1S5ED

Cholera holotoxin, crystal form 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
pubmed doi rcsb
molecule keywords Cholera enterotoxin, A chain precursor
source organism Vibrio cholerae
molecule tags Transferase,toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, J, K, L, M, N
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s5eD00
2RDGA 1QILA 1RD9D 4RGTA 4C56C 1DJRD 1LTTD 1L0XB 3BYYB 1LT5D 1LTID 1PRTB 1V1PA 1FNWA 1HTLD 1EU3A 1AW7A 1JQYD 1ENFA 1LLRD 1T5XD 5I4DA 1LO5D 1BCPC 3DWAA 1SEBD 3R2TA 1B44D 1D5XC 1PTOC 2XRQD 4RFBA 4K6LA 1DYQA 2G9HD 3BVZA 4OHJA 5TSSA 4TSSA 1SBBB 4L63B 2TSSA 4RGMA 1BXTA 1UNSA 4Z9CB 1I4RA 1HXYD 1JWUD 1PRTF 1LTGD 1S5DD 4RGNA 1EEFD 1RDPD 2J4XA 2RDHA 3DWPA 1SXTA 1CT1D 1JWSD 1S5FD 1FNVA 1AN8A 2AQ2B 3MFGA 5ELDA 1D5MC 3R8BA 3TSSA 3DWQA 1PYWD 1ET9A 1TS5A 1EFID 1SJHD 3BYTB 4DXGA 1CQVA 1I4HA 1M4VA 4RCOA 5ELFA 1S5BD 1FNUA 1BCPB 1EEID 1HQRD 1JWMD 1XTCD 1LTBD 1PZID 1RCVD 1TS3A 1TS2A 4DXFA 1V1OA 3R2IA 3W2DA 3KLSX 1FGBD 1PTOB 3GP7A 1S5CD 1PRTD 2AQ1B 4RHRA 1HA5A 2XN9C 5FKAC 1BCPD 1LTRD 2R61A 5ELEA 2Z8LA 1D5ZC 5D3DA 2IJ0A 1PTOD 1I4GA 1KLGD 1PTOH 1BCPF 1V1PB 3OWEB 1SJED 1JCKB 1UUPA 1G8ZD 2QEJC 2AQ3B 4RGOS 1CK1A 1PTOF 1TY2A 3BVGA 1KLUD 1FD7D 1TY0A 4UDUC 1CHPD 3EA6A 1LTAD 1PZKD 2XRSD 5D3IB 1JR0D 3MC0B 4ZYSA 1MD2D 1KTKA 1PZJD 2QILA 1LTSD 2ICIA 1SE4A 1RF2D 1EU4A 1CHQD 1GOZA 1TS4A 2NTTA 3EFXD 4L6TB 1SE2A 5FK9C 2XNAC 1PRTC 2IPKD 4BWGB 3URYA 4RHSA 1S5ED 1I4QA 1ESFA 2O2LD 5ELBA 2NTSA 1B1ZA 1STEA 2SEBD 3O13A 1EWCA 4O1NA 1F77A 1SE3A 2WV6D 1ET6A 1L0YB 1LT6D 3BVMA 1LT4D 4RH6A 1I4PA 5ELCA 3SEBA 3CHBD 1D6EC 3BZDB 1I4XA 2CHBD 1XXGA 3V05A 1LT3D
chains in the Genus database with same CATH superfamily
2MPMA 1I94Q 3I7FA 4IFDI 2PZTA 4DUYL 2F3WA 3NWSA 4F87A 1PH2A 5M3MH 4QUFA 3S1MB 4ME3A 4DV3L 4XT1B 4JG2A 2Z4IA 2E75C 3A55A 4DUZQ 3PGZA 3OIQA 2N55A 5AFWA 4GKJQ 1K8GA 1XNRQ 5EPJA 4GOPB 4KN7C 3CPWA 3PQIA 5FO7B 1PRTF 3ERQA 4QB4A 4IQZA 5J39A 2VW9A 2AQ2B 4OXPA 1J6QA 4EQPA 4QIWE 1H9SA 4MTKA 5GAGC 5HY6A 3HOXB 4YCVA 2R7FA 4A3BG 1LTBD 5IYCH 5IODA 3NXWA 1CI3M 5LMNQ 3BDCA 3PUYA 2HIVA 3X3MA 3F2BA 1HR0L 1PRTD 1YHQA 1X9NA 4LUOA 2K5QA 1HA5A 5M5YB 1AFPA 2CWAA 3FRPB 2XSCA 1IW7C 2L55A 5E4XA 4EQ5A 3TQYA 4LF9L 3CMEA 5IWAQ 4JBKA 2QF7A 3OWEB 2UU9L 1IL2A 3LWUA 1G8ZD 2BDOA 4DV1L 3F8TA 1X56A 3T1HQ 5EPLA 4K8JA 3LGJA 2Q8RE 4H02A 1N36L 5C44G 3BDLA 4JOIA 4YY3Q 1HJPA 2ICIA 4KKSA 4X3KA 3PUZA 1STAA 4G7ZC 4HSVA 3CCJA 4POGA 2K5DA 3T1YQ 1MJEA 1A8VA 3P20A 3HOWB 1Q1EA 4BS9A 1J8IA 4QIWB 4JI2Q 2JSOA 4IJLA 3BVMA 1QNUA 1JE4A 3NBHB 1X6OA 3DEPA 4JYAL 2K1BA 3I72A 3UE0A 3T56B 1IBML 1XMQQ 3GTMB 2A1AA 1VQHA 4IPCA 5HGQA 3SHLA 2VZAA 1XMOQ 3H0GB 3E5SA 1STNA 5C4XB 4QGUA 4JI8Q 3PO3G 3OSOA 3NTIA 2UUCQ 2UXDL 5EGTA 3MXNB 2B2UA 2KJXA 2E5LL 2E2IH 5TSSA 2VXWA 2NZHA 3VYRA 1K73C 4UAIA 4RGMA 2HT1A 1UNSA 2JA5G 4ZLTF 5DAUA 3DM1A 1RDPD 2DUDA 1EUJA 5CV7A 1WTWA 3ER0A 2IX3A 4R4CA 1ET9A 1EFID 3SK5A 1VQPA 4NMZA 4DXGA 1EIGA 2FHTA 1VQ7A 4DV2L 3CC2A 4FF2A 3CCUA 2Q2UA 2A19A 4Y7NH 3J81i 2CKZB 1AP0A 4HTHA 3MEFA 5IT9L 1PTOB 4JBWA 1AEXA 5M5XB 3GTOB 5FLMG 3W5OA 5JJIA 2AUKA 2MP1A 5CGKA 4N9PA 4BY7B 1TQOA 1YVCA 4DUYQ 2H1EA 4LFCL 1YHAA 4OO1H 4DV3Q 1EY5A 2NB0A 3KJPA 1JCKB 3DLLA 4P75A 2K7VA 5CV5A 4QF4A 2AQ3B 1HZAA 4QJFA 5JJLA 1N32Q 4KKUA 4KV6A 4TVAB 5D14A 2F03A 5JPMC 1Z6HA 2LXJA 5FLXc 3C1FA 3J7ZC 1EIYB 1VDZA 3OIPA 1SDFA 1B4OA 3PIO3 3J7YW 3HFZB 3W1BA 2J0TD 3PMFA 5DEHA 1BF4A 2LY7A 1MBYA 1TWCB 3U9SA 2YTXA 3VYUA 3HOVH 4BBSH 1EZ8A 3KDFB 4RKBA 3JAMi 4XDXA 2E2HB 3S1NH 2UUBL 1HR0Q 3KLWA 3K81C 2L11A 4OL7A 4R8IA 1M1KC 1GUOA 4GN4B 1W2BA 1TIID 5ELCA 4DGZA 1O7LA 2X6GA 3GTJB 4B3ML 4YWKA 2CHBD 1V43A 1EZ6A 4LF9Q 1DZ1A 1XWEA 5C0XG 2C35B 1RD9D 3PIOA 3TEHB 3I8ZA 1DJRD 3A7AB 2UU9Q 3A56A 1RIPA 3I4NH 1H95A 4DV1Q 3UDIA 2YTYA 1B70B 3NQIA 1IXRA 1ZKOA 5I6WA 1N36Q 2F0LA 1TU2B 1EYAA 2R93B 5CV8A 2MO0A 3MA2B 4DR6L 3Q8DA 5IYDH 1VQ4A 3ND8A 5BR8L 4P74A 4DFAA 3J80c 1NUCA 1CKNB 5E4WC 2O5IC 1FNVA 1H9JA 2N88A 4IOAA 1X3GA 1QVFA 3CC7A 3H6MA 2MO1A 4CJ0B 5BN3A 3EBEA 2V4DA 2ZTDA 1D1KA 3F2DA 5ISRA 1NMGA 4DAMA 2EY1A 5EPKA 4RCNA 1XNQL 4YHHL 1TXYA 4B3TL 1BKBA 3KLSX 4ULLA 1PH8A 3GP7A 4JYAQ 2GVAA 3F2UA 4WJWA 3SR1A 2TMPA 1CTMA 1IBMQ 5F2DA 2L12A 2Z8LA 3STBD 2CFMA 1GUNA 2XGTA 3HOZG 3S17H 3RMHA 1Y1VB 1TWFH 3S15H 2UXDQ 1PTOF 2B63H 2E5LQ 1VQDA 1G51A 5M3FG 1YNXA 4JOIC 4C2MH 1NMFA 1F9PA 3EA6A 3S2HH 4A3CG 1LTSD 3NQTA 4OX9L 1LYLA 3E9HA 1GOZA 2F0NA 4CDCC 1VF7A 2CWPA 2A8VA 3OWFA 2WINB 1VMPA 4TRDA 4L5TA 2YV5A 1WTPA 1A2UA 4P72A 4DV2Q 5JPNC 4K0KQ 4KHPL 4J6HA 1EY8A 5C4ZA 1QUQA 1RODA 1CKMA 5IGEA 1E7ZA 1N33L 3O13A 2D0PA 3S24A 2K05A 2CH4W 4UY8C 3FMCA 5JVH3 1Q7YC 2R92H 5KNDA 4GZYC 2JA7G 3AYHB 4OONA 1VQ9A 2B2WC 5K36H 1VMCA 4JCVE 4BBRH 3I70A 5EKKA 1I4XA 4A3BB 1PFNA 5IGBA 1Q1BA 1XX8A 2DN8A 1TWAH 5CBEE 1G91A 1FNWA 1QE6A 2MJ8A 1EU3A 5IP9H 4HJ9A 4OWTB 3OOCA 4PV1C 1DD2A 1A3VA 1U4LA 4DV5L 2B2UC 1B44D 2JA8H 2EYPA 2XRQD 5JOBA 4LF7L 2IL8A 3BVZA 4A3JH 4DR7L 2BDNA 4FF4A 2EZVA 2PNHA 5C3EB 1M90C 2CVRA 5GADC 1HXYD 4DU9A 1L1OA 2F0FA 2ZJRA 3C2PA 4A93H 3HKSA 4C3JH 3GTPH 3MXPA 2NVXB 1QJOA 3RLFA 3G6EA 4MN3A 5C44B 3A7LA 4LF8L 2UUBQ 5FO9B 3HEJA 1TS3A 2OEOA 1HTPA 3RUZA 4DAYB 3H09A 5J3BA 3TREA 2K5VA 2Q8IB 3D4RA 2F3VA 2P5ZX 1KRSA 3IL8A 4B3MQ 3MXUA 4K5WA 5FKAC 1AE3A 3VR6A 2QA4A 1L2FA 2RKSA 4JI0Q 1Z7TA 2LS01 4GLXA 1T9HA 2E8GA 2QW7A 3TS0A 1PH7A 4NXNL 2PYKA 3AFPA 2IX0A 1K0SA 1KLUD 4DNRB 3FKIG 4QCLA 2F0EA 5E7NA 2LKVA 4A4IA 4HIMA 4FP5D 5EKLA 4DR6Q 4PG3A 1MD2D 3T4AC 3PUXA 1D7QA 3G7LA 4PQXA 2FJ2A 1TS4A 3PO3B 1CM9A 1SE2A 4GLVB 3S16H 5KIXA 1G6PA 1UE7A 3K6OA 5IE8A 2O2LD 3KBXA 2AWOA 2NBFA 2K5NA 2JA5B 1XNQQ 4YHHQ 4B3TQ 1SNCA 4FXDA 2Q2TA 5H1SE 2EYOA 1ET6A 2Z9HA 1LT6D 2AHOB 3DXJC 1YBYA 2FMMA 3PO2G 5M9OA 5IYBH 1R9TH 2ZTCA 5C0XI 1WTHA 4P73A 1XTDA 2EJMA 1L0XB 2A69D 2IHEA 3T53B 4K6DA 2NVQB 4BA2I 3F2CA 2NVTH 1GHJA 3STBC 1D5XC 3UDXA 3SGIA 3AU7A 3KFUA 2Q2HA 4OWXB 4KY5A 3G71A 2NZ1D 4TSSA 3UDFA 2B8FA 3GTLB 3CPFA 3FEWX 1AZQA 3S1MH 5IOCA 2J4XA 2PW7A 1JWSD 2JXMB 4KHPQ 2RBMA 2FINB 3EIVA 4P2CB 2L15A 1J9OA 2NN6H 4JK1C 5IYCG 1N33Q 1U0LA 1LABA 5ELNA 3W1GA 5C4JB 1JWMD 4BXXG 4KI0A 2DJGC 4R4TA 4A3LG 3TP5A 2D5DA 2FMCA 3MTSA 3MAQA 4IZ8A 3HOXH 3M85A 1LTRD 4P71A 4ZK9B 4YY3L 3K5NA 3I55A 5G3LD 5GAEC 1HR0W 1H9SB 1KLGD 4PZ8A 4DV5Q 1PYSB 2EY2A 2Z6BA 5M5YH 1JB3A 3K57A 3S2DB 2EQSA 1EQQA 2EPBA 1CHPD 4HMJA 3KF8A 4LUVA 3VA7A 4JI7L 4PMBA 4RMFA 1MGSA 1JR0D 4J8QA 3HRZC 1Q81C 1RF2D 3VR2A 2IY5B 4LJZC 4LF6L 1JC7A 4LF8Q 5IP7H 2WKDA 3FHWA 4B3RL 4A3MG 3M7NA 3BZCA 1B7YB 2HD3A 1MHWC 4ILWA 4CKEA 5FJ8H 1FGUA 1MIUA 1BBXC 4IJHA 1L0YB 3BJUA 2IWHA 1D2BA 4ZUJA 2RF4A 3I3CA 1KAAA 2OTLA 1QOHA 3MEHA 2M2LA 3C3LA 3HOWH 1O7ZA 4HSPA 4I7ZC 1Y69U 4H44C 4MIUA 2LFNA 2SNSA 1ENFA 1T5XD 2K5HA 5I4DA 1B53A 3R2TA 2B2YA 2EE1A 3A74A 1EQVA 1Q90A 3GTMH 2KQ3A 4DR3L 1R4PB 2WAQG 4UPAA 3P1HA 3H0GH 3HOZB 1L1OC 5C4XH 1A2TA 4Z9CB 1YEZA 2PQEA 1E24A 4A76A 3CU7A 3DWPA 3PSIA 1SR3A 4N9TA 4BY1G 5M3FB 3PF4A 2PQAA 3U50C 2BE5D 4KKTA 4HCSA 4O0AA 1EFWA 2Y0SG 1EWHA 1MI2A 2VY3A 1M4VA 1S5BD 1FNUA 1PFMA 4FNFA 1RL2A 2WP8J 5EJWA 4A3IB 1R4QB 2F4IA 2V1CC 2L5TA 3VR3A 2OF1A 3WOFA 1N32L 2K03A 5CMDA 2VUMG 1VQIA 2EYHA 1ICFB 1BCPD 4ALPA 4OO1G 2I0QA 2ZXRA 3U58A 1PTOH 3HGBA 4A75A 4XQNA 5M5XH 3GTOH 5I6YA 1BOSA 1CZWA 3NTKA 3CAMA 1K3RA 4BY7H 3DEOA 2A69C 4JI3L 1VS0A 1X32A 1O7YA 2OWOA 1T5EA 4GS3A 5C3XA 4B9WA 1SRUA 1CSQA 1KTKA 5A2QL 1SE4A 3ZJYC 1PMRA 1Z9FA 4L6TB 4Q5VA 1KIXA 3L2PA 1IBLL 3C46A 3ONAB 2F0UA 1STYA 3GD7A 5DNFA 1TT2A 4Y52H 4X3TA 2A6HC 2JJQA 3H94A 4C3IG 2KCNA 2F0GA 5I9OA 4IUNA 3CCQA 2OQ0A 1HFGA 1TWCH 1I4PA 1P16A 3TDQA 3A8JE 1Q82C 4KMUC 1EY0A 2F0HA 4OELB 4L8JA 1PH9A 3M4PA 2DNCA 4IPDA 2H4OA 2E2HH 3P7JA 3V05A 4B08A 1PH1A 3I4NG 1IHZA 3K58A 3TBIB 1UE6A 4ZKCB 3MXGA 3NEMA 4IFDJ 3KF6A 4M1UB 1LLRD 2BOSA 2NZOA 3GTJH 2B2TA 3J81c 1JE5A 5KEEA 1Y8OB 1YZ6A 4JI7Q 3HOUG 3D4WA 4YWLA 1EL0A 1B3QA 2YU9B 5T1IA 1BXTA 3NE5B 1NJIC 4KD3A 4A3DG 4LF6Q 2B29A 2HIXA 3FKIB 1GM5A 5LL6X 4IPGA 4IURA 4B3RQ 2R93H 1TS5A 3A8IE 3WOEA 4CJ1B 4LNQA 4AYBG 1CA5A 2UUAL 2JEAI 3AEVA 2RA4A 2CQOA 3W2DA 1HA6A 2G9DA 4XYOA 2EYFA 1FL0A 1ZXTA 1IZ6A 1TWGB 1OTCA 1LTLA 3S14B 1GVPA 1SSOA 3QB3A 2WFWA 4LF4Q 1VQ6A 1I4GA 1V1PB 3JAMc 2DGYA 4Q0FA 3FVQA 5IGDA 4X65Q 1C8CA 3PO2B 5KRUA 1WTOA 1OXUA 1U4PA 4K0KL 1ENCA 1I5FA 5GQOA 1FD7D 4DR3Q 2F0VA 3HOYG 3S1QB 1YJNA 3I73A 3E3XA 2SOBA 4GKKQ 2J7ZA 3OPOA 1SNPA 1KDBA 4GOPA 4FXGC 3LWEA 1Y1VH 1BQQT 2F0OA 2K28A 1B3AA 1N9WA 2JQOA 2EY5A 5KNCA 1S5ED 1ESFA 1SFOB 4WJ4A 2EJGC 2MGSA 1KABA 1SNDA 1X55A 4A3GG 4RG1A 1XJVA 4CKCA 1OXSC 3PUVA 2B2VA 1I50B 2BE5C 2R92G 3DHQA 3Q22A 1LT4D 1G6ZA 4EX5A 4RH6A 4R1JA 1VQBA 4K2LA 1WD0A 3E9IA 1EIFA 5E3FA 1XXGA 5EKIA 3I90A 2PPBC 2KCTA 5JEAG 1WFQA 3CCLA 1XPUA 3I2ZA 3TP6A 1QUQB 3S9WA 1VCIA 1BCPC 4ME5A 4HEDA 2JA8G 5DM63 1SEBD 4DN4M 5CV6A 4JI3Q 3I4OA 4A3BH 3LX0A 1QVCA 4CHTB 4B3SL 4OHJA 4L63B 1EWIA 2ZM6L 2QCPX 1WI5A 1I3QB 1I4RA 3HKZG 1Y1WG 4JI4Q 1EEFD 3ULLA 2JP1A 4KHVA 3EN2A 1S5FD 1IBLQ 2L0CA 3H3VC 2XTIA 2R7ZB 1KDCA 4JI0L 4KHZA 3UDGA 3DWQA 2HDLA 3BYTB 3RLNA 2Y0SE 5E1FA 1YIJA 5C3EH 1XTCD 1PZID 1XPOA 1SMYD 2NVXH 2O4XA 1IYUA 3PUWA 5LL6S 4A3KG 4A3FG 1TVXA 5C44H 3NBHA 4RKLA 4A3MB 1L1OB 4LK1C 4OO1I 1U5KA 3Q6SA 1Q3LA 4JI5L 1UWVA 2K32A 4G7HC 4JVZA 5FLXE 4LFAL 3WWVA 2R7DA 3UI2A 5I2YA 2VB2X 4CKBA 3IAYA 1EOVA 1CKOA 3MXNA 1TY0A 2CQAA 1EYDA 1HPCA 5FO8B 1K83B 3U4VA 2QILA 1WCMG 4ZUIA 3RZOB 1STHA 2E2JB 1X3QA 2EOTA 1TR5A 2UUAQ 4TQUS 2FFKB 2M00A 3RD4A 4IOCA 4HN7A 4CDDC 1ONLA 3A8KE 4O1NA 1WTQA 4DK6C 3SK4A 3PO3H 2Z6KA 2WV6D 2A6ED 2B3GA 2ID0A 4BY1B 4GN3B 4A3EG 3CRLC 1QB5D 2Y0SB 3GV3A 2DJFC 1PVOA 2JA5H 1K0RA 2RDGA 4LWCA 3ZYYX 2SDFA 3S1RB 1GD7A 2EYJA 4OIKA 1LO5D 1GO3E 3ICEA 1ILPA 1WVLA 1JMCA 2VUMB 1RTOA 1OXXK 1U9RA 1QNKA 3J80E 2XWJB 4FF1A 4RFBA 1NTGA 3GDEA 2NVQH 5FLMH 3T51B 3DM3A 1PHJA 3KBGA 3KLSA 1LTGD 1XPRA 2K33A 4KN4C 2JA6G 4DV7L 5FOBB 2F52A 1ICWA 1AN8A 3R8BA 5I9PA 2RCNA 3RLOA 3GTLH 1CUKA 3J7A5 1JB7A 3QJYA 1SYEA 4AYBE 3R2IA 4O42A 4DR2L 2KEEA 2XIWA 3OW2A 1Q86C 1E2WA 3D4DA 2OCEA 4HJ5A 3K7AB 1NCVA 4DR5L 2YYZA 4KY6A 1DM0B 2F0DA 2N3SA 1PLFA 1B8AA 5C4HA 5C4JH 3OTOL 4C3IB 2XVSA 2X69A 1QCBD 3NTHA 1DOKA 1A0IA 2D2CC 2E76C 4KK7A 4B3SQ 3ULJA 3I4NB 1HUNA 3BDOA 5D3IB 2ZM6Q 4LFBL 4ZYSA 2WB1G 4HMIA 1PV4A 4CBVA 2ASBA 3H91A 2MQHA 3DMUA 1CKNA 3EROA 1YNJD 1E2VA 3PF5A 5C0XH 1CFMA 1VQFA 3MHBA 3PCOB 3C1EA 5CORA 3HOUB 1K8MA 4LAAA 5CYUA 4AIMA 5ELBA 1FVIA 3K80C 1B2TA 4A3DB 3I4MG 2EJFC 2FXQA 3VYTA 4R8NA 4C3HG 2CCZA 1FJGL 1GJXA 4NXML 3H3VI 1RHPA 3DUZA 1PH5A 4X3SA 4KJNA 3GTKB 1I6HB 4F7XA 2K75A 2B39A 4JI5Q 4AYBB 1SMYC 1IKMA 4LFAQ 2VNUD 1B9MA 3ULPA 1AW7A 2KVMA 2A5HA 2RVLA 4MZ9A 1N34L 1ASYA 3IFTA 2BA1A 3CC4A 2M9VA 3KK7A 1G291 4K6LA 3I4LA 2TSSA 1B50A 3GO5A 3KLRA 1HCZA 4H13C 1Y8NB 2CH4A 1EY7A 4F8MA 5EQ0A 5T1GA 1S5DD 1ZEQX 3GTGB 3HOYB 1D5MC 3GV6A 2K6AA 3RZDB 1YHBA 5M3MG 2I46A 1HUMA 5CBAE 1HNZL 2R3ZA 4JI6L 3G6JB 1CQVA 3HOZH 1BCPB 4JBMA 3BZKA 4KD4A 1YNND 1QWYA 5HGTA 5M3FH 1KC8C 1NY4A 1Q8KA 4A3CH 2HDMA 4CDFC 2R6GA 4IUPA 2L9HA 3NWTA 1SNQA 4A3GB 5FLXL 4A3IH 2A6EC 1NAPA 2PQAB 2A6HD 1X3FA 3CRKC 2PI2A 5IT9c 1QZHA 5G3LF 4WJ3M 2HQLA 2BA0A 2Q2IA 4C1NI 1K8OA 2I5LX 1LUZA 2PO4A 4XYQA 4HJAA 2ALYB 2KHJA 1H9RA 1SYGA 5KYLA 1S40A 2MHVA 2JA8B 1EU4A 4DV7Q 5CC4A 2NTTA 4S3SA 1X65A 2RHSB 3MFYA 4DPGA 4G7OC 5JEAJ 1QG7A 4EVOA 3ERSX 2NYZD 2I5HA 3CW2C 2ENBA 2Z6KC 2L4NA 4DR2Q 5CV9A 1Y1WB 1U4RA 2EY6A 4DAYA 3F1ZA 5GAHC 4RA8A 5EBCA 1NR2A 1NSNS 4DR5Q 1PA6A 3OTOQ 3KUPA 4OIJA 4MNOA 1SE8A 4XT3B 1QILA 3EQLC 4RGTA 5C0XJ 1O78A 4A3KB 4DKAC 1AE2A 4A3FB 4IFDH 1PXUA 3J80L 1O80A 1KD1C 5IGGA 3M4OB 4LFBQ 3QIAA 4DK0A 1NNXA 2EYLA 1EQRA 2XWBB 1WTVA 2ZXOA 1F2LA 3SK6A 4NP5A 2C9OA 2YU9H 2RSOA 4HIDA 3CCEA 1I4HA 4LF4L 1WCMB 4RCOA 1FJGQ 1HQRD 4DR4L 4WFN3 4X65L 1PFBA 1TS2A 2DY7A 4NXMQ 1YNJC 4TKOB 1M8AA 3NELA 3E6ZX 4I7AA 2E2DC 4R4OA 1YITA 3FKIH 2HCIA 1G2TA 1WTRA 2HQEA 3OMGA 1UEAB 4GKKL 2R61A 2D62A 2F0TA 3SE0A 1D5ZC 3A5ZB 4G4KA 1WTXA 2IJ0A 4JPBW 1BCPF 4A3EB 1N34Q 4V190 4QQBX 2QEJC 4RGOS 5J22A 4GNXA 3VR4A 1TY2A 1TWGH 3T13A 2NUCA 3BS1A 3S14H 1VQLA 4DR1Q 1RTNA 1MSGA 2IW3A 2KEDA 4HR7B 1PZKD 1A6XA 2KHSA 2GN5A 1NBWA 3TS2A 2UXBL 2WB1E 2F0SA 3QO2A 3PO2H 3BG3A 2AKWB 1BBUA 4YCWA 3M4QA 1HNZQ 3URYA 4JI6Q 3K5OA 3S1QH 4HJ8A 3KOJA 2QKIC 1ML0D 1STEA 2VS1A 2AUJD 4DNTB 1VQ5A 2JA7B 2RQXA 1Q8IA 1BBWA 1JOOA 3N6RA 1BVSA 3B6YA 4K5XA 3E0JA 4IUVA 2JA6B 3NENA 1KRTA 3TZUA 3AFQA 1KQSA 5K5PA 3J7AV 3R93A 2KOLA 1CSPA 2F0JA 3CQZB 3HP3A 2K01A 1SFOH 3SEBA 3AB9A 3CCMA 4JI1Q 1K3BC 1E22A 1EY4A 5D65A 2RDFA 1YNNC 1HZ9A 3LNNA 3Q0AA 3BYYB 2IHFA 3HOVG 4BBSG 1I50H 1LT5D 3SDZA 4JI4L 2N49A 1JQYD 4I65A 2BH2A 4O2DA 1GUTA 2VQFL 3DWAA 4YIJA 2D0OA 4HCEA 4BXXH 1SN8A 1DOLA 4MTNA 2MNAA 4A3LH 3BU2A 5CR3A 5IGFA 1RJTA 1Q12A 3GTQB 1IKLA 3CCRA 4PZ7A 1JWUD 4WRDA 2HHHL 1F9RA 5ELDA 4B9XA 1J5EL 5C3EG 1H9KA 2WB1B 5GROA 1BO0A 5M5WB 1I3QH 1H9MA 1SMXA 1MSHA 2F4VL 1WD1A 1EQTA 3T16A 1S5CD 2R7ZH 1PYBA 4H0LC 1V1QA 5IYDG 4RHRA 4FYDA 2XN9C 1SYDA 3CD6A 2KCCA 5ELEA 1BNZA 3I4MB 3HS0C 4C3HB 2IX1A 2KENA 4IUQA 2VL6A 3JC66 4A3MH 1TWHB 3VYSA 2NVYB 1Q46A 2XRSD 4M8AA 3L7ZC 3M3YB 1Y14B 1E2ZA 1F2YA 3QG1A 1O7IA 2B2WA 1C0AA 2F0KA 2OT2A 2PZUA 3OMCA 1D1IA 3H15A 1C48A 4LW1A 2PW5A 4DR4Q 1K83H 4DV0Q 1B1ZA 2B63G 5HURA 3J7AF 4QUCA 1F77A 1NR4A 1UE5A 3RZOH 2E2JH 4L5RC 3IRBA 5LMUL 5M3MB 1SNOA 3J81E 4OGQC 2F0MA 1F9QA 3E0EA 4BY1H 4X66L 1HH2P 2ATWA 2QDBA 1XYIA 1GUSA 4POFA 5JVG3 4DAPA 2WIIB 1AZPA 4CJ2C 2F1MA 1F2ZA 3I91A 1IBKQ 3S1RH 4UP8A 5L37A 3D6WA 4J15A 3OW7A 3HG9A 2UXBQ 3U4ZA 5K36G 4BBRG 1KNAA 1VQ8A 4JC0A 4UP9A 3Q23A 2Z1CA 2VUMH 2A73B 4YCUA 3W3AA 1JICA 1CT1D 4JV5L 2OQKA 5IP9G 3MFGA 1KHIA 2UXCL 3K8AA 5J1ZA 1D8LA 1SLJA 1RKNA 3NBIA 1EY9A 2B2YC 2KBNA 1KXLA 2K4KA 3TP7A 4A3JG 3QOJA 4ZRZA 1S4ZA 3CMAA 3JAME 1OXVA 2BCOA 4IN3A 1C7YA 1E1OA 3P75A 4L5SA 1X3PA 2WAQE 4A93G 1EY6A 4DV4L 5JJKA 2ZJQA 2D9UA 1LACA 4K8IA 1QZGA 4C3JG 4N8FA 2JK8A 2G5DA 3L3OC 1PH6A 1SNMA 3VDYA 1VQCA 4PMWA 1ILQA 2VQFQ 2DY8A 4GNXC 1PFSA 3K7AH 3SVMA 4HJ7A 2OTJA 1ENAA 3N52A 4C3IH 4LF5L 2JEBI 3RR5A 2EXZA 1BR9A 2E74C 2RSNA 3G4SA 5IY0A 3R3OA 4GLAC 2HHHQ 2KHIA 1KDAA 3EFXD 1VQGA 1HZCA 4ZQ3A 1HHVA 2OXPA 5FK9C 1PRTC 2IPKD 3K7UC 1J5EQ 1YJ9A 1STBA 2N8NA 4X62L 3D6CA 1P8LA 3V96A 2F4VQ 3RN2A 1KNEA 4PZ6A 4QY7A 1SE3A 5C5MA 1WYDA 2LXKA 5DM73 2F3IA 4IPHA 4HAEA 4DF7A 2GVBA 3HOUH 4FO2A 1MKHA 2AMCB 2VQEL 1A62A 2Z0SA 4IUTA 2KCMA 4A3DH 1GKHA 2PZWA 1W6KA 1HNWL 2E2IB 1DGSA 1V1PA 1IYVA 1HTLD 1Z47A 2I5MX 1F2MA 2RHQB 2WAQB 3HZXA 3RNUA 4ZKBB 1A63A 3GTKH 3CP0A 1I6HH 1PDQA 3CCSA 1SAPA 4G57A 1DYQA 1FR3A 2GA4B 3QOLA 1II3A 5IYBG 2PI2E 1CZGA 2K14A 2PCFB 1SYBA 1ZYRD 3TZDA 3NHHA 3UE1A 4Y7NB 1HRJA 2RDHA 1X3EA 4DV6L 4C1NK 3K5MA 1GHKA 1B9NA 4ZCKA 3IFDA 2NWGA 1AH9A 2B2TC 1EOTA 4AH6A 2BH8A 1RCVD 4EQNA 4R4IA 2K52A 2QDLA 1F9SA 4FF3A 2K50A 5LMUQ 2PNRC 2AQ1B 3GTGH 3HOYH 4XXEA 3RZDH 1S3OA 1CQFA 2EDGA 2YTVA 4A3IG 2K04A 1SROA 2MFIA 1K8AC 3NK9A 1JOQA 3PV0A 3SK8A 3M4YA 4QL5A 1PTOD 4X66Q 1CA6A 1FYCA 4XQJA 3J80i 1WJJA 2NN6G 4F88A 5C6AA 1OXTA 2F0WA 4V0BA 3KDFA 1CK1A 3OYYA 4LUZA 4ID6A 1K28A 1HZBA 4HIKA 2SNMA 1LM0A 4A3GH 2K5WA 3HOVB 4BBSB 1E1TA 1GUGA 3H3VH 3NP8A 3HOXG 2RCFA 3S1NB 2H5XA 1STGA 4LFCQ 1CHQD 3K59A 4JV5Q 5AJ3L 2UXCQ 2A74C 5LMNW 5KYIA 2ZJPA 4IO9A 4RHSA 1HNXL 1L0WA 4X3UA 5JEAH 1V9PA 4NW2A 2EYMA 3D8GA 3I56A 4CGYB 5A35A 2WACA 3NPPA 3ITPA 4E6IA 3FP9A 4PMCA 4EQOA 1IL8A 2A68D 3MVVA 3J81L 1X54A 1YJWA 4GOPC 1W3SA 4DV4Q 1DOMA 2MUYA 3CHBD 2CW0D 3FPPA 5KGUA 1E0BA 2EXDA 1Y1WH 5IP7G 4C56C 3A5UA 3S2DH 4X6AH 4IFDG 1ESRA 1EYCA 4FVMA 1KL9A 1JJGA 1GUWA 4QMGA 4X64L 5I2XA 5FJ8G 1Y8PB 1GXDC 4GN5A 2B2VC 4KY7A 4LF5Q 4FXKC 3FPUB 2LMCB 5NUCA 1UE1A 3L9AX 2G9HD 3KF8B 1SBBB 2B8GA 4U68A 1KAWA 3NUCA 4A3KH 1YI2A 2N78A 4A3FH 1IYJB 4AQYL 2HCCA 4RGNA 5COYA 3HOWG 4NB3A 1W6JA 4RAUC 3VA5A 2JA9A 1VQMA 1SXTA 4X62Q 3M4OH 3TRZA 1PYWD 2KUMA 2ZXPA 3KJOA 4KLKA 1SJHD 4XQQA 3A54A 5EBDA 5KNBA 1EEID 2JYOA 4K2KA 2AWNA 4DXFA 1V1OA 3JAML 2F0PA 1K9MC 3V2TA 4APVA 3CF5A 1A3UA 3H0GG 2VQEQ 1PH4A 4DR1L 3S17B 5BR8Q 1JJCB 3QWNA 5C4XG 1TWFB 1ASZA 3S15B 4MHEA 2B63B 1WCMH 1HNWQ 5A2QE 4C2MB 4N8X1 3HKZE 3CXCA 3S2HB 4DAVA 1I94L 1EYGA 2Q8TA 4K5VA 3WDNA 2ES2A 5CV4A 4KTAA 4XIGS 1U4MA 5JAVA 4DUZL 1C4QA 3PIP3 1DONA 2ZT9C 3TP8A 4A3EH 4GKJL 2L1BA 4OEMB 1XNRL 4OWWB 2DNEA 4DV6Q 1VF5C 1MJCA 1EIHA 4JI1L 1E3PA 3D0FA 4L5QA 4CDEC 1DXMA 2R92B 4XTCS 3SXHA 2NTSA 2VB3X 4BBRB 4GNXB 1ZYRC 2I07B 2SEBD 2Z4HA 4BY7G 1IW7D 1TWAB 3J81j 1BUVT 2F0QA 2JN4A 3X3NA 4OX9Q 5LMNL 2HUGA 4NPSA 2F0IA 3PIPA 3MWYW 3TN2A 3Q24A 4LMQD 1VQEA 4UP7A 3BZDB 3AMUA 1VQKA 2JA7H 5EAYA 3EVQA 1V8QA 4R4QA 1LTTD 4A3JB 1LTID 1PRTB 2JA6H 3TMEA 2O5JC 3D3RA 3VR5A 5IWAL 4FDBA 3CQZH 1I6VC 3RN5A 1JORA 1JOKA 4A93B 5BN5A 4C3JB 1BDOA 3MZ5A 1C9OA 3HKZB 1PTOC 4IALA 5LHY1 3GTPB 3T1HL 4ODGA 2LSSA 1N8RC 2PMZE 4HIOA 2X6LA 2EIFA 2WKCA 2IT1A 5AJ3Q 3A0JA 3IKJA 4WORA 4J1MA 1HNXQ 4DK1A 3TSSA 1SYFA 1VQAA 4DNIA 1QVGA 3M9BA 1UAPA 2QEXA 4NDXA 3GTQH 5ELFA 4YWMA 1JT8A 2C5CA 4R9WA 3T1YL 3CKIB 4LF7Q 4DR7Q 4ABNA 3CCVA 1PH3A 2R7ZG 3OHXC 2KA7A 1FGBD 3M7GA 3K0XA 4EGVA 5BN4A 5DLQE 2EVBA 2ZTEA 3ND9A 4JI2L 3GQBA 4UHVA 5IT9E 1OO9B 4JBJA 1VQNA 1TKWB 2QGQA 5M5WH 1VQOA 5D3DA 1VQJA 5JJZA 2A68C 5IIFA 2R93G 3FDTA 1XMQL 4KJOA 2NN6I 5IGCA 1SJED 3KF6B 4X64Q 1XMOL 2CW0C 1UUPA 2KECA 4K14A 4PNYA 1G2SA 3BVGA 3NSWA 4JI8L 4DV0L 3I4MH 1NE3A 3S16B 2UUCL 4UDUC 4C3HH 1LTAD 3MC0B 3G48A 4JW0A 4AQYQ 1PZJD 3D31A 5ELOA 3KYHC 3K5LA 1JJ2A 1DCZA 3U9OA 1TWHH 1WOCA 2XNAC 1S72A 4NXNQ 4BA1I 4BWGB 1I4QA 2NVYH 3QR8A 3EJIA 2PMZB 1R9TB 3M3YH 5C5LA 2JE6I 1HFNA 1A3TA 4DA2A 1EWCA 4RWSC 4NKLA 1UEBA 3L0OA 1HQMC 2ICEC 4IUUA 4H7BA 3K0YA 4ZAIA 4U673 3AQQA 1Y1VG 1IBKL 1LV9A 1SYCA 1D6EC 2NVTB 1A15A 5C3WA 4DK3C 1LT3D
chains in the Genus database with same CATH topology
2MPMA 4IFDI 2PZTA 2F3WA 3NWSA 4F87A 4QUFA 3S1MB 4XT1B 2Z4IA 2E75C 3A55A 3OIQA 2N55A 5AFWA 5EPJA 4KN7C 5FO7B 1PRTF 3ERQA 4QB4A 4IQZA 5J39A 2AQ2B 4EQPA 1H9SA 3HOXB 1LTBD 5IODA 3NXWA 1CI3M 3BDCA 3PUYA 3X3MA 1PRTD 2K5QA 1HA5A 5M5YB 1AFPA 3FRPB 2XSCA 1IW7C 2L55A 5E4XA 2QF7A 3OWEB 3LWUA 1G8ZD 2BDOA 5EPLA 4K8JA 2Q8RE 3BDLA 2ICIA 4KKSA 4X3KA 3PUZA 1STAA 4G7ZC 4HSVA 2K5DA 3P20A 3HOWB 1Q1EA 4BS9A 1J8IA 4QIWB 2JSOA 3BVMA 1QNUA 1JE4A 3DEPA 2K1BA 3I72A 3T56B 3GTMB 3SHLA 3E5SA 3H0GB 1STNA 5C4XB 3OSOA 3NTIA 5EGTA 2B2UA 2KJXA 5TSSA 2VXWA 3VYRA 4UAIA 4RGMA 1UNSA 4ZLTF 5DAUA 3DM1A 1RDPD 5CV7A 1WTWA 2IX3A 1ET9A 1EFID 3SK5A 4NMZA 4DXGA 1EIGA 2FHTA 4FF2A 1AP0A 4HTHA 5IT9L 1PTOB 4JBWA 1AEXA 5M5XB 3GTOB 2AUKA 2MP1A 5CGKA 4N9PA 4BY7B 1TQOA 2H1EA 4OO1H 1EY5A 2NB0A 1JCKB 2K7VA 5CV5A 4QF4A 2AQ3B 4KKUA 4KV6A 5D14A 2F03A 5JPMC 1Z6HA 3C1FA 1VDZA 3OIPA 1SDFA 1B4OA 3PIO3 3J7YW 2J0TD 3PMFA 5DEHA 1BF4A 2LY7A 1MBYA 1TWCB 3U9SA 3VYUA 1EZ8A 4RKBA 4XDXA 2E2HB 2L11A 4OL7A 4R8IA 1GUOA 1TIID 5ELCA 4DGZA 1O7LA 2X6GA 3GTJB 2CHBD 1V43A 1EZ6A 1DZ1A 1XWEA 5C0XG 1RD9D 3I8ZA 1DJRD 3A7AB 3A56A 3NQIA 1ZKOA 5I6WA 2F0LA 1TU2B 1EYAA 2R93B 5CV8A 3MA2B 3ND8A 4DFAA 1NUCA 5E4WC 2O5IC 1FNVA 1H9JA 2N88A 3H6MA 4CJ0B 5BN3A 2V4DA 1D1KA 5ISRA 5EPKA 2EY1A 4RCNA 3KLSX 4ULLA 3GP7A 3F2UA 4WJWA 3SR1A 2TMPA 1CTMA 5F2DA 2L12A 2Z8LA 1GUNA 3RMHA 1Y1VB 1PTOF 1F9PA 3EA6A 1LTSD 3NQTA 1GOZA 2F0NA 1VF7A 3OWFA 2WINB 1VMPA 4TRDA 1WTPA 1A2UA 5JPNC 5C4ZA 1EY8A 4J6HA 1RODA 5IGEA 3O13A 2K05A 3FMCA 5JVH3 5KNDA 4GZYC 2B2WC 5K36H 1VMCA 3I70A 5EKKA 1I4XA 4A3BB 1PFNA 5IGBA 1Q1BA 1XX8A 2DN8A 5CBEE 1G91A 1FNWA 1QE6A 2MJ8A 1EU3A 3OOCA 4PV1C 1DD2A 1A3VA 1U4LA 2B2UC 1B44D 2EYPA 2XRQD 5JOBA 2IL8A 3BVZA 2BDNA 4FF4A 2EZVA 5C3EB 2CVRA 1HXYD 4DU9A 2F0FA 3C2PA 2NVXB 3MXPA 1QJOA 3RLFA 4MN3A 5C44B 3A7LA 5FO9B 3HEJA 1TS3A 2OEOA 1HTPA 3RUZA 3H09A 2Q8IB 3D4RA 2F3VA 3IL8A 3MXUA 4K5WA 5FKAC 3VR6A 2RKSA 1Z7TA 2LS01 2PYKA 2IX0A 1KLUD 4DNRB 4QCLA 2F0EA 2LKVA 4FP5D 5EKLA 1MD2D 3T4AC 3PUXA 3G7LA 4PQXA 2FJ2A 1TS4A 3PO3B 1CM9A 1SE2A 5KIXA 3K6OA 2O2LD 3KBXA 2AWOA 2NBFA 2JA5B 1SNCA 4FXDA 2EYOA 1ET6A 1LT6D 3DXJC 2FMMA 5M9OA 5C0XI 2EJMA 1L0XB 2A69D 3T53B 4K6DA 2NVQB 4BA2I 1GHJA 1D5XC 3AU7A 4KY5A 2NZ1D 4TSSA 2B8FA 3GTLB 3FEWX 1AZQA 5IOCA 2J4XA 2PW7A 1JWSD 2JXMB 2RBMA 2FINB 4P2CB 2NN6H 1J9OA 4JK1C 1LABA 5C4JB 1JWMD 4KI0A 3TP5A 2D5DA 2FMCA 3MTSA 3MAQA 4IZ8A 3M85A 1LTRD 4ZK9B 3K5NA 5G3LD 1H9SB 1KLGD 2EY2A 1JB3A 3K57A 3S2DB 2EPBA 1CHPD 4HMJA 3KF8A 3VA7A 4PMBA 1MGSA 1JR0D 4J8QA 3HRZC 1RF2D 3VR2A 4LJZC 1JC7A 2WKDA 3M7NA 4ILWA 4CKEA 1BBXC 1L0YB 2IWHA 1D2BA 4ZUJA 3I3CA 1KAAA 1QOHA 3MEHA 2M2LA 3C3LA 1O7ZA 4HSPA 4I7ZC 1Y69U 4H44C 4MIUA 2LFNA 2SNSA 1ENFA 1T5XD 5I4DA 1B53A 3R2TA 2B2YA 2EE1A 1EQVA 1Q90A 2KQ3A 1R4PB 3P1HA 3HOZB 1A2TA 4Z9CB 2PQEA 3CU7A 3DWPA 4N9TA 5M3FB 2BE5D 4KKTA 4HCSA 1EWHA 1MI2A 1M4VA 1S5BD 1FNUA 1PFMA 4FNFA 5EJWA 2WP8J 4A3IB 1R4QB 2F4IA 2L5TA 3VR3A 2OF1A 3WOFA 2K03A 5CMDA 2EYHA 1BCPD 4OO1G 2ZXRA 1PTOH 3HGBA 4XQNA 5I6YA 1BOSA 1CZWA 3NTKA 3DEOA 2A69C 1X32A 1O7YA 1T5EA 5C3XA 4B9WA 1KTKA 5A2QL 1SE4A 1PMRA 4L6TB 4Q5VA 3C46A 3ONAB 2F0UA 1STYA 3GD7A 5DNFA 1TT2A 4X3TA 2A6HC 4C3IG 3H94A 2KCNA 2F0GA 5I9OA 4IUNA 1HFGA 1I4PA 3TDQA 3A8JE 4KMUC 1EY0A 2F0HA 4L8JA 2DNCA 2H4OA 3P7JA 3V05A 4B08A 1IHZA 3K58A 3TBIB 4ZKCB 3MXGA 4IFDJ 4M1UB 1LLRD 2BOSA 2B2TA 5KEEA 1Y8OB 3D4WA 1EL0A 2YU9B 5T1IA 1BXTA 3NE5B 4KD3A 3FKIB 5LL6X 4IURA 1TS5A 3A8IE 3WOEA 4CJ1B 1CA5A 2JEAI 2RA4A 3W2DA 1HA6A 2G9DA 4XYOA 2EYFA 1ZXTA 1TWGB 3S14B 1SSOA 3QB3A 1I4GA 1V1PB 4Q0FA 3FVQA 5IGDA 3PO2B 1C8CA 5KRUA 1WTOA 1OXUA 1U4PA 1ENCA 1FD7D 2F0VA 3S1QB 3I73A 2SOBA 2J7ZA 3OPOA 1SNPA 1KDBA 4FXGC 3LWEA 1BQQT 2F0OA 2K28A 1B3AA 2EY5A 5KNCA 1S5ED 1ESFA 1SFOB 2EJGC 2MGSA 1KABA 1SNDA 4CKCA 1OXSC 3PUVA 2B2VA 1I50B 2BE5C 3DHQA 3Q22A 1LT4D 1G6ZA 4RH6A 4K2LA 1WD0A 5E3FA 1XXGA 5EKIA 3I90A 2PPBC 5JEAG 3TP6A 3S9WA 1VCIA 1BCPC 4ME5A 4HEDA 5DM63 1SEBD 4DN4M 5CV6A 3LX0A 4CHTB 4OHJA 4L63B 2QCPX 1I3QB 1I4RA 1EEFD 2JP1A 4KHVA 1S5FD 3H3VC 2L0CA 2R7ZB 1KDCA 4KHZA 3DWQA 2HDLA 3BYTB 5E1FA 1XTCD 1PZID 1SMYD 2O4XA 1IYUA 3PUWA 5LL6S 1TVXA 3NBHA 4RKLA 4A3MB 4LK1C 4OO1I 3Q6SA 1Q3LA 2K32A 4G7HC 5FLXE 3UI2A 5I2YA 2VB2X 4CKBA 3IAYA 3MXNA 1TY0A 2CQAA 1EYDA 1HPCA 5FO8B 1K83B 2QILA 4ZUIA 3RZOB 1STHA 2E2JB 1X3QA 2EOTA 1TR5A 4TQUS 2FFKB 2M00A 3RD4A 4HN7A 1ONLA 3A8KE 4O1NA 1WTQA 3SK4A 2WV6D 2A6ED 4BY1B 2ID0A 3CRLC 1QB5D 2Y0SB 3GV3A 2RDGA 3ZYYX 2SDFA 3S1RB 2EYJA 4OIKA 1LO5D 1ILPA 1WVLA 2VUMB 1RTOA 1OXXK 1U9RA 1QNKA 3J80E 2XWJB 4FF1A 4RFBA 3T51B 3KBGA 3KLSA 1LTGD 2K33A 4KN4C 5FOBB 1ICWA 1AN8A 3R8BA 5I9PA 3QJYA 1SYEA 3R2IA 4O42A 2KEEA 2XIWA 1E2WA 3D4DA 3K7AB 1NCVA 2YYZA 4KY6A 1DM0B 2F0DA 1PLFA 5C4HA 4C3IB 2XVSA 2X69A 1QCBD 3NTHA 1DOKA 2D2CC 2E76C 4KK7A 3I4NB 1HUNA 3BDOA 5D3IB 4ZYSA 4HMIA 4CBVA 3H91A 3DMUA 3EROA 1YNJD 1E2VA 5C0XH 1CFMA 3MHBA 5CORA 3C1EA 3HOUB 1K8MA 4LAAA 5CYUA 5ELBA 1B2TA 4A3DB 2EJFC 3VYTA 4R8NA 4C3HG 1GJXA 1RHPA 3DUZA 4X3SA 4KJNA 3GTKB 1I6HB 4F7XA 2B39A 4AYBB 1SMYC 1IKMA 2VNUD 1B9MA 1AW7A 2KVMA 2A5HA 2RVLA 3IFTA 2BA1A 2M9VA 3KK7A 1G291 4K6LA 3I4LA 2TSSA 1B50A 3GO5A 3KLRA 1HCZA 4H13C 1Y8NB 1EY7A 4F8MA 5EQ0A 5T1GA 1S5DD 1ZEQX 3GTGB 3HOYB 1D5MC 3GV6A 2K6AA 3RZDB 2I46A 1HUMA 5CBAE 2R3ZA 3G6JB 1CQVA 1BCPB 4KD4A 1YNND 1QWYA 5HGTA 2HDMA 2R6GA 4IUPA 2L9HA 3NWTA 1SNQA 4A3GB 5FLXL 2A6EC 1NAPA 2A6HD 3CRKC 5G3LF 2BA0A 4C1NI 1K8OA 2PO4A 4XYQA 1H9RA 1SYGA 5KYLA 2MHVA 2JA8B 1EU4A 5CC4A 2NTTA 4S3SA 3MFYA 4G7OC 5JEAJ 1QG7A 4EVOA 2NYZD 2ENBA 2L4NA 5CV9A 1Y1WB 1U4RA 2EY6A 4DAYA 4RA8A 5EBCA 1NR2A 1NSNS 3KUPA 4OIJA 4XT3B 1QILA 3EQLC 4RGTA 5C0XJ 1O78A 4A3KB 4A3FB 4IFDH 1PXUA 3J80L 1O80A 5IGGA 3M4OB 3QIAA 4DK0A 2EYLA 2XWBB 1WTVA 2ZXOA 1F2LA 3SK6A 4NP5A 2C9OA 2RSOA 1I4HA 1WCMB 4RCOA 1HQRD 4WFN3 1PFBA 1TS2A 2DY7A 1YNJC 4TKOB 1M8AA 3E6ZX 2E2DC 2HCIA 1G2TA 1WTRA 2HQEA 3OMGA 1UEAB 2R61A 2D62A 2F0TA 3SE0A 1D5ZC 4G4KA 1WTXA 2IJ0A 1BCPF 4A3EB 4V190 2QEJC 4RGOS 5J22A 3VR4A 1TY2A 3T13A 2NUCA 3BS1A 1RTNA 1MSGA 2IW3A 2KEDA 4HR7B 1PZKD 1A6XA 2KHSA 2F0SA 3QO2A 3BG3A 3URYA 3K5OA 2QKIC 1ML0D 1STEA 4DNTB 2AUJD 2JA7B 2RQXA 1Q8IA 3N6RA 1JOOA 4K5XA 3E0JA 4IUVA 2JA6B 3TZUA 5K5PA 3J7AV 3R93A 2KOLA 2F0JA 3CQZB 3HP3A 2K01A 3SEBA 3AB9A 1EY4A 5D65A 2RDFA 1YNNC 3LNNA 3Q0AA 3BYYB 1LT5D 3SDZA 1JQYD 4I65A 1GUTA 3DWAA 4YIJA 4HCEA 1DOLA 5CR3A 5IGFA 1RJTA 1Q12A 3GTQB 1IKLA 1JWUD 4WRDA 1F9RA 5ELDA 4B9XA 1H9KA 2WB1B 1BO0A 5M5WB 1H9MA 1MSHA 1WD1A 1EQTA 3T16A 1S5CD 4H0LC 4FYDA 4RHRA 2XN9C 1SYDA 2KCCA 5ELEA 1BNZA 3I4MB 3HS0C 4C3HB 2IX1A 4IUQA 1TWHB 3VYSA 2NVYB 2XRSD 4M8AA 3L7ZC 3M3YB 1E2ZA 1F2YA 3QG1A 2B2WA 2F0KA 2OT2A 2PZUA 3OMCA 1D1IA 1C48A 2PW5A 1B1ZA 5HURA 3J7AF 4QUCA 1F77A 1NR4A 5M3MB 1SNOA 3J81E 4OGQC 2F0MA 1F9QA 2QDBA 1XYIA 1GUSA 5JVG3 4DAPA 2WIIB 1AZPA 4CJ2C 2F1MA 1F2ZA 3I91A 3D6WA 3OW7A 3HG9A 5K36G 1KNAA 3Q23A 2Z1CA 2A73B 3W3AA 1JICA 1CT1D 3MFGA 5J1ZA 1RKNA 3NBIA 1EY9A 2B2YC 3TP7A 3QOJA 4ZRZA 1S4ZA 3JAME 1OXVA 2BCOA 4IN3A 3P75A 1X3PA 1EY6A 2D9UA 1LACA 4K8IA 4C3JG 3L3OC 1SNMA 4PMWA 1ILQA 2DY8A 3SVMA 1ENAA 3N52A 2JEBI 2EXZA 1BR9A 2E74C 2RSNA 3R3OA 1KDAA 3EFXD 4ZQ3A 1HHVA 2OXPA 5FK9C 1PRTC 2IPKD 1STBA 3D6CA 3V96A 1KNEA 1SE3A 5C5MA 5DM73 4HAEA 4DF7A 4FO2A 4IUTA 2PZWA 1W6KA 2E2IB 1V1PA 1IYVA 1HTLD 1Z47A 1F2MA 2WAQB 3HZXA 4ZKBB 1PDQA 1SAPA 4G57A 1DYQA 1FR3A 2GA4B 3QOLA 1II3A 1CZGA 2PCFB 1SYBA 1ZYRD 3TZDA 3NHHA 4Y7NB 1HRJA 2RDHA 4C1NK 3K5MA 1GHKA 1B9NA 3IFDA 2NWGA 2B2TC 1EOTA 1RCVD 4EQNA 1F9SA 4FF3A 2PNRC 2AQ1B 4XXEA 1CQFA 2EDGA 2K04A 3NK9A 1JOQA 3PV0A 3SK8A 3M4YA 1PTOD 1CA6A 1FYCA 4XQJA 2NN6G 4F88A 5C6AA 1OXTA 2F0WA 4V0BA 1CK1A 4ID6A 2SNMA 2K5WA 3HOVB 4BBSB 1GUGA 3NP8A 3S1NB 1STGA 1CHQD 3K59A 2A74C 5KYIA 4RHSA 4X3UA 5JEAH 4NW2A 2EYMA 3D8GA 4CGYB 5A35A 2WACA 3NPPA 3ITPA 4E6IA 4PMCA 4EQOA 1IL8A 2A68D 3MVVA 3J81L 1DOMA 2MUYA 3CHBD 2CW0D 3FPPA 5KGUA 1E0BA 4C56C 4IFDG 1ESRA 1EYCA 4FVMA 1GUWA 4QMGA 5I2XA 1Y8PB 1GXDC 2B2VC 4KY7A 4FXKC 3FPUB 2LMCB 5NUCA 3L9AX 2G9HD 1SBBB 2B8GA 4U68A 3NUCA 2HCCA 4RGNA 5COYA 1W6JA 4RAUC 3VA5A 1SXTA 1PYWD 2KUMA 2ZXPA 1SJHD 4XQQA 3A54A 5EBDA 5KNBA 1EEID 2JYOA 4K2KA 2AWNA 4DXFA 1V1OA 3JAML 2F0PA 3V2TA 1A3UA 3S17B 3QWNA 1TWFB 3S15B 4MHEA 2B63B 5A2QE 4C2MB 3S2HB 4DAVA 2Q8TA 4K5VA 3WDNA 5CV4A 4KTAA 4XIGS 1U4MA 5JAVA 1C4QA 3PIP3 1DONA 2ZT9C 3TP8A 2L1BA 2DNEA 1VF5C 1EIHA 1DXMA 2R92B 4XTCS 3SXHA 2NTSA 2VB3X 4BBRB 1ZYRC 2I07B 2SEBD 2Z4HA 1IW7D 1TWAB 1BUVT 2F0QA 3X3NA 2HUGA 2F0IA 3MWYW 3TN2A 3Q24A 4LMQD 3BZDB 3AMUA 3EVQA 1V8QA 4A3JB 1LTTD 1LTID 1PRTB 3TMEA 2O5JC 3D3RA 3VR5A 1I6VC 1JORA 1JOKA 4A93B 5BN5A 4C3JB 1BDOA 3MZ5A 3HKZB 5LHY1 1PTOC 4IALA 3GTPB 4ODGA 2X6LA 2WKCA 2IT1A 3IKJA 4WORA 4J1MA 4DK1A 3TSSA 1SYFA 1UAPA 4NDXA 5ELFA 2C5CA 4R9WA 3CKIB 4ABNA 3OHXC 2KA7A 1FGBD 3M7GA 4EGVA 5BN4A 2EVBA 3ND9A 3GQBA 5IT9E 1OO9B 1TKWB 5D3DA 5JJZA 2A68C 5IIFA 3FDTA 4KJOA 2NN6I 5IGCA 1SJED 2CW0C 1UUPA 2KECA 4K14A 4PNYA 1G2SA 3BVGA 3NSWA 3S16B 4UDUC 1LTAD 3MC0B 1PZJD 3D31A 3K5LA 1DCZA 3U9OA 2XNAC 4BA1I 4BWGB 1I4QA 3EJIA 2PMZB 1R9TB 5C5LA 2JE6I 1HFNA 1A3TA 4DA2A 1EWCA 4RWSC 4NKLA 1HQMC 2ICEC 4IUUA 4H7BA 3K0YA 4ZAIA 4U673 1LV9A 1SYCA 1D6EC 2NVTB 1A15A 5C3WA 1LT3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDG A;  1QIL A;  1RD9 D;  4RGT A;  4C56 C;  1DJR D;  1LTT D;  1L0X B;  3BYY B;  1LT5 D;  1LTI D;  1PRT B;  1V1P A;  1FNW A;  1HTL D;  1EU3 A;  1AW7 A;  1JQY D;  1ENF A;  1LLR D;  1T5X D;  5I4D A;  1LO5 D;  1BCP C;  3DWA A;  1SEB D;  3R2T A;  1B44 D;  1D5X C;  1PTO C;  2XRQ D;  4RFB A;  4K6L A;  1DYQ A;  2G9H D;  3BVZ A;  4OHJ A;  5TSS A;  4TSS A;  1SBB B;  4L63 B;  2TSS A;  4RGM A;  1BXT A;  1UNS A;  4Z9C B;  1I4R A;  1HXY D;  1JWU D;  1PRT F;  1LTG D;  1S5D D;  4RGN A;  1EEF D;  1RDP D;  2J4X A;  2RDH A;  3DWP A;  1SXT A;  1CT1 D;  1JWS D;  1S5F D;  1FNV A;  1AN8 A;  2AQ2 B;  3MFG A;  5ELD A;  1D5M C;  3R8B A;  3TSS A;  3DWQ A;  1PYW D;  1ET9 A;  1TS5 A;  1EFI D;  1SJH D;  3BYT B;  4DXG A;  1CQV A;  1I4H A;  1M4V A;  4RCO A;  5ELF A;  1S5B D;  1FNU A;  1BCP B;  1EEI D;  1HQR D;  1JWM D;  1XTC D;  1LTB D;  1PZI D;  1RCV D;  1TS3 A;  1TS2 A;  4DXF A;  1V1O A;  3R2I A;  3W2D A;  3KLS X;  1FGB D;  1PTO B;  3GP7 A;  1S5C D;  1PRT D;  2AQ1 B;  4RHR A;  1HA5 A;  2XN9 C;  5FKA C;  1BCP D;  1LTR D;  2R61 A;  5ELE A;  2Z8L A;  1D5Z C;  5D3D A;  2IJ0 A;  1PTO D;  1I4G A;  1KLG D;  1PTO H;  1BCP F;  1V1P B;  3OWE B;  1SJE D;  1JCK B;  1UUP A;  1G8Z D;  2QEJ C;  2AQ3 B;  4RGO S;  1CK1 A;  1PTO F;  1TY2 A;  3BVG A;  1KLU D;  1FD7 D;  1TY0 A;  4UDU C;  1CHP D;  3EA6 A;  1LTA D;  1PZK D;  2XRS D;  5D3I B;  1JR0 D;  3MC0 B;  4ZYS A;  1MD2 D;  1KTK A;  1PZJ D;  2QIL A;  1LTS D;  2ICI A;  1SE4 A;  1RF2 D;  1EU4 A;  1CHQ D;  1GOZ A;  1TS4 A;  2NTT A;  3EFX D;  4L6T B;  1SE2 A;  5FK9 C;  2XNA C;  1PRT C;  2IPK D;  4BWG B;  3URY A;  4RHS A;  1S5E D;  1I4Q A;  1ESF A;  2O2L D;  5ELB A;  2NTS A;  1B1Z A;  1STE A;  2SEB D;  3O13 A;  1EWC A;  4O1N A;  1F77 A;  1SE3 A;  2WV6 D;  1ET6 A;  1L0Y B;  1LT6 D;  3BVM A;  1LT4 D;  4RH6 A;  1I4P A;  5ELC A;  3SEB A;  3CHB D;  1D6E C;  3BZD B;  1I4X A;  2CHB D;  1XXG A;  3V05 A;  1LT3 D; 
#chains in the Genus database with same CATH topology
 2MPM A;  1I94 Q;  3I7F A;  4IFD I;  2PZT A;  4DUY L;  2F3W A;  3NWS A;  4F87 A;  1PH2 A;  5M3M H;  4QUF A;  3S1M B;  4ME3 A;  4DV3 L;  4XT1 B;  4JG2 A;  2Z4I A;  2E75 C;  3A55 A;  4DUZ Q;  3PGZ A;  3OIQ A;  2N55 A;  5AFW A;  4GKJ Q;  1K8G A;  1XNR Q;  5EPJ A;  4GOP B;  4KN7 C;  3CPW A;  3PQI A;  5FO7 B;  1PRT F;  3ERQ A;  4QB4 A;  4IQZ A;  5J39 A;  2VW9 A;  2AQ2 B;  4OXP A;  1J6Q A;  4EQP A;  4QIW E;  1H9S A;  4MTK A;  5GAG C;  5HY6 A;  3HOX B;  4YCV A;  2R7F A;  4A3B G;  1LTB D;  5IYC H;  5IOD A;  3NXW A;  1CI3 M;  5LMN Q;  3BDC A;  3PUY A;  2HIV A;  3X3M A;  3F2B A;  1HR0 L;  1PRT D;  1YHQ A;  1X9N A;  4LUO A;  2K5Q A;  1HA5 A;  5M5Y B;  1AFP A;  2CWA A;  3FRP B;  2XSC A;  1IW7 C;  2L55 A;  5E4X A;  4EQ5 A;  3TQY A;  4LF9 L;  3CME A;  5IWA Q;  4JBK A;  2QF7 A;  3OWE B;  2UU9 L;  1IL2 A;  3LWU A;  1G8Z D;  2BDO A;  4DV1 L;  3F8T A;  1X56 A;  3T1H Q;  5EPL A;  4K8J A;  3LGJ A;  2Q8R E;  4H02 A;  1N36 L;  5C44 G;  3BDL A;  4JOI A;  4YY3 Q;  1HJP A;  2ICI A;  4KKS A;  4X3K A;  3PUZ A;  1STA A;  4G7Z C;  4HSV A;  3CCJ A;  4POG A;  2K5D A;  3T1Y Q;  1MJE A;  1A8V A;  3P20 A;  3HOW B;  1Q1E A;  4BS9 A;  1J8I A;  4QIW B;  4JI2 Q;  2JSO A;  4IJL A;  3BVM A;  1QNU A;  1JE4 A;  3NBH B;  1X6O A;  3DEP A;  4JYA L;  2K1B A;  3I72 A;  3UE0 A;  3T56 B;  1IBM L;  1XMQ Q;  3GTM B;  2A1A A;  1VQH A;  4IPC A;  5HGQ A;  3SHL A;  2VZA A;  1XMO Q;  3H0G B;  3E5S A;  1STN A;  5C4X B;  4QGU A;  4JI8 Q;  3PO3 G;  3OSO A;  3NTI A;  2UUC Q;  2UXD L;  5EGT A;  3MXN B;  2B2U A;  2KJX A;  2E5L L;  2E2I H;  5TSS A;  2VXW A;  2NZH A;  3VYR A;  1K73 C;  4UAI A;  4RGM A;  2HT1 A;  1UNS A;  2JA5 G;  4ZLT F;  5DAU A;  3DM1 A;  1RDP D;  2DUD A;  1EUJ A;  5CV7 A;  1WTW A;  3ER0 A;  2IX3 A;  4R4C A;  1ET9 A;  1EFI D;  3SK5 A;  1VQP A;  4NMZ A;  4DXG A;  1EIG A;  2FHT A;  1VQ7 A;  4DV2 L;  3CC2 A;  4FF2 A;  3CCU A;  2Q2U A;  2A19 A;  4Y7N H;  3J81 i;  2CKZ B;  1AP0 A;  4HTH A;  3MEF A;  5IT9 L;  1PTO B;  4JBW A;  1AEX A;  5M5X B;  3GTO B;  5FLM G;  3W5O A;  5JJI A;  2AUK A;  2MP1 A;  5CGK A;  4N9P A;  4BY7 B;  1TQO A;  1YVC A;  4DUY Q;  2H1E A;  4LFC L;  1YHA A;  4OO1 H;  4DV3 Q;  1EY5 A;  2NB0 A;  3KJP A;  1JCK B;  3DLL A;  4P75 A;  2K7V A;  5CV5 A;  4QF4 A;  2AQ3 B;  1HZA A;  4QJF A;  5JJL A;  1N32 Q;  4KKU A;  4KV6 A;  4TVA B;  5D14 A;  2F03 A;  5JPM C;  1Z6H A;  2LXJ A;  5FLX c;  3C1F A;  3J7Z C;  1EIY B;  1VDZ A;  3OIP A;  1SDF A;  1B4O A;  3PIO 3;  3J7Y W;  3HFZ B;  3W1B A;  2J0T D;  3PMF A;  5DEH A;  1BF4 A;  2LY7 A;  1MBY A;  1TWC B;  3U9S A;  2YTX A;  3VYU A;  3HOV H;  4BBS H;  1EZ8 A;  3KDF B;  4RKB A;  3JAM i;  4XDX A;  2E2H B;  3S1N H;  2UUB L;  1HR0 Q;  3KLW A;  3K81 C;  2L11 A;  4OL7 A;  4R8I A;  1M1K C;  1GUO A;  4GN4 B;  1W2B A;  1TII D;  5ELC A;  4DGZ A;  1O7L A;  2X6G A;  3GTJ B;  4B3M L;  4YWK A;  2CHB D;  1V43 A;  1EZ6 A;  4LF9 Q;  1DZ1 A;  1XWE A;  5C0X G;  2C35 B;  1RD9 D;  3PIO A;  3TEH B;  3I8Z A;  1DJR D;  3A7A B;  2UU9 Q;  3A56 A;  1RIP A;  3I4N H;  1H95 A;  4DV1 Q;  3UDI A;  2YTY A;  1B70 B;  3NQI A;  1IXR A;  1ZKO A;  5I6W A;  1N36 Q;  2F0L A;  1TU2 B;  1EYA A;  2R93 B;  5CV8 A;  2MO0 A;  3MA2 B;  4DR6 L;  3Q8D A;  5IYD H;  1VQ4 A;  3ND8 A;  5BR8 L;  4P74 A;  4DFA A;  3J80 c;  1NUC A;  1CKN B;  5E4W C;  2O5I C;  1FNV A;  1H9J A;  2N88 A;  4IOA A;  1X3G A;  1QVF A;  3CC7 A;  3H6M A;  2MO1 A;  4CJ0 B;  5BN3 A;  3EBE A;  2V4D A;  2ZTD A;  1D1K A;  3F2D A;  5ISR A;  1NMG A;  4DAM A;  2EY1 A;  5EPK A;  4RCN A;  1XNQ L;  4YHH L;  1TXY A;  4B3T L;  1BKB A;  3KLS X;  4ULL A;  1PH8 A;  3GP7 A;  4JYA Q;  2GVA A;  3F2U A;  4WJW A;  3SR1 A;  2TMP A;  1CTM A;  1IBM Q;  5F2D A;  2L12 A;  2Z8L A;  3STB D;  2CFM A;  1GUN A;  2XGT A;  3HOZ G;  3S17 H;  3RMH A;  1Y1V B;  1TWF H;  3S15 H;  2UXD Q;  1PTO F;  2B63 H;  2E5L Q;  1VQD A;  1G51 A;  5M3F G;  1YNX A;  4JOI C;  4C2M H;  1NMF A;  1F9P A;  3EA6 A;  3S2H H;  4A3C G;  1LTS D;  3NQT A;  4OX9 L;  1LYL A;  3E9H A;  1GOZ A;  2F0N A;  4CDC C;  1VF7 A;  2CWP A;  2A8V A;  3OWF A;  2WIN B;  1VMP A;  4TRD A;  4L5T A;  2YV5 A;  1WTP A;  1A2U A;  4P72 A;  4DV2 Q;  5JPN C;  4K0K Q;  4KHP L;  4J6H A;  1EY8 A;  5C4Z A;  1QUQ A;  1ROD A;  1CKM A;  5IGE A;  1E7Z A;  1N33 L;  3O13 A;  2D0P A;  3S24 A;  2K05 A;  2CH4 W;  4UY8 C;  3FMC A;  5JVH 3;  1Q7Y C;  2R92 H;  5KND A;  4GZY C;  2JA7 G;  3AYH B;  4OON A;  1VQ9 A;  2B2W C;  5K36 H;  1VMC A;  4JCV E;  4BBR H;  3I70 A;  5EKK A;  1I4X A;  4A3B B;  1PFN A;  5IGB A;  1Q1B A;  1XX8 A;  2DN8 A;  1TWA H;  5CBE E;  1G91 A;  1FNW A;  1QE6 A;  2MJ8 A;  1EU3 A;  5IP9 H;  4HJ9 A;  4OWT B;  3OOC A;  4PV1 C;  1DD2 A;  1A3V A;  1U4L A;  4DV5 L;  2B2U C;  1B44 D;  2JA8 H;  2EYP A;  2XRQ D;  5JOB A;  4LF7 L;  2IL8 A;  3BVZ A;  4A3J H;  4DR7 L;  2BDN A;  4FF4 A;  2EZV A;  2PNH A;  5C3E B;  1M90 C;  2CVR A;  5GAD C;  1HXY D;  4DU9 A;  1L1O A;  2F0F A;  2ZJR A;  3C2P A;  4A93 H;  3HKS A;  4C3J H;  3GTP H;  3MXP A;  2NVX B;  1QJO A;  3RLF A;  3G6E A;  4MN3 A;  5C44 B;  3A7L A;  4LF8 L;  2UUB Q;  5FO9 B;  3HEJ A;  1TS3 A;  2OEO A;  1HTP A;  3RUZ A;  4DAY B;  3H09 A;  5J3B A;  3TRE A;  2K5V A;  2Q8I B;  3D4R A;  2F3V A;  2P5Z X;  1KRS A;  3IL8 A;  4B3M Q;  3MXU A;  4K5W A;  5FKA C;  1AE3 A;  3VR6 A;  2QA4 A;  1L2F A;  2RKS A;  4JI0 Q;  1Z7T A;  2LS0 1;  4GLX A;  1T9H A;  2E8G A;  2QW7 A;  3TS0 A;  1PH7 A;  4NXN L;  2PYK A;  3AFP A;  2IX0 A;  1K0S A;  1KLU D;  4DNR B;  3FKI G;  4QCL A;  2F0E A;  5E7N A;  2LKV A;  4A4I A;  4HIM A;  4FP5 D;  5EKL A;  4DR6 Q;  4PG3 A;  1MD2 D;  3T4A C;  3PUX A;  1D7Q A;  3G7L A;  4PQX A;  2FJ2 A;  1TS4 A;  3PO3 B;  1CM9 A;  1SE2 A;  4GLV B;  3S16 H;  5KIX A;  1G6P A;  1UE7 A;  3K6O A;  5IE8 A;  2O2L D;  3KBX A;  2AWO A;  2NBF A;  2K5N A;  2JA5 B;  1XNQ Q;  4YHH Q;  4B3T Q;  1SNC A;  4FXD A;  2Q2T A;  5H1S E;  2EYO A;  1ET6 A;  2Z9H A;  1LT6 D;  2AHO B;  3DXJ C;  1YBY A;  2FMM A;  3PO2 G;  5M9O A;  5IYB H;  1R9T H;  2ZTC A;  5C0X I;  1WTH A;  4P73 A;  1XTD A;  2EJM A;  1L0X B;  2A69 D;  2IHE A;  3T53 B;  4K6D A;  2NVQ B;  4BA2 I;  3F2C A;  2NVT H;  1GHJ A;  3STB C;  1D5X C;  3UDX A;  3SGI A;  3AU7 A;  3KFU A;  2Q2H A;  4OWX B;  4KY5 A;  3G71 A;  2NZ1 D;  4TSS A;  3UDF A;  2B8F A;  3GTL B;  3CPF A;  3FEW X;  1AZQ A;  3S1M H;  5IOC A;  2J4X A;  2PW7 A;  1JWS D;  2JXM B;  4KHP Q;  2RBM A;  2FIN B;  3EIV A;  4P2C B;  2L15 A;  1J9O A;  2NN6 H;  4JK1 C;  5IYC G;  1N33 Q;  1U0L A;  1LAB A;  5ELN A;  3W1G A;  5C4J B;  1JWM D;  4BXX G;  4KI0 A;  2DJG C;  4R4T A;  4A3L G;  3TP5 A;  2D5D A;  2FMC A;  3MTS A;  3MAQ A;  4IZ8 A;  3HOX H;  3M85 A;  1LTR D;  4P71 A;  4ZK9 B;  4YY3 L;  3K5N A;  3I55 A;  5G3L D;  5GAE C;  1HR0 W;  1H9S B;  1KLG D;  4PZ8 A;  4DV5 Q;  1PYS B;  2EY2 A;  2Z6B A;  5M5Y H;  1JB3 A;  3K57 A;  3S2D B;  2EQS A;  1EQQ A;  2EPB A;  1CHP D;  4HMJ A;  3KF8 A;  4LUV A;  3VA7 A;  4JI7 L;  4PMB A;  4RMF A;  1MGS A;  1JR0 D;  4J8Q A;  3HRZ C;  1Q81 C;  1RF2 D;  3VR2 A;  2IY5 B;  4LJZ C;  4LF6 L;  1JC7 A;  4LF8 Q;  5IP7 H;  2WKD A;  3FHW A;  4B3R L;  4A3M G;  3M7N A;  3BZC A;  1B7Y B;  2HD3 A;  1MHW C;  4ILW A;  4CKE A;  5FJ8 H;  1FGU A;  1MIU A;  1BBX C;  4IJH A;  1L0Y B;  3BJU A;  2IWH A;  1D2B A;  4ZUJ A;  2RF4 A;  3I3C A;  1KAA A;  2OTL A;  1QOH A;  3MEH A;  2M2L A;  3C3L A;  3HOW H;  1O7Z A;  4HSP A;  4I7Z C;  1Y69 U;  4H44 C;  4MIU A;  2LFN A;  2SNS A;  1ENF A;  1T5X D;  2K5H A;  5I4D A;  1B53 A;  3R2T A;  2B2Y A;  2EE1 A;  3A74 A;  1EQV A;  1Q90 A;  3GTM H;  2KQ3 A;  4DR3 L;  1R4P B;  2WAQ G;  4UPA A;  3P1H A;  3H0G H;  3HOZ B;  1L1O C;  5C4X H;  1A2T A;  4Z9C B;  1YEZ A;  2PQE A;  1E24 A;  4A76 A;  3CU7 A;  3DWP A;  3PSI A;  1SR3 A;  4N9T A;  4BY1 G;  5M3F B;  3PF4 A;  2PQA A;  3U50 C;  2BE5 D;  4KKT A;  4HCS A;  4O0A A;  1EFW A;  2Y0S G;  1EWH A;  1MI2 A;  2VY3 A;  1M4V A;  1S5B D;  1FNU A;  1PFM A;  4FNF A;  1RL2 A;  2WP8 J;  5EJW A;  4A3I B;  1R4Q B;  2F4I A;  2V1C C;  2L5T A;  3VR3 A;  2OF1 A;  3WOF A;  1N32 L;  2K03 A;  5CMD A;  2VUM G;  1VQI A;  2EYH A;  1ICF B;  1BCP D;  4ALP A;  4OO1 G;  2I0Q A;  2ZXR A;  3U58 A;  1PTO H;  3HGB A;  4A75 A;  4XQN A;  5M5X H;  3GTO H;  5I6Y A;  1BOS A;  1CZW A;  3NTK A;  3CAM A;  1K3R A;  4BY7 H;  3DEO A;  2A69 C;  4JI3 L;  1VS0 A;  1X32 A;  1O7Y A;  2OWO A;  1T5E A;  4GS3 A;  5C3X A;  4B9W A;  1SRU A;  1CSQ A;  1KTK A;  5A2Q L;  1SE4 A;  3ZJY C;  1PMR A;  1Z9F A;  4L6T B;  4Q5V A;  1KIX A;  3L2P A;  1IBL L;  3C46 A;  3ONA B;  2F0U A;  1STY A;  3GD7 A;  5DNF A;  1TT2 A;  4Y52 H;  4X3T A;  2A6H C;  2JJQ A;  3H94 A;  4C3I G;  2KCN A;  2F0G A;  5I9O A;  4IUN A;  3CCQ A;  2OQ0 A;  1HFG A;  1TWC H;  1I4P A;  1P16 A;  3TDQ A;  3A8J E;  1Q82 C;  4KMU C;  1EY0 A;  2F0H A;  4OEL B;  4L8J A;  1PH9 A;  3M4P A;  2DNC A;  4IPD A;  2H4O A;  2E2H H;  3P7J A;  3V05 A;  4B08 A;  1PH1 A;  3I4N G;  1IHZ A;  3K58 A;  3TBI B;  1UE6 A;  4ZKC B;  3MXG A;  3NEM A;  4IFD J;  3KF6 A;  4M1U B;  1LLR D;  2BOS A;  2NZO A;  3GTJ H;  2B2T A;  3J81 c;  1JE5 A;  5KEE A;  1Y8O B;  1YZ6 A;  4JI7 Q;  3HOU G;  3D4W A;  4YWL A;  1EL0 A;  1B3Q A;  2YU9 B;  5T1I A;  1BXT A;  3NE5 B;  1NJI C;  4KD3 A;  4A3D G;  4LF6 Q;  2B29 A;  2HIX A;  3FKI B;  1GM5 A;  5LL6 X;  4IPG A;  4IUR A;  4B3R Q;  2R93 H;  1TS5 A;  3A8I E;  3WOE A;  4CJ1 B;  4LNQ A;  4AYB G;  1CA5 A;  2UUA L;  2JEA I;  3AEV A;  2RA4 A;  2CQO A;  3W2D A;  1HA6 A;  2G9D A;  4XYO A;  2EYF A;  1FL0 A;  1ZXT A;  1IZ6 A;  1TWG B;  1OTC A;  1LTL A;  3S14 B;  1GVP A;  1SSO A;  3QB3 A;  2WFW A;  4LF4 Q;  1VQ6 A;  1I4G A;  1V1P B;  3JAM c;  2DGY A;  4Q0F A;  3FVQ A;  5IGD A;  4X65 Q;  1C8C A;  3PO2 B;  5KRU A;  1WTO A;  1OXU A;  1U4P A;  4K0K L;  1ENC A;  1I5F A;  5GQO A;  1FD7 D;  4DR3 Q;  2F0V A;  3HOY G;  3S1Q B;  1YJN A;  3I73 A;  3E3X A;  2SOB A;  4GKK Q;  2J7Z A;  3OPO A;  1SNP A;  1KDB A;  4GOP A;  4FXG C;  3LWE A;  1Y1V H;  1BQQ T;  2F0O A;  2K28 A;  1B3A A;  1N9W A;  2JQO A;  2EY5 A;  5KNC A;  1S5E D;  1ESF A;  1SFO B;  4WJ4 A;  2EJG C;  2MGS A;  1KAB A;  1SND A;  1X55 A;  4A3G G;  4RG1 A;  1XJV A;  4CKC A;  1OXS C;  3PUV A;  2B2V A;  1I50 B;  2BE5 C;  2R92 G;  3DHQ A;  3Q22 A;  1LT4 D;  1G6Z A;  4EX5 A;  4RH6 A;  4R1J A;  1VQB A;  4K2L A;  1WD0 A;  3E9I A;  1EIF A;  5E3F A;  1XXG A;  5EKI A;  3I90 A;  2PPB C;  2KCT A;  5JEA G;  1WFQ A;  3CCL A;  1XPU A;  3I2Z A;  3TP6 A;  1QUQ B;  3S9W A;  1VCI A;  1BCP C;  4ME5 A;  4HED A;  2JA8 G;  5DM6 3;  1SEB D;  4DN4 M;  5CV6 A;  4JI3 Q;  3I4O A;  4A3B H;  3LX0 A;  1QVC A;  4CHT B;  4B3S L;  4OHJ A;  4L63 B;  1EWI A;  2ZM6 L;  2QCP X;  1WI5 A;  1I3Q B;  1I4R A;  3HKZ G;  1Y1W G;  4JI4 Q;  1EEF D;  3ULL A;  2JP1 A;  4KHV A;  3EN2 A;  1S5F D;  1IBL Q;  2L0C A;  3H3V C;  2XTI A;  2R7Z B;  1KDC A;  4JI0 L;  4KHZ A;  3UDG A;  3DWQ A;  2HDL A;  3BYT B;  3RLN A;  2Y0S E;  5E1F A;  1YIJ A;  5C3E H;  1XTC D;  1PZI D;  1XPO A;  1SMY D;  2NVX H;  2O4X A;  1IYU A;  3PUW A;  5LL6 S;  4A3K G;  4A3F G;  1TVX A;  5C44 H;  3NBH A;  4RKL A;  4A3M B;  1L1O B;  4LK1 C;  4OO1 I;  1U5K A;  3Q6S A;  1Q3L A;  4JI5 L;  1UWV A;  2K32 A;  4G7H C;  4JVZ A;  5FLX E;  4LFA L;  3WWV A;  2R7D A;  3UI2 A;  5I2Y A;  2VB2 X;  4CKB A;  3IAY A;  1EOV A;  1CKO A;  3MXN A;  1TY0 A;  2CQA A;  1EYD A;  1HPC A;  5FO8 B;  1K83 B;  3U4V A;  2QIL A;  1WCM G;  4ZUI A;  3RZO B;  1STH A;  2E2J B;  1X3Q A;  2EOT A;  1TR5 A;  2UUA Q;  4TQU S;  2FFK B;  2M00 A;  3RD4 A;  4IOC A;  4HN7 A;  4CDD C;  1ONL A;  3A8K E;  4O1N A;  1WTQ A;  4DK6 C;  3SK4 A;  3PO3 H;  2Z6K A;  2WV6 D;  2A6E D;  2B3G A;  2ID0 A;  4BY1 B;  4GN3 B;  4A3E G;  3CRL C;  1QB5 D;  2Y0S B;  3GV3 A;  2DJF C;  1PVO A;  2JA5 H;  1K0R A;  2RDG A;  4LWC A;  3ZYY X;  2SDF A;  3S1R B;  1GD7 A;  2EYJ A;  4OIK A;  1LO5 D;  1GO3 E;  3ICE A;  1ILP A;  1WVL A;  1JMC A;  2VUM B;  1RTO A;  1OXX K;  1U9R A;  1QNK A;  3J80 E;  2XWJ B;  4FF1 A;  4RFB A;  1NTG A;  3GDE A;  2NVQ H;  5FLM H;  3T51 B;  3DM3 A;  1PHJ A;  3KBG A;  3KLS A;  1LTG D;  1XPR A;  2K33 A;  4KN4 C;  2JA6 G;  4DV7 L;  5FOB B;  2F52 A;  1ICW A;  1AN8 A;  3R8B A;  5I9P A;  2RCN A;  3RLO A;  3GTL H;  1CUK A;  3J7A 5;  1JB7 A;  3QJY A;  1SYE A;  4AYB E;  3R2I A;  4O42 A;  4DR2 L;  2KEE A;  2XIW A;  3OW2 A;  1Q86 C;  1E2W A;  3D4D A;  2OCE A;  4HJ5 A;  3K7A B;  1NCV A;  4DR5 L;  2YYZ A;  4KY6 A;  1DM0 B;  2F0D A;  2N3S A;  1PLF A;  1B8A A;  5C4H A;  5C4J H;  3OTO L;  4C3I B;  2XVS A;  2X69 A;  1QCB D;  3NTH A;  1DOK A;  1A0I A;  2D2C C;  2E76 C;  4KK7 A;  4B3S Q;  3ULJ A;  3I4N B;  1HUN A;  3BDO A;  5D3I B;  2ZM6 Q;  4LFB L;  4ZYS A;  2WB1 G;  4HMI A;  1PV4 A;  4CBV A;  2ASB A;  3H91 A;  2MQH A;  3DMU A;  1CKN A;  3ERO A;  1YNJ D;  1E2V A;  3PF5 A;  5C0X H;  1CFM A;  1VQF A;  3MHB A;  3PCO B;  3C1E A;  5COR A;  3HOU B;  1K8M A;  4LAA A;  5CYU A;  4AIM A;  5ELB A;  1FVI A;  3K80 C;  1B2T A;  4A3D B;  3I4M G;  2EJF C;  2FXQ A;  3VYT A;  4R8N A;  4C3H G;  2CCZ A;  1FJG L;  1GJX A;  4NXM L;  3H3V I;  1RHP A;  3DUZ A;  1PH5 A;  4X3S A;  4KJN A;  3GTK B;  1I6H B;  4F7X A;  2K75 A;  2B39 A;  4JI5 Q;  4AYB B;  1SMY C;  1IKM A;  4LFA Q;  2VNU D;  1B9M A;  3ULP A;  1AW7 A;  2KVM A;  2A5H A;  2RVL A;  4MZ9 A;  1N34 L;  1ASY A;  3IFT A;  2BA1 A;  3CC4 A;  2M9V A;  3KK7 A;  1G29 1;  4K6L A;  3I4L A;  2TSS A;  1B50 A;  3GO5 A;  3KLR A;  1HCZ A;  4H13 C;  1Y8N B;  2CH4 A;  1EY7 A;  4F8M A;  5EQ0 A;  5T1G A;  1S5D D;  1ZEQ X;  3GTG B;  3HOY B;  1D5M C;  3GV6 A;  2K6A A;  3RZD B;  1YHB A;  5M3M G;  2I46 A;  1HUM A;  5CBA E;  1HNZ L;  2R3Z A;  4JI6 L;  3G6J B;  1CQV A;  3HOZ H;  1BCP B;  4JBM A;  3BZK A;  4KD4 A;  1YNN D;  1QWY A;  5HGT A;  5M3F H;  1KC8 C;  1NY4 A;  1Q8K A;  4A3C H;  2HDM A;  4CDF C;  2R6G A;  4IUP A;  2L9H A;  3NWT A;  1SNQ A;  4A3G B;  5FLX L;  4A3I H;  2A6E C;  1NAP A;  2PQA B;  2A6H D;  1X3F A;  3CRK C;  2PI2 A;  5IT9 c;  1QZH A;  5G3L F;  4WJ3 M;  2HQL A;  2BA0 A;  2Q2I A;  4C1N I;  1K8O A;  2I5L X;  1LUZ A;  2PO4 A;  4XYQ A;  4HJA A;  2ALY B;  2KHJ A;  1H9R A;  1SYG A;  5KYL A;  1S40 A;  2MHV A;  2JA8 B;  1EU4 A;  4DV7 Q;  5CC4 A;  2NTT A;  4S3S A;  1X65 A;  2RHS B;  3MFY A;  4DPG A;  4G7O C;  5JEA J;  1QG7 A;  4EVO A;  3ERS X;  2NYZ D;  2I5H A;  3CW2 C;  2ENB A;  2Z6K C;  2L4N A;  4DR2 Q;  5CV9 A;  1Y1W B;  1U4R A;  2EY6 A;  4DAY A;  3F1Z A;  5GAH C;  4RA8 A;  5EBC A;  1NR2 A;  1NSN S;  4DR5 Q;  1PA6 A;  3OTO Q;  3KUP A;  4OIJ A;  4MNO A;  1SE8 A;  4XT3 B;  1QIL A;  3EQL C;  4RGT A;  5C0X J;  1O78 A;  4A3K B;  4DKA C;  1AE2 A;  4A3F B;  4IFD H;  1PXU A;  3J80 L;  1O80 A;  1KD1 C;  5IGG A;  3M4O B;  4LFB Q;  3QIA A;  4DK0 A;  1NNX A;  2EYL A;  1EQR A;  2XWB B;  1WTV A;  2ZXO A;  1F2L A;  3SK6 A;  4NP5 A;  2C9O A;  2YU9 H;  2RSO A;  4HID A;  3CCE A;  1I4H A;  4LF4 L;  1WCM B;  4RCO A;  1FJG Q;  1HQR D;  4DR4 L;  4WFN 3;  4X65 L;  1PFB A;  1TS2 A;  2DY7 A;  4NXM Q;  1YNJ C;  4TKO B;  1M8A A;  3NEL A;  3E6Z X;  4I7A A;  2E2D C;  4R4O A;  1YIT A;  3FKI H;  2HCI A;  1G2T A;  1WTR A;  2HQE A;  3OMG A;  1UEA B;  4GKK L;  2R61 A;  2D62 A;  2F0T A;  3SE0 A;  1D5Z C;  3A5Z B;  4G4K A;  1WTX A;  2IJ0 A;  4JPB W;  1BCP F;  4A3E B;  1N34 Q;  4V19 0;  4QQB X;  2QEJ C;  4RGO S;  5J22 A;  4GNX A;  3VR4 A;  1TY2 A;  1TWG H;  3T13 A;  2NUC A;  3BS1 A;  3S14 H;  1VQL A;  4DR1 Q;  1RTN A;  1MSG A;  2IW3 A;  2KED A;  4HR7 B;  1PZK D;  1A6X A;  2KHS A;  2GN5 A;  1NBW A;  3TS2 A;  2UXB L;  2WB1 E;  2F0S A;  3QO2 A;  3PO2 H;  3BG3 A;  2AKW B;  1BBU A;  4YCW A;  3M4Q A;  1HNZ Q;  3URY A;  4JI6 Q;  3K5O A;  3S1Q H;  4HJ8 A;  3KOJ A;  2QKI C;  1ML0 D;  1STE A;  2VS1 A;  2AUJ D;  4DNT B;  1VQ5 A;  2JA7 B;  2RQX A;  1Q8I A;  1BBW A;  1JOO A;  3N6R A;  1BVS A;  3B6Y A;  4K5X A;  3E0J A;  4IUV A;  2JA6 B;  3NEN A;  1KRT A;  3TZU A;  3AFQ A;  1KQS A;  5K5P A;  3J7A V;  3R93 A;  2KOL A;  1CSP A;  2F0J A;  3CQZ B;  3HP3 A;  2K01 A;  1SFO H;  3SEB A;  3AB9 A;  3CCM A;  4JI1 Q;  1K3B C;  1E22 A;  1EY4 A;  5D65 A;  2RDF A;  1YNN C;  1HZ9 A;  3LNN A;  3Q0A A;  3BYY B;  2IHF A;  3HOV G;  4BBS G;  1I50 H;  1LT5 D;  3SDZ A;  4JI4 L;  2N49 A;  1JQY D;  4I65 A;  2BH2 A;  4O2D A;  1GUT A;  2VQF L;  3DWA A;  4YIJ A;  2D0O A;  4HCE A;  4BXX H;  1SN8 A;  1DOL A;  4MTN A;  2MNA A;  4A3L H;  3BU2 A;  5CR3 A;  5IGF A;  1RJT A;  1Q12 A;  3GTQ B;  1IKL A;  3CCR A;  4PZ7 A;  1JWU D;  4WRD A;  2HHH L;  1F9R A;  5ELD A;  4B9X A;  1J5E L;  5C3E G;  1H9K A;  2WB1 B;  5GRO A;  1BO0 A;  5M5W B;  1I3Q H;  1H9M A;  1SMX A;  1MSH A;  2F4V L;  1WD1 A;  1EQT A;  3T16 A;  1S5C D;  2R7Z H;  1PYB A;  4H0L C;  1V1Q A;  5IYD G;  4RHR A;  4FYD A;  2XN9 C;  1SYD A;  3CD6 A;  2KCC A;  5ELE A;  1BNZ A;  3I4M B;  3HS0 C;  4C3H B;  2IX1 A;  2KEN A;  4IUQ A;  2VL6 A;  3JC6 6;  4A3M H;  1TWH B;  3VYS A;  2NVY B;  1Q46 A;  2XRS D;  4M8A A;  3L7Z C;  3M3Y B;  1Y14 B;  1E2Z A;  1F2Y A;  3QG1 A;  1O7I A;  2B2W A;  1C0A A;  2F0K A;  2OT2 A;  2PZU A;  3OMC A;  1D1I A;  3H15 A;  1C48 A;  4LW1 A;  2PW5 A;  4DR4 Q;  1K83 H;  4DV0 Q;  1B1Z A;  2B63 G;  5HUR A;  3J7A F;  4QUC A;  1F77 A;  1NR4 A;  1UE5 A;  3RZO H;  2E2J H;  4L5R C;  3IRB A;  5LMU L;  5M3M B;  1SNO A;  3J81 E;  4OGQ C;  2F0M A;  1F9Q A;  3E0E A;  4BY1 H;  4X66 L;  1HH2 P;  2ATW A;  2QDB A;  1XYI A;  1GUS A;  4POF A;  5JVG 3;  4DAP A;  2WII B;  1AZP A;  4CJ2 C;  2F1M A;  1F2Z A;  3I91 A;  1IBK Q;  3S1R H;  4UP8 A;  5L37 A;  3D6W A;  4J15 A;  3OW7 A;  3HG9 A;  2UXB Q;  3U4Z A;  5K36 G;  4BBR G;  1KNA A;  1VQ8 A;  4JC0 A;  4UP9 A;  3Q23 A;  2Z1C A;  2VUM H;  2A73 B;  4YCU A;  3W3A A;  1JIC A;  1CT1 D;  4JV5 L;  2OQK A;  5IP9 G;  3MFG A;  1KHI A;  2UXC L;  3K8A A;  5J1Z A;  1D8L A;  1SLJ A;  1RKN A;  3NBI A;  1EY9 A;  2B2Y C;  2KBN A;  1KXL A;  2K4K A;  3TP7 A;  4A3J G;  3QOJ A;  4ZRZ A;  1S4Z A;  3CMA A;  3JAM E;  1OXV A;  2BCO A;  4IN3 A;  1C7Y A;  1E1O A;  3P75 A;  4L5S A;  1X3P A;  2WAQ E;  4A93 G;  1EY6 A;  4DV4 L;  5JJK A;  2ZJQ A;  2D9U A;  1LAC A;  4K8I A;  1QZG A;  4C3J G;  4N8F A;  2JK8 A;  2G5D A;  3L3O C;  1PH6 A;  1SNM A;  3VDY A;  1VQC A;  4PMW A;  1ILQ A;  2VQF Q;  2DY8 A;  4GNX C;  1PFS A;  3K7A H;  3SVM A;  4HJ7 A;  2OTJ A;  1ENA A;  3N52 A;  4C3I H;  4LF5 L;  2JEB I;  3RR5 A;  2EXZ A;  1BR9 A;  2E74 C;  2RSN A;  3G4S A;  5IY0 A;  3R3O A;  4GLA C;  2HHH Q;  2KHI A;  1KDA A;  3EFX D;  1VQG A;  1HZC A;  4ZQ3 A;  1HHV A;  2OXP A;  5FK9 C;  1PRT C;  2IPK D;  3K7U C;  1J5E Q;  1YJ9 A;  1STB A;  2N8N A;  4X62 L;  3D6C A;  1P8L A;  3V96 A;  2F4V Q;  3RN2 A;  1KNE A;  4PZ6 A;  4QY7 A;  1SE3 A;  5C5M A;  1WYD A;  2LXK A;  5DM7 3;  2F3I A;  4IPH A;  4HAE A;  4DF7 A;  2GVB A;  3HOU H;  4FO2 A;  1MKH A;  2AMC B;  2VQE L;  1A62 A;  2Z0S A;  4IUT A;  2KCM A;  4A3D H;  1GKH A;  2PZW A;  1W6K A;  1HNW L;  2E2I B;  1DGS A;  1V1P A;  1IYV A;  1HTL D;  1Z47 A;  2I5M X;  1F2M A;  2RHQ B;  2WAQ B;  3HZX A;  3RNU A;  4ZKB B;  1A63 A;  3GTK H;  3CP0 A;  1I6H H;  1PDQ A;  3CCS A;  1SAP A;  4G57 A;  1DYQ A;  1FR3 A;  2GA4 B;  3QOL A;  1II3 A;  5IYB G;  2PI2 E;  1CZG A;  2K14 A;  2PCF B;  1SYB A;  1ZYR D;  3TZD A;  3NHH A;  3UE1 A;  4Y7N B;  1HRJ A;  2RDH A;  1X3E A;  4DV6 L;  4C1N K;  3K5M A;  1GHK A;  1B9N A;  4ZCK A;  3IFD A;  2NWG A;  1AH9 A;  2B2T C;  1EOT A;  4AH6 A;  2BH8 A;  1RCV D;  4EQN A;  4R4I A;  2K52 A;  2QDL A;  1F9S A;  4FF3 A;  2K50 A;  5LMU Q;  2PNR C;  2AQ1 B;  3GTG H;  3HOY H;  4XXE A;  3RZD H;  1S3O A;  1CQF A;  2EDG A;  2YTV A;  4A3I G;  2K04 A;  1SRO A;  2MFI A;  1K8A C;  3NK9 A;  1JOQ A;  3PV0 A;  3SK8 A;  3M4Y A;  4QL5 A;  1PTO D;  4X66 Q;  1CA6 A;  1FYC A;  4XQJ A;  3J80 i;  1WJJ A;  2NN6 G;  4F88 A;  5C6A A;  1OXT A;  2F0W A;  4V0B A;  3KDF A;  1CK1 A;  3OYY A;  4LUZ A;  4ID6 A;  1K28 A;  1HZB A;  4HIK A;  2SNM A;  1LM0 A;  4A3G H;  2K5W A;  3HOV B;  4BBS B;  1E1T A;  1GUG A;  3H3V H;  3NP8 A;  3HOX G;  2RCF A;  3S1N B;  2H5X A;  1STG A;  4LFC Q;  1CHQ D;  3K59 A;  4JV5 Q;  5AJ3 L;  2UXC Q;  2A74 C;  5LMN W;  5KYI A;  2ZJP A;  4IO9 A;  4RHS A;  1HNX L;  1L0W A;  4X3U A;  5JEA H;  1V9P A;  4NW2 A;  2EYM A;  3D8G A;  3I56 A;  4CGY B;  5A35 A;  2WAC A;  3NPP A;  3ITP A;  4E6I A;  3FP9 A;  4PMC A;  4EQO A;  1IL8 A;  2A68 D;  3MVV A;  3J81 L;  1X54 A;  1YJW A;  4GOP C;  1W3S A;  4DV4 Q;  1DOM A;  2MUY A;  3CHB D;  2CW0 D;  3FPP A;  5KGU A;  1E0B A;  2EXD A;  1Y1W H;  5IP7 G;  4C56 C;  3A5U A;  3S2D H;  4X6A H;  4IFD G;  1ESR A;  1EYC A;  4FVM A;  1KL9 A;  1JJG A;  1GUW A;  4QMG A;  4X64 L;  5I2X A;  5FJ8 G;  1Y8P B;  1GXD C;  4GN5 A;  2B2V C;  4KY7 A;  4LF5 Q;  4FXK C;  3FPU B;  2LMC B;  5NUC A;  1UE1 A;  3L9A X;  2G9H D;  3KF8 B;  1SBB B;  2B8G A;  4U68 A;  1KAW A;  3NUC A;  4A3K H;  1YI2 A;  2N78 A;  4A3F H;  1IYJ B;  4AQY L;  2HCC A;  4RGN A;  5COY A;  3HOW G;  4NB3 A;  1W6J A;  4RAU C;  3VA5 A;  2JA9 A;  1VQM A;  1SXT A;  4X62 Q;  3M4O H;  3TRZ A;  1PYW D;  2KUM A;  2ZXP A;  3KJO A;  4KLK A;  1SJH D;  4XQQ A;  3A54 A;  5EBD A;  5KNB A;  1EEI D;  2JYO A;  4K2K A;  2AWN A;  4DXF A;  1V1O A;  3JAM L;  2F0P A;  1K9M C;  3V2T A;  4APV A;  3CF5 A;  1A3U A;  3H0G G;  2VQE Q;  1PH4 A;  4DR1 L;  3S17 B;  5BR8 Q;  1JJC B;  3QWN A;  5C4X G;  1TWF B;  1ASZ A;  3S15 B;  4MHE A;  2B63 B;  1WCM H;  1HNW Q;  5A2Q E;  4C2M B;  4N8X 1;  3HKZ E;  3CXC A;  3S2H B;  4DAV A;  1I94 L;  1EYG A;  2Q8T A;  4K5V A;  3WDN A;  2ES2 A;  5CV4 A;  4KTA A;  4XIG S;  1U4M A;  5JAV A;  4DUZ L;  1C4Q A;  3PIP 3;  1DON A;  2ZT9 C;  3TP8 A;  4A3E H;  4GKJ L;  2L1B A;  4OEM B;  1XNR L;  4OWW B;  2DNE A;  4DV6 Q;  1VF5 C;  1MJC A;  1EIH A;  4JI1 L;  1E3P A;  3D0F A;  4L5Q A;  4CDE C;  1DXM A;  2R92 B;  4XTC S;  3SXH A;  2NTS A;  2VB3 X;  4BBR B;  4GNX B;  1ZYR C;  2I07 B;  2SEB D;  2Z4H A;  4BY7 G;  1IW7 D;  1TWA B;  3J81 j;  1BUV T;  2F0Q A;  2JN4 A;  3X3N A;  4OX9 Q;  5LMN L;  2HUG A;  4NPS A;  2F0I A;  3PIP A;  3MWY W;  3TN2 A;  3Q24 A;  4LMQ D;  1VQE A;  4UP7 A;  3BZD B;  3AMU A;  1VQK A;  2JA7 H;  5EAY A;  3EVQ A;  1V8Q A;  4R4Q A;  1LTT D;  4A3J B;  1LTI D;  1PRT B;  2JA6 H;  3TME A;  2O5J C;  3D3R A;  3VR5 A;  5IWA L;  4FDB A;  3CQZ H;  1I6V C;  3RN5 A;  1JOR A;  1JOK A;  4A93 B;  5BN5 A;  4C3J B;  1BDO A;  3MZ5 A;  1C9O A;  3HKZ B;  1PTO C;  4IAL A;  5LHY 1;  3GTP B;  3T1H L;  4ODG A;  2LSS A;  1N8R C;  2PMZ E;  4HIO A;  2X6L A;  2EIF A;  2WKC A;  2IT1 A;  5AJ3 Q;  3A0J A;  3IKJ A;  4WOR A;  4J1M A;  1HNX Q;  4DK1 A;  3TSS A;  1SYF A;  1VQA A;  4DNI A;  1QVG A;  3M9B A;  1UAP A;  2QEX A;  4NDX A;  3GTQ H;  5ELF A;  4YWM A;  1JT8 A;  2C5C A;  4R9W A;  3T1Y L;  3CKI B;  4LF7 Q;  4DR7 Q;  4ABN A;  3CCV A;  1PH3 A;  2R7Z G;  3OHX C;  2KA7 A;  1FGB D;  3M7G A;  3K0X A;  4EGV A;  5BN4 A;  5DLQ E;  2EVB A;  2ZTE A;  3ND9 A;  4JI2 L;  3GQB A;  4UHV A;  5IT9 E;  1OO9 B;  4JBJ A;  1VQN A;  1TKW B;  2QGQ A;  5M5W H;  1VQO A;  5D3D A;  1VQJ A;  5JJZ A;  2A68 C;  5IIF A;  2R93 G;  3FDT A;  1XMQ L;  4KJO A;  2NN6 I;  5IGC A;  1SJE D;  3KF6 B;  4X64 Q;  1XMO L;  2CW0 C;  1UUP A;  2KEC A;  4K14 A;  4PNY A;  1G2S A;  3BVG A;  3NSW A;  4JI8 L;  4DV0 L;  3I4M H;  1NE3 A;  3S16 B;  2UUC L;  4UDU C;  4C3H H;  1LTA D;  3MC0 B;  3G48 A;  4JW0 A;  4AQY Q;  1PZJ D;  3D31 A;  5ELO A;  3KYH C;  3K5L A;  1JJ2 A;  1DCZ A;  3U9O A;  1TWH H;  1WOC A;  2XNA C;  1S72 A;  4NXN Q;  4BA1 I;  4BWG B;  1I4Q A;  2NVY H;  3QR8 A;  3EJI A;  2PMZ B;  1R9T B;  3M3Y H;  5C5L A;  2JE6 I;  1HFN A;  1A3T A;  4DA2 A;  1EWC A;  4RWS C;  4NKL A;  1UEB A;  3L0O A;  1HQM C;  2ICE C;  4IUU A;  4H7B A;  3K0Y A;  4ZAI A;  4U67 3;  3AQQ A;  1Y1V G;  1IBK L;  1LV9 A;  1SYC A;  1D6E C;  2NVT B;  1A15 A;  5C3W A;  4DK3 C;  1LT3 D; 
#chains in the Genus database with same CATH homology
 2MPM A;  4IFD I;  2PZT A;  2F3W A;  3NWS A;  4F87 A;  4QUF A;  3S1M B;  4XT1 B;  2Z4I A;  2E75 C;  3A55 A;  3OIQ A;  2N55 A;  5AFW A;  5EPJ A;  4KN7 C;  5FO7 B;  1PRT F;  3ERQ A;  4QB4 A;  4IQZ A;  5J39 A;  2AQ2 B;  4EQP A;  1H9S A;  3HOX B;  1LTB D;  5IOD A;  3NXW A;  1CI3 M;  3BDC A;  3PUY A;  3X3M A;  1PRT D;  2K5Q A;  1HA5 A;  5M5Y B;  1AFP A;  3FRP B;  2XSC A;  1IW7 C;  2L55 A;  5E4X A;  2QF7 A;  3OWE B;  3LWU A;  1G8Z D;  2BDO A;  5EPL A;  4K8J A;  2Q8R E;  3BDL A;  2ICI A;  4KKS A;  4X3K A;  3PUZ A;  1STA A;  4G7Z C;  4HSV A;  2K5D A;  3P20 A;  3HOW B;  1Q1E A;  4BS9 A;  1J8I A;  4QIW B;  2JSO A;  3BVM A;  1QNU A;  1JE4 A;  3DEP A;  2K1B A;  3I72 A;  3T56 B;  3GTM B;  3SHL A;  3E5S A;  3H0G B;  1STN A;  5C4X B;  3OSO A;  3NTI A;  5EGT A;  2B2U A;  2KJX A;  5TSS A;  2VXW A;  3VYR A;  4UAI A;  4RGM A;  1UNS A;  4ZLT F;  5DAU A;  3DM1 A;  1RDP D;  5CV7 A;  1WTW A;  2IX3 A;  1ET9 A;  1EFI D;  3SK5 A;  4NMZ A;  4DXG A;  1EIG A;  2FHT A;  4FF2 A;  1AP0 A;  4HTH A;  5IT9 L;  1PTO B;  4JBW A;  1AEX A;  5M5X B;  3GTO B;  2AUK A;  2MP1 A;  5CGK A;  4N9P A;  4BY7 B;  1TQO A;  2H1E A;  4OO1 H;  1EY5 A;  2NB0 A;  1JCK B;  2K7V A;  5CV5 A;  4QF4 A;  2AQ3 B;  4KKU A;  4KV6 A;  5D14 A;  2F03 A;  5JPM C;  1Z6H A;  3C1F A;  1VDZ A;  3OIP A;  1SDF A;  1B4O A;  3PIO 3;  3J7Y W;  2J0T D;  3PMF A;  5DEH A;  1BF4 A;  2LY7 A;  1MBY A;  1TWC B;  3U9S A;  3VYU A;  1EZ8 A;  4RKB A;  4XDX A;  2E2H B;  2L11 A;  4OL7 A;  4R8I A;  1GUO A;  1TII D;  5ELC A;  4DGZ A;  1O7L A;  2X6G A;  3GTJ B;  2CHB D;  1V43 A;  1EZ6 A;  1DZ1 A;  1XWE A;  5C0X G;  1RD9 D;  3I8Z A;  1DJR D;  3A7A B;  3A56 A;  3NQI A;  1ZKO A;  5I6W A;  2F0L A;  1TU2 B;  1EYA A;  2R93 B;  5CV8 A;  3MA2 B;  3ND8 A;  4DFA A;  1NUC A;  5E4W C;  2O5I C;  1FNV A;  1H9J A;  2N88 A;  3H6M A;  4CJ0 B;  5BN3 A;  2V4D A;  1D1K A;  5ISR A;  5EPK A;  2EY1 A;  4RCN A;  3KLS X;  4ULL A;  3GP7 A;  3F2U A;  4WJW A;  3SR1 A;  2TMP A;  1CTM A;  5F2D A;  2L12 A;  2Z8L A;  1GUN A;  3RMH A;  1Y1V B;  1PTO F;  1F9P A;  3EA6 A;  1LTS D;  3NQT A;  1GOZ A;  2F0N A;  1VF7 A;  3OWF A;  2WIN B;  1VMP A;  4TRD A;  1WTP A;  1A2U A;  5JPN C;  5C4Z A;  1EY8 A;  4J6H A;  1ROD A;  5IGE A;  3O13 A;  2K05 A;  3FMC A;  5JVH 3;  5KND A;  4GZY C;  2B2W C;  5K36 H;  1VMC A;  3I70 A;  5EKK A;  1I4X A;  4A3B B;  1PFN A;  5IGB A;  1Q1B A;  1XX8 A;  2DN8 A;  5CBE E;  1G91 A;  1FNW A;  1QE6 A;  2MJ8 A;  1EU3 A;  3OOC A;  4PV1 C;  1DD2 A;  1A3V A;  1U4L A;  2B2U C;  1B44 D;  2EYP A;  2XRQ D;  5JOB A;  2IL8 A;  3BVZ A;  2BDN A;  4FF4 A;  2EZV A;  5C3E B;  2CVR A;  1HXY D;  4DU9 A;  2F0F A;  3C2P A;  2NVX B;  3MXP A;  1QJO A;  3RLF A;  4MN3 A;  5C44 B;  3A7L A;  5FO9 B;  3HEJ A;  1TS3 A;  2OEO A;  1HTP A;  3RUZ A;  3H09 A;  2Q8I B;  3D4R A;  2F3V A;  3IL8 A;  3MXU A;  4K5W A;  5FKA C;  3VR6 A;  2RKS A;  1Z7T A;  2LS0 1;  2PYK A;  2IX0 A;  1KLU D;  4DNR B;  4QCL A;  2F0E A;  2LKV A;  4FP5 D;  5EKL A;  1MD2 D;  3T4A C;  3PUX A;  3G7L A;  4PQX A;  2FJ2 A;  1TS4 A;  3PO3 B;  1CM9 A;  1SE2 A;  5KIX A;  3K6O A;  2O2L D;  3KBX A;  2AWO A;  2NBF A;  2JA5 B;  1SNC A;  4FXD A;  2EYO A;  1ET6 A;  1LT6 D;  3DXJ C;  2FMM A;  5M9O A;  5C0X I;  2EJM A;  1L0X B;  2A69 D;  3T53 B;  4K6D A;  2NVQ B;  4BA2 I;  1GHJ A;  1D5X C;  3AU7 A;  4KY5 A;  2NZ1 D;  4TSS A;  2B8F A;  3GTL B;  3FEW X;  1AZQ A;  5IOC A;  2J4X A;  2PW7 A;  1JWS D;  2JXM B;  2RBM A;  2FIN B;  4P2C B;  2NN6 H;  1J9O A;  4JK1 C;  1LAB A;  5C4J B;  1JWM D;  4KI0 A;  3TP5 A;  2D5D A;  2FMC A;  3MTS A;  3MAQ A;  4IZ8 A;  3M85 A;  1LTR D;  4ZK9 B;  3K5N A;  5G3L D;  1H9S B;  1KLG D;  2EY2 A;  1JB3 A;  3K57 A;  3S2D B;  2EPB A;  1CHP D;  4HMJ A;  3KF8 A;  3VA7 A;  4PMB A;  1MGS A;  1JR0 D;  4J8Q A;  3HRZ C;  1RF2 D;  3VR2 A;  4LJZ C;  1JC7 A;  2WKD A;  3M7N A;  4ILW A;  4CKE A;  1BBX C;  1L0Y B;  2IWH A;  1D2B A;  4ZUJ A;  3I3C A;  1KAA A;  1QOH A;  3MEH A;  2M2L A;  3C3L A;  1O7Z A;  4HSP A;  4I7Z C;  1Y69 U;  4H44 C;  4MIU A;  2LFN A;  2SNS A;  1ENF A;  1T5X D;  5I4D A;  1B53 A;  3R2T A;  2B2Y A;  2EE1 A;  1EQV A;  1Q90 A;  2KQ3 A;  1R4P B;  3P1H A;  3HOZ B;  1A2T A;  4Z9C B;  2PQE A;  3CU7 A;  3DWP A;  4N9T A;  5M3F B;  2BE5 D;  4KKT A;  4HCS A;  1EWH A;  1MI2 A;  1M4V A;  1S5B D;  1FNU A;  1PFM A;  4FNF A;  5EJW A;  2WP8 J;  4A3I B;  1R4Q B;  2F4I A;  2L5T A;  3VR3 A;  2OF1 A;  3WOF A;  2K03 A;  5CMD A;  2EYH A;  1BCP D;  4OO1 G;  2ZXR A;  1PTO H;  3HGB A;  4XQN A;  5I6Y A;  1BOS A;  1CZW A;  3NTK A;  3DEO A;  2A69 C;  1X32 A;  1O7Y A;  1T5E A;  5C3X A;  4B9W A;  1KTK A;  5A2Q L;  1SE4 A;  1PMR A;  4L6T B;  4Q5V A;  3C46 A;  3ONA B;  2F0U A;  1STY A;  3GD7 A;  5DNF A;  1TT2 A;  4X3T A;  2A6H C;  4C3I G;  3H94 A;  2KCN A;  2F0G A;  5I9O A;  4IUN A;  1HFG A;  1I4P A;  3TDQ A;  3A8J E;  4KMU C;  1EY0 A;  2F0H A;  4L8J A;  2DNC A;  2H4O A;  3P7J A;  3V05 A;  4B08 A;  1IHZ A;  3K58 A;  3TBI B;  4ZKC B;  3MXG A;  4IFD J;  4M1U B;  1LLR D;  2BOS A;  2B2T A;  5KEE A;  1Y8O B;  3D4W A;  1EL0 A;  2YU9 B;  5T1I A;  1BXT A;  3NE5 B;  4KD3 A;  3FKI B;  5LL6 X;  4IUR A;  1TS5 A;  3A8I E;  3WOE A;  4CJ1 B;  1CA5 A;  2JEA I;  2RA4 A;  3W2D A;  1HA6 A;  2G9D A;  4XYO A;  2EYF A;  1ZXT A;  1TWG B;  3S14 B;  1SSO A;  3QB3 A;  1I4G A;  1V1P B;  4Q0F A;  3FVQ A;  5IGD A;  3PO2 B;  1C8C A;  5KRU A;  1WTO A;  1OXU A;  1U4P A;  1ENC A;  1FD7 D;  2F0V A;  3S1Q B;  3I73 A;  2SOB A;  2J7Z A;  3OPO A;  1SNP A;  1KDB A;  4FXG C;  3LWE A;  1BQQ T;  2F0O A;  2K28 A;  1B3A A;  2EY5 A;  5KNC A;  1S5E D;  1ESF A;  1SFO B;  2EJG C;  2MGS A;  1KAB A;  1SND A;  4CKC A;  1OXS C;  3PUV A;  2B2V A;  1I50 B;  2BE5 C;  3DHQ A;  3Q22 A;  1LT4 D;  1G6Z A;  4RH6 A;  4K2L A;  1WD0 A;  5E3F A;  1XXG A;  5EKI A;  3I90 A;  2PPB C;  5JEA G;  3TP6 A;  3S9W A;  1VCI A;  1BCP C;  4ME5 A;  4HED A;  5DM6 3;  1SEB D;  4DN4 M;  5CV6 A;  3LX0 A;  4CHT B;  4OHJ A;  4L63 B;  2QCP X;  1I3Q B;  1I4R A;  1EEF D;  2JP1 A;  4KHV A;  1S5F D;  3H3V C;  2L0C A;  2R7Z B;  1KDC A;  4KHZ A;  3DWQ A;  2HDL A;  3BYT B;  5E1F A;  1XTC D;  1PZI D;  1SMY D;  2O4X A;  1IYU A;  3PUW A;  5LL6 S;  1TVX A;  3NBH A;  4RKL A;  4A3M B;  4LK1 C;  4OO1 I;  3Q6S A;  1Q3L A;  2K32 A;  4G7H C;  5FLX E;  3UI2 A;  5I2Y A;  2VB2 X;  4CKB A;  3IAY A;  3MXN A;  1TY0 A;  2CQA A;  1EYD A;  1HPC A;  5FO8 B;  1K83 B;  2QIL A;  4ZUI A;  3RZO B;  1STH A;  2E2J B;  1X3Q A;  2EOT A;  1TR5 A;  4TQU S;  2FFK B;  2M00 A;  3RD4 A;  4HN7 A;  1ONL A;  3A8K E;  4O1N A;  1WTQ A;  3SK4 A;  2WV6 D;  2A6E D;  4BY1 B;  2ID0 A;  3CRL C;  1QB5 D;  2Y0S B;  3GV3 A;  2RDG A;  3ZYY X;  2SDF A;  3S1R B;  2EYJ A;  4OIK A;  1LO5 D;  1ILP A;  1WVL A;  2VUM B;  1RTO A;  1OXX K;  1U9R A;  1QNK A;  3J80 E;  2XWJ B;  4FF1 A;  4RFB A;  3T51 B;  3KBG A;  3KLS A;  1LTG D;  2K33 A;  4KN4 C;  5FOB B;  1ICW A;  1AN8 A;  3R8B A;  5I9P A;  3QJY A;  1SYE A;  3R2I A;  4O42 A;  2KEE A;  2XIW A;  1E2W A;  3D4D A;  3K7A B;  1NCV A;  2YYZ A;  4KY6 A;  1DM0 B;  2F0D A;  1PLF A;  5C4H A;  4C3I B;  2XVS A;  2X69 A;  1QCB D;  3NTH A;  1DOK A;  2D2C C;  2E76 C;  4KK7 A;  3I4N B;  1HUN A;  3BDO A;  5D3I B;  4ZYS A;  4HMI A;  4CBV A;  3H91 A;  3DMU A;  3ERO A;  1YNJ D;  1E2V A;  5C0X H;  1CFM A;  3MHB A;  5COR A;  3C1E A;  3HOU B;  1K8M A;  4LAA A;  5CYU A;  5ELB A;  1B2T A;  4A3D B;  2EJF C;  3VYT A;  4R8N A;  4C3H G;  1GJX A;  1RHP A;  3DUZ A;  4X3S A;  4KJN A;  3GTK B;  1I6H B;  4F7X A;  2B39 A;  4AYB B;  1SMY C;  1IKM A;  2VNU D;  1B9M A;  1AW7 A;  2KVM A;  2A5H A;  2RVL A;  3IFT A;  2BA1 A;  2M9V A;  3KK7 A;  1G29 1;  4K6L A;  3I4L A;  2TSS A;  1B50 A;  3GO5 A;  3KLR A;  1HCZ A;  4H13 C;  1Y8N B;  1EY7 A;  4F8M A;  5EQ0 A;  5T1G A;  1S5D D;  1ZEQ X;  3GTG B;  3HOY B;  1D5M C;  3GV6 A;  2K6A A;  3RZD B;  2I46 A;  1HUM A;  5CBA E;  2R3Z A;  3G6J B;  1CQV A;  1BCP B;  4KD4 A;  1YNN D;  1QWY A;  5HGT A;  2HDM A;  2R6G A;  4IUP A;  2L9H A;  3NWT A;  1SNQ A;  4A3G B;  5FLX L;  2A6E C;  1NAP A;  2A6H D;  3CRK C;  5G3L F;  2BA0 A;  4C1N I;  1K8O A;  2PO4 A;  4XYQ A;  1H9R A;  1SYG A;  5KYL A;  2MHV A;  2JA8 B;  1EU4 A;  5CC4 A;  2NTT A;  4S3S A;  3MFY A;  4G7O C;  5JEA J;  1QG7 A;  4EVO A;  2NYZ D;  2ENB A;  2L4N A;  5CV9 A;  1Y1W B;  1U4R A;  2EY6 A;  4DAY A;  4RA8 A;  5EBC A;  1NR2 A;  1NSN S;  3KUP A;  4OIJ A;  4XT3 B;  1QIL A;  3EQL C;  4RGT A;  5C0X J;  1O78 A;  4A3K B;  4A3F B;  4IFD H;  1PXU A;  3J80 L;  1O80 A;  5IGG A;  3M4O B;  3QIA A;  4DK0 A;  2EYL A;  2XWB B;  1WTV A;  2ZXO A;  1F2L A;  3SK6 A;  4NP5 A;  2C9O A;  2RSO A;  1I4H A;  1WCM B;  4RCO A;  1HQR D;  4WFN 3;  1PFB A;  1TS2 A;  2DY7 A;  1YNJ C;  4TKO B;  1M8A A;  3E6Z X;  2E2D C;  2HCI A;  1G2T A;  1WTR A;  2HQE A;  3OMG A;  1UEA B;  2R61 A;  2D62 A;  2F0T A;  3SE0 A;  1D5Z C;  4G4K A;  1WTX A;  2IJ0 A;  1BCP F;  4A3E B;  4V19 0;  2QEJ C;  4RGO S;  5J22 A;  3VR4 A;  1TY2 A;  3T13 A;  2NUC A;  3BS1 A;  1RTN A;  1MSG A;  2IW3 A;  2KED A;  4HR7 B;  1PZK D;  1A6X A;  2KHS A;  2F0S A;  3QO2 A;  3BG3 A;  3URY A;  3K5O A;  2QKI C;  1ML0 D;  1STE A;  4DNT B;  2AUJ D;  2JA7 B;  2RQX A;  1Q8I A;  3N6R A;  1JOO A;  4K5X A;  3E0J A;  4IUV A;  2JA6 B;  3TZU A;  5K5P A;  3J7A V;  3R93 A;  2KOL A;  2F0J A;  3CQZ B;  3HP3 A;  2K01 A;  3SEB A;  3AB9 A;  1EY4 A;  5D65 A;  2RDF A;  1YNN C;  3LNN A;  3Q0A A;  3BYY B;  1LT5 D;  3SDZ A;  1JQY D;  4I65 A;  1GUT A;  3DWA A;  4YIJ A;  4HCE A;  1DOL A;  5CR3 A;  5IGF A;  1RJT A;  1Q12 A;  3GTQ B;  1IKL A;  1JWU D;  4WRD A;  1F9R A;  5ELD A;  4B9X A;  1H9K A;  2WB1 B;  1BO0 A;  5M5W B;  1H9M A;  1MSH A;  1WD1 A;  1EQT A;  3T16 A;  1S5C D;  4H0L C;  4FYD A;  4RHR A;  2XN9 C;  1SYD A;  2KCC A;  5ELE A;  1BNZ A;  3I4M B;  3HS0 C;  4C3H B;  2IX1 A;  4IUQ A;  1TWH B;  3VYS A;  2NVY B;  2XRS D;  4M8A A;  3L7Z C;  3M3Y B;  1E2Z A;  1F2Y A;  3QG1 A;  2B2W A;  2F0K A;  2OT2 A;  2PZU A;  3OMC A;  1D1I A;  1C48 A;  2PW5 A;  1B1Z A;  5HUR A;  3J7A F;  4QUC A;  1F77 A;  1NR4 A;  5M3M B;  1SNO A;  3J81 E;  4OGQ C;  2F0M A;  1F9Q A;  2QDB A;  1XYI A;  1GUS A;  5JVG 3;  4DAP A;  2WII B;  1AZP A;  4CJ2 C;  2F1M A;  1F2Z A;  3I91 A;  3D6W A;  3OW7 A;  3HG9 A;  5K36 G;  1KNA A;  3Q23 A;  2Z1C A;  2A73 B;  3W3A A;  1JIC A;  1CT1 D;  3MFG A;  5J1Z A;  1RKN A;  3NBI A;  1EY9 A;  2B2Y C;  3TP7 A;  3QOJ A;  4ZRZ A;  1S4Z A;  3JAM E;  1OXV A;  2BCO A;  4IN3 A;  3P75 A;  1X3P A;  1EY6 A;  2D9U A;  1LAC A;  4K8I A;  4C3J G;  3L3O C;  1SNM A;  4PMW A;  1ILQ A;  2DY8 A;  3SVM A;  1ENA A;  3N52 A;  2JEB I;  2EXZ A;  1BR9 A;  2E74 C;  2RSN A;  3R3O A;  1KDA A;  3EFX D;  4ZQ3 A;  1HHV A;  2OXP A;  5FK9 C;  1PRT C;  2IPK D;  1STB A;  3D6C A;  3V96 A;  1KNE A;  1SE3 A;  5C5M A;  5DM7 3;  4HAE A;  4DF7 A;  4FO2 A;  4IUT A;  2PZW A;  1W6K A;  2E2I B;  1V1P A;  1IYV A;  1HTL D;  1Z47 A;  1F2M A;  2WAQ B;  3HZX A;  4ZKB B;  1PDQ A;  1SAP A;  4G57 A;  1DYQ A;  1FR3 A;  2GA4 B;  3QOL A;  1II3 A;  1CZG A;  2PCF B;  1SYB A;  1ZYR D;  3TZD A;  3NHH A;  4Y7N B;  1HRJ A;  2RDH A;  4C1N K;  3K5M A;  1GHK A;  1B9N A;  3IFD A;  2NWG A;  2B2T C;  1EOT A;  1RCV D;  4EQN A;  1F9S A;  4FF3 A;  2PNR C;  2AQ1 B;  4XXE A;  1CQF A;  2EDG A;  2K04 A;  3NK9 A;  1JOQ A;  3PV0 A;  3SK8 A;  3M4Y A;  1PTO D;  1CA6 A;  1FYC A;  4XQJ A;  2NN6 G;  4F88 A;  5C6A A;  1OXT A;  2F0W A;  4V0B A;  1CK1 A;  4ID6 A;  2SNM A;  2K5W A;  3HOV B;  4BBS B;  1GUG A;  3NP8 A;  3S1N B;  1STG A;  1CHQ D;  3K59 A;  2A74 C;  5KYI A;  4RHS A;  4X3U A;  5JEA H;  4NW2 A;  2EYM A;  3D8G A;  4CGY B;  5A35 A;  2WAC A;  3NPP A;  3ITP A;  4E6I A;  4PMC A;  4EQO A;  1IL8 A;  2A68 D;  3MVV A;  3J81 L;  1DOM A;  2MUY A;  3CHB D;  2CW0 D;  3FPP A;  5KGU A;  1E0B A;  4C56 C;  4IFD G;  1ESR A;  1EYC A;  4FVM A;  1GUW A;  4QMG A;  5I2X A;  1Y8P B;  1GXD C;  2B2V C;  4KY7 A;  4FXK C;  3FPU B;  2LMC B;  5NUC A;  3L9A X;  2G9H D;  1SBB B;  2B8G A;  4U68 A;  3NUC A;  2HCC A;  4RGN A;  5COY A;  1W6J A;  4RAU C;  3VA5 A;  1SXT A;  1PYW D;  2KUM A;  2ZXP A;  1SJH D;  4XQQ A;  3A54 A;  5EBD A;  5KNB A;  1EEI D;  2JYO A;  4K2K A;  2AWN A;  4DXF A;  1V1O A;  3JAM L;  2F0P A;  3V2T A;  1A3U A;  3S17 B;  3QWN A;  1TWF B;  3S15 B;  4MHE A;  2B63 B;  5A2Q E;  4C2M B;  3S2H B;  4DAV A;  2Q8T A;  4K5V A;  3WDN A;  5CV4 A;  4KTA A;  4XIG S;  1U4M A;  5JAV A;  1C4Q A;  3PIP 3;  1DON A;  2ZT9 C;  3TP8 A;  2L1B A;  2DNE A;  1VF5 C;  1EIH A;  1DXM A;  2R92 B;  4XTC S;  3SXH A;  2NTS A;  2VB3 X;  4BBR B;  1ZYR C;  2I07 B;  2SEB D;  2Z4H A;  1IW7 D;  1TWA B;  1BUV T;  2F0Q A;  3X3N A;  2HUG A;  2F0I A;  3MWY W;  3TN2 A;  3Q24 A;  4LMQ D;  3BZD B;  3AMU A;  3EVQ A;  1V8Q A;  4A3J B;  1LTT D;  1LTI D;  1PRT B;  3TME A;  2O5J C;  3D3R A;  3VR5 A;  1I6V C;  1JOR A;  1JOK A;  4A93 B;  5BN5 A;  4C3J B;  1BDO A;  3MZ5 A;  3HKZ B;  5LHY 1;  1PTO C;  4IAL A;  3GTP B;  4ODG A;  2X6L A;  2WKC A;  2IT1 A;  3IKJ A;  4WOR A;  4J1M A;  4DK1 A;  3TSS A;  1SYF A;  1UAP A;  4NDX A;  5ELF A;  2C5C A;  4R9W A;  3CKI B;  4ABN A;  3OHX C;  2KA7 A;  1FGB D;  3M7G A;  4EGV A;  5BN4 A;  2EVB A;  3ND9 A;  3GQB A;  5IT9 E;  1OO9 B;  1TKW B;  5D3D A;  5JJZ A;  2A68 C;  5IIF A;  3FDT A;  4KJO A;  2NN6 I;  5IGC A;  1SJE D;  2CW0 C;  1UUP A;  2KEC A;  4K14 A;  4PNY A;  1G2S A;  3BVG A;  3NSW A;  3S16 B;  4UDU C;  1LTA D;  3MC0 B;  1PZJ D;  3D31 A;  3K5L A;  1DCZ A;  3U9O A;  2XNA C;  4BA1 I;  4BWG B;  1I4Q A;  3EJI A;  2PMZ B;  1R9T B;  5C5L A;  2JE6 I;  1HFN A;  1A3T A;  4DA2 A;  1EWC A;  4RWS C;  4NKL A;  1HQM C;  2ICE C;  4IUU A;  4H7B A;  3K0Y A;  4ZAI A;  4U67 3;  1LV9 A;  1SYC A;  1D6E C;  2NVT B;  1A15 A;  5C3W A;  1LT3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...