 3HOZG 1DOLA 1C9OA 2RHSB 1I5FA 2WKCA 4IUNA 1VQDA 4DFAA 3D4WA 1EOTA 3PUWA 1GUGA 4B3TL 1WD0A 2F0WA 4A3GB 2QEJC 2AQ1B 3A56A 3C1EA 1STEA 1Z6HA 4GLXA 5EBCA 2ENBA 4H13C 3VR3A 1O7IA 4GNXC 3DMUA 5M3MG 5NUCA 3BG3A 2OCEA 4KHZA 3CCJA 1IBKL 3GTOH 3U4VA 3I4MG 1I50H 1SXTA 4X66Q 4J1MA 4GS3A 4FF2A 5CR3A 4LF9L 2VQFL 5M5YH 1TT2A 2PZUA 2PQAA 1N32L 3KJPA 1RF2D 1RIPA 2WB1B 4A3FH 3HKZB 4JBMA 2JYOA 4L5QA 1Q1BA 1K3BC 1UAPA 5C4HA 1FJGQ 4GN4B 3T53B 4JI0Q 1I6HB 1SYDA 4LWCA 5FLMH 3HOZB 1IZ6A 4DXFA 4WJ3M 1PHJA 2QA4A 3CQZB 1BCPF 2R6GA 3OOCA 2F0NA 4ZUIA 5CBAE 4DV2Q 2MFIA 2M00A 1IBLL 3I4NH 1NCVA 1K73C 4LMQD 1N36Q 3CXCA 2CH4A 3OWEB 1WTPA 4OONA 1DCZA 4QJFA 2RF4A 2IX3A 4OELB 2BH8A 2WACA 4A3MH 1YJNA 2JQOA 4R1JA 3PIP3 1F9PA 2O5IC 5JEAH 1CZGA 2E2HH 2E74C 2R92B 5JJKA 1DONA 1BCPB 2LMCB 2R93G 1B44D 1XNQQ 1VCIA 3K80C 5IYCH 3NENA 5JVG3 1DD2A 2ICIA 5EBDA 1N34L 4A93G 5K36G 3CCRA 1J9OA 1HA5A 4DR7Q 1MJCA 1FGBD 1HQRD 2CQOA 3H3VI 1KIXA 1HCZA 2L0CA 4WFN3 2RCNA 5M9OA 1TVXA 4JI0L 2C5CA 2E76C 3GTJB 3TEHB 3K5LA 5E4XA 4DUZL 2FFKB 2YTYA 5C3XA 3HOYH 4DR1L 1K0RA 1IYJB 1KABA 2NVTB 2MUYA 1STNA 1Q46A 4OHJA 3PIPA 3GTKH 4R4IA 1F2LA 3CAMA 4DV6L 2JA7G 3ITPA 3DM3A 1CUKA 1JR0D 1AZQA 1K8GA 2C35B 3RZOH 3MXUA 2XWJB 2EYOA 1I6VC 4DR5L 3TP6A 4O2DA 3MEFA 4OWXB 4C3HB 3AMUA 3S1RH 4KHPL 1X54A 1QCBD 4F7XA 1B8AA 4FNFA 1JJCB 1TS5A 4DV7Q 1U0LA 4QIWB 3J7YW 4GKKQ 5M3FG 2N78A 4LF6Q 4OO1G 5EKKA 2XVSA 1BBWA 4IO9A 2Z6BA 3HOUH 1LYLA 2HQEA 4C1NI 4DK3C 4JI2L 5LMNL 3VYSA 1RJTA 4YCWA 1CM9A 2D9UA 2K4KA 1TQOA 2HIVA 4GKJQ 2E2JH 4A3JH 5IT9c 3E3XA 2K01A 4HCEA 1VMPA 5LL6S 1TY2A 3HKZG 3NWTA 2V1CC 1KC8C 5BR8Q 3PUXA 4AH6A 1X9NA 2Z1CA 2Q2HA 1TKWB 1GHKA 1L1OB 2I5LX 4CJ2C 1X3GA 4KMUC 3U50C 1PRTC 4AQYQ 1PH4A 4IJLA 1Y14B 4C3IH 1HNXQ 4JV5Q 2CH4W 1B3AA 1MJEA 3HOWH 2IWHA 5IP9H 4KK7A 1IXRA 4O0AA 3Q23A 4JI3L 5IGEA 2KUMA 2VS1A 1K83B 1ZXTA 1J5EQ 4AYBG 5ELNA 4RGMA 2NN6H 2YV5A 2KEDA 1Y1VB 3I4NB 1PH5A 2RKSA 3CMEA 4DV6Q 3CQZH 3BDCA 2D0PA 1YJWA 4DAPA 3M85A 2MNAA 1PFMA 1ASYA 4G57A 1SMYC 1XWEA 2DJFC 1DJRD 4NKLA 3SEBA 1R4QB 1I4HA 4BY1H 4DUZQ 1NTGA 4IPCA 2ASBA 1RHPA 1BF4A 4BY1B 2KCNA 3KF6B 4JBKA 2VUMH 1GHJA 1QVFA 2KVMA 2Q2IA 3FVQA 3NK9A 2A1AA 5D14A 4DV3L 5IWAL 4L8JA 2I0QA 1I50B 5EGTA 1YITA 1VQJA 1XNRQ 3C46A 1EY5A 1CK1A 4BXXG 1V1PB 4DV0L 2B2VC 1HQMC 3P1HA 2VW9A 2JN4A 2F03A 1C0AA 5I9OA 5I6YA 2K5DA 1Y8NB 4BA1I 4PQXA 1JWUD 1Y1VG 5IGFA 1Z47A 4DNTB 2L4NA 1HXYD 5EAYA 4BA2I 5EPJA 2VY3A 1VQNA 5JJZA 2KECA 5KYIA 1D8LA 1PTOF 2O5JC 1HUMA 2VQEL 3FKIG 1U5KA 1K3RA 1RCVD 1GJXA 2BDNA 5HY6A 3HFZB 1I94Q 2PNHA 4DR1Q 1EYAA 3D3RA 2JA5G 3OWFA 3T13A 4IALA 5CV9A 1E1TA 2N55A 4PG3A 4GN5A 2CHBD 2AHOB 2K28A 4MZ9A 4A93H 3SVMA 3CW2C 1Q12A 3S1RB 5L37A 2F0MA 1HNZQ 4EX5A 3BYYB 1SNQA 5C44H 1ILPA 5KNCA 2UUAQ 3TZDA 1Z9FA 2VQEQ 3NBIA 4X64L 1YHQA 3PO2B 3PSIA 4IZ8A 5C6AA 3RN2A 5T1IA 5C4XB 3GQBA 4FO2A 2PI2E 2KENA 4K5VA 1H95A 2Z4HA 1SR3A 1KDCA 1EL0A 1PYBA 4RWSC 4ZRZA 4C3IG 2RSNA 3QIAA 2NVTH 1TWGB 1KTKA 1CHQD 1DXMA 1GKHA 3UE1A 1TWGH 3I72A 2OT2A 2K50A 1SDFA 1PDQA 2EYJA 3KFUA 1EY9A 2LXJA 1EWCA 3CHBD 2K5VA 2ZXPA 1V1PA 5DAUA 4OWTB 5IE8A 1HR0W 2OWOA 4B3RL 4KY5A 3ND8A 2WP8J 1F2YA 2PW7A 3M7GA 2UU9L 4JI5L 2F4VQ 3S15H 2XRSD 4JI4L 2QCPX 1AE3A 4QUCA 3CCQA 4YWMA 4ABNA 3CC7A 1UE1A 1BXTA 3HP3A 1EU3A 5C3EH 4CDEC 2NTSA 4A3MB 2H5XA 1C4QA 1MSGA 4K6DA 2BA1A 1XX8A 4DKAC 1IBKQ 3T1HL 1B7YB 1LT4D 2QW7A 2PYKA 3S24A 1DM0B 1WOCA 1Q1EA 4KLKA 3KUPA 2H4OA 3PV0A 5I9PA 1E24A 4GOPC 1D1IA 3FEWX 1A3VA 4QUFA 1VQFA 4OO1H 2AWOA 4DV2L 5IGBA 5C0XI 4NDXA 4IUPA 3OTOL 1UEAB 2OQ0A 1SYGA 3MFGA 3DLLA 1U4PA 1EZ6A 4A3EB 4KI0A 1S72A 4V190 1NSNS 5HGQA 5M3FB 2CFMA 4QY7A 3NTHA 1FL0A 4P74A 2HT1A 2CVRA 2KCMA 1XMOL 1F9QA 3QB3A 4K14A 1Y8OB 1JORA 2A68C 4LFAL 1YZ6A 4JCVE 4N9PA 1EIHA 2MHVA 1SN8A 4LFBQ 1G51A 1WCMB 2OEOA 3VYRA 2K03A 3S1NB 4LF5L 4KKTA 4B3SL 5ELDA 4DAMA 4A3MG 2JA8H 1CI3M 3I3CA 1LTRD 2A68D 4KD3A 3M3YH 4JVZA 4ALPA 2KHSA 1LTBD 5IGDA 3BVMA 1K8OA 3NPPA 2QGQA 2UUAL 3NWSA 1E0BA 4A3KB 1JB7A 1S4ZA 2K32A 1OO9B 1YJ9A 3J7AV 1Z7TA 5M5XB 3PO3G 5HGTA 2ZT9C 3QOJA 1S3OA 3A5UA 5CV5A 1G6ZA 1KAAA 4DV3Q 3EJIA 1JMCA 2EJMA 1O7ZA 4M8AA 3R93A 4IFDH 3P7JA 3DEOA 5ELOA 2EY1A 2K52A 2A6HD 1VQMA 4ZKBB 1E3PA 1BQQT 5FJ8H 4A3DH 1VQ5A 1GO3E 4PMBA 3RLFA 5FOBB 4A3IB 1IL2A 2EYLA 2B63H 2F0TA 1SE8A 1PLFA 3KBXA 1E2WA 1OXTA 3I4MH 1G6PA 3HOUB 1B3QA 4ULLA 3JAME 3EN2A 3K58A 1UE7A 3M4QA 3NXWA 2UXBL 3ZJYC 4CJ1B 5J39A 4A3IG 2QDLA 5KNBA 5FLMG 5I2YA 2RBMA 3KLRA 4J15A 3LGJA 2EIFA 4ME5A 1I3QB 4PZ8A 4RGTA 5JJIA 1HNXL 2HUGA 2F0UA 4A3FG 3D0FA 4A3GG 4X62L 1KAWA 1K28A 1F9RA 4LUVA 2MO1A 5KNDA 2LS01 1UE6A 3K59A 3BYTB 3WDNA 2BE5C 3KK7A 4K0KQ 4Y7NB 2B3GA 1YHBA 2JEBI 3I56A 4L5RC 2PMZE 4XT3B 3A5ZB 2L55A 4HTHA 1J8IA 2JA8B 3T51B 4CKBA 5CC4A 1PA6A 2B2TA 3AYHB 2IY5B 2KBNA 3LX0A 5GQOA 5KEEA 4KJOA 1C7YA 4JI6L 1QNKA 2ZJRA 5FK9C 1CKNB 2N8NA 5J22A 1BDOA 2A6ED 3H0GB 1QOHA 4CDFC 3OW7A 3VR5A 3MWYW 2BDOA 1ENFA 4OIKA 4LF7Q 4DR5Q 2ATWA 1YI2A 2UXDQ 3RR5A 4DUYQ 2F0GA 1SAPA 1Y69U 3QOLA 4DGZA 3BZDB 2XWBB 2UXCL 4NMZA 1T5EA 4FDBA 4R4TA 1YHAA 3D8GA 3GDEA 3T1YL 3BDLA 1A15A 5CV8A 3J7A5 1EQTA 3CU7A 1WI5A 5T1GA 4UP7A 2G9DA 3RMHA 1EIYB 4HMJA 2PQAB 4UP9A 2CW0C 4J8QA 3STBC 1XNRL 1CA6A 3CCLA 4DV4Q 3S1MH 3PGZA 1ZKOA 2DGYA 1W3SA 4UP8A 4LFCQ 3E0EA 4RH6A 3B6YA 3S16H 4XDXA 1YNJD 4A3KG 2ZJQA 4QMGA 3K6OA 1ENCA 1UE5A 4DV4L 2D2CC 1JE5A 1LTAD 2F0OA 4JI1L 3DM1A 3V2TA 5EJWA 3HOXB 3S2DB 2EY2A 1QB5D 1S5CD 1IHZA 4LFCL 4A3CH 1YIJA 1EOVA 3TP8A 1G8ZD 1PH7A 2KHIA 2EZVA 1SE4A 3J7AF 2PI2A 4KKSA 1G2TA 1H9RA 1IBLQ 2L15A 1ONLA 3HOVH 2XGTA 3CPWA 4CDDC 1SYFA 2NVXB 3CKIB 1LM0A 4LF9Q 1JE4A 2TSSA 3IFDA 3Q22A 2RDGA 1V1OA 3ONAB 3S9WA 4H7BA 3BDOA 4QF4A 4OXPA 2K5WA 1RTNA 4K8JA 3KF8B 3H3VH 4ME3A 1VF5C 3T1HQ 1EEFD 4KKUA 1M1KC 4DR2Q 2DNCA 1NMGA 2F0SA 5C5LA 2E2IH 1NNXA 2L12A 1WTQA 1WTOA 4EQPA 2KOLA 1TS3A 5IP7G 1UNSA 4JBJA 3GTGH 3M4OH 2L11A 1TY0A 2Q8TA 5KGUA 1STAA 2IX0A 3CCMA 1E1OA 4DAYB 2BH2A 1LLRD 2F4VL 5E3FA 2E2IB 2ZM6Q 1A8VA 1TWFH 2F0HA 1AE2A 4Z9CB 1Q7YC 4G7ZC 2PMZB 1H9SA 2PZTA 1EY0A 3NBHB 1RDPD 2JA7H 5JOBA 4KJNA 1F77A 3OHXC 1XMQQ 1U4LA 1UWVA 1W2BA 4JW0A 2QKIC 3A55A 2ZTEA 2PPBC 2NVXH 5E7NA 5IYBH 1G291 3L3OC 1ICFB 3HOWG 1HA6A 1D5ZC 2NVQH 3FPPA 4RGOS 2PNRC 5C0XJ 2MQHA 4DUYL 1J5EL 2NVYB 2IHFA 1JC7A 1BKBA 4DPGA 1N36L 3CCEA 4LW1A 3F1ZA 4L6TB 4ILWA 2RDFA 4RCNA 4ZYSA 4BY7H 3J80E 2R92G 1SYBA 3KLSA 3F2UA 2V4DA 5IYCG 1VQEA 5FO9B 3OPOA 4JI1Q 4DK6C 3CPFA 2RDHA 2R93H 2D5DA 4JBWA 1ASZA 4XQQA 1C48A 3PO2G 1PTOC 1WCMH 1WJJA 1RL2A 2B63G 1G2SA 2R7ZG 1HR0Q 1SLJA 1PZKD 3BZCA 4RHRA 3NQIA 1O7YA 4YY3Q 2B2WC 1IW7D 3NE5B 4EGVA 1II3A 3FMCA 4G7HC 3ULPA 3A8IE 2EYMA 4B08A 3OIPA 4CGYB 3S1MB 2E75C 1SNDA 4TSSA 1KLUD 3JC66 2HDMA 3I4NG 1VQHA 1PRTB 1K9MC 4GKKL 1S5BD 1JOKA 1PV4A 1D5XC 2WB1G 2F52A 1H9JA 3M9BA 1A6XA 2RQXA 4C3IB 4K5XA 2EPBA 5C0XH 2MP1A 1KNEA 3T1YQ 1EY8A 2EQSA 3DWQA 4LF5Q 5JPMC 3Q0AA 1SEBD 3MC0B 3CC2A 3J81j 3MXPA 1L2FA 4IPDA 1A0IA 3WOEA 1ICWA 1Y1WG 3HRZC 3UI2A 2WV6D 2E2JB 1FR3A 3HEJA 5CGKA 2FXQA 1M8AA 4DU9A 3EROA 1D7QA 1HZAA 3KLSX 1XMOQ 1VQLA 1GUNA 1BNZA 1Q81C 4N9TA 2LSSA 3K7AH 1E22A 3KF6A 4FP5D 2NUCA 1KLGD 4ZCKA 2WINB 4E6IA 4NW2A 3SE0A 1KQSA 1X56A 4IUUA 3G6JB 3NELA 4B9XA 4BY7B 4CDCC 1VQBA 3IFTA 3JAML 1DZ1A 2K14A 1D1KA 4X66L 3HKZE 3RZOB 4U673 3ND9A 3C2PA 1X3EA 1G91A 1C8CA 4OX9Q 3RD4A 1TU2B 4JK1C 4JG2A 1STYA 3P20A 4OEMB 2I5MX 1XTCD 5A35A 1PH6A 3E9IA 4K8IA 1PYSB 1EQRA 2Z4IA 4FXDA 3HOWB 4A76A 2Z9HA 1HZBA 1EUJA 1BUVT 4JYAL 5EQ0A 2A74C 4HIKA 5COYA 4ODGA 2ES2A 5CMDA 2ZJPA 4LAAA 3GTQH 4DK0A 3TREA 1EIFA 2GN5A 5CYUA 3ULJA 3RLNA 3NSWA 2MGSA 4A3IH 1WTHA 3MXNB 5KIXA 2VUMG 2UUBL 1LTGD 1L1OC 4A93B 4FF4A 2UXCQ 2HHHL 4DR6Q 1Y8PB 1RD9D 5G3LD 4QGUA 3EA6A 3G71A 4BBRB 1B4OA 2A73B 1QJOA 5FKAC 1VF7A 4EQOA 4KHPQ 3A74A 4IFDI 2HCIA 2K05A 3DWAA 3TSSA 1I4RA 3RUZA 2WAQB 4TQUS 1XTDA 1QE6A 4A3KH 2IL8A 5IGCA 1XJVA 1N33Q 4OX9L 3U58A 2UXDL 1MBYA 5IP9G 2B2YC 4MNOA 3HOUG 4C3JG 4DN4M 1QNUA 2K5QA 2Z6KA 4P75A 1JOOA 1SE2A 4ZQ3A 3S1QB 4C3HG 5EKIA 4CKEA 4BBSG 3PO3H 1R4PB 4Q0FA 1MGSA 2QILA 3OIQA 2DNEA 3L7ZC 3L2PA 3S1NH 4R8IA 2VNUD 4DV0Q 1FNVA 5IT9L 3NUCA 1FYCA 2FHTA 2XIWA 4PZ6A 1EQVA 3GTLB 3CF5A 4HIMA 1V9PA 4HN7A 2R3ZA 4GKJL 1XPOA 4FVMA 3MEHA 4PMCA 1PH3A 1XXGA 1QG7A 4LUZA 1FNUA 1WTRA 1O7LA 1L0WA 4FF1A 2B2WA 2LXKA 5M3FH 4JI7Q 3PF4A 2H1EA 4IPGA 4WJWA 3AEVA 3S16B 1LABA 1RODA 3LWUA 3PO3B 2EXZA 1CQVA 3L0OA 4LF4L 2BOSA 2A69C 2NN6I 3DHQA 1QUQB 2Q8RE 3Q24A 4B3MQ 1WVLA 1Q86C 3UDXA 3PMFA 3KJOA 1I4GA 1DOMA 4DF7A 2JA5B 2VB2X 4YWKA 3X3NA 4JI8Q 3CRLC 1SE3A 1JCKB 4JOIA 1VQ4A 1FJGL 1WTVA 1MHWC 1X3QA 1EIGA 4J6HA 1T9HA 1VQ9A 3MFYA 4JI4Q 2J7ZA 4M1UB 1KL9A 1FNWA 2QF7A 3S14B 3S15B 1HFNA 2B2UA 2GA4B 1A2TA 3X3MA 2HCCA 2L5TA 2LY7A 1YNXA 1R9TB 5K36H 3HOVG 2AQ3B 3PCOB 4BBSH 2RVLA 3CCVA 5JEAJ 2GVAA 1JT8A 3HG9A 1PYWD 3H3VC 3J81L 4ZAIA 3BU2A 1HTPA 4TKOB 1GXDC 2PCFB 1GUSA 4WJ4A 2L1BA 2Z8LA 5EPLA 3GTPB 3P75A 3FRPB 5C4XH 5ELCA 1X65A 3TZUA 1LO5D 3F2DA 4YIJA 4NB3A 4EVOA 5AJ3L 3QR8A 1PH1A 2RCFA 3W3AA 3PO2H 4HSVA 4C2MB 1N9WA 4LFAQ 2KCCA 3A8JE 4NP5A 5C44B 2YYZA 1QZGA 3GTPH 2R7DA 2FMCA 1A63A 2EDGA 1SBBB 3BVZA 5D3DA 4WORA 1LTID 1Q8KA 2Z0SA 4DV7L 3HOYB 1WFQA 1SNOA 2EY5A 2WKDA 4DV5Q 5GROA 5E4WC 2JP1A 5DLQE 2K6AA 2BE5D 4HIOA 1LTSD 4GLVB 3FP9A 1TS4A 2IX1A 1HJPA 3AB9A 2OTJA 4DR7L 3I4MB 1EZ8A 2F0QA 2YU9B 1BBXC 1PRTF 2B63B 1X6OA 1PVOA 1JJ2A 3N6RA 3J80c 2BCOA 2RHQB 3K5OA 3J7ZC 4KY7A 3TP7A 1O78A 4NXNQ 3TQYA 2NWGA 3HGBA 5FLXE 2WFWA 2E2HB 2EYFA 5A2QL 4RKLA 3U9SA 2PO4A 4HJ5A 3IL8A 4DV5L 3IRBA 3FKIH 3S17H 2EJGC 2JA5H 5GADC 4R4CA 2A19A 3NHHA 2LFNA 1ET6A 5H1SE 3D6WA 1YBYA 1EYCA 1V43A 2F0IA 2NZ1D 2HHHQ 4DR6L 5LHY1 5M5WH 3HOYG 2F4IA 4RFBA 2B2TC 1ENAA 2A6HC 3O13A 3I4OA 3M3YB 1BCPC 4GZYC 4A3BG 1STGA 2ID0A 4X62Q 4YY3L 1EY4A 3PF5A 1M90C 5JAVA 2K1BA 3NQTA 4IPHA 2F3IA 3PQIA 4FF3A 4C1NK 1MSHA 4BWGB 1KDBA 3R8BA 4O42A 4X64Q 4OIJA 3SK4A 4OO1I 1NUCA 3HS0C 5C3WA 1SRUA 2JK8A 3K5NA 2N49A 3OSOA 3I2ZA 3A8KE 1Q90A 2CWAA 1TXYA 2TMPA 1CHPD 4GLAC 4DK1A 4HJ8A 4CJ0B 5FLXL 1TWHH 5D65A 3H94A 4A3EH 5CORA 2NVQB 1JWMD 5I4DA 4A75A 2M2LA 5LL6X 2DY7A 3GV6A 2F0EA 5C4JB 4RHSA 4IOCA 3FKIB 3NTKA 4JPBW 2E5LQ 1A3TA 3EQLC 4IUQA 4H02A 1I94L 3S1QH 2FINB 5ELBA 5DNFA 2VB3X 3I7FA 5ISRA 2AKWB 5FLXc 1VMCA 2O2LD 3WOFA 4A3JB 1E2ZA 5FJ8G 3R2IA 1K8AC 1WCMG 5GAEC 2I46A 2YU9H 3NEMA 3I55A 2J0TD 1K8MA 2WIIB 1S5DD 1XYIA 3CC4A 3GTGB 2ICEC 1PFNA 4UAIA 1U9RA 1EFWA 5GAHC 4DNIA 2XNAC 1VQ7A 3CCUA 3H0GG 4A3EG 3T4AC 1TS2A 3Q8DA 1W6KA 2HIXA 3PUZA 4KHVA 5IYBG 2M9VA 4K2KA 1K0SA 4C2MH 1PXUA 1VQIA 4IJHA 3OMGA 1A3UA 1F9SA 3FPUB 4OGQC 4K6LA 2K7VA 4KN7C 3DXJC 4JYAQ 2SEBD 1EY6A 4PMWA 1HZ9A 1NR2A 3CMAA 4G7OC 3GP7A 4YHHQ 1OXXK 3OTOQ 3SDZA 4O1NA 1QWYA 2B2YA 3MXNA 3UDFA 2J4XA 2Z6KC 3K81C 3S2HB 1EFID 1H9SB 2DUDA 1YNNC 1YVCA 1HPCA 1VQGA 1YNJC 1PTOD 2F0FA 2Y0SB 4GN3B 1H9MA 1STHA 2EY6A 5IP7H 4BBSB 2JE6I 3RN5A 1GUOA 2B39A 2PW5A 4B3SQ 1T5XD 4GOPB 1AP0A 4QL5A 2C9OA 1MI2A 3STBD 3UE0A 3OW2A 2X6LA 4HJ9A 4UDUC 4BS9A 4YWLA 1IKLA 1PZID 1WTWA 5J3BA 4EQ5A 1MKHA 2EXDA 3DWPA 4Y52H 1JJGA 1Q8IA 1ILQA 5IY0A 2UU9Q 4JI8L 1SJHD 5BR8L 2ALYB 2JXMB 3W1BA 4H0LC 3MA2B 4F87A 2ZM6L 1KD1C 1RTOA 4BY1G 2HDLA 3I8ZA 1VQAA 3D6CA 3TS2A 2JSOA 3T56B 3AFPA 2D62A 2IT1A 3H15A 3ULLA 4JI2Q 2A69D 2JA6G 1ML0D 2AQ2B 2JJQA 2P5ZX 1PH2A 1S5ED 3BS1A 3DUZA 1HH2P 4KD4A 3VR2A 3HKSA 2XRQD 3JAMi 2XN9C 2WAQG 1TWHB 3MAQA 1WYDA 2QEXA 4LFBL 1N32Q 4OL7A 4XYOA 4JI7L 3EIVA 2HQLA 2K5HA 2NYZD 2RA4A 5IGGA 2OF1A 1JICA 1SNPA 2EJFC 1CTMA 4IUVA 4L5TA 3ZYYX 3WWVA 2CCZA 1YNND 2VUMB 2B2UC 4RAUC 2EVBA 2B8FA 1X3PA 1EYDA 1TWAH 1W6JA 1AH9A 5JPNC 4LNQA 4XQNA 3SK6A 5HURA 4KN4C 1EY7A 1UEBA 1XPRA 1X32A 1JB3A 1AZPA 1U4MA 1PMRA 1KHIA 1EWIA 4NPSA 4N8X1 2VL6A 1HRJA 5IOCA 3I73A 4I65A 3VR4A 3RNUA 1HZCA 4Y7NH 5M5WB 2KQ3A 3G7LA 3PIO3 3VR6A 1VQ6A 1HUNA 3RZDB 2AUJD 4OWWB 4HSPA 1SNMA 4JV5L 1PTOB 4XIGS 4R4OA 3PIOA 1SROA 1BOSA 4P2CB 1Y1WB 3AQQA 1V1QA 2IW3A 2DY8A 1TWCH 3KDFA 1DYQA 3K5MA 5JVH3 4A3LH 5TSSA 2JA7B 2ZXOA 3J80L 4QB4A 3FDTA 2AUKA 4X3UA 3TRZA 2EE1A 5IODA 3SK5A 3K0YA 1OXUA 2F0VA 1PRTD 1OXVA 3GTQB 1MIUA 1HTLD 4UPAA 3C3LA 4HR7B 1BO0A 1OTCA 1Q3LA 3CRKC 3M4OB 1VQCA 3G4SA 4HIDA 1DOKA 2OQKA 3A7LA 3NTIA 2F0LA 1VS0A 1VQKA 4X3SA 3E6ZX 1TWCB 2CW0D 4BXXH 1IYVA 2LKVA 5FO8B 2L9HA 3K8AA 2N88A 5LMUQ 1Y1WH 1EWHA 2VQFQ 3HZXA 1GM5A 2X6GA 4C3HH 1MD2D 4DA2A 1WTXA 3RZDH 1BBUA 3V96A 2Y0SE 4DXGA 5K5PA 5EPKA 5M5XH 5BN5A 5JEAG 4B3ML 5C0XG 3E5SA 1SYCA 4R8NA 4KY6A 3F8TA 3UDIA 4MHEA 3GTKB 4LF4Q 5DM73 4HJ7A 2FJ2A 5LMNW 3MXGA 2DN8A 4A3CG 2NN6G 3K7AB 4H44C 4P72A 2Q8IB 3TBIB 3EFXD 3QG1A 5ELFA 4EQNA 1HNWQ 2B29A 1KXLA 4AYBE 1TWAB 1XMQL 4F8MA 3CD6A 1AFPA 4UHVA 4QIWE 2OTLA 1CSPA 4B3TQ 5AJ3Q 3A7AB 4ZLTF 4QCLA 1L1OA 1ET9A 1D5MC 1SFOB 1R9TH 1KRSA 1NBWA 5LMNQ 3AU7A 4GNXA 4FXGC 3HOXH 3S2DH 1HR0L 1E7ZA 3S14H 2UUCQ 5CV4A 4C3JB 4DR3L 1XNQL 2K75A 5ELEA 1QZHA 4DV1L 2QDBA 5EKLA 4X65L 4NXML 2R92H 2CKZB 1P16A 3KF8A 3M4PA 3EBEA 3GTMB 2MO0A 4NXNL 4QQBX 1FGUA 1UUPA 3W1GA 3TDQA 2VXWA 1A2UA 4A3BH 1IBML 4CHTB 1J6QA 3L9AX 2JA8G 2EYHA 3G48A 4F88A 4K5WA 5GAGC 4YCVA 2E8GA 3D4DA 3TP5A 1QVGA 4HJAA 1CKOA 1A62A 1I4XA 3UDGA 2ZXRA 2KJXA 4JC0A 4HAEA 1OXSC 3A0JA 3HOZH 3FHWA 1B50A 5IWAQ 3GTMH 3TN2A 1I6HH 1B2TA 1IW7C 4DV1Q 4PNYA 3I70A 3ERQA 5C3EB 3NBHA 2K33A 2WB1E 1PH9A 1IYUA 4IFDJ 4A3FB 3VA7A 4YHHL 2UUBQ 2SNSA 5E1FA 2R93B 2E2DC 4JOIC 4JI5Q 5M5YB 2B2VA 4XTCS 4FXKC 2G9HD 3J81i 1FVIA 2F3WA 3QO2A 1LUZA 1NJIC 2VZAA 1F2ZA 2F3VA 3GTOB 4POFA 1CFMA 1Q82C 4RKBA 1U4RA 3Q6SA 4R9WA 3TMEA 1NY4A 1QILA 4P73A 3GTLH 2PQEA 2KA7A 2NVYH 2B8GA 4YCUA 2EYPA 2G5DA 2FMMA 3KYHC 1I4PA 4A3LG 3S2HH 5M3MB 1XPUA 3I91A 5FO7B 1CKNA 4ZK9B 4A3GH 4IQZA 1EYGA 1IBMQ 2IJ0A 2K5NA 4HMIA 2NZHA 4P71A 1V8QA 2D0OA 4RMFA 1LT6D 4AQYL 4S3SA 2MJ8A 1ZYRC 1H9KA 4DAVA 1BCPD 1DGSA 4I7ZC 3ERSX 1LTLA 2OXPA 1B70B 1PFSA 1GUTA 5I2XA 1EU4A 1NR4A 4TVAB 4LUOA 4PZ7A 1CQFA 4XXEA 3R3OA 1HFGA 1B9MA 2NB0A 1KDAA 1TWFB 5KRUA 5LMUL 3OYYA 3H91A 2NBFA 2JA9A 1HNZL 1AEXA 4RG1A 3F2BA 1VQPA 4BBRH 2SOBA 2NZOA 2R7ZH 2CQAA 2N3SA 5DEHA 3ICEA 3I90A 1BVSA 1YEZA 4LF6L 1NAPA 4IFDG 4I7AA 2R7ZB 3CCSA 2JA6H 3IAYA 2UXBQ 2F0JA 3LWEA 4X3KA 3SR1A 2KEEA 4A3DG 1AW7A 1IKMA 4B9WA 3NP8A 1N34Q 4DR4L 2I5HA 4GNXB 3G6EA 2SNMA 2YTVA 2F1MA 4V0BA 5C5MA 4CBVA 1NE3A 2I07B 5C4XG 5CV6A 3T16A 4R4QA 1SNCA 4A3JG 4RA8A 5IYDG 1M4VA 3U4ZA
chains in the Genus database with same CATH topology
5I6WA 1B53A 3D4RA 4ZUJA 3HOVB 1SJED 3U9OA 3W2DA 4G4KA 4MN3A 4RGNA 3OMCA 1TIID 3VA5A 1CZWA 3SHLA 1PFBA 1TR5A 3I4LA 2F0PA 3M4YA 4U68A 3PUYA 1D2BA 1ZEQX 1LT5D 1SSOA 3QJYA 3GO5A 4FYDA 1ESRA 4ID6A 1JQYD 2K04A 1GUWA 1B9NA 1LV9A 1KNAA 1PZJD 5CBEE 4XT1B 3DEPA 3V05A 5F2DA 3H09A 4KV6A 3J81E 1VDZA 2NTTA 1WD1A 1D6EC 4A3BB 4DAYA 3S17B 2F0KA 5G3LF 4DNRB 3MVVA 1IL8A 5IIFA 5DM63 4IN3A 5CV7A 2RSOA 3MTSA 2MPMA 3D31A 1CT1D 1L0XB 1RKNA 1ZYRD 3SK8A 4XQJA 1BR9A 3R2TA 1L0YB 4CKCA 2PZWA 3LNNA 4Q5VA 4X3TA 3PUVA 1ESFA 5AFWA 4K2LA 2A6EC 5KYLA 4L63B 4XYQA 4TRDA 4IUTA 4HCSA 2EOTA 4PV1C 4WRDA 3H6MA 1B1ZA 4C56C 3VYUA 4RCOA 5A2QE 2AWNA 2XSCA 4HEDA 5BN4A 4MIUA 3A54A 1JWSD 4ZKCB 2SDFA 5BN3A 5J1ZA 2BA0A 1JOQA 2F0DA 4IURA 3MHBA 3E0JA 1LTTD 5D3IB 3KBGA 4KTAA 1LT3D 1FD7D 1SYEA 3QWNA 3URYA 4LJZC 1SMYD 1LACA 1S5FD 1I4QA 2JEAI 1E2VA 2R61A 2JA6B 1GOZA 3GD7A 4A3DB 3VYTA 1F2MA 3C1FA 1HHVA 4AYBB 4LK1C 3M7NA 3K57A 3EVQA 1CA5A 3IKJA 3GV3A 2A5HA 1PTOH 1EEID 1O80A 1AN8A 3SXHA 3MZ5A 2O4XA 5C4ZA 2IPKD 2X69A 5IT9E 3BVGA 3N52A 1STBA 1DOLA 2WKCA 4IUNA 4DFAA 3D4WA 1EOTA 3PUWA 1GUGA 1WD0A 2F0WA 4A3GB 2QEJC 2AQ1B 3A56A 3C1EA 1STEA 1Z6HA 5EBCA 2ENBA 4H13C 3VR3A 3DMUA 5NUCA 3BG3A 4KHZA 1SXTA 4J1MA 4FF2A 5CR3A 1TT2A 2PZUA 1RF2D 2WB1B 3HKZB 2JYOA 1Q1BA 1UAPA 5C4HA 3T53B 1I6HB 1SYDA 3HOZB 4DXFA 3CQZB 1BCPF 2R6GA 3OOCA 2F0NA 4ZUIA 5CBAE 2M00A 1NCVA 4LMQD 3OWEB 1WTPA 1DCZA 2IX3A 2WACA 3PIP3 1F9PA 2O5IC 5JEAH 1CZGA 2E74C 2R92B 1DONA 1BCPB 2LMCB 1B44D 1VCIA 5JVG3 1DD2A 2ICIA 5EBDA 5K36G 1J9OA 1HA5A 1FGBD 1HQRD 1HCZA 2L0CA 4WFN3 5M9OA 1TVXA 2C5CA 2E76C 3GTJB 3K5LA 5E4XA 2FFKB 5C3XA 1KABA 2NVTB 2MUYA 1STNA 4OHJA 1F2LA 3ITPA 1JR0D 1AZQA 3MXUA 2XWJB 2EYOA 1I6VC 3TP6A 4C3HB 3AMUA 4F7XA 1QCBD 4FNFA 1TS5A 4QIWB 3J7YW 4OO1G 5EKKA 2XVSA 2HQEA 4C1NI 3VYSA 1RJTA 1CM9A 2D9UA 1TQOA 2K01A 4HCEA 1VMPA 5LL6S 1TY2A 3NWTA 3PUXA 2Z1CA 1TKWB 1GHKA 4CJ2C 4KMUC 1PRTC 1B3AA 2IWHA 4KK7A 3Q23A 5IGEA 2KUMA 1K83B 1ZXTA 4RGMA 2NN6H 2KEDA 1Y1VB 3I4NB 2RKSA 3BDCA 4DAPA 3M85A 1PFMA 4G57A 1SMYC 1XWEA 1DJRD 4NKLA 3SEBA 1R4QB 1I4HA 1RHPA 1BF4A 4BY1B 2KCNA 1GHJA 2KVMA 3FVQA 3NK9A 5D14A 4L8JA 1I50B 5EGTA 3C46A 1EY5A 1CK1A 1V1PB 2B2VC 1HQMC 3P1HA 2F03A 5I9OA 5I6YA 2K5DA 1Y8NB 4BA1I 4PQXA 1JWUD 5IGFA 1Z47A 4DNTB 2L4NA 1HXYD 4BA2I 5EPJA 5JJZA 2KECA 5KYIA 1PTOF 2O5JC 1HUMA 1RCVD 1GJXA 2BDNA 1EYAA 3D3RA 3OWFA 3T13A 4IALA 5CV9A 2N55A 2CHBD 2K28A 3SVMA 1Q12A 3S1RB 2F0MA 3BYYB 1SNQA 1ILPA 5KNCA 3TZDA 3NBIA 3PO2B 4IZ8A 5C6AA 5T1IA 5C4XB 3GQBA 4FO2A 4K5VA 2Z4HA 1KDCA 1EL0A 4RWSC 4C3IG 4ZRZA 2RSNA 3QIAA 1TWGB 1KTKA 1CHQD 1DXMA 3I72A 2OT2A 1SDFA 1PDQA 2EYJA 1EY9A 1EWCA 3CHBD 2ZXPA 1V1PA 5DAUA 4KY5A 3ND8A 2WP8J 1F2YA 2PW7A 3M7GA 2XRSD 2QCPX 4QUCA 4ABNA 1BXTA 3HP3A 1EU3A 2NTSA 4A3MB 1C4QA 1MSGA 4K6DA 2BA1A 1XX8A 1LT4D 2PYKA 1DM0B 1Q1EA 3KUPA 2H4OA 3PV0A 5I9PA 1D1IA 3FEWX 1A3VA 4QUFA 4OO1H 2AWOA 5IGBA 5C0XI 4NDXA 4IUPA 1UEAB 1SYGA 3MFGA 1U4PA 1EZ6A 4A3EB 4KI0A 4V190 1NSNS 5M3FB 3NTHA 2CVRA 1F9QA 3QB3A 4K14A 1Y8OB 1JORA 2A68C 4N9PA 1EIHA 2MHVA 1WCMB 2OEOA 3VYRA 2K03A 3S1NB 4KKTA 5ELDA 1CI3M 3I3CA 1LTRD 2A68D 4KD3A 2KHSA 1LTBD 5IGDA 3BVMA 1K8OA 3NPPA 3NWSA 1E0BA 4A3KB 1S4ZA 2K32A 1OO9B 3J7AV 1Z7TA 5M5XB 5HGTA 2ZT9C 3QOJA 5CV5A 1G6ZA 1KAAA 3EJIA 2EJMA 1O7ZA 4M8AA 3R93A 4IFDH 3P7JA 3DEOA 2EY1A 2A6HD 4ZKBB 1BQQT 4PMBA 3RLFA 5FOBB 4A3IB 2EYLA 2F0TA 1PLFA 3KBXA 1E2WA 1OXTA 3HOUB 4ULLA 3JAME 3K58A 3NXWA 4CJ1B 5J39A 5KNBA 5I2YA 2RBMA 3KLRA 4ME5A 1I3QB 4RGTA 2HUGA 2F0UA 1F9RA 5KNDA 2LS01 3K59A 3BYTB 3WDNA 2BE5C 3KK7A 4Y7NB 2JEBI 4XT3B 2L55A 4HTHA 1J8IA 2JA8B 3T51B 4CKBA 5CC4A 2B2TA 3LX0A 5KEEA 4KJOA 1QNKA 5FK9C 5J22A 1BDOA 2A6ED 3H0GB 1QOHA 3OW7A 3VR5A 3MWYW 2BDOA 1ENFA 4OIKA 2F0GA 1SAPA 1Y69U 3QOLA 4DGZA 3BZDB 2XWBB 4NMZA 1T5EA 3D8GA 3BDLA 1A15A 5CV8A 1EQTA 3CU7A 5T1GA 2G9DA 3RMHA 4HMJA 2CW0C 4J8QA 1CA6A 1ZKOA 4RH6A 4XDXA 1YNJD 4QMGA 3K6OA 1ENCA 2D2CC 1LTAD 2F0OA 3V2TA 3DM1A 5EJWA 3HOXB 3S2DB 2EY2A 1QB5D 1S5CD 1IHZA 3TP8A 1G8ZD 2EZVA 1SE4A 3J7AF 4KKSA 1G2TA 1H9RA 1ONLA 1SYFA 2NVXB 3CKIB 1JE4A 2TSSA 3IFDA 3Q22A 2RDGA 1V1OA 3ONAB 3S9WA 4H7BA 3BDOA 4QF4A 2K5WA 1RTNA 4K8JA 1VF5C 1EEFD 4KKUA 2DNCA 2F0SA 5C5LA 2L12A 1WTQA 1WTOA 4EQPA 2KOLA 1TS3A 1UNSA 2L11A 1TY0A 2Q8TA 5KGUA 1STAA 2IX0A 2E2IB 1LLRD 5E3FA 2F0HA 4Z9CB 4G7ZC 2PMZB 1H9SA 2PZTA 1EY0A 1RDPD 5JOBA 4KJNA 1F77A 3OHXC 1U4LA 2QKIC 3A55A 2PPBC 1G291 3L3OC 1HA6A 1D5ZC 3FPPA 4RGOS 2PNRC 5C0XJ 2NVYB 1JC7A 4L6TB 4ILWA 2RDFA 4RCNA 4ZYSA 3J80E 1SYBA 3KLSA 3F2UA 2V4DA 5FO9B 3OPOA 2RDHA 2D5DA 4JBWA 4XQQA 1C48A 1PTOC 1G2SA 1PZKD 4RHRA 3NQIA 1O7YA 2B2WC 1IW7D 3NE5B 4EGVA 1II3A 3FMCA 4G7HC 3A8IE 2EYMA 4B08A 3OIPA 4CGYB 3S1MB 2E75C 1SNDA 4TSSA 1KLUD 2HDMA 1PRTB 1S5BD 1JOKA 1D5XC 1H9JA 1A6XA 2RQXA 4C3IB 4K5XA 2EPBA 5C0XH 2MP1A 1KNEA 1EY8A 3DWQA 5JPMC 3Q0AA 1SEBD 3MC0B 3MXPA 3WOEA 1ICWA 3HRZC 3UI2A 2WV6D 2E2JB 1FR3A 3HEJA 5CGKA 1M8AA 4DU9A 3EROA 3KLSX 1GUNA 1BNZA 4N9TA 4FP5D 2NUCA 1KLGD 2WINB 4E6IA 4NW2A 3SE0A 4IUUA 3G6JB 4B9XA 4BY7B 3IFTA 3JAML 1DZ1A 1D1KA 3RZOB 4U673 3ND9A 3C2PA 1G91A 1C8CA 3RD4A 1TU2B 4JK1C 1STYA 3P20A 1XTCD 5A35A 4K8IA 2Z4IA 4FXDA 3HOWB 1BUVT 5EQ0A 2A74C 5COYA 4ODGA 5CMDA 4LAAA 4DK0A 5CYUA 3NSWA 2MGSA 5KIXA 1LTGD 4A93B 4FF4A 1Y8PB 1RD9D 5G3LD 3EA6A 4BBRB 1B4OA 2A73B 1QJOA 5FKAC 1VF7A 4EQOA 4IFDI 2HCIA 2K05A 3DWAA 3TSSA 1I4RA 3RUZA 2WAQB 4TQUS 1QE6A 2IL8A 5IGCA 1MBYA 2B2YC 4C3JG 4DN4M 1QNUA 2K5QA 4ZQ3A 1JOOA 1SE2A 3S1QB 4C3HG 5EKIA 4CKEA 1R4PB 4Q0FA 1MGSA 2QILA 3OIQA 2DNEA 3L7ZC 4R8IA 2VNUD 1FNVA 5IT9L 3NUCA 1FYCA 2FHTA 2XIWA 3GTLB 1EQVA 4HN7A 2R3ZA 4FVMA 3MEHA 4PMCA 1XXGA 1QG7A 1FNUA 1WTRA 1O7LA 4FF1A 2B2WA 2H1EA 4WJWA 3S16B 1LABA 1RODA 3LWUA 3PO3B 2EXZA 1CQVA 2BOSA 2A69C 2NN6I 3DHQA 2Q8RE 3Q24A 1WVLA 3PMFA 1I4GA 1DOMA 4DF7A 2JA5B 2VB2X 3X3NA 3CRLC 1SE3A 1JCKB 1WTVA 1X3QA 1EIGA 4J6HA 3MFYA 2J7ZA 4M1UB 1FNWA 2QF7A 3S14B 3S15B 1HFNA 2B2UA 2GA4B 1A2TA 3X3MA 2HCCA 2L5TA 2LY7A 1R9TB 5K36H 2AQ3B 2RVLA 5JEAJ 3HG9A 1PYWD 3H3VC 3J81L 4ZAIA 1HTPA 4TKOB 1GXDC 2PCFB 1GUSA 2L1BA 2Z8LA 5EPLA 3GTPB 3P75A 3FRPB 5ELCA 3TZUA 1LO5D 4YIJA 4EVOA 3W3AA 4HSVA 4C2MB 2KCCA 3A8JE 4NP5A 5C44B 2YYZA 2FMCA 2EDGA 1SBBB 3BVZA 5D3DA 4WORA 1LTID 3HOYB 1SNOA 2EY5A 2WKDA 5E4WC 2JP1A 2K6AA 2BE5D 1LTSD 1TS4A 2IX1A 3AB9A 3I4MB 1EZ8A 2F0QA 2YU9B 1BBXC 1PRTF 2B63B 3N6RA 2BCOA 3K5OA 4KY7A 3TP7A 1O78A 2NWGA 3HGBA 5FLXE 2E2HB 2EYFA 5A2QL 4RKLA 3U9SA 2PO4A 3IL8A 2EJGC 3NHHA 2LFNA 1ET6A 3D6WA 1EYCA 1V43A 2F0IA 2NZ1D 5LHY1 2F4IA 4RFBA 2B2TC 1ENAA 2A6HC 3O13A 3M3YB 1BCPC 4GZYC 1STGA 2ID0A 1EY4A 5JAVA 2K1BA 3NQTA 4FF3A 4C1NK 1MSHA 4BWGB 1KDBA 3R8BA 4O42A 4OIJA 3SK4A 4OO1I 1NUCA 3HS0C 5C3WA 3K5NA 3OSOA 3A8KE 1Q90A 2TMPA 1CHPD 4DK1A 4CJ0B 5FLXL 5D65A 3H94A 5CORA 2NVQB 1JWMD 5I4DA 5LL6X 2M2LA 2DY7A 3GV6A 2F0EA 5C4JB 4RHSA 3FKIB 3NTKA 1A3TA 3EQLC 4IUQA 2FINB 5ELBA 5DNFA 2VB3X 5ISRA 1VMCA 2O2LD 3WOFA 4A3JB 1E2ZA 3R2IA 2I46A 2J0TD 1K8MA 2WIIB 1S5DD 1XYIA 3GTGB 2ICEC 1PFNA 4UAIA 1U9RA 2XNAC 3T4AC 1TS2A 1W6KA 3PUZA 4KHVA 2M9VA 4K2KA 1PXUA 3OMGA 1A3UA 1F9SA 3FPUB 4OGQC 4K6LA 2K7VA 4KN7C 3DXJC 2SEBD 1EY6A 4PMWA 1NR2A 4G7OC 3GP7A 1OXXK 3SDZA 4O1NA 1QWYA 2B2YA 3MXNA 2J4XA 3S2HB 1EFID 1H9SB 1YNNC 1HPCA 1YNJC 1PTOD 2F0FA 2Y0SB 1H9MA 1STHA 2EY6A 4BBSB 2JE6I 1GUOA 2B39A 2PW5A 1T5XD 1AP0A 2C9OA 1MI2A 2X6LA 4UDUC 4BS9A 1IKLA 1PZID 1WTWA 3DWPA 1Q8IA 1ILQA 1SJHD 2JXMB 4H0LC 3MA2B 4F87A 1RTOA 2HDLA 3I8ZA 3D6CA 2JSOA 3T56B 2D62A 2IT1A 2A69D 1ML0D 2AQ2B 1S5ED 3BS1A 3DUZA 4KD4A 3VR2A 2XRQD 2XN9C 1TWHB 3MAQA 4OL7A 4XYOA 2NYZD 2RA4A 5IGGA 2OF1A 1JICA 1SNPA 2EJFC 1CTMA 4IUVA 3ZYYX 1YNND 2VUMB 2B2UC 4RAUC 2EVBA 2B8FA 1X3PA 1EYDA 1W6JA 5JPNC 4XQNA 3SK6A 5HURA 4KN4C 1EY7A 1X32A 1JB3A 1AZPA 1U4MA 1PMRA 1HRJA 5IOCA 3I73A 4I65A 3VR4A 5M5WB 2KQ3A 3G7LA 3PIO3 3VR6A 1HUNA 3RZDB 2AUJD 4HSPA 1SNMA 1PTOB 4XIGS 1BOSA 4P2CB 1Y1WB 2IW3A 2DY8A 5JVH3 1DYQA 3K5MA 5TSSA 2JA7B 2ZXOA 3J80L 4QB4A 3FDTA 2AUKA 4X3UA 2EE1A 5IODA 3SK5A 3K0YA 1OXUA 2F0VA 1PRTD 1OXVA 3GTQB 1HTLD 3C3LA 4HR7B 1BO0A 1Q3LA 3CRKC 3M4OB 1DOKA 3A7LA 3NTIA 2F0LA 4X3SA 3E6ZX 1TWCB 2CW0D 1IYVA 2LKVA 5FO8B 2L9HA 2N88A 1EWHA 3HZXA 2X6GA 1MD2D 4DA2A 1WTXA 3V96A 4DXGA 5K5PA 5EPKA 5BN5A 5JEAG 5C0XG 3E5SA 1SYCA 4R8NA 4KY6A 4MHEA 3GTKB 5DM73 2FJ2A 3MXGA 2DN8A 2NN6G 3K7AB 4H44C 2Q8IB 3TBIB 3EFXD 3QG1A 5ELFA 4EQNA 1TWAB 4F8MA 1AFPA 3A7AB 4ZLTF 4QCLA 1ET9A 1D5MC 1SFOB 3AU7A 4FXGC 5CV4A 4C3JB 5ELEA 2QDBA 5EKLA 3KF8A 3GTMB 1UUPA 3TDQA 2VXWA 1A2UA 4CHTB 3L9AX 2EYHA 4F88A 4K5WA 3D4DA 3TP5A 1I4XA 2ZXRA 2KJXA 4HAEA 1OXSC 1B50A 3TN2A 1B2TA 1IW7C 4PNYA 3I70A 3ERQA 5C3EB 3NBHA 2K33A 1IYUA 4IFDJ 4A3FB 3VA7A 2SNSA 5E1FA 2R93B 2E2DC 5M5YB 2B2VA 4XTCS 4FXKC 2G9HD 2F3WA 3QO2A 1F2ZA 2F3VA 3GTOB 1CFMA 4RKBA 1U4RA 3Q6SA 4R9WA 3TMEA 1QILA 2PQEA 2KA7A 2B8GA 2EYPA 2FMMA 1I4PA 5M3MB 3I91A 5FO7B 4ZK9B 4IQZA 2IJ0A 4HMIA 1V8QA 1LT6D 4S3SA 2MJ8A 1ZYRC 1H9KA 4DAVA 1BCPD 4I7ZC 2OXPA 1GUTA 5I2XA 1EU4A 1NR4A 1CQFA 4XXEA 3R3OA 1HFGA 1B9MA 2NB0A 1KDAA 1TWFB 5KRUA 3H91A 2NBFA 1AEXA 2SOBA 2CQAA 5DEHA 3I90A 1NAPA 4IFDG 2R7ZB 3IAYA 2F0JA 3LWEA 4X3KA 3SR1A 2KEEA 1IKMA 1AW7A 4B9WA 3NP8A 2SNMA 2F1MA 4V0BA 5C5MA 4CBVA 2I07B 5CV6A 3T16A 1SNCA 4RA8A 1M4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTS A;  4RHS A;  1SXT A;  1I4X A;  3DWP A;  1JWU D;  1SBB B;  1XXG A;  3BVZ A;  5D3D A;  1B1Z A;  1PRT D;  4C56 C;  4RCO A;  1SJH D;  1LTI D;  1SJE D;  1TS5 A;  5ELB A;  1HTL D;  1FNU A;  4RH6 A;  3W2D A;  1LT4 D;  1HXY D;  1D5Z C;  4RGO S;  1RF2 D;  4RGN A;  1JWS D;  2O2L D;  1LTS D;  1PTO F;  3R2I A;  1LTA D;  1TS4 A;  1XTC D;  4L6T B;  4RGT A;  4ZYS A;  1S5C D;  1RCV D;  4DXF A;  2G9H D;  2AQ2 B;  1S5D D;  1CQV A;  1LTT D;  1PRT F;  1BCP F;  1S5E D;  5D3I B;  1MD2 D;  1G8Z D;  2RDH A;  1LT3 D;  3MFG A;  1LT5 D;  1SE4 A;  2XRQ D;  4DXG A;  1QIL A;  2XN9 C;  1FD7 D;  3BYT B;  1PTO C;  1TY2 A;  2CHB D;  2XNA C;  1I4P A;  3OWE B;  3URY A;  1PZK D;  4RHR A;  1JQY D;  2IJ0 A;  1I4G A;  1TS2 A;  1PRT C;  1S5F D;  1LT6 D;  1PZJ D;  3BYY B;  1SE3 A;  1JCK B;  1BCP D;  1I4Q A;  1ET6 A;  2TSS A;  2R61 A;  4TSS A;  3V05 A;  1LTG D;  2RDG A;  1KLU D;  1V1O A;  3EFX D;  5ELF A;  1BCP B;  1GOZ A;  1PRT B;  1EU4 A;  1RD9 D;  1B44 D;  1S5B D;  5FK9 C;  4K6L A;  2NTT A;  4RGM A;  3EA6 A;  4RFB A;  1FNW A;  1D6E C;  1D5X C;  3O13 A;  5FKA C;  2ICI A;  2SEB D;  5ELD A;  1EEF D;  1ET9 A;  1D5M C;  1KTK A;  1BCP C;  1HA5 A;  1LTR D;  1FGB D;  1CHQ D;  1HQR D;  1PTO H;  3DWA A;  3TSS A;  1I4R A;  1EEI D;  3GP7 A;  1ENF A;  4O1N A;  3DWQ A;  2AQ3 B;  1AN8 A;  2J4X A;  1LTB D;  1EWC A;  3CHB D;  1SEB D;  1DJR D;  3BVM A;  3MC0 B;  3SEB A;  1I4H A;  1V1P A;  1EFI D;  2IPK D;  5ELE A;  4BWG B;  1TS3 A;  3R8B A;  3BVG A;  1UNS A;  3BZD B;  1PTO D;  1CT1 D;  1L0X B;  1PYW D;  1TY0 A;  2WV6 D;  1LLR D;  3R2T A;  1AW7 A;  1L0Y B;  1PTO B;  1SE2 A;  1T5X D;  1UUP A;  2QIL A;  2Z8L A;  3KLS X;  4OHJ A;  1ESF A;  4Z9C B;  2XRS D;  5ELC A;  1CK1 A;  1CHP D;  2AQ1 B;  1DYQ A;  1V1P B;  2QEJ C;  1JR0 D;  1LO5 D;  1STE A;  5TSS A;  4L63 B;  1RDP D;  1FNV A;  4UDU C;  1BXT A;  1F77 A;  1EU3 A;  1JWM D;  5I4D A;  1PZI D;  1KLG D;  1M4V A; 
#chains in the Genus database with same CATH topology
 5I6W A;  1B53 A;  3D4R A;  4ZUJ A;  4GOP A;  3HOV B;  1PH8 A;  1SJE D;  5C4J H;  3U9O A;  3W2D A;  4G4K A;  4MN3 A;  5M3M H;  3RLO A;  4RGN A;  3OMC A;  1TII D;  3VA5 A;  2UUC L;  2DJG C;  1CZW A;  3SHL A;  4BY7 G;  1PFB A;  4K0K L;  1TR5 A;  3I4L A;  4LF8 L;  2F0P A;  3M4Y A;  4LF8 Q;  4U68 A;  3PUY A;  1D2B A;  4B3R Q;  1ZEQ X;  2KHJ A;  1LT5 D;  1X3F A;  3KLW A;  4IOA A;  1SSO A;  4AIM A;  3QJY A;  3GO5 A;  4FYD A;  1ESR A;  4ID6 A;  1JQY D;  2K04 A;  1GUW A;  3K0X A;  1B9N A;  2Q2T A;  1LV9 A;  1KNA A;  1PZJ D;  5CBE E;  1SMX A;  4XT1 B;  1Y1V H;  3DEP A;  3V05 A;  1N8R C;  5F2D A;  3H09 A;  4KV6 A;  1K83 H;  3J81 E;  2IHE A;  4JI6 Q;  3J81 c;  1KRT A;  1VDZ A;  3BJU A;  2NTT A;  2ZTC A;  1WD1 A;  1D6E C;  3BZK A;  4A3B B;  4DR4 Q;  4DAY A;  2E5L L;  1NMF A;  3S17 B;  2F0K A;  5G3L F;  4DNR B;  3MVV A;  1IL8 A;  2CWP A;  5IIF A;  5DM6 3;  2HD3 A;  4IN3 A;  5CV7 A;  4DR3 Q;  2RSO A;  2R7F A;  4C3J H;  5C3E G;  3MTS A;  2MPM A;  3D31 A;  1CT1 D;  1L0X B;  1RKN A;  1ZYR D;  3SK8 A;  4APV A;  2A8V A;  4XQJ A;  1S40 A;  1BR9 A;  4MTN A;  3R2T A;  1L0Y B;  5IYD H;  3ER0 A;  4CKC A;  4LF7 L;  1SFO H;  2PZW A;  3LNN A;  4Q5V A;  3H0G H;  4X3T A;  3PUV A;  1ESF A;  5AFW A;  1GVP A;  4K2L A;  2A6E C;  5KYL A;  4L63 B;  4XYQ A;  3HOX G;  3VDY A;  4TRD A;  1QVC A;  4IUT A;  2Y0S G;  1CSQ A;  4HCS A;  3JAM c;  1VQO A;  2Q2U A;  2EOT A;  2ZTD A;  4PV1 C;  4WRD A;  4L5S A;  2XTI A;  3H6M A;  1B1Z A;  4C56 C;  3VYU A;  4RCO A;  5A2Q E;  4DR2 L;  1VQ8 A;  2AWN A;  2XSC A;  4HED A;  3KDF B;  1CKM A;  5BN4 A;  4MIU A;  3A54 A;  1JWS D;  4BBR G;  5C44 G;  4X6A H;  1X55 A;  4A4I A;  4ZKC B;  2SDF A;  5BN3 A;  5J1Z A;  2BA0 A;  1JOQ A;  2F0D A;  4IUR A;  3MHB A;  1P8L A;  3E0J A;  1LTT D;  3F2C A;  1I3Q H;  5D3I B;  3KOJ A;  3KBG A;  4KTA A;  1LT3 D;  3W5O A;  3AFQ A;  1FD7 D;  1SYE A;  2YTX A;  3GTJ H;  4UY8 C;  3J80 i;  3QWN A;  3URY A;  4POG A;  2KCT A;  1EQQ A;  1N33 L;  4LJZ C;  1SMY D;  1LAC A;  1S5F D;  3E9H A;  1I4Q A;  3CP0 A;  2JEA I;  1E2V A;  1QUQ A;  2R61 A;  4N8F A;  2JA6 B;  4JI3 Q;  4X65 Q;  1GOZ A;  4NXM Q;  3GD7 A;  4A3D B;  3VYT A;  1F2M A;  3C1F A;  1HHV A;  5JJL A;  4AYB B;  4LK1 C;  3M7N A;  2AMC B;  3K57 A;  3EVQ A;  1CA5 A;  3IKJ A;  2WAQ E;  3GV3 A;  2A5H A;  1GD7 A;  1PTO H;  2GVB A;  1EEI D;  3SGI A;  1O80 A;  1AN8 A;  3SXH A;  3K7U C;  3MZ5 A;  2O4X A;  5C4Z A;  4MTK A;  2IPK D;  2X69 A;  5IT9 E;  3BVG A;  3N52 A;  1STB A;  1HNW L;  3TS0 A;  3HOZ G;  1DOL A;  1C9O A;  2RHS B;  1I5F A;  2WKC A;  4IUN A;  1VQD A;  4DFA A;  3D4W A;  1EOT A;  3PUW A;  1GUG A;  4B3T L;  1WD0 A;  2F0W A;  4A3G B;  2QEJ C;  2AQ1 B;  3A56 A;  3C1E A;  1STE A;  1Z6H A;  4GLX A;  5EBC A;  2ENB A;  4H13 C;  3VR3 A;  1O7I A;  4GNX C;  3DMU A;  5M3M G;  5NUC A;  3BG3 A;  2OCE A;  4KHZ A;  3CCJ A;  1IBK L;  3GTO H;  3U4V A;  3I4M G;  1I50 H;  1SXT A;  4X66 Q;  4J1M A;  4GS3 A;  4FF2 A;  5CR3 A;  4LF9 L;  2VQF L;  5M5Y H;  1TT2 A;  2PZU A;  2PQA A;  1N32 L;  3KJP A;  1RF2 D;  1RIP A;  2WB1 B;  4A3F H;  3HKZ B;  4JBM A;  2JYO A;  4L5Q A;  1Q1B A;  1K3B C;  1UAP A;  5C4H A;  1FJG Q;  4GN4 B;  3T53 B;  4JI0 Q;  1I6H B;  1SYD A;  4LWC A;  5FLM H;  3HOZ B;  1IZ6 A;  4DXF A;  4WJ3 M;  1PHJ A;  2QA4 A;  3CQZ B;  1BCP F;  2R6G A;  3OOC A;  2F0N A;  4ZUI A;  5CBA E;  4DV2 Q;  2MFI A;  2M00 A;  1IBL L;  3I4N H;  1NCV A;  1K73 C;  4LMQ D;  1N36 Q;  3CXC A;  2CH4 A;  3OWE B;  1WTP A;  4OON A;  1DCZ A;  4QJF A;  2RF4 A;  2IX3 A;  4OEL B;  2BH8 A;  2WAC A;  4A3M H;  1YJN A;  2JQO A;  4R1J A;  3PIP 3;  1F9P A;  2O5I C;  5JEA H;  1CZG A;  2E2H H;  2E74 C;  2R92 B;  5JJK A;  1DON A;  1BCP B;  2LMC B;  2R93 G;  1B44 D;  1XNQ Q;  1VCI A;  3K80 C;  5IYC H;  3NEN A;  5JVG 3;  1DD2 A;  2ICI A;  5EBD A;  1N34 L;  4A93 G;  5K36 G;  3CCR A;  1J9O A;  1HA5 A;  4DR7 Q;  1MJC A;  1FGB D;  1HQR D;  2CQO A;  3H3V I;  1KIX A;  1HCZ A;  2L0C A;  4WFN 3;  2RCN A;  5M9O A;  1TVX A;  4JI0 L;  2C5C A;  2E76 C;  3GTJ B;  3TEH B;  3K5L A;  5E4X A;  4DUZ L;  2FFK B;  2YTY A;  5C3X A;  3HOY H;  4DR1 L;  1K0R A;  1IYJ B;  1KAB A;  2NVT B;  2MUY A;  1STN A;  1Q46 A;  4OHJ A;  3PIP A;  3GTK H;  4R4I A;  1F2L A;  3CAM A;  4DV6 L;  2JA7 G;  3ITP A;  3DM3 A;  1CUK A;  1JR0 D;  1AZQ A;  1K8G A;  2C35 B;  3RZO H;  3MXU A;  2XWJ B;  2EYO A;  1I6V C;  4DR5 L;  3TP6 A;  4O2D A;  3MEF A;  4OWX B;  4C3H B;  3AMU A;  3S1R H;  4KHP L;  1X54 A;  1QCB D;  4F7X A;  1B8A A;  4FNF A;  1JJC B;  1TS5 A;  4DV7 Q;  1U0L A;  4QIW B;  3J7Y W;  4GKK Q;  5M3F G;  2N78 A;  4LF6 Q;  4OO1 G;  5EKK A;  2XVS A;  1BBW A;  4IO9 A;  2Z6B A;  3HOU H;  1LYL A;  2HQE A;  4C1N I;  4DK3 C;  4JI2 L;  5LMN L;  3VYS A;  1RJT A;  4YCW A;  1CM9 A;  2D9U A;  2K4K A;  1TQO A;  2HIV A;  4GKJ Q;  2E2J H;  4A3J H;  5IT9 c;  3E3X A;  2K01 A;  4HCE A;  1VMP A;  5LL6 S;  1TY2 A;  3HKZ G;  3NWT A;  2V1C C;  1KC8 C;  5BR8 Q;  3PUX A;  4AH6 A;  1X9N A;  2Z1C A;  2Q2H A;  1TKW B;  1GHK A;  1L1O B;  2I5L X;  4CJ2 C;  1X3G A;  4KMU C;  3U50 C;  1PRT C;  4AQY Q;  1PH4 A;  4IJL A;  1Y14 B;  4C3I H;  1HNX Q;  4JV5 Q;  2CH4 W;  1B3A A;  1MJE A;  3HOW H;  2IWH A;  5IP9 H;  4KK7 A;  1IXR A;  4O0A A;  3Q23 A;  4JI3 L;  5IGE A;  2KUM A;  2VS1 A;  1K83 B;  1ZXT A;  1J5E Q;  4AYB G;  5ELN A;  4RGM A;  2NN6 H;  2YV5 A;  2KED A;  1Y1V B;  3I4N B;  1PH5 A;  2RKS A;  3CME A;  4DV6 Q;  3CQZ H;  3BDC A;  2D0P A;  1YJW A;  4DAP A;  3M85 A;  2MNA A;  1PFM A;  1ASY A;  4G57 A;  1SMY C;  1XWE A;  2DJF C;  1DJR D;  4NKL A;  3SEB A;  1R4Q B;  1I4H A;  4BY1 H;  4DUZ Q;  1NTG A;  4IPC A;  2ASB A;  1RHP A;  1BF4 A;  4BY1 B;  2KCN A;  3KF6 B;  4JBK A;  2VUM H;  1GHJ A;  1QVF A;  2KVM A;  2Q2I A;  3FVQ A;  3NK9 A;  2A1A A;  5D14 A;  4DV3 L;  5IWA L;  4L8J A;  2I0Q A;  1I50 B;  5EGT A;  1YIT A;  1VQJ A;  1XNR Q;  3C46 A;  1EY5 A;  1CK1 A;  4BXX G;  1V1P B;  4DV0 L;  2B2V C;  1HQM C;  3P1H A;  2VW9 A;  2JN4 A;  2F03 A;  1C0A A;  5I9O A;  5I6Y A;  2K5D A;  1Y8N B;  4BA1 I;  4PQX A;  1JWU D;  1Y1V G;  5IGF A;  1Z47 A;  4DNT B;  2L4N A;  1HXY D;  5EAY A;  4BA2 I;  5EPJ A;  2VY3 A;  1VQN A;  5JJZ A;  2KEC A;  5KYI A;  1D8L A;  1PTO F;  2O5J C;  1HUM A;  2VQE L;  3FKI G;  1U5K A;  1K3R A;  1RCV D;  1GJX A;  2BDN A;  5HY6 A;  3HFZ B;  1I94 Q;  2PNH A;  4DR1 Q;  1EYA A;  3D3R A;  2JA5 G;  3OWF A;  3T13 A;  4IAL A;  5CV9 A;  1E1T A;  2N55 A;  4PG3 A;  4GN5 A;  2CHB D;  2AHO B;  2K28 A;  4MZ9 A;  4A93 H;  3SVM A;  3CW2 C;  1Q12 A;  3S1R B;  5L37 A;  2F0M A;  1HNZ Q;  4EX5 A;  3BYY B;  1SNQ A;  5C44 H;  1ILP A;  5KNC A;  2UUA Q;  3TZD A;  1Z9F A;  2VQE Q;  3NBI A;  4X64 L;  1YHQ A;  3PO2 B;  3PSI A;  4IZ8 A;  5C6A A;  3RN2 A;  5T1I A;  5C4X B;  3GQB A;  4FO2 A;  2PI2 E;  2KEN A;  4K5V A;  1H95 A;  2Z4H A;  1SR3 A;  1KDC A;  1EL0 A;  1PYB A;  4RWS C;  4ZRZ A;  4C3I G;  2RSN A;  3QIA A;  2NVT H;  1TWG B;  1KTK A;  1CHQ D;  1DXM A;  1GKH A;  3UE1 A;  1TWG H;  3I72 A;  2OT2 A;  2K50 A;  1SDF A;  1PDQ A;  2EYJ A;  3KFU A;  1EY9 A;  2LXJ A;  1EWC A;  3CHB D;  2K5V A;  2ZXP A;  1V1P A;  5DAU A;  4OWT B;  5IE8 A;  1HR0 W;  2OWO A;  4B3R L;  4KY5 A;  3ND8 A;  2WP8 J;  1F2Y A;  2PW7 A;  3M7G A;  2UU9 L;  4JI5 L;  2F4V Q;  3S15 H;  2XRS D;  4JI4 L;  2QCP X;  1AE3 A;  4QUC A;  3CCQ A;  4YWM A;  4ABN A;  3CC7 A;  1UE1 A;  1BXT A;  3HP3 A;  1EU3 A;  5C3E H;  4CDE C;  2NTS A;  4A3M B;  2H5X A;  1C4Q A;  1MSG A;  4K6D A;  2BA1 A;  1XX8 A;  4DKA C;  1IBK Q;  3T1H L;  1B7Y B;  1LT4 D;  2QW7 A;  2PYK A;  3S24 A;  1DM0 B;  1WOC A;  1Q1E A;  4KLK A;  3KUP A;  2H4O A;  3PV0 A;  5I9P A;  1E24 A;  4GOP C;  1D1I A;  3FEW X;  1A3V A;  4QUF A;  1VQF A;  4OO1 H;  2AWO A;  4DV2 L;  5IGB A;  5C0X I;  4NDX A;  4IUP A;  3OTO L;  1UEA B;  2OQ0 A;  1SYG A;  3MFG A;  3DLL A;  1U4P A;  1EZ6 A;  4A3E B;  4KI0 A;  1S72 A;  4V19 0;  1NSN S;  5HGQ A;  5M3F B;  2CFM A;  4QY7 A;  3NTH A;  1FL0 A;  4P74 A;  2HT1 A;  2CVR A;  2KCM A;  1XMO L;  1F9Q A;  3QB3 A;  4K14 A;  1Y8O B;  1JOR A;  2A68 C;  4LFA L;  1YZ6 A;  4JCV E;  4N9P A;  1EIH A;  2MHV A;  1SN8 A;  4LFB Q;  1G51 A;  1WCM B;  2OEO A;  3VYR A;  2K03 A;  3S1N B;  4LF5 L;  4KKT A;  4B3S L;  5ELD A;  4DAM A;  4A3M G;  2JA8 H;  1CI3 M;  3I3C A;  1LTR D;  2A68 D;  4KD3 A;  3M3Y H;  4JVZ A;  4ALP A;  2KHS A;  1LTB D;  5IGD A;  3BVM A;  1K8O A;  3NPP A;  2QGQ A;  2UUA L;  3NWS A;  1E0B A;  4A3K B;  1JB7 A;  1S4Z A;  2K32 A;  1OO9 B;  1YJ9 A;  3J7A V;  1Z7T A;  5M5X B;  3PO3 G;  5HGT A;  2ZT9 C;  3QOJ A;  1S3O A;  3A5U A;  5CV5 A;  1G6Z A;  1KAA A;  4DV3 Q;  3EJI A;  1JMC A;  2EJM A;  1O7Z A;  4M8A A;  3R93 A;  4IFD H;  3P7J A;  3DEO A;  5ELO A;  2EY1 A;  2K52 A;  2A6H D;  1VQM A;  4ZKB B;  1E3P A;  1BQQ T;  5FJ8 H;  4A3D H;  1VQ5 A;  1GO3 E;  4PMB A;  3RLF A;  5FOB B;  4A3I B;  1IL2 A;  2EYL A;  2B63 H;  2F0T A;  1SE8 A;  1PLF A;  3KBX A;  1E2W A;  1OXT A;  3I4M H;  1G6P A;  3HOU B;  1B3Q A;  4ULL A;  3JAM E;  3EN2 A;  3K58 A;  1UE7 A;  3M4Q A;  3NXW A;  2UXB L;  3ZJY C;  4CJ1 B;  5J39 A;  4A3I G;  2QDL A;  5KNB A;  5FLM G;  5I2Y A;  2RBM A;  3KLR A;  4J15 A;  3LGJ A;  2EIF A;  4ME5 A;  1I3Q B;  4PZ8 A;  4RGT A;  5JJI A;  1HNX L;  2HUG A;  2F0U A;  4A3F G;  3D0F A;  4A3G G;  4X62 L;  1KAW A;  1K28 A;  1F9R A;  4LUV A;  2MO1 A;  5KND A;  2LS0 1;  1UE6 A;  3K59 A;  3BYT B;  3WDN A;  2BE5 C;  3KK7 A;  4K0K Q;  4Y7N B;  2B3G A;  1YHB A;  2JEB I;  3I56 A;  4L5R C;  2PMZ E;  4XT3 B;  3A5Z B;  2L55 A;  4HTH A;  1J8I A;  2JA8 B;  3T51 B;  4CKB A;  5CC4 A;  1PA6 A;  2B2T A;  3AYH B;  2IY5 B;  2KBN A;  3LX0 A;  5GQO A;  5KEE A;  4KJO A;  1C7Y A;  4JI6 L;  1QNK A;  2ZJR A;  5FK9 C;  1CKN B;  2N8N A;  5J22 A;  1BDO A;  2A6E D;  3H0G B;  1QOH A;  4CDF C;  3OW7 A;  3VR5 A;  3MWY W;  2BDO A;  1ENF A;  4OIK A;  4LF7 Q;  4DR5 Q;  2ATW A;  1YI2 A;  2UXD Q;  3RR5 A;  4DUY Q;  2F0G A;  1SAP A;  1Y69 U;  3QOL A;  4DGZ A;  3BZD B;  2XWB B;  2UXC L;  4NMZ A;  1T5E A;  4FDB A;  4R4T A;  1YHA A;  3D8G A;  3GDE A;  3T1Y L;  3BDL A;  1A15 A;  5CV8 A;  3J7A 5;  1EQT A;  3CU7 A;  1WI5 A;  5T1G A;  4UP7 A;  2G9D A;  3RMH A;  1EIY B;  4HMJ A;  2PQA B;  4UP9 A;  2CW0 C;  4J8Q A;  3STB C;  1XNR L;  1CA6 A;  3CCL A;  4DV4 Q;  3S1M H;  3PGZ A;  1ZKO A;  2DGY A;  1W3S A;  4UP8 A;  4LFC Q;  3E0E A;  4RH6 A;  3B6Y A;  3S16 H;  4XDX A;  1YNJ D;  4A3K G;  2ZJQ A;  4QMG A;  3K6O A;  1ENC A;  1UE5 A;  4DV4 L;  2D2C C;  1JE5 A;  1LTA D;  2F0O A;  4JI1 L;  3DM1 A;  3V2T A;  5EJW A;  3HOX B;  3S2D B;  2EY2 A;  1QB5 D;  1S5C D;  1IHZ A;  4LFC L;  4A3C H;  1YIJ A;  1EOV A;  3TP8 A;  1G8Z D;  1PH7 A;  2KHI A;  2EZV A;  1SE4 A;  3J7A F;  2PI2 A;  4KKS A;  1G2T A;  1H9R A;  1IBL Q;  2L15 A;  1ONL A;  3HOV H;  2XGT A;  3CPW A;  4CDD C;  1SYF A;  2NVX B;  3CKI B;  1LM0 A;  4LF9 Q;  1JE4 A;  2TSS A;  3IFD A;  3Q22 A;  2RDG A;  1V1O A;  3ONA B;  3S9W A;  4H7B A;  3BDO A;  4QF4 A;  4OXP A;  2K5W A;  1RTN A;  4K8J A;  3KF8 B;  3H3V H;  4ME3 A;  1VF5 C;  3T1H Q;  1EEF D;  4KKU A;  1M1K C;  4DR2 Q;  2DNC A;  1NMG A;  2F0S A;  5C5L A;  2E2I H;  1NNX A;  2L12 A;  1WTQ A;  1WTO A;  4EQP A;  2KOL A;  1TS3 A;  5IP7 G;  1UNS A;  4JBJ A;  3GTG H;  3M4O H;  2L11 A;  1TY0 A;  2Q8T A;  5KGU A;  1STA A;  2IX0 A;  3CCM A;  1E1O A;  4DAY B;  2BH2 A;  1LLR D;  2F4V L;  5E3F A;  2E2I B;  2ZM6 Q;  1A8V A;  1TWF H;  2F0H A;  1AE2 A;  4Z9C B;  1Q7Y C;  4G7Z C;  2PMZ B;  1H9S A;  2PZT A;  1EY0 A;  3NBH B;  1RDP D;  2JA7 H;  5JOB A;  4KJN A;  1F77 A;  3OHX C;  1XMQ Q;  1U4L A;  1UWV A;  1W2B A;  4JW0 A;  2QKI C;  3A55 A;  2ZTE A;  2PPB C;  2NVX H;  5E7N A;  5IYB H;  1G29 1;  3L3O C;  1ICF B;  3HOW G;  1HA6 A;  1D5Z C;  2NVQ H;  3FPP A;  4RGO S;  2PNR C;  5C0X J;  2MQH A;  4DUY L;  1J5E L;  2NVY B;  2IHF A;  1JC7 A;  1BKB A;  4DPG A;  1N36 L;  3CCE A;  4LW1 A;  3F1Z A;  4L6T B;  4ILW A;  2RDF A;  4RCN A;  4ZYS A;  4BY7 H;  3J80 E;  2R92 G;  1SYB A;  3KLS A;  3F2U A;  2V4D A;  5IYC G;  1VQE A;  5FO9 B;  3OPO A;  4JI1 Q;  4DK6 C;  3CPF A;  2RDH A;  2R93 H;  2D5D A;  4JBW A;  1ASZ A;  4XQQ A;  1C48 A;  3PO2 G;  1PTO C;  1WCM H;  1WJJ A;  1RL2 A;  2B63 G;  1G2S A;  2R7Z G;  1HR0 Q;  1SLJ A;  1PZK D;  3BZC A;  4RHR A;  3NQI A;  1O7Y A;  4YY3 Q;  2B2W C;  1IW7 D;  3NE5 B;  4EGV A;  1II3 A;  3FMC A;  4G7H C;  3ULP A;  3A8I E;  2EYM A;  4B08 A;  3OIP A;  4CGY B;  3S1M B;  2E75 C;  1SND A;  4TSS A;  1KLU D;  3JC6 6;  2HDM A;  3I4N G;  1VQH A;  1PRT B;  1K9M C;  4GKK L;  1S5B D;  1JOK A;  1PV4 A;  1D5X C;  2WB1 G;  2F52 A;  1H9J A;  3M9B A;  1A6X A;  2RQX A;  4C3I B;  4K5X A;  2EPB A;  5C0X H;  2MP1 A;  1KNE A;  3T1Y Q;  1EY8 A;  2EQS A;  3DWQ A;  4LF5 Q;  5JPM C;  3Q0A A;  1SEB D;  3MC0 B;  3CC2 A;  3J81 j;  3MXP A;  1L2F A;  4IPD A;  1A0I A;  3WOE A;  1ICW A;  1Y1W G;  3HRZ C;  3UI2 A;  2WV6 D;  2E2J B;  1FR3 A;  3HEJ A;  5CGK A;  2FXQ A;  1M8A A;  4DU9 A;  3ERO A;  1D7Q A;  1HZA A;  3KLS X;  1XMO Q;  1VQL A;  1GUN A;  1BNZ A;  1Q81 C;  4N9T A;  2LSS A;  3K7A H;  1E22 A;  3KF6 A;  4FP5 D;  2NUC A;  1KLG D;  4ZCK A;  2WIN B;  4E6I A;  4NW2 A;  3SE0 A;  1KQS A;  1X56 A;  4IUU A;  3G6J B;  3NEL A;  4B9X A;  4BY7 B;  4CDC C;  1VQB A;  3IFT A;  3JAM L;  1DZ1 A;  2K14 A;  1D1K A;  4X66 L;  3HKZ E;  3RZO B;  4U67 3;  3ND9 A;  3C2P A;  1X3E A;  1G91 A;  1C8C A;  4OX9 Q;  3RD4 A;  1TU2 B;  4JK1 C;  4JG2 A;  1STY A;  3P20 A;  4OEM B;  2I5M X;  1XTC D;  5A35 A;  1PH6 A;  3E9I A;  4K8I A;  1PYS B;  1EQR A;  2Z4I A;  4FXD A;  3HOW B;  4A76 A;  2Z9H A;  1HZB A;  1EUJ A;  1BUV T;  4JYA L;  5EQ0 A;  2A74 C;  4HIK A;  5COY A;  4ODG A;  2ES2 A;  5CMD A;  2ZJP A;  4LAA A;  3GTQ H;  4DK0 A;  3TRE A;  1EIF A;  2GN5 A;  5CYU A;  3ULJ A;  3RLN A;  3NSW A;  2MGS A;  4A3I H;  1WTH A;  3MXN B;  5KIX A;  2VUM G;  2UUB L;  1LTG D;  1L1O C;  4A93 B;  4FF4 A;  2UXC Q;  2HHH L;  4DR6 Q;  1Y8P B;  1RD9 D;  5G3L D;  4QGU A;  3EA6 A;  3G71 A;  4BBR B;  1B4O A;  2A73 B;  1QJO A;  5FKA C;  1VF7 A;  4EQO A;  4KHP Q;  3A74 A;  4IFD I;  2HCI A;  2K05 A;  3DWA A;  3TSS A;  1I4R A;  3RUZ A;  2WAQ B;  4TQU S;  1XTD A;  1QE6 A;  4A3K H;  2IL8 A;  5IGC A;  1XJV A;  1N33 Q;  4OX9 L;  3U58 A;  2UXD L;  1MBY A;  5IP9 G;  2B2Y C;  4MNO A;  3HOU G;  4C3J G;  4DN4 M;  1QNU A;  2K5Q A;  2Z6K A;  4P75 A;  1JOO A;  1SE2 A;  4ZQ3 A;  3S1Q B;  4C3H G;  5EKI A;  4CKE A;  4BBS G;  3PO3 H;  1R4P B;  4Q0F A;  1MGS A;  2QIL A;  3OIQ A;  2DNE A;  3L7Z C;  3L2P A;  3S1N H;  4R8I A;  2VNU D;  4DV0 Q;  1FNV A;  5IT9 L;  3NUC A;  1FYC A;  2FHT A;  2XIW A;  4PZ6 A;  1EQV A;  3GTL B;  3CF5 A;  4HIM A;  1V9P A;  4HN7 A;  2R3Z A;  4GKJ L;  1XPO A;  4FVM A;  3MEH A;  4PMC A;  1PH3 A;  1XXG A;  1QG7 A;  4LUZ A;  1FNU A;  1WTR A;  1O7L A;  1L0W A;  4FF1 A;  2B2W A;  2LXK A;  5M3F H;  4JI7 Q;  3PF4 A;  2H1E A;  4IPG A;  4WJW A;  3AEV A;  3S16 B;  1LAB A;  1ROD A;  3LWU A;  3PO3 B;  2EXZ A;  1CQV A;  3L0O A;  4LF4 L;  2BOS A;  2A69 C;  2NN6 I;  3DHQ A;  1QUQ B;  2Q8R E;  3Q24 A;  4B3M Q;  1WVL A;  1Q86 C;  3UDX A;  3PMF A;  3KJO A;  1I4G A;  1DOM A;  4DF7 A;  2JA5 B;  2VB2 X;  4YWK A;  3X3N A;  4JI8 Q;  3CRL C;  1SE3 A;  1JCK B;  4JOI A;  1VQ4 A;  1FJG L;  1WTV A;  1MHW C;  1X3Q A;  1EIG A;  4J6H A;  1T9H A;  1VQ9 A;  3MFY A;  4JI4 Q;  2J7Z A;  4M1U B;  1KL9 A;  1FNW A;  2QF7 A;  3S14 B;  3S15 B;  1HFN A;  2B2U A;  2GA4 B;  1A2T A;  3X3M A;  2HCC A;  2L5T A;  2LY7 A;  1YNX A;  1R9T B;  5K36 H;  3HOV G;  2AQ3 B;  3PCO B;  4BBS H;  2RVL A;  3CCV A;  5JEA J;  2GVA A;  1JT8 A;  3HG9 A;  1PYW D;  3H3V C;  3J81 L;  4ZAI A;  3BU2 A;  1HTP A;  4TKO B;  1GXD C;  2PCF B;  1GUS A;  4WJ4 A;  2L1B A;  2Z8L A;  5EPL A;  3GTP B;  3P75 A;  3FRP B;  5C4X H;  5ELC A;  1X65 A;  3TZU A;  1LO5 D;  3F2D A;  4YIJ A;  4NB3 A;  4EVO A;  5AJ3 L;  3QR8 A;  1PH1 A;  2RCF A;  3W3A A;  3PO2 H;  4HSV A;  4C2M B;  1N9W A;  4LFA Q;  2KCC A;  3A8J E;  4NP5 A;  5C44 B;  2YYZ A;  1QZG A;  3GTP H;  2R7D A;  2FMC A;  1A63 A;  2EDG A;  1SBB B;  3BVZ A;  5D3D A;  4WOR A;  1LTI D;  1Q8K A;  2Z0S A;  4DV7 L;  3HOY B;  1WFQ A;  1SNO A;  2EY5 A;  2WKD A;  4DV5 Q;  5GRO A;  5E4W C;  2JP1 A;  5DLQ E;  2K6A A;  2BE5 D;  4HIO A;  1LTS D;  4GLV B;  3FP9 A;  1TS4 A;  2IX1 A;  1HJP A;  3AB9 A;  2OTJ A;  4DR7 L;  3I4M B;  1EZ8 A;  2F0Q A;  2YU9 B;  1BBX C;  1PRT F;  2B63 B;  1X6O A;  1PVO A;  1JJ2 A;  3N6R A;  3J80 c;  2BCO A;  2RHQ B;  3K5O A;  3J7Z C;  4KY7 A;  3TP7 A;  1O78 A;  4NXN Q;  3TQY A;  2NWG A;  3HGB A;  5FLX E;  2WFW A;  2E2H B;  2EYF A;  5A2Q L;  4RKL A;  3U9S A;  2PO4 A;  4HJ5 A;  3IL8 A;  4DV5 L;  3IRB A;  3FKI H;  3S17 H;  2EJG C;  2JA5 H;  5GAD C;  4R4C A;  2A19 A;  3NHH A;  2LFN A;  1ET6 A;  5H1S E;  3D6W A;  1YBY A;  1EYC A;  1V43 A;  2F0I A;  2NZ1 D;  2HHH Q;  4DR6 L;  5LHY 1;  5M5W H;  3HOY G;  2F4I A;  4RFB A;  2B2T C;  1ENA A;  2A6H C;  3O13 A;  3I4O A;  3M3Y B;  1BCP C;  4GZY C;  4A3B G;  1STG A;  2ID0 A;  4X62 Q;  4YY3 L;  1EY4 A;  3PF5 A;  1M90 C;  5JAV A;  2K1B A;  3NQT A;  4IPH A;  2F3I A;  3PQI A;  4FF3 A;  4C1N K;  1MSH A;  4BWG B;  1KDB A;  3R8B A;  4O42 A;  4X64 Q;  4OIJ A;  3SK4 A;  4OO1 I;  1NUC A;  3HS0 C;  5C3W A;  1SRU A;  2JK8 A;  3K5N A;  2N49 A;  3OSO A;  3I2Z A;  3A8K E;  1Q90 A;  2CWA A;  1TXY A;  2TMP A;  1CHP D;  4GLA C;  4DK1 A;  4HJ8 A;  4CJ0 B;  5FLX L;  1TWH H;  5D65 A;  3H94 A;  4A3E H;  5COR A;  2NVQ B;  1JWM D;  5I4D A;  4A75 A;  2M2L A;  5LL6 X;  2DY7 A;  3GV6 A;  2F0E A;  5C4J B;  4RHS A;  4IOC A;  3FKI B;  3NTK A;  4JPB W;  2E5L Q;  1A3T A;  3EQL C;  4IUQ A;  4H02 A;  1I94 L;  3S1Q H;  2FIN B;  5ELB A;  5DNF A;  2VB3 X;  3I7F A;  5ISR A;  2AKW B;  5FLX c;  1VMC A;  2O2L D;  3WOF A;  4A3J B;  1E2Z A;  5FJ8 G;  3R2I A;  1K8A C;  1WCM G;  5GAE C;  2I46 A;  2YU9 H;  3NEM A;  3I55 A;  2J0T D;  1K8M A;  2WII B;  1S5D D;  1XYI A;  3CC4 A;  3GTG B;  2ICE C;  1PFN A;  4UAI A;  1U9R A;  1EFW A;  5GAH C;  4DNI A;  2XNA C;  1VQ7 A;  3CCU A;  3H0G G;  4A3E G;  3T4A C;  1TS2 A;  3Q8D A;  1W6K A;  2HIX A;  3PUZ A;  4KHV A;  5IYB G;  2M9V A;  4K2K A;  1K0S A;  4C2M H;  1PXU A;  1VQI A;  4IJH A;  3OMG A;  1A3U A;  1F9S A;  3FPU B;  4OGQ C;  4K6L A;  2K7V A;  4KN7 C;  3DXJ C;  4JYA Q;  2SEB D;  1EY6 A;  4PMW A;  1HZ9 A;  1NR2 A;  3CMA A;  4G7O C;  3GP7 A;  4YHH Q;  1OXX K;  3OTO Q;  3SDZ A;  4O1N A;  1QWY A;  2B2Y A;  3MXN A;  3UDF A;  2J4X A;  2Z6K C;  3K81 C;  3S2H B;  1EFI D;  1H9S B;  2DUD A;  1YNN C;  1YVC A;  1HPC A;  1VQG A;  1YNJ C;  1PTO D;  2F0F A;  2Y0S B;  4GN3 B;  1H9M A;  1STH A;  2EY6 A;  5IP7 H;  4BBS B;  2JE6 I;  3RN5 A;  1GUO A;  2B39 A;  2PW5 A;  4B3S Q;  1T5X D;  4GOP B;  1AP0 A;  4QL5 A;  2C9O A;  1MI2 A;  3STB D;  3UE0 A;  3OW2 A;  2X6L A;  4HJ9 A;  4UDU C;  4BS9 A;  4YWL A;  1IKL A;  1PZI D;  1WTW A;  5J3B A;  4EQ5 A;  1MKH A;  2EXD A;  3DWP A;  4Y52 H;  1JJG A;  1Q8I A;  1ILQ A;  5IY0 A;  2UU9 Q;  4JI8 L;  1SJH D;  5BR8 L;  2ALY B;  2JXM B;  3W1B A;  4H0L C;  3MA2 B;  4F87 A;  2ZM6 L;  1KD1 C;  1RTO A;  4BY1 G;  2HDL A;  3I8Z A;  1VQA A;  3D6C A;  3TS2 A;  2JSO A;  3T56 B;  3AFP A;  2D62 A;  2IT1 A;  3H15 A;  3ULL A;  4JI2 Q;  2A69 D;  2JA6 G;  1ML0 D;  2AQ2 B;  2JJQ A;  2P5Z X;  1PH2 A;  1S5E D;  3BS1 A;  3DUZ A;  1HH2 P;  4KD4 A;  3VR2 A;  3HKS A;  2XRQ D;  3JAM i;  2XN9 C;  2WAQ G;  1TWH B;  3MAQ A;  1WYD A;  2QEX A;  4LFB L;  1N32 Q;  4OL7 A;  4XYO A;  4JI7 L;  3EIV A;  2HQL A;  2K5H A;  2NYZ D;  2RA4 A;  5IGG A;  2OF1 A;  1JIC A;  1SNP A;  2EJF C;  1CTM A;  4IUV A;  4L5T A;  3ZYY X;  3WWV A;  2CCZ A;  1YNN D;  2VUM B;  2B2U C;  4RAU C;  2EVB A;  2B8F A;  1X3P A;  1EYD A;  1TWA H;  1W6J A;  1AH9 A;  5JPN C;  4LNQ A;  4XQN A;  3SK6 A;  5HUR A;  4KN4 C;  1EY7 A;  1UEB A;  1XPR A;  1X32 A;  1JB3 A;  1AZP A;  1U4M A;  1PMR A;  1KHI A;  1EWI A;  4NPS A;  4N8X 1;  2VL6 A;  1HRJ A;  5IOC A;  3I73 A;  4I65 A;  3VR4 A;  3RNU A;  1HZC A;  4Y7N H;  5M5W B;  2KQ3 A;  3G7L A;  3PIO 3;  3VR6 A;  1VQ6 A;  1HUN A;  3RZD B;  2AUJ D;  4OWW B;  4HSP A;  1SNM A;  4JV5 L;  1PTO B;  4XIG S;  4R4O A;  3PIO A;  1SRO A;  1BOS A;  4P2C B;  1Y1W B;  3AQQ A;  1V1Q A;  2IW3 A;  2DY8 A;  1TWC H;  3KDF A;  1DYQ A;  3K5M A;  5JVH 3;  4A3L H;  5TSS A;  2JA7 B;  2ZXO A;  3J80 L;  4QB4 A;  3FDT A;  2AUK A;  4X3U A;  3TRZ A;  2EE1 A;  5IOD A;  3SK5 A;  3K0Y A;  1OXU A;  2F0V A;  1PRT D;  1OXV A;  3GTQ B;  1MIU A;  1HTL D;  4UPA A;  3C3L A;  4HR7 B;  1BO0 A;  1OTC A;  1Q3L A;  3CRK C;  3M4O B;  1VQC A;  3G4S A;  4HID A;  1DOK A;  2OQK A;  3A7L A;  3NTI A;  2F0L A;  1VS0 A;  1VQK A;  4X3S A;  3E6Z X;  1TWC B;  2CW0 D;  4BXX H;  1IYV A;  2LKV A;  5FO8 B;  2L9H A;  3K8A A;  2N88 A;  5LMU Q;  1Y1W H;  1EWH A;  2VQF Q;  3HZX A;  1GM5 A;  2X6G A;  4C3H H;  1MD2 D;  4DA2 A;  1WTX A;  3RZD H;  1BBU A;  3V96 A;  2Y0S E;  4DXG A;  5K5P A;  5EPK A;  5M5X H;  5BN5 A;  5JEA G;  4B3M L;  5C0X G;  3E5S A;  1SYC A;  4R8N A;  4KY6 A;  3F8T A;  3UDI A;  4MHE A;  3GTK B;  4LF4 Q;  5DM7 3;  4HJ7 A;  2FJ2 A;  5LMN W;  3MXG A;  2DN8 A;  4A3C G;  2NN6 G;  3K7A B;  4H44 C;  4P72 A;  2Q8I B;  3TBI B;  3EFX D;  3QG1 A;  5ELF A;  4EQN A;  1HNW Q;  2B29 A;  1KXL A;  4AYB E;  1TWA B;  1XMQ L;  4F8M A;  3CD6 A;  1AFP A;  4UHV A;  4QIW E;  2OTL A;  1CSP A;  4B3T Q;  5AJ3 Q;  3A7A B;  4ZLT F;  4QCL A;  1L1O A;  1ET9 A;  1D5M C;  1SFO B;  1R9T H;  1KRS A;  1NBW A;  5LMN Q;  3AU7 A;  4GNX A;  4FXG C;  3HOX H;  3S2D H;  1HR0 L;  1E7Z A;  3S14 H;  2UUC Q;  5CV4 A;  4C3J B;  4DR3 L;  1XNQ L;  2K75 A;  5ELE A;  1QZH A;  4DV1 L;  2QDB A;  5EKL A;  4X65 L;  4NXM L;  2R92 H;  2CKZ B;  1P16 A;  3KF8 A;  3M4P A;  3EBE A;  3GTM B;  2MO0 A;  4NXN L;  4QQB X;  1FGU A;  1UUP A;  3W1G A;  3TDQ A;  2VXW A;  1A2U A;  4A3B H;  1IBM L;  4CHT B;  1J6Q A;  3L9A X;  2JA8 G;  2EYH A;  3G48 A;  4F88 A;  4K5W A;  5GAG C;  4YCV A;  2E8G A;  3D4D A;  3TP5 A;  1QVG A;  4HJA A;  1CKO A;  1A62 A;  1I4X A;  3UDG A;  2ZXR A;  2KJX A;  4JC0 A;  4HAE A;  1OXS C;  3A0J A;  3HOZ H;  3FHW A;  1B50 A;  5IWA Q;  3GTM H;  3TN2 A;  1I6H H;  1B2T A;  1IW7 C;  4DV1 Q;  4PNY A;  3I70 A;  3ERQ A;  5C3E B;  3NBH A;  2K33 A;  2WB1 E;  1PH9 A;  1IYU A;  4IFD J;  4A3F B;  3VA7 A;  4YHH L;  2UUB Q;  2SNS A;  5E1F A;  2R93 B;  2E2D C;  4JOI C;  4JI5 Q;  5M5Y B;  2B2V A;  4XTC S;  4FXK C;  2G9H D;  3J81 i;  1FVI A;  2F3W A;  3QO2 A;  1LUZ A;  1NJI C;  2VZA A;  1F2Z A;  2F3V A;  3GTO B;  4POF A;  1CFM A;  1Q82 C;  4RKB A;  1U4R A;  3Q6S A;  4R9W A;  3TME A;  1NY4 A;  1QIL A;  4P73 A;  3GTL H;  2PQE A;  2KA7 A;  2NVY H;  2B8G A;  4YCU A;  2EYP A;  2G5D A;  2FMM A;  3KYH C;  1I4P A;  4A3L G;  3S2H H;  5M3M B;  1XPU A;  3I91 A;  5FO7 B;  1CKN A;  4ZK9 B;  4A3G H;  4IQZ A;  1EYG A;  1IBM Q;  2IJ0 A;  2K5N A;  4HMI A;  2NZH A;  4P71 A;  1V8Q A;  2D0O A;  4RMF A;  1LT6 D;  4AQY L;  4S3S A;  2MJ8 A;  1ZYR C;  1H9K A;  4DAV A;  1BCP D;  1DGS A;  4I7Z C;  3ERS X;  1LTL A;  2OXP A;  1B70 B;  1PFS A;  1GUT A;  5I2X A;  1EU4 A;  1NR4 A;  4TVA B;  4LUO A;  4PZ7 A;  1CQF A;  4XXE A;  3R3O A;  1HFG A;  1B9M A;  2NB0 A;  1KDA A;  1TWF B;  5KRU A;  5LMU L;  3OYY A;  3H91 A;  2NBF A;  2JA9 A;  1HNZ L;  1AEX A;  4RG1 A;  3F2B A;  1VQP A;  4BBR H;  2SOB A;  2NZO A;  2R7Z H;  2CQA A;  2N3S A;  5DEH A;  3ICE A;  3I90 A;  1BVS A;  1YEZ A;  4LF6 L;  1NAP A;  4IFD G;  4I7A A;  2R7Z B;  3CCS A;  2JA6 H;  3IAY A;  2UXB Q;  2F0J A;  3LWE A;  4X3K A;  3SR1 A;  2KEE A;  4A3D G;  1AW7 A;  1IKM A;  4B9W A;  3NP8 A;  1N34 Q;  4DR4 L;  2I5H A;  4GNX B;  3G6E A;  2SNM A;  2YTV A;  2F1M A;  4V0B A;  5C5M A;  4CBV A;  1NE3 A;  2I07 B;  5C4X G;  5CV6 A;  3T16 A;  4R4Q A;  1SNC A;  4A3J G;  4RA8 A;  5IYD G;  1M4V A;  3U4Z A; 
#chains in the Genus database with same CATH homology
 5I6W A;  1B53 A;  3D4R A;  4ZUJ A;  3HOV B;  1SJE D;  3U9O A;  3W2D A;  4G4K A;  4MN3 A;  4RGN A;  3OMC A;  1TII D;  3VA5 A;  1CZW A;  3SHL A;  1PFB A;  1TR5 A;  3I4L A;  2F0P A;  3M4Y A;  4U68 A;  3PUY A;  1D2B A;  1ZEQ X;  1LT5 D;  1SSO A;  3QJY A;  3GO5 A;  4FYD A;  1ESR A;  4ID6 A;  1JQY D;  2K04 A;  1GUW A;  1B9N A;  1LV9 A;  1KNA A;  1PZJ D;  5CBE E;  4XT1 B;  3DEP A;  3V05 A;  5F2D A;  3H09 A;  4KV6 A;  3J81 E;  1VDZ A;  2NTT A;  1WD1 A;  1D6E C;  4A3B B;  4DAY A;  3S17 B;  2F0K A;  5G3L F;  4DNR B;  3MVV A;  1IL8 A;  5IIF A;  5DM6 3;  4IN3 A;  5CV7 A;  2RSO A;  3MTS A;  2MPM A;  3D31 A;  1CT1 D;  1L0X B;  1RKN A;  1ZYR D;  3SK8 A;  4XQJ A;  1BR9 A;  3R2T A;  1L0Y B;  4CKC A;  2PZW A;  3LNN A;  4Q5V A;  4X3T A;  3PUV A;  1ESF A;  5AFW A;  4K2L A;  2A6E C;  5KYL A;  4L63 B;  4XYQ A;  4TRD A;  4IUT A;  4HCS A;  2EOT A;  4PV1 C;  4WRD A;  3H6M A;  1B1Z A;  4C56 C;  3VYU A;  4RCO A;  5A2Q E;  2AWN A;  2XSC A;  4HED A;  5BN4 A;  4MIU A;  3A54 A;  1JWS D;  4ZKC B;  2SDF A;  5BN3 A;  5J1Z A;  2BA0 A;  1JOQ A;  2F0D A;  4IUR A;  3MHB A;  3E0J A;  1LTT D;  5D3I B;  3KBG A;  4KTA A;  1LT3 D;  1FD7 D;  1SYE A;  3QWN A;  3URY A;  4LJZ C;  1SMY D;  1LAC A;  1S5F D;  1I4Q A;  2JEA I;  1E2V A;  2R61 A;  2JA6 B;  1GOZ A;  3GD7 A;  4A3D B;  3VYT A;  1F2M A;  3C1F A;  1HHV A;  4AYB B;  4LK1 C;  3M7N A;  3K57 A;  3EVQ A;  1CA5 A;  3IKJ A;  3GV3 A;  2A5H A;  1PTO H;  1EEI D;  1O80 A;  1AN8 A;  3SXH A;  3MZ5 A;  2O4X A;  5C4Z A;  2IPK D;  2X69 A;  5IT9 E;  3BVG A;  3N52 A;  1STB A;  1DOL A;  2WKC A;  4IUN A;  4DFA A;  3D4W A;  1EOT A;  3PUW A;  1GUG A;  1WD0 A;  2F0W A;  4A3G B;  2QEJ C;  2AQ1 B;  3A56 A;  3C1E A;  1STE A;  1Z6H A;  5EBC A;  2ENB A;  4H13 C;  3VR3 A;  3DMU A;  5NUC A;  3BG3 A;  4KHZ A;  1SXT A;  4J1M A;  4FF2 A;  5CR3 A;  1TT2 A;  2PZU A;  1RF2 D;  2WB1 B;  3HKZ B;  2JYO A;  1Q1B A;  1UAP A;  5C4H A;  3T53 B;  1I6H B;  1SYD A;  3HOZ B;  4DXF A;  3CQZ B;  1BCP F;  2R6G A;  3OOC A;  2F0N A;  4ZUI A;  5CBA E;  2M00 A;  1NCV A;  4LMQ D;  3OWE B;  1WTP A;  1DCZ A;  2IX3 A;  2WAC A;  3PIP 3;  1F9P A;  2O5I C;  5JEA H;  1CZG A;  2E74 C;  2R92 B;  1DON A;  1BCP B;  2LMC B;  1B44 D;  1VCI A;  5JVG 3;  1DD2 A;  2ICI A;  5EBD A;  5K36 G;  1J9O A;  1HA5 A;  1FGB D;  1HQR D;  1HCZ A;  2L0C A;  4WFN 3;  5M9O A;  1TVX A;  2C5C A;  2E76 C;  3GTJ B;  3K5L A;  5E4X A;  2FFK B;  5C3X A;  1KAB A;  2NVT B;  2MUY A;  1STN A;  4OHJ A;  1F2L A;  3ITP A;  1JR0 D;  1AZQ A;  3MXU A;  2XWJ B;  2EYO A;  1I6V C;  3TP6 A;  4C3H B;  3AMU A;  4F7X A;  1QCB D;  4FNF A;  1TS5 A;  4QIW B;  3J7Y W;  4OO1 G;  5EKK A;  2XVS A;  2HQE A;  4C1N I;  3VYS A;  1RJT A;  1CM9 A;  2D9U A;  1TQO A;  2K01 A;  4HCE A;  1VMP A;  5LL6 S;  1TY2 A;  3NWT A;  3PUX A;  2Z1C A;  1TKW B;  1GHK A;  4CJ2 C;  4KMU C;  1PRT C;  1B3A A;  2IWH A;  4KK7 A;  3Q23 A;  5IGE A;  2KUM A;  1K83 B;  1ZXT A;  4RGM A;  2NN6 H;  2KED A;  1Y1V B;  3I4N B;  2RKS A;  3BDC A;  4DAP A;  3M85 A;  1PFM A;  4G57 A;  1SMY C;  1XWE A;  1DJR D;  4NKL A;  3SEB A;  1R4Q B;  1I4H A;  1RHP A;  1BF4 A;  4BY1 B;  2KCN A;  1GHJ A;  2KVM A;  3FVQ A;  3NK9 A;  5D14 A;  4L8J A;  1I50 B;  5EGT A;  3C46 A;  1EY5 A;  1CK1 A;  1V1P B;  2B2V C;  1HQM C;  3P1H A;  2F03 A;  5I9O A;  5I6Y A;  2K5D A;  1Y8N B;  4BA1 I;  4PQX A;  1JWU D;  5IGF A;  1Z47 A;  4DNT B;  2L4N A;  1HXY D;  4BA2 I;  5EPJ A;  5JJZ A;  2KEC A;  5KYI A;  1PTO F;  2O5J C;  1HUM A;  1RCV D;  1GJX A;  2BDN A;  1EYA A;  3D3R A;  3OWF A;  3T13 A;  4IAL A;  5CV9 A;  2N55 A;  2CHB D;  2K28 A;  3SVM A;  1Q12 A;  3S1R B;  2F0M A;  3BYY B;  1SNQ A;  1ILP A;  5KNC A;  3TZD A;  3NBI A;  3PO2 B;  4IZ8 A;  5C6A A;  5T1I A;  5C4X B;  3GQB A;  4FO2 A;  4K5V A;  2Z4H A;  1KDC A;  1EL0 A;  4RWS C;  4C3I G;  4ZRZ A;  2RSN A;  3QIA A;  1TWG B;  1KTK A;  1CHQ D;  1DXM A;  3I72 A;  2OT2 A;  1SDF A;  1PDQ A;  2EYJ A;  1EY9 A;  1EWC A;  3CHB D;  2ZXP A;  1V1P A;  5DAU A;  4KY5 A;  3ND8 A;  2WP8 J;  1F2Y A;  2PW7 A;  3M7G A;  2XRS D;  2QCP X;  4QUC A;  4ABN A;  1BXT A;  3HP3 A;  1EU3 A;  2NTS A;  4A3M B;  1C4Q A;  1MSG A;  4K6D A;  2BA1 A;  1XX8 A;  1LT4 D;  2PYK A;  1DM0 B;  1Q1E A;  3KUP A;  2H4O A;  3PV0 A;  5I9P A;  1D1I A;  3FEW X;  1A3V A;  4QUF A;  4OO1 H;  2AWO A;  5IGB A;  5C0X I;  4NDX A;  4IUP A;  1UEA B;  1SYG A;  3MFG A;  1U4P A;  1EZ6 A;  4A3E B;  4KI0 A;  4V19 0;  1NSN S;  5M3F B;  3NTH A;  2CVR A;  1F9Q A;  3QB3 A;  4K14 A;  1Y8O B;  1JOR A;  2A68 C;  4N9P A;  1EIH A;  2MHV A;  1WCM B;  2OEO A;  3VYR A;  2K03 A;  3S1N B;  4KKT A;  5ELD A;  1CI3 M;  3I3C A;  1LTR D;  2A68 D;  4KD3 A;  2KHS A;  1LTB D;  5IGD A;  3BVM A;  1K8O A;  3NPP A;  3NWS A;  1E0B A;  4A3K B;  1S4Z A;  2K32 A;  1OO9 B;  3J7A V;  1Z7T A;  5M5X B;  5HGT A;  2ZT9 C;  3QOJ A;  5CV5 A;  1G6Z A;  1KAA A;  3EJI A;  2EJM A;  1O7Z A;  4M8A A;  3R93 A;  4IFD H;  3P7J A;  3DEO A;  2EY1 A;  2A6H D;  4ZKB B;  1BQQ T;  4PMB A;  3RLF A;  5FOB B;  4A3I B;  2EYL A;  2F0T A;  1PLF A;  3KBX A;  1E2W A;  1OXT A;  3HOU B;  4ULL A;  3JAM E;  3K58 A;  3NXW A;  4CJ1 B;  5J39 A;  5KNB A;  5I2Y A;  2RBM A;  3KLR A;  4ME5 A;  1I3Q B;  4RGT A;  2HUG A;  2F0U A;  1F9R A;  5KND A;  2LS0 1;  3K59 A;  3BYT B;  3WDN A;  2BE5 C;  3KK7 A;  4Y7N B;  2JEB I;  4XT3 B;  2L55 A;  4HTH A;  1J8I A;  2JA8 B;  3T51 B;  4CKB A;  5CC4 A;  2B2T A;  3LX0 A;  5KEE A;  4KJO A;  1QNK A;  5FK9 C;  5J22 A;  1BDO A;  2A6E D;  3H0G B;  1QOH A;  3OW7 A;  3VR5 A;  3MWY W;  2BDO A;  1ENF A;  4OIK A;  2F0G A;  1SAP A;  1Y69 U;  3QOL A;  4DGZ A;  3BZD B;  2XWB B;  4NMZ A;  1T5E A;  3D8G A;  3BDL A;  1A15 A;  5CV8 A;  1EQT A;  3CU7 A;  5T1G A;  2G9D A;  3RMH A;  4HMJ A;  2CW0 C;  4J8Q A;  1CA6 A;  1ZKO A;  4RH6 A;  4XDX A;  1YNJ D;  4QMG A;  3K6O A;  1ENC A;  2D2C C;  1LTA D;  2F0O A;  3V2T A;  3DM1 A;  5EJW A;  3HOX B;  3S2D B;  2EY2 A;  1QB5 D;  1S5C D;  1IHZ A;  3TP8 A;  1G8Z D;  2EZV A;  1SE4 A;  3J7A F;  4KKS A;  1G2T A;  1H9R A;  1ONL A;  1SYF A;  2NVX B;  3CKI B;  1JE4 A;  2TSS A;  3IFD A;  3Q22 A;  2RDG A;  1V1O A;  3ONA B;  3S9W A;  4H7B A;  3BDO A;  4QF4 A;  2K5W A;  1RTN A;  4K8J A;  1VF5 C;  1EEF D;  4KKU A;  2DNC A;  2F0S A;  5C5L A;  2L12 A;  1WTQ A;  1WTO A;  4EQP A;  2KOL A;  1TS3 A;  1UNS A;  2L11 A;  1TY0 A;  2Q8T A;  5KGU A;  1STA A;  2IX0 A;  2E2I B;  1LLR D;  5E3F A;  2F0H A;  4Z9C B;  4G7Z C;  2PMZ B;  1H9S A;  2PZT A;  1EY0 A;  1RDP D;  5JOB A;  4KJN A;  1F77 A;  3OHX C;  1U4L A;  2QKI C;  3A55 A;  2PPB C;  1G29 1;  3L3O C;  1HA6 A;  1D5Z C;  3FPP A;  4RGO S;  2PNR C;  5C0X J;  2NVY B;  1JC7 A;  4L6T B;  4ILW A;  2RDF A;  4RCN A;  4ZYS A;  3J80 E;  1SYB A;  3KLS A;  3F2U A;  2V4D A;  5FO9 B;  3OPO A;  2RDH A;  2D5D A;  4JBW A;  4XQQ A;  1C48 A;  1PTO C;  1G2S A;  1PZK D;  4RHR A;  3NQI A;  1O7Y A;  2B2W C;  1IW7 D;  3NE5 B;  4EGV A;  1II3 A;  3FMC A;  4G7H C;  3A8I E;  2EYM A;  4B08 A;  3OIP A;  4CGY B;  3S1M B;  2E75 C;  1SND A;  4TSS A;  1KLU D;  2HDM A;  1PRT B;  1S5B D;  1JOK A;  1D5X C;  1H9J A;  1A6X A;  2RQX A;  4C3I B;  4K5X A;  2EPB A;  5C0X H;  2MP1 A;  1KNE A;  1EY8 A;  3DWQ A;  5JPM C;  3Q0A A;  1SEB D;  3MC0 B;  3MXP A;  3WOE A;  1ICW A;  3HRZ C;  3UI2 A;  2WV6 D;  2E2J B;  1FR3 A;  3HEJ A;  5CGK A;  1M8A A;  4DU9 A;  3ERO A;  3KLS X;  1GUN A;  1BNZ A;  4N9T A;  4FP5 D;  2NUC A;  1KLG D;  2WIN B;  4E6I A;  4NW2 A;  3SE0 A;  4IUU A;  3G6J B;  4B9X A;  4BY7 B;  3IFT A;  3JAM L;  1DZ1 A;  1D1K A;  3RZO B;  4U67 3;  3ND9 A;  3C2P A;  1G91 A;  1C8C A;  3RD4 A;  1TU2 B;  4JK1 C;  1STY A;  3P20 A;  1XTC D;  5A35 A;  4K8I A;  2Z4I A;  4FXD A;  3HOW B;  1BUV T;  5EQ0 A;  2A74 C;  5COY A;  4ODG A;  5CMD A;  4LAA A;  4DK0 A;  5CYU A;  3NSW A;  2MGS A;  5KIX A;  1LTG D;  4A93 B;  4FF4 A;  1Y8P B;  1RD9 D;  5G3L D;  3EA6 A;  4BBR B;  1B4O A;  2A73 B;  1QJO A;  5FKA C;  1VF7 A;  4EQO A;  4IFD I;  2HCI A;  2K05 A;  3DWA A;  3TSS A;  1I4R A;  3RUZ A;  2WAQ B;  4TQU S;  1QE6 A;  2IL8 A;  5IGC A;  1MBY A;  2B2Y C;  4C3J G;  4DN4 M;  1QNU A;  2K5Q A;  4ZQ3 A;  1JOO A;  1SE2 A;  3S1Q B;  4C3H G;  5EKI A;  4CKE A;  1R4P B;  4Q0F A;  1MGS A;  2QIL A;  3OIQ A;  2DNE A;  3L7Z C;  4R8I A;  2VNU D;  1FNV A;  5IT9 L;  3NUC A;  1FYC A;  2FHT A;  2XIW A;  3GTL B;  1EQV A;  4HN7 A;  2R3Z A;  4FVM A;  3MEH A;  4PMC A;  1XXG A;  1QG7 A;  1FNU A;  1WTR A;  1O7L A;  4FF1 A;  2B2W A;  2H1E A;  4WJW A;  3S16 B;  1LAB A;  1ROD A;  3LWU A;  3PO3 B;  2EXZ A;  1CQV A;  2BOS A;  2A69 C;  2NN6 I;  3DHQ A;  2Q8R E;  3Q24 A;  1WVL A;  3PMF A;  1I4G A;  1DOM A;  4DF7 A;  2JA5 B;  2VB2 X;  3X3N A;  3CRL C;  1SE3 A;  1JCK B;  1WTV A;  1X3Q A;  1EIG A;  4J6H A;  3MFY A;  2J7Z A;  4M1U B;  1FNW A;  2QF7 A;  3S14 B;  3S15 B;  1HFN A;  2B2U A;  2GA4 B;  1A2T A;  3X3M A;  2HCC A;  2L5T A;  2LY7 A;  1R9T B;  5K36 H;  2AQ3 B;  2RVL A;  5JEA J;  3HG9 A;  1PYW D;  3H3V C;  3J81 L;  4ZAI A;  1HTP A;  4TKO B;  1GXD C;  2PCF B;  1GUS A;  2L1B A;  2Z8L A;  5EPL A;  3GTP B;  3P75 A;  3FRP B;  5ELC A;  3TZU A;  1LO5 D;  4YIJ A;  4EVO A;  3W3A A;  4HSV A;  4C2M B;  2KCC A;  3A8J E;  4NP5 A;  5C44 B;  2YYZ A;  2FMC A;  2EDG A;  1SBB B;  3BVZ A;  5D3D A;  4WOR A;  1LTI D;  3HOY B;  1SNO A;  2EY5 A;  2WKD A;  5E4W C;  2JP1 A;  2K6A A;  2BE5 D;  1LTS D;  1TS4 A;  2IX1 A;  3AB9 A;  3I4M B;  1EZ8 A;  2F0Q A;  2YU9 B;  1BBX C;  1PRT F;  2B63 B;  3N6R A;  2BCO A;  3K5O A;  4KY7 A;  3TP7 A;  1O78 A;  2NWG A;  3HGB A;  5FLX E;  2E2H B;  2EYF A;  5A2Q L;  4RKL A;  3U9S A;  2PO4 A;  3IL8 A;  2EJG C;  3NHH A;  2LFN A;  1ET6 A;  3D6W A;  1EYC A;  1V43 A;  2F0I A;  2NZ1 D;  5LHY 1;  2F4I A;  4RFB A;  2B2T C;  1ENA A;  2A6H C;  3O13 A;  3M3Y B;  1BCP C;  4GZY C;  1STG A;  2ID0 A;  1EY4 A;  5JAV A;  2K1B A;  3NQT A;  4FF3 A;  4C1N K;  1MSH A;  4BWG B;  1KDB A;  3R8B A;  4O42 A;  4OIJ A;  3SK4 A;  4OO1 I;  1NUC A;  3HS0 C;  5C3W A;  3K5N A;  3OSO A;  3A8K E;  1Q90 A;  2TMP A;  1CHP D;  4DK1 A;  4CJ0 B;  5FLX L;  5D65 A;  3H94 A;  5COR A;  2NVQ B;  1JWM D;  5I4D A;  5LL6 X;  2M2L A;  2DY7 A;  3GV6 A;  2F0E A;  5C4J B;  4RHS A;  3FKI B;  3NTK A;  1A3T A;  3EQL C;  4IUQ A;  2FIN B;  5ELB A;  5DNF A;  2VB3 X;  5ISR A;  1VMC A;  2O2L D;  3WOF A;  4A3J B;  1E2Z A;  3R2I A;  2I46 A;  2J0T D;  1K8M A;  2WII B;  1S5D D;  1XYI A;  3GTG B;  2ICE C;  1PFN A;  4UAI A;  1U9R A;  2XNA C;  3T4A C;  1TS2 A;  1W6K A;  3PUZ A;  4KHV A;  2M9V A;  4K2K A;  1PXU A;  3OMG A;  1A3U A;  1F9S A;  3FPU B;  4OGQ C;  4K6L A;  2K7V A;  4KN7 C;  3DXJ C;  2SEB D;  1EY6 A;  4PMW A;  1NR2 A;  4G7O C;  3GP7 A;  1OXX K;  3SDZ A;  4O1N A;  1QWY A;  2B2Y A;  3MXN A;  2J4X A;  3S2H B;  1EFI D;  1H9S B;  1YNN C;  1HPC A;  1YNJ C;  1PTO D;  2F0F A;  2Y0S B;  1H9M A;  1STH A;  2EY6 A;  4BBS B;  2JE6 I;  1GUO A;  2B39 A;  2PW5 A;  1T5X D;  1AP0 A;  2C9O A;  1MI2 A;  2X6L A;  4UDU C;  4BS9 A;  1IKL A;  1PZI D;  1WTW A;  3DWP A;  1Q8I A;  1ILQ A;  1SJH D;  2JXM B;  4H0L C;  3MA2 B;  4F87 A;  1RTO A;  2HDL A;  3I8Z A;  3D6C A;  2JSO A;  3T56 B;  2D62 A;  2IT1 A;  2A69 D;  1ML0 D;  2AQ2 B;  1S5E D;  3BS1 A;  3DUZ A;  4KD4 A;  3VR2 A;  2XRQ D;  2XN9 C;  1TWH B;  3MAQ A;  4OL7 A;  4XYO A;  2NYZ D;  2RA4 A;  5IGG A;  2OF1 A;  1JIC A;  1SNP A;  2EJF C;  1CTM A;  4IUV A;  3ZYY X;  1YNN D;  2VUM B;  2B2U C;  4RAU C;  2EVB A;  2B8F A;  1X3P A;  1EYD A;  1W6J A;  5JPN C;  4XQN A;  3SK6 A;  5HUR A;  4KN4 C;  1EY7 A;  1X32 A;  1JB3 A;  1AZP A;  1U4M A;  1PMR A;  1HRJ A;  5IOC A;  3I73 A;  4I65 A;  3VR4 A;  5M5W B;  2KQ3 A;  3G7L A;  3PIO 3;  3VR6 A;  1HUN A;  3RZD B;  2AUJ D;  4HSP A;  1SNM A;  1PTO B;  4XIG S;  1BOS A;  4P2C B;  1Y1W B;  2IW3 A;  2DY8 A;  5JVH 3;  1DYQ A;  3K5M A;  5TSS A;  2JA7 B;  2ZXO A;  3J80 L;  4QB4 A;  3FDT A;  2AUK A;  4X3U A;  2EE1 A;  5IOD A;  3SK5 A;  3K0Y A;  1OXU A;  2F0V A;  1PRT D;  1OXV A;  3GTQ B;  1HTL D;  3C3L A;  4HR7 B;  1BO0 A;  1Q3L A;  3CRK C;  3M4O B;  1DOK A;  3A7L A;  3NTI A;  2F0L A;  4X3S A;  3E6Z X;  1TWC B;  2CW0 D;  1IYV A;  2LKV A;  5FO8 B;  2L9H A;  2N88 A;  1EWH A;  3HZX A;  2X6G A;  1MD2 D;  4DA2 A;  1WTX A;  3V96 A;  4DXG A;  5K5P A;  5EPK A;  5BN5 A;  5JEA G;  5C0X G;  3E5S A;  1SYC A;  4R8N A;  4KY6 A;  4MHE A;  3GTK B;  5DM7 3;  2FJ2 A;  3MXG A;  2DN8 A;  2NN6 G;  3K7A B;  4H44 C;  2Q8I B;  3TBI B;  3EFX D;  3QG1 A;  5ELF A;  4EQN A;  1TWA B;  4F8M A;  1AFP A;  3A7A B;  4ZLT F;  4QCL A;  1ET9 A;  1D5M C;  1SFO B;  3AU7 A;  4FXG C;  5CV4 A;  4C3J B;  5ELE A;  2QDB A;  5EKL A;  3KF8 A;  3GTM B;  1UUP A;  3TDQ A;  2VXW A;  1A2U A;  4CHT B;  3L9A X;  2EYH A;  4F88 A;  4K5W A;  3D4D A;  3TP5 A;  1I4X A;  2ZXR A;  2KJX A;  4HAE A;  1OXS C;  1B50 A;  3TN2 A;  1B2T A;  1IW7 C;  4PNY A;  3I70 A;  3ERQ A;  5C3E B;  3NBH A;  2K33 A;  1IYU A;  4IFD J;  4A3F B;  3VA7 A;  2SNS A;  5E1F A;  2R93 B;  2E2D C;  5M5Y B;  2B2V A;  4XTC S;  4FXK C;  2G9H D;  2F3W A;  3QO2 A;  1F2Z A;  2F3V A;  3GTO B;  1CFM A;  4RKB A;  1U4R A;  3Q6S A;  4R9W A;  3TME A;  1QIL A;  2PQE A;  2KA7 A;  2B8G A;  2EYP A;  2FMM A;  1I4P A;  5M3M B;  3I91 A;  5FO7 B;  4ZK9 B;  4IQZ A;  2IJ0 A;  4HMI A;  1V8Q A;  1LT6 D;  4S3S A;  2MJ8 A;  1ZYR C;  1H9K A;  4DAV A;  1BCP D;  4I7Z C;  2OXP A;  1GUT A;  5I2X A;  1EU4 A;  1NR4 A;  1CQF A;  4XXE A;  3R3O A;  1HFG A;  1B9M A;  2NB0 A;  1KDA A;  1TWF B;  5KRU A;  3H91 A;  2NBF A;  1AEX A;  2SOB A;  2CQA A;  5DEH A;  3I90 A;  1NAP A;  4IFD G;  2R7Z B;  3IAY A;  2F0J A;  3LWE A;  4X3K A;  3SR1 A;  2KEE A;  1IKM A;  1AW7 A;  4B9W A;  3NP8 A;  2SNM A;  2F1M A;  4V0B A;  5C5M A;  4CBV A;  2I07 B;  5CV6 A;  3T16 A;  1SNC A;  4RA8 A;  1M4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...