1S5ED

Cholera holotoxin, crystal form 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera enterotoxin, A chain precursor
publication title Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase,toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, J, K, L, M, N
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s5eD00
1MD2D 1LTID 2G9HD 4DXGA 1TS3A 4BWGB 1UUPA 1PTOB 2NTSA 1SJHD 1RF2D 1EU4A 3BVMA 2RDGA 1S5DD 1FNUA 4RGMA 1L0XB 1AW7A 1BCPC 1JWUD 2RDHA 4RHSA 3MC0B 1TS4A 1SJED 1M4VA 1BCPF 1V1PA 1LLRD 1LTSD 1STEA 1EEFD 3DWPA 5ELDA 1FNVA 1KTKA 3SEBA 1BCPB 1BXTA 3URYA 1DJRD 1FNWA 5ELBA 1HXYD 1UNSA 1G8ZD 1EWCA 1SBBB 1S5CD 3KLSX 1HTLD 1PZJD 1I4PA 1LTAD 4ZYSA 4C56C 2AQ1B 3R8BA 1JWSD 1PRTB 5ELFA 1S5FD 2Z8LA 3TSSA 4Z9CB 1TY2A 2TSSA 3EA6A 2NTTA 1B1ZA 1I4QA 1LT4D 1AN8A 2QILA 1I4RA 1I4XA 3GP7A 1PYWD 2R61A 1HA5A 3EFXD 1ENFA 1FGBD 2XRQD 1SE3A 1EFID 2AQ2B 4UDUC 5I4DA 1S5ED 1FD7D 1PTOH 5FKAC 3BVGA 1SE4A 1CQVA 4RGTA 3R2IA 5D3DA 5ELEA 1PTOD 1EEID 1HQRD 3BVZA 4L63B 1LTTD 4RH6A 3DWQA 3BYTB 1TY0A 1LT6D 1KLGD 2XN9C 2IPKD 1SXTA 2WV6D 1KLUD 1TS2A 1PZID 2J4XA 1JWMD 1CT1D 1JR0D 2IJ0A 1XTCD 2O2LD 3MFGA 4O1NA 1D5XC 1JCKB 1S5BD 1SEBD 1TS5A 5ELCA 2SEBD 3OWEB 1RCVD 1LTGD 1CHPD 4RGOS 1T5XD 1ET9A 1LTRD 3BYYB 1V1PB 1ESFA 1PTOC 1GOZA 1PZKD 1SE2A 5TSSA 1EU3A 2XNAC 3BZDB 1JQYD 1PRTD 5D3IB 1B44D 1LO5D 4TSSA 1PTOF 1I4GA 1D5ZC 1RDPD 4RHRA 1L0YB 3O13A 4RGNA 3V05A 3W2DA 1F77A 4K6LA 1V1OA 1LT5D 1ET6A 1RD9D 1CHQD 3CHBD 2CHBD 1BCPD 4RFBA 1D6EC 1D5MC 1CK1A 2QEJC 1LT3D 2XRSD 1I4HA 4L6TB 3R2TA 4OHJA 2ICIA 3DWAA 4RCOA 5FK9C 1LTBD 1PRTC 1QILA 2AQ3B 4DXFA 1XXGA 1DYQA 1PRTF
chains in the Genus database with same CATH superfamily
1UEAB 2F1MA 1TWHH 2Y0SG 4E6IA 5EJWA 1EQRA 4A3MH 2PI2A 3K81C 4B3SL 4C2MB 2UUBQ 2R92G 2E76C 2WKDA 3I55A 2A6HC 3FHWA 4XIGS 1FNWA 3URYA 4RCNA 4DV6L 4B3MQ 3VR5A 3GO5A 3OIQA 2XIWA 1F9QA 1YHAA 2C9OA 1IBKL 3A0JA 5CR3A 1CM9A 4JI4L 1KHIA 1V43A 4LUZA 1P16A 3H91A 3HP3A 2E2HH 1IW7D 1HH2P 1Z47A 4IFDI 5FLXL 3D6CA 2YV5A 2BDNA 2R3ZA 3KUPA 3MAQA 5BR8Q 3GV6A 3TZDA 4GNXA 1Y1WG 2XRQD 1XWEA 2IX0A 4CHTB 2Z6KA 3PO3G 2NVYB 5DM63 5D3DA 2P5ZX 5ELEA 2BA0A 3M85A 1Q8KA 1HQRD 2D5DA 3PF5A 1C9OA 1KDCA 3EJIA 1N33Q 1QOHA 5IP9H 1B3QA 1E2ZA 2RDFA 2HT1A 1XMOQ 4ABNA 1W3SA 3M4QA 4X3TA 4GLXA 3ULLA 2OTJA 3GTGB 1Y1VG 2F0KA 3SK5A 1UE1A 5IT9c 1CA5A 3PGZA 5IE8A 4NPSA 2IHFA 5M3FG 3BU2A 4N9TA 4GZYC 3BYYB 1GM5A 1KDAA 4CKBA 1NR4A 3HOXB 1SE2A 2H1EA 4IJLA 2TMPA 4DV4Q 1PTOF 3MXUA 4UP9A 1EOVA 3KBXA 3OYYA 3KK7A 2VXWA 2Z9HA 3OTOQ 3TZUA 1DXMA 3VA5A 4LF6L 4A3BH 4LJZC 4UPAA 1HNZL 3DM1A 1Q46A 2F4VL 4RCOA 3T53B 2MNAA 4JV5Q 1TWCB 1PRTC 5JPMC 2QKIC 3NSWA 1BUVT 1X3QA 1DYQA 3TMEA 2PQAB 1A8VA 3GTKH 2GN5A 1H9JA 2G9HD 1KD1C 4YWMA 4BWGB 4DV2Q 3HOYB 2E74C 4DR7L 1S5DD 1XPOA 2J0TD 2ZT9C 3W3AA 3U50C 1QVGA 1QWYA 5KNBA 2K03A 4B3SQ 1WTOA 2XTIA 2CWAA 1CA6A 2R93H 3J7AF 2EXDA 3HOVH 3FKIG 5IGDA 2DJFC 5CV6A 4EQOA 1S5CD 2ZM6L 5IWAQ 1YJNA 3E6ZX 2KBNA 1WOCA 2Q8IB 2AQ1B 1I50B 4XYQA 1JWSD 4M1UB 3GV3A 1KC8C 1OXVA 1VF7A 5FLXc 2Z8LA 1B2TA 4BY1H 4LF5Q 4BBSH 3AU7A 1AN8A 2AMCB 2QILA 3F2UA 3EFXD 2F3VA 3TREA 5I4DA 2XGTA 5L37A 3RN2A 3OIPA 2HHHL 2WB1G 5C3EG 2B63G 2VQFL 1CQVA 3PO3B 1PH9A 4HCSA 2VW9A 3BVZA 5ELOA 2EXZA 4XQJA 4KKSA 3J80c 2NBFA 1EL0A 4C2MH 1SMXA 4KHZA 3M4PA 3FPUB 5EKLA 4JBMA 3Q0AA 2IJ0A 1BDOA 1ZEQX 3OHXC 4KY6A 1S5BD 4LF8L 1Y1VB 1CKOA 2HIXA 3I4OA 2NZOA 2ALYB 4YWLA 1WD1A 1KXLA 5M3FB 4QGUA 1EU3A 3X3MA 2OWOA 1L2FA 3S1QB 2F0QA 2KUMA 1WTVA 3G7LA 4N8X1 2B8GA 1R9TH 1Z9FA 2K5HA 2A74C 1I5FA 1D1IA 3PUYA 4R1JA 4UHVA 1KAWA 1E2WA 5LMNW 5JJLA 1BCPD 3SGIA 2EJMA 5KGUA 1BNZA 2NVYH 4LMQD 5E3FA 4U68A 2MGSA 3R2TA 1HNZQ 4OO1I 1NSNS 4DNIA 2ICIA 3UI2A 5FK9C 4K0KQ 2AQ3B 2K6AA 5C3WA 1C4QA 1WCMB 2MO0A 2UUCL 1VQLA 1CZWA 3PUXA 4DV0L 4LK1C 3RD4A 4J1MA 3GTGH 1S72A 3HOZB 2Z1CA 3NQTA 1EOTA 3Q8DA 5C4XB 3GTOH 3S2HB 3NP8A 4CGYB 4CJ2C 3I2ZA 1LLRD 3HOXH 3VYTA 4XT1B 1EEFD 1GO3E 2E2DC 1EQQA 1E24A 1GXDC 2X6GA 3NTKA 5IYCG 2IX1A 1ILQA 2RF4A 4B3TL 3I70A 4JOIC 3FKIB 1SYDA 2K14A 4YWKA 2ZTEA 1UE6A 1PYBA 3S16H 4ULLA 3UE0A 3J7A5 2L5TA 2EY1A 4A3KG 2Q2HA 3KLWA 1ZYRD 3STBD 1EYAA 1VQ6A 1HUNA 2D62A 5CGKA 1O7ZA 1SN8A 1TWCH 1TXYA 4XQQA 2F3WA 3D0FA 4CJ1B 1H9RA 2EYFA 1R4PB 3F2CA 4LWCA 3IKJA 2UUAQ 3H3VI 3HOYH 4IUQA 3J81E 3PIOA 4DNTB 2VQFQ 1WVLA 2EJFC 4CDFC 4X6AH 5GAHC 3EN2A 4RH6A 4HJ5A 1PV4A 1SNOA 1K83B 1A2TA 1KLGD 5IYBG 3HGBA 2IPKD 3IFTA 1B7YB 2K33A 4L5TA 1IKLA 2YU9B 1HA6A 2Z6BA 4A93H 5BN3A 1STBA 4LAAA 1YBYA 2L1BA 1EUJA 2XSCA 3CRLC 1WTHA 3DEOA 4F7XA 3SR1A 4O0AA 3S24A 4LF8Q 2C35B 2PI2E 3GTMB 2UU9L 4DV5L 3UDFA 5IGEA 1BBXC 1EY5A 4U673 1PZKD 1N34L 4NKLA 2PMZE 2E2JB 1TVXA 1NCVA 1LO5D 5CV7A 4CDCC 4RHRA 3G6JB 5M5XB 3LWUA 3K80C 5CORA 2MPMA 1D7QA 5IODA 3K5OA 5C6AA 1U4PA 2EVBA 4KN7C 1IBLL 3CHBD 2PW7A 2RKSA 4DR4L 4KJNA 4A3MG 4S3SA 1VQPA 1NY4A 2HQEA 4X64L 4QJFA 3S1NB 2NVTB 3UDIA 5CC4A 3MXNA 4AIMA 3HRZC 1J5EQ 2BOSA 4MNOA 2UUCQ 2NVXH 3TN2A 2K1BA 2B2TA 4RG1A 1QUQB 1EU4A 4DR1L 4KKUA 2NUCA 1AW7A 1UEBA 3F2BA 4IZ8A 3I73A 3HFZB 4PMWA 5GQOA 1SSOA 3DWPA 4PZ6A 1KTKA 4A75A 4JI7L 3S1QH 2B2WA 1VQJA 1HFGA 1W6KA 1X56A 2F0UA 4J15A 1QVCA 3NXWA 4B3TQ 1EWCA 1PYSB 5DEHA 3PQIA 5LL6S 1VQ4A 4Y7NH 1MKHA 3FPPA 2ENBA 3GD7A 3R8BA 1VQ9A 1JJGA 2OF1A 1VQ8A 1RHPA 4L8JA 3HOUG 1IKMA 3RZOB 4H13C 2A6EC 2F0OA 1LT4D 3RZDB 3A74A 5C5MA 2WAQB 1YZ6A 3R93A 1WCMH 4ZUIA 4KY5A 3JAMi 2G5DA 3HOZH 4DKAC 2UXDQ 1EY4A 5F2DA 1CKMA 4RGTA 4WJ3M 4C3JB 3K5LA 1CSPA 3CD6A 5C4XH 4P73A 3S2HH 1TY0A 3TP7A 3H3VC 4HTHA 2F0HA 4R4TA 2L11A 1D1KA 3I8ZA 4JBWA 2EE1A 1J8IA 4I65A 1STNA 4EQ5A 1ENCA 2NZHA 5IGBA 1O78A 3AB9A 4O1NA 1SYCA 4LUVA 4QUCA 2HDLA 3FKIH 5C0XH 4A3LG 3HKZE 4R9WA 3KF6B 5DAUA 2UU9Q 4DV5Q 1NJIC 2RCNA 1X3FA 2R7DA 2XWBB 4DUYL 3ICEA 2FMMA 4HMJA 1D5ZC 1L0YB 2SNMA 4NB3A 4C1NI 1UE7A 2QEXA 1HR0W 1SYGA 2E8GA 1E3PA 4ODGA 4DR6L 5BN4A 4DR4Q 3HEJA 2HCCA 3VR2A 1EZ8A 4LFBL 4GS3A 4OIJA 3NHHA 4IJHA 2B3GA 4A3MB 2XRSD 2YTYA 4LF7Q 4L6TB 1PMRA 4JG2A 1K83H 2R93G 4XT3B 5GROA 1SYBA 4OL7A 2YU9H 1TWAH 1II3A 5I6YA 1K9MC 2JA6G 5HGQA 4GOPC 3SK4A 4DR5L 3E3XA 2A68C 1FNUA 1A3TA 3GTMH 4GLVB 3ITPA 4C1NK 3I90A 2QF7A 1XYIA 1Y8NB 2N3SA 1T9HA 1MBYA 1CFMA 4X3SA 1STEA 4JI7Q 1JICA 3FVQA 4BBSG 3LNNA 5COYA 4UP7A 5CV4A 3M7NA 1VQBA 5M5XH 4PQXA 2K01A 3GQBA 1WD0A 4CJ0B 4A3DB 1EY6A 1YNND 1LTAD 4C3IG 4X62L 1O7IA 2A19A 2AWOA 3MTSA 4G7HC 1PRTB 4A76A 3HOUB 1CUKA 1O7LA 2PO4A 3EA6A 3M9BA 1HHVA 2OXPA 3S1NH 2EYLA 1JJCB 1I4XA 2UUBL 1KRTA 4IALA 4IN3A 1BR9A 2NN6G 2QDBA 1N36L 1SNQA 3K7AH 4DFAA 1SE4A 1YNJD 1LABA 3CU7A 1N32Q 3SK6A 3BDCA 4A3EB 1PTOD 3KBGA 3BYTB 1BBWA 2K04A 3AQQA 3RLOA 4R4IA 1JWMD 1U4LA 1TR5A 5IYCH 1A15A 1LV9A 3T13A 1AH9A 1Y8OB 5EAYA 2RHQB 1LTGD 1YJ9A 3M7GA 3AYHB 3KJOA 3M3YB 4GN4B 2OQKA 2LKVA 4FDBA 4DUYQ 3RZOH 2BE5D 4XXEA 1K28A 4DU9A 2AKWB 3RZDH 1N33L 2X6LA 3VYUA 3CMAA 1H9SB 1NMGA 3TS2A 1QCBD 1EQVA 3TEHB 4LFBQ 3D8GA 3ER0A 5FOBB 4B3RQ 1STAA 2VL6A 4C3JH 1H9MA 3VYSA 2JSOA 3HZXA 4R4QA 5DNFA 2NYZD 1PH4A 5HY6A 3QO2A 1NTGA 1QILA 1A6XA 5IYBH 2EYHA 2R93B 4OXPA 1MD2D 2HDMA 2RSNA 2JA6B 4K2LA 1LYLA 1MIUA 4DR5Q 1Q3LA 3Q6SA 3QR8A 1RF2D 2JA5H 1E22A 4DAPA 4A3IG 2RDHA 4QB4A 3NENA 2CFMA 1H95A 1O80A 3J81L 2ES2A 4ME5A 1GUOA 1BCPB 2KHJA 1DJRD 1E2VA 2BH8A 5LL6X 4JV5L 1SBBB 2RSOA 3MVVA 5C5LA 2O4XA 1CTMA 4TQUS 4I7ZC 1YITA 1YNXA 2BA1A 3VA7A 1PH1A 3HOYG 3S14B 1GHKA 5DLQE 1KAAA 1LACA 3LWEA 4C3IB 1JB3A 1X65A 4DV2L 5JJIA 3D4DA 2JQOA 1OO9B 3QOLA 3M4YA 1Y14B 1PYWD 4A93G 2DJGC 2PQAA 4QL5A 2A69D 1K8GA 4LFAL 4J8QA 1N36Q 1QG7A 4IUUA 5IGCA 3A5UA 5IWAL 2UXCL 5ISRA 1PA6A 2JA8B 4Y52H 1ZXTA 4JI0Q 4V0BA 3CPWA 1IW7C 5HURA 1PLFA 3I72A 4DAYB 4LF5L 3MFGA 1R9TB 4WJ4A 1TS5A 4X3UA 4A3DH 2KCTA 1TWFH 3C46A 2VUMG 3OWEB 1RCVD 4A3CG 1UAPA 5T1GA 2JA9A 2Z4IA 4JYAL 1XNQQ 1HR0L 2F0JA 2ZJQA 3HOUH 2A73B 5HGTA 2VZAA 2PZTA 3PO2G 4YHHL 5KYIA 1IHZA 2MJ8A 4QCLA 3L7ZC 3MXGA 1HJPA 4ZKBB 3PUZA 4IUPA 3J80L 1EIHA 2QEJC 4A3EH 4FXKC 2JE6I 2FFKB 1DOLA 2FJ2A 3GTOB 2K52A 3SVMA 1LTBD 3CPFA 2VQEL 2B2UC 1JJ2A 4K14A 1RJTA 3J81c 4ZAIA 1AE3A 4OEMB 1MSGA 4HIMA 1L0XB 2L15A 3L0OA 1DOMA 1AZPA 4A3LH 3CC7A 3CAMA 1V8QA 3S16B 4QIWE 4A3IB 1TS4A 3M3YH 2B2WC 2LY7A 3PCOB 4IFDH 4HJ7A 4K0KL 2FINB 1WCMG 1GUGA 3KLSX 1EY7A 4JI3Q 3JC66 3HOZG 1NBWA 3CMEA 3D31A 2NVQH 5ELFA 4R8NA 1A0IA 3U4ZA 5C4XG 3TSSA 1R4QB 1YI2A 2HD3A 2N49A 4OGQC 2LXJA 4P71A 2EY2A 5J22A 1PFBA 1GUSA 4JI8Q 5J39A 5EGTA 4A93B 2AHOB 4LFAQ 1SE3A 3K58A 2JA6H 3P75A 2PMZB 5C0XG 4X62Q 2L55A 2KECA 2KQ3A 2UXCQ 4P2CB 2JN4A 2KENA 2O5JC 4DA2A 1SXTA 4NXML 2J4XA 2QGQA 2O2LD 3T1YQ 3NBHB 1PXUA 3QIAA 1XMQL 5J1ZA 4RGOS 1Z7TA 1KNAA 4QF4A 2VUMB 3RR5A 3S14H 2EOTA 4JYAQ 4C3IH 2KCMA 2UUAL 1HR0Q 2FHTA 3BZDB 4IPHA 5D3IB 3C1EA 3K0YA 4YHHQ 1EZ6A 1A3UA 3I4MG 2ATWA 3PO2B 3H0GB 2F52A 2EIFA 1NR2A 4XQNA 2B2YA 2NVXB 3QB3A 2I5LX 4FP5D 2NN6H 1XPRA 1HFNA 1E0BA 1LT3D 5A2QE 1IXRA 4FF4A 4ZK9B 2JA8H 3CCMA 1U4RA 1G91A 2ZTDA 2VQEQ 4K5WA 4DN4M 2Q8TA 4WORA 2N8NA 4ZKCB 3NE5B 3DM3A 1PH8A 4Y7NB 3S2DB 1BCPC 1KIXA 2VY3A 1HZ9A 3CP0A 3ND8A 1TWGB 3LX0A 1N9WA 1M4VA 4ZRZA 4FVMA 2ZXPA 2F0MA 1BOSA 4LF4Q 1J5EL 1JC7A 3MHBA 3Q22A 1RODA 4HMIA 3S9WA 5JPNC 4IOAA 2WFWA 3J7ZC 1VQNA 4WFN3 2TSSA 1F2MA 1L1OC 4GN3B 3SK8A 4GOPB 1Q90A 3GP7A 2K32A 1GKHA 3KF8B 2LFNA 4O2DA 4P72A 1IZ6A 1CQFA 3G71A 1F2LA 3SHLA 1HUMA 5ELNA 1FD7D 1MJEA 1NNXA 3A7LA 2CH4A 1WI5A 1QUQA 4CKCA 4L63B 4FO2A 1IBMQ 1VS0A 2Z4HA 3QG1A 1SROA 3STBC 1ZYRC 2XN9C 4BBRH 4A3IH 2ID0A 5K5PA 4L5SA 4NXMQ 4POGA 1TS2A 1K73C 1N8RC 3HKSA 1EIGA 2WAQG 1SNMA 5IP7H 2RBMA 3NUCA 3JAME 3PSIA 4HIDA 1XMQQ 1ET9A 1LTRD 1U9RA 2B39A 2UXDL 3K7UC 4C3JG 4KN4C 2SOBA 4OWXB 2F0GA 1W2BA 4OO1H 2K50A 4YCVA 4PNYA 1CI3M 1ICWA 2EQSA 1F9PA 3T16A 4HJ8A 3I4MB 1JT8A 3NELA 4F8MA 2JYOA 1TWAB 2AUKA 4YCWA 4FF1A 4AQYL 3CCUA 3T56B 2JA5G 4GKKQ 1WJJA 2IX3A 5H1SE 3FRPB 3LGJA 3DHQA 4AYBG 5BN5A 4F87A 1J9OA 3PIP3 3L2PA 3ERQA 4JI6L 4JCVE 4HEDA 1PRTF 1KABA 1JB7A 3A7AB 5CBEE 4BY7G 3NTHA 5C0XJ 4PMCA 4TKOB 1UUPA 2YYZA 1WTPA 4A3GB 4HSPA 5C4JH 4DF7A 1B50A 5D65A 2ASBA 1HPCA 2Y0SE 2K4KA 1JWUD 1VQFA 3KF6A 4R8IA 5EBCA 1PH6A 2VUMH 4MZ9A 4A3CH 1UE5A 1LTSD 4KY7A 4PZ8A 4POFA 4DV7L 4LF7L 3U9SA 2D0PA 3PO2H 3QOJA 2EY6A 3H0GH 3MXPA 2JEBI 2ZTCA 3G48A 4P75A 4C56C 1KDBA 3H3VH 3H6MA 1XNRQ 4UAIA 1EIFA 3K7AB 3E5SA 1B4OA 5I2XA 4RAUC 4BA2I 4LFCQ 2HIVA 1ICFB 2Q8RE 1F2ZA 2EYOA 5JVG3 3AMUA 1MHWC 3KLSA 5KNCA 1I6HB 3R3OA 1QB5D 1QE6A 3P20A 2Q2UA 5M3MH 4A3DG 1ONLA 4BXXG 1RIPA 1SMYD 5FKAC 1WFQA 3UDXA 1JORA 1SNPA 1A2UA 1E1OA 2KEEA 3ULJA 3S2DH 4F88A 3CCLA 1TWGH 4IQZA 2K5WA 3T4AC 3UE1A 3ZYYX 2F0EA 3U58A 1LTLA 5JOBA 3G4SA 3TP6A 3W5OA 4JK1C 4I7AA 2PCFB 4GNXC 3I7FA 1KL9A 1K0SA 2Z6KC 1WTQA 3CCEA 1GOZA 1VCIA 4A3EG 1B44D 1N32L 3D4RA 1K8OA 3RNUA 4K6LA 1STYA 1LT5D 3CXCA 2M9VA 3G6EA 2K05A 4X66Q 5EKKA 3K6OA 2J7ZA 1G6PA 1EY9A 2JK8A 2CKZB 4AQYQ 4KLKA 2F0FA 5E4XA 4WJWA 1Q7YC 1B3AA 2JA5B 4BS9A 1ILPA 2R6GA 2QA4A 2BDOA 3J81i 4AYBB 1FJGL 2C5CA 3I91A 1XXGA 4JI6Q 3X3NA 4IFDG 1B53A 2K5VA 5KYLA 3AFPA 5LMNL 4B08A 4BY7B 3MEHA 3IAYA 4HJAA 2HUGA 3PV0A 4R4CA 1ML0D 4DK1A 3NK9A 4C3HH 2G9DA 3A8KE 5ELDA 1EWHA 2MQHA 4LF9L 4B3RL 4DV7Q 5ELBA 2SDFA 3PIPA 5C44H 1UNSA 2ZJPA 1G8ZD 3KDFB 1EYCA 3I4MH 1OXXK 1G51A 1PZJD 1I4PA 1YEZA 1V9PA 1H9SA 2E75C 2HQLA 4RKLA 2K5NA 3E0JA 2OT2A 1JE5A 4HIOA 3Q23A 1C0AA 4LUOA 1B1ZA 1IYJB 3L3OC 3DLLA 1GUTA 3E9HA 1XX8A 3FP9A 4DK6C 3CKIB 1K3BC 1VQMA 4OWWB 1SYFA 1B9NA 5GAGC 5JJZA 2MO1A 3Q24A 1M1KC 3TRZA 1YNNC 2N88A 4A3GH 1CKNB 1TWFB 1EEID 2EDGA 2WB1E 5FLMG 2GVAA 1KRSA 4A3FH 1GJXA 2WIIB 5A2QL 1Q86C 1FVIA 5KIXA 2MUYA 2ZJRA 3W1GA 3CRKC 3VR3A 3WDNA 2MFIA 1YNJC 3J80i 1PTOC 5TSSA 4APVA 2JA8G 2Q2IA 1X3PA 4KTAA 2B8FA 3A8JE 5IGGA 4JI0L 3A5ZB 4DK3C 1I6HH 1VQCA 1PFMA 1QNUA 4MN3A 1HNXL 2JA7H 1D6EC 2V1CC 3TBIB 3C3LA 5G3LF 2F0PA 2PW5A 2PQEA 1XNQL 1VQAA 2BE5C 3BG3A 1FJGQ 4JOIA 1DZ1A 4KHVA 1NUCA 3MZ5A 5C3XA 1EY8A 4K8IA 4YY3L 4CKEA 2L12A 2A8VA 4DXGA 4DAYA 5LMNQ 3K59A 4PZ7A 2I46A 4DK0A 1W6JA 3WOFA 1X6OA 5C4HA 3MC0B 2Q2TA 4DR2Q 4P74A 3PMFA 1SJED 4CDDC 2NVQB 2KA7A 3SEBA 1Q12A 1MSHA 2QCPX 1CZGA 4LF9Q 1STGA 2I5HA 1FGUA 2R7FA 2DNCA 4MHEA 3HG9A 3VYRA 3D6WA 2LXKA 1QZGA 1GVPA 1L0WA 2H4OA 3OWFA 2CW0D 3P7JA 2I07B 2NTTA 4BBRG 1PH7A 2YTVA 2WAQE 1ASZA 4K2KA 4B9XA 2M2LA 1O7YA 4KI0A 1EFWA 2E5LL 3SDZA 4KHPQ 5IP7G 3TP5A 1S5ED 4R4OA 1MJCA 4BY7H 4IOCA 4JI3L 4K8JA 3H94A 5CMDA 2GVBA 1G2TA 4IFDJ 4OO1G 4K5XA 4H44C 5FJ8G 3HS0C 1SAPA 4DV1Q 3VR4A 1ASYA 4XYOA 4JBJA 3GTPB 1M8AA 1PH3A 1JCKB 1TT2A 2A69C 1VQKA 3WOEA 3A54A 4JI8L 1CHPD 1L1OB 1T5XD 1PFNA 1V1PB 1HNWL 2DUDA 5T1IA 1IYVA 2PZWA 4BA1I 1X54A 3O13A 2CH4W 1V1OA 1PFSA 2FXQA 3D4WA 4NP5A 5GAEC 3PUWA 1VQEA 1HNXQ 3T1YL 5NUCA 1ZKOA 1EQTA 4BXXH 1AFPA 1F2YA 1STHA 5EQ0A 2WP8J 2F0TA 2A6HD 4K6DA 2RHSB 4GN5A 1C7YA 4YY3Q 3OW7A 2B2VA 2E2IB 3H0GG 3NBHA 5IYDH 4JI1L 2K7VA 1QJOA 3KJPA 4RGMA 4RHSA 1PHJA 1EY0A 3MFYA 1RKNA 4LW1A 2JJQA 1Q1EA 3S1RH 1BXTA 3T51B 1HTPA 3CF5A 2JP1A 2DNEA 3HOWH 3JAMc 2V4DA 4ZYSA 5M3MG 4A3JB 4ALPA 2QDLA 1S5FD 4GKJL 2B2TC 4OONA 4ID6A 1I3QH 4IUVA 2XVSA 3A8IE 1I4QA 1K8MA 3ND9A 2QW7A 2K5DA 1EYGA 4BBRB 2D2CC 2PNRC 4HSVA 1PDQA 3F2DA 2IW3A 1JMCA 2BH2A 2E5LQ 1EFID 2AQ2B 1ESRA 4N9PA 1C8CA 2F03A 1G291 4LF4L 3M4OB 4FNFA 1OXSC 2JXMB 1LM0A 2IHEA 1LT6D 1EYDA 1TQOA 1XTDA 4KD4A 3PF4A 1HQMC 2F3IA 3A55A 2M00A 3NQIA 4NMZA 4IUNA 2VNUD 3HKZG 4ILWA 3J7AV 4DGZA 3DMUA 4RA8A 3N52A 3K5NA 2I0QA 4IUTA 5ELCA 5J3BA 1HZCA 2SEBD 2KHSA 2WINB 3ONAB 1JOQA 5M5WB 1HNWQ 2L0CA 2XNAC 1PRTD 1IBML 5FO9B 4RGNA 1S40A 4RMFA 2NN6I 4GOPA 2Y0SB 3KYHC 5EBDA 1ET6A 3KF8A 3SXHA 2KCNA 3K5MA 1F9RA 3U4VA 3BZCA 1X3EA 2CHBD 2ZXRA 5JAVA 2R92B 1CK1A 2NWGA 3DUZA 1I4HA 5C4JB 2CCZA 4DV6Q 4G4KA 3GTLB 1VQGA 4OHJA 4EQNA 4DAVA 2R7ZG 3DWAA 3EVQA 4C3HG 4NW2A 1KQSA 1IBKQ 5FLMH 4DXFA 1Q82C 3PIO3 1FYCA 1DD2A 4GNXB 2K28A 1D8LA 1XJVA 5C44G 4JI4Q 3GTPH 5K36H 1SJHD 4JI1Q 4HJ9A 1IYUA 3OPOA 4KJOA 5M5YB 4DR3L 4UY8C 1NMFA 1TKWB 3TQYA 1SFOB 4GKKL 4OELB 5CV9A 2N55A 2F0IA 4J6HA 2D0OA 1AZQA 1V1QA 4X65L 1Y1WB 3I4NG 2VB3X 4MIUA 1WTXA 3FMCA 3IFDA 1BO0A 4EVOA 1B8AA 2RA4A 4A3GG 4UP8A 5M3MB 3RN5A 4GKJQ 3W1BA 3C2PA 2UXBL 3A56A 4A3FG 1JOKA 3BDLA 1KNEA 1HA5A 1ENFA 1VQIA 4EQPA 1NAPA 4UDUC 2KJXA 2E2IH 2A1AA 4JC0A 1G6ZA 1Y69U 2L9HA 3R2IA 1GUWA 4HIKA 3SE0A 3WWVA 3H15A 1MGSA 4PV1C 1I94L 1XNRL 3OMGA 5IIFA 5AFWA 4K5VA 1PZID 4QUFA 4LFCL 1CT1D 1XTCD 2IT1A 3NEMA 4LF6Q 3HKZB 4DUZL 3I3CA 2F0WA 3RMHA 2F4VQ 3S1MB 4L5RC 1VDZA 2JA7G 4A3JH 2MP1A 2IL8A 4TSSA 4FXGC 3PUVA 3W2DA 1CSQA 2A5HA 3NPPA 4DR7Q 2PNHA 2EY5A 4FYDA 1OXTA 4HAEA 5CV5A 4JBKA 1A3VA 4RFBA 2D9UA 1D5MC 3M4OH 3MA2B 3QWNA 1XPUA 1I6VC 5JVH3 1BBUA 2KEDA 5EPJA 2ZM6Q 4TRDA 1BQQT 2R7ZB 4C3HB 1H9KA 3RUZA 1WTWA 5A35A 5FJ8H 1SLJA 5IT9E 1PTOB 3E0EA 5C44B 2Z0SA 2RCFA 2NZ1D 3OOCA 4X66L 2ICEC 2PZUA 5GADC 4DR3Q 4PG3A 5E1FA 2ZXOA 3D3RA 4JI2L 1A63A 5M5WH 5JEAG 2CQAA 4ZUJA 1K3RA 4OWTB 3U9OA 1QZHA 4B9WA 3B6YA 1SDFA 4X65Q 2HHHQ 4G7ZC 2F0SA 1SNDA 3C1FA 2WB1B 5C3EB 3I4NB 4H0LC 2B63B 4KKTA 4JW0A 1SRUA 1VMCA 1U4MA 4CBVA 3BJUA 3I4LA 2PPBC 2R92H 2AUJD 1TY2A 3IRBA 3GTLH 2UXBQ 2AWNA 5FO7B 3RLNA 3EBEA 4GLAC 1I4RA 4DNRB 4A3FB 1DM0B 3DXJC 3GTQB 2R61A 2XWJB 4RKBA 1VQHA 1GHJA 1HCZA 1I50H 2FMCA 2EJGC 3H09A 1YHQA 4XDXA 3BVGA 2H5XA 3CCVA 4HR7B 4KD3A 2KVMA 1LTTD 5KRUA 4Q5VA 5M5YH 1LUZA 3S17B 2WV6D 1I94Q 1YVCA 3EQLC 1SFOH 1S3OA 1Y1WH 4PMBA 1J6QA 3KDFA 3QJYA 2PYKA 3PO3H 5KNDA 4DUZQ 5G3LD 4V190 1DCZA 1Q81C 1AP0A 4JVZA 1SMYC 2VS1A 4ZQ3A 4ZLTF 1TIID 4MTKA 3DEPA 5FLXE 2JA7B 4AH6A 3T1HL 1HZAA 3OSOA 2B2UA 1X9NA 4DV0Q 2SNSA 1I4GA 4OX9L 1RDPD 1EIYB 3E9IA 4QY7A 1Y1VH 2LSSA 5E4WC 5C0XI 5KEEA 4EGVA 1ENAA 1E1TA 2KHIA 5M3FH 5IYDG 3CC4A 1CKNA 4ME3A 3TP8A 3J80E 1SYEA 2L4NA 3L9AX 3NWTA 2EZVA 5LMUL 2B2VC 1FR3A 5I9OA 1VQOA 2IY5B 1G2SA 5EPKA 1UWVA 5EPLA 3HOWG 1BF4A 3EROA 5AJ3L 2LS01 4A3KB 3NBIA 1X3GA 4RWSC 2I5MX 2LMCB 3ULPA 1M90C 3S1MH 5IP9G 3RLFA 2A6ED 4FF3A 4JI2Q 1BCPF 3FDTA 4DAMA 3CCRA 1WYDA 1OXUA 3BDOA 2F0LA 1HZBA 1HXYD 4G7OC 3ZJYC 3GTJB 1HTLD 3CQZB 4G57A 1PH5A 1Q1BA 1PVOA 2DY7A 4FXDA 1VQ7A 4L5QA 1QNKA 2KOLA 2VB2X 4NDXA 5JJKA 3CCSA 4Z9CB 1Z6HA 3FEWX 4KMUC 4CDEC 3KFUA 5I2YA 4NXNL 1VQ5A 4DR2L 3OMCA 2R7ZH 2EYJA 2OCEA 2HCIA 4WRDA 5IGFA 4A3BG 3K57A 1PTOH 3NTIA 1N34Q 1X32A 3VR6A 1DGSA 3K0XA 3MXNB 2DY8A 3UDGA 4DV3L 3S15B 1A62A 1SE8A 1U0LA 5FO8B 1IBLQ 1BKBA 1JR0D 4DPGA 1TWHB 1D5XC 2O5IC 4HN7A 4X64Q 3VDYA 5C3EH 1IL2A 3I4NH 4XTCS 5EKIA 2OEOA 4EX5A 2B63H 2N78A 2JEAI 2EYMA 3CC2A 5JEAJ 4KHPL 3HOVG 3T1HQ 4M8AA 4OX9Q 3ERSX 3V05A 3J7YW 4JI5L 1F77A 1S4ZA 1RTOA 2BCOA 1C48A 3GTQH 4DR1Q 1QVFA 2OQ0A 4QQBX 1RD9D 1CHQD 5IY0A 1TU2B 2F0VA 4N8FA 2A68D 4DV1L 1B70B 5K36G 1Y8PB 4KK7A 4A4IA 3MWYW 1YIJA 2E2JH 4BY1G 5C4ZA 2E2HB 1VQDA 3NWSA 3S17H 1JOOA 2WKCA 2KCCA 2K75A 3F1ZA 3S1RB 5LMUQ 5I6WA 1LTID 1VMPA 3F8TA 1VF5C 1TS3A 4Q0FA 3V2TA 3CCJA 2NTSA 1F9SA 3BVMA 5AJ3Q 2RDGA 1IL8A 3HOWB 2B2YC 5LHY1 4ZCKA 4QIWB 2NVTH 2CQOA 1L1OA 3V96A 1P8LA 5D14A 2EPBA 1V1PA 1YJWA 1FNVA 3N6RA 3GDEA 3BS1A 4IO9A 3AFQA 1I3QB 4B3ML 1E7ZA 4HCEA 1JE4A 1T5EA 3OW2A 1DONA 1FL0A 2YTXA 2GA4B 1NE3A 4YIJA 1GUNA 4IPDA 5M9OA 2CVRA 4H7BA 1GD7A 1HRJA 5CBAE 4IPGA 3CW2C 3J81j 1SNCA 3KLRA 4NXNQ 5E7NA 1BVSA 2WACA 2MHVA 2F0DA 4IPCA 5CV8A 4QMGA 5BR8L 1FGBD 1K8AC 3CCQA 4A3BB 5DM73 4A3KH 3MEFA 2DN8A 1X55A 4A3JG 3DWQA 1DOKA 1YHBA 1KLUD 2CW0C 1XMOL 3AEVA 4YCUA 4DV3Q 1U5KA 3K8AA 5JEAH 3JAML 1OTCA 2RQXA 3BZKA 3TDQA 3GTKB 4DR6Q 4KV6A 1MI2A 2F0NA 3IL8A 2K5QA 1SEBD 3GTJH 3CQZH 1Q8IA 5I9PA 2EYPA 3HOXG 5IT9L 1EWIA 5IOCA 4OIKA 1ESFA 1PH2A 1JQYD 1RTNA 4DV4L 4O42A 2OTLA 3HOVB 1AEXA 4TVAB 2B29A 2RVLA 5CYUA 4JI5Q 1SR3A 3I56A 1AE2A 4JPBW 3P1HA 1WTRA 4H02A 1D2BA 4IURA 3KOJA 4LNQA 4FF2A 1B9MA 3OTOL 1RL2A 4X3KA 2F4IA 4BY1B 2X69A 4BBSB 4MTNA 2DGYA 2CWPA 1K0RA 4AYBE 3S15H 2IWHA 2NB0A 3EIVA 3TS0A
chains in the Genus database with same CATH topology
1UEAB 2F1MA 4E6IA 5EJWA 4C2MB 2E76C 2WKDA 2A6HC 4XIGS 3URYA 1FNWA 4RCNA 3VR5A 3GO5A 3OIQA 2XIWA 1F9QA 2C9OA 5CR3A 1CM9A 1V43A 3H91A 3HP3A 1IW7D 1Z47A 4IFDI 5FLXL 3D6CA 2BDNA 2R3ZA 3KUPA 3MAQA 3TZDA 3GV6A 2XRQD 1XWEA 2IX0A 4CHTB 2NVYB 5DM63 5D3DA 5ELEA 3M85A 2BA0A 1HQRD 2D5DA 1KDCA 3EJIA 1QOHA 1E2ZA 2RDFA 4ABNA 4X3TA 3GTGB 2F0KA 3SK5A 1CA5A 4N9TA 4GZYC 3BYYB 1KDAA 4CKBA 1NR4A 3HOXB 1SE2A 2H1EA 2TMPA 1PTOF 3MXUA 3KBXA 3KK7A 2VXWA 3TZUA 1DXMA 3VA5A 4LJZC 3DM1A 4RCOA 3T53B 5JPMC 1TWCB 1PRTC 2QKIC 3NSWA 1BUVT 1X3QA 1DYQA 3TMEA 1H9JA 2G9HD 4BWGB 3HOYB 2E74C 1S5DD 2J0TD 2ZT9C 3W3AA 1QWYA 5KNBA 2K03A 1WTOA 1CA6A 3J7AF 5IGDA 5CV6A 4EQOA 1S5CD 3E6ZX 2Q8IB 2AQ1B 1I50B 4XYQA 1JWSD 4M1UB 3GV3A 1OXVA 1VF7A 2Z8LA 1B2TA 3AU7A 1AN8A 2QILA 3F2UA 3EFXD 2F3VA 5I4DA 3OIPA 1CQVA 3PO3B 4HCSA 3BVZA 2EXZA 4XQJA 4KKSA 1EL0A 2NBFA 4KHZA 3FPUB 5EKLA 3Q0AA 2IJ0A 1BDOA 1ZEQX 3OHXC 4KY6A 1S5BD 1Y1VB 1WD1A 5M3FB 1EU3A 3X3MA 3S1QB 2F0QA 2KUMA 1WTVA 3G7LA 2B8GA 2A74C 3PUYA 1D1IA 1E2WA 1BCPD 5KGUA 2EJMA 1BNZA 4LMQD 5E3FA 4U68A 2MGSA 3R2TA 4OO1I 1NSNS 2ICIA 3UI2A 5FK9C 2AQ3B 2K6AA 5C3WA 1C4QA 1WCMB 1CZWA 3PUXA 4LK1C 3RD4A 4J1MA 3HOZB 2Z1CA 3NQTA 1EOTA 5C4XB 3S2HB 3NP8A 4CGYB 4CJ2C 1LLRD 3VYTA 4XT1B 1EEFD 2E2DC 1GXDC 2X6GA 3NTKA 2IX1A 1ILQA 3I70A 3FKIB 1SYDA 4ULLA 2L5TA 2EY1A 1ZYRD 1EYAA 1HUNA 2D62A 5CGKA 1O7ZA 4XQQA 4CJ1B 2F3WA 1H9RA 2EYFA 1R4PB 3IKJA 4IUQA 3J81E 4DNTB 1WVLA 2EJFC 4RH6A 1SNOA 1K83B 1A2TA 1KLGD 3HGBA 2IPKD 3IFTA 2K33A 1IKLA 2YU9B 1HA6A 5BN3A 1STBA 4LAAA 2L1BA 2XSCA 3CRLC 3DEOA 4F7XA 3SR1A 3GTMB 5IGEA 1BBXC 1EY5A 4U673 1PZKD 4NKLA 2E2JB 1TVXA 1NCVA 1LO5D 5CV7A 4RHRA 3G6JB 5M5XB 3LWUA 5CORA 2MPMA 5IODA 3K5OA 5C6AA 1U4PA 2EVBA 4KN7C 3CHBD 2PW7A 2RKSA 4KJNA 4S3SA 2HQEA 3S1NB 2NVTB 5CC4A 3MXNA 3HRZC 2BOSA 3TN2A 2K1BA 2B2TA 1EU4A 4KKUA 2NUCA 1AW7A 4IZ8A 3I73A 4PMWA 1SSOA 3DWPA 1KTKA 2B2WA 1W6KA 1HFGA 2F0UA 3NXWA 1EWCA 5DEHA 5LL6S 3FPPA 2ENBA 3GD7A 3R8BA 2OF1A 1RHPA 4L8JA 1IKMA 3RZOB 4H13C 2A6EC 2F0OA 1LT4D 3RZDB 5C5MA 2WAQB 3R93A 4ZUIA 4KY5A 1EY4A 5F2DA 4RGTA 4C3JB 3K5LA 1TY0A 3TP7A 3H3VC 4HTHA 2F0HA 2L11A 1D1KA 3I8ZA 4JBWA 2EE1A 1J8IA 4I65A 1STNA 1ENCA 5IGBA 1O78A 3AB9A 4O1NA 1SYCA 4QUCA 2HDLA 5C0XH 4R9WA 5DAUA 2XWBB 2FMMA 4HMJA 1D5ZC 1L0YB 2SNMA 4C1NI 1SYGA 4ODGA 5BN4A 3HEJA 2HCCA 3VR2A 1EZ8A 4OIJA 3NHHA 4A3MB 2XRSD 4L6TB 1PMRA 4XT3B 1SYBA 4OL7A 5I6YA 1II3A 3SK4A 2A68C 1FNUA 1A3TA 3ITPA 4C1NK 3I90A 2QF7A 1XYIA 1Y8NB 1MBYA 1CFMA 4X3SA 1STEA 1JICA 3FVQA 3LNNA 5COYA 5CV4A 3M7NA 4PQXA 2K01A 3GQBA 1WD0A 4CJ0B 4A3DB 1EY6A 1YNND 1LTAD 4C3IG 2AWOA 3MTSA 4G7HC 1PRTB 3HOUB 1O7LA 2PO4A 3EA6A 1HHVA 2OXPA 2EYLA 1I4XA 4IALA 4IN3A 1BR9A 2NN6G 2QDBA 1SNQA 4DFAA 1SE4A 1YNJD 1LABA 3CU7A 3SK6A 3BDCA 4A3EB 1PTOD 3KBGA 3BYTB 2K04A 1JWMD 1U4LA 1TR5A 1A15A 1LV9A 3T13A 1Y8OB 1LTGD 3M7GA 3M3YB 2LKVA 2BE5D 4XXEA 4DU9A 2X6LA 3VYUA 1H9SB 1QCBD 1EQVA 3D8GA 5FOBB 1STAA 1H9MA 3VYSA 2JSOA 3HZXA 5DNFA 2NYZD 3QO2A 1QILA 1A6XA 2EYHA 2R93B 1MD2D 2HDMA 2RSNA 2JA6B 4K2LA 1Q3LA 3Q6SA 1RF2D 4DAPA 2RDHA 4QB4A 1O80A 3J81L 4ME5A 1GUOA 1BCPB 1DJRD 1E2VA 5LL6X 1SBBB 2RSOA 3MVVA 5C5LA 2O4XA 1CTMA 4TQUS 4I7ZC 2BA1A 3VA7A 1GHKA 3S14B 1KAAA 1LACA 3LWEA 4C3IB 1JB3A 3D4DA 1OO9B 3QOLA 3M4YA 1PYWD 2A69D 4J8QA 1QG7A 4IUUA 5IGCA 5ISRA 2JA8B 1ZXTA 4V0BA 1IW7C 5HURA 1PLFA 3I72A 3MFGA 1R9TB 1TS5A 4X3UA 3C46A 3OWEB 1RCVD 1UAPA 5T1GA 2Z4IA 2F0JA 2A73B 5HGTA 2PZTA 5KYIA 1IHZA 2MJ8A 4QCLA 3L7ZC 3MXGA 4ZKBB 3PUZA 4IUPA 3J80L 1EIHA 2QEJC 2JE6I 4FXKC 2FFKB 1DOLA 2FJ2A 3GTOB 3SVMA 1LTBD 2B2UC 4K14A 1RJTA 4ZAIA 1MSGA 1L0XB 1AZPA 1DOMA 1V8QA 3S16B 4A3IB 1TS4A 2B2WC 2LY7A 4IFDH 2FINB 3KLSX 1GUGA 1EY7A 3D31A 5ELFA 4R8NA 3TSSA 1R4QB 4OGQC 2EY2A 5J22A 1PFBA 1GUSA 5J39A 5EGTA 4A93B 3K58A 1SE3A 3P75A 2PMZB 5C0XG 2L55A 2KECA 2KQ3A 4P2CB 2O5JC 4DA2A 1SXTA 2J4XA 2O2LD 1PXUA 3QIAA 5J1ZA 4RGOS 1Z7TA 1KNAA 4QF4A 2VUMB 2EOTA 2FHTA 3BZDB 5D3IB 3C1EA 3K0YA 1EZ6A 1A3UA 3PO2B 3H0GB 1NR2A 4XQNA 2B2YA 2NVXB 3QB3A 4FP5D 2NN6H 1HFNA 1E0BA 1LT3D 5A2QE 4FF4A 4ZK9B 1U4RA 1G91A 4K5WA 4DN4M 2Q8TA 4WORA 4ZKCB 3NE5B 4Y7NB 3S2DB 1BCPC 3ND8A 1TWGB 3LX0A 1M4VA 4ZRZA 4FVMA 2ZXPA 2F0MA 1BOSA 1JC7A 3MHBA 3Q22A 1RODA 4HMIA 3S9WA 5JPNC 4WFN3 2TSSA 1F2MA 3SK8A 1Q90A 3GP7A 2K32A 2LFNA 1CQFA 1F2LA 3SHLA 1HUMA 1FD7D 3A7LA 4CKCA 4L63B 4FO2A 2Z4HA 3QG1A 1ZYRC 2XN9C 2ID0A 5K5PA 1TS2A 1EIGA 1SNMA 2RBMA 3NUCA 3JAME 1ET9A 1LTRD 1U9RA 2B39A 4C3JG 4KN4C 2SOBA 2F0GA 4OO1H 4PNYA 1CI3M 1ICWA 1F9PA 3T16A 3I4MB 4F8MA 2JYOA 1TWAB 2AUKA 4FF1A 3T56B 2IX3A 3FRPB 3DHQA 5BN5A 4F87A 1J9OA 3PIP3 3ERQA 4HEDA 1PRTF 1KABA 3A7AB 5CBEE 3NTHA 5C0XJ 4PMCA 4TKOB 1UUPA 2YYZA 1WTPA 4A3GB 4HSPA 1B50A 4DF7A 5D65A 1HPCA 1JWUD 4R8IA 5EBCA 1LTSD 4KY7A 3U9SA 3QOJA 2EY6A 3MXPA 2JEBI 4C56C 1KDBA 3H6MA 4UAIA 3K7AB 3E5SA 1B4OA 5I2XA 4RAUC 4BA2I 2Q8RE 1F2ZA 2EYOA 5JVG3 3AMUA 3KLSA 5KNCA 1I6HB 3R3OA 1QB5D 1QE6A 3P20A 1ONLA 1SMYD 5FKAC 1JORA 1SNPA 1A2UA 2KEEA 4F88A 4IQZA 2K5WA 3T4AC 3ZYYX 2F0EA 5JOBA 3TP6A 4JK1C 2PCFB 1WTQA 1GOZA 1VCIA 1B44D 3D4RA 1K8OA 4K6LA 1STYA 1LT5D 2M9VA 2K05A 5EKKA 3K6OA 2J7ZA 1EY9A 2F0FA 5E4XA 4WJWA 1B3AA 2JA5B 4BS9A 1ILPA 2R6GA 2BDOA 4AYBB 2C5CA 3I91A 1XXGA 3X3NA 4IFDG 1B53A 5KYLA 4B08A 4BY7B 3MEHA 3IAYA 2HUGA 3PV0A 1ML0D 4DK1A 3NK9A 2G9DA 3A8KE 5ELDA 1EWHA 5ELBA 2SDFA 1UNSA 1G8ZD 1EYCA 1OXXK 1PZJD 1I4PA 1H9SA 2E75C 4RKLA 3E0JA 2OT2A 3Q23A 1B1ZA 3L3OC 1GUTA 1XX8A 3CKIB 1SYFA 1B9NA 5JJZA 3Q24A 1YNNC 2N88A 1TWFB 1EEID 2EDGA 1GJXA 2WIIB 5A2QL 5KIXA 2MUYA 3CRKC 3VR3A 3WDNA 1YNJC 1PTOC 5TSSA 1X3PA 4KTAA 2B8FA 3A8JE 5IGGA 1PFMA 1QNUA 4MN3A 1D6EC 3TBIB 3C3LA 5G3LF 2F0PA 2PW5A 2PQEA 2BE5C 3BG3A 1DZ1A 4KHVA 1NUCA 3MZ5A 5C3XA 1EY8A 4K8IA 4CKEA 2L12A 4DXGA 4DAYA 3K59A 2I46A 4DK0A 1W6JA 3WOFA 5C4HA 3MC0B 3PMFA 1SJED 2NVQB 2KA7A 3SEBA 1Q12A 1MSHA 2QCPX 1CZGA 1STGA 2DNCA 4MHEA 3HG9A 3VYRA 3D6WA 2H4OA 3OWFA 2CW0D 3P7JA 2I07B 2NTTA 4K2KA 4B9XA 2M2LA 1O7YA 4KI0A 3SDZA 3TP5A 1S5ED 4K8JA 3H94A 5CMDA 1G2TA 4IFDJ 4OO1G 4K5XA 4H44C 3HS0C 1SAPA 3VR4A 4XYOA 3GTPB 1M8AA 1JCKB 1TT2A 2A69C 3WOEA 3A54A 1CHPD 1T5XD 1PFNA 1V1PB 5T1IA 1IYVA 2PZWA 4BA1I 3O13A 1V1OA 3D4WA 4NP5A 3PUWA 5NUCA 1ZKOA 1EQTA 1AFPA 1F2YA 1STHA 5EQ0A 2WP8J 2F0TA 2A6HD 4K6DA 3OW7A 2B2VA 2E2IB 3NBHA 2K7VA 1QJOA 4RGMA 4RHSA 1EY0A 3MFYA 1RKNA 1Q1EA 1BXTA 3T51B 1HTPA 2JP1A 2DNEA 2V4DA 4ZYSA 4A3JB 1S5FD 2B2TC 4ID6A 4IUVA 2XVSA 3A8IE 1I4QA 1K8MA 3ND9A 2K5DA 4BBRB 2D2CC 2PNRC 4HSVA 1PDQA 2IW3A 1EFID 2AQ2B 1ESRA 4N9PA 1C8CA 2F03A 1G291 3M4OB 4FNFA 1OXSC 2JXMB 1LT6D 1EYDA 1TQOA 4KD4A 1HQMC 3A55A 2M00A 3NQIA 4NMZA 4IUNA 2VNUD 4ILWA 3J7AV 4DGZA 3DMUA 4RA8A 3N52A 3K5NA 4IUTA 5ELCA 2SEBD 2KHSA 2WINB 3ONAB 1JOQA 5M5WB 2L0CA 2XNAC 1PRTD 5FO9B 4RGNA 2NN6I 2Y0SB 5EBDA 1ET6A 3KF8A 3SXHA 2KCNA 3K5MA 1F9RA 2CHBD 2ZXRA 5JAVA 2R92B 1CK1A 2NWGA 3DUZA 1I4HA 5C4JB 4G4KA 3GTLB 4OHJA 4EQNA 4DAVA 3DWAA 3EVQA 4C3HG 4NW2A 4DXFA 3PIO3 1FYCA 1DD2A 2K28A 5K36H 1SJHD 1IYUA 3OPOA 4KJOA 5M5YB 1TKWB 1SFOB 5CV9A 2N55A 2F0IA 4J6HA 1AZQA 1Y1WB 2VB3X 4MIUA 1WTXA 3FMCA 3IFDA 1BO0A 4EVOA 2RA4A 5M3MB 3C2PA 3A56A 1JOKA 3BDLA 1KNEA 1HA5A 1ENFA 4EQPA 1NAPA 4UDUC 2KJXA 1G6ZA 1Y69U 2L9HA 3R2IA 1GUWA 3SE0A 1MGSA 4PV1C 3OMGA 5IIFA 5AFWA 4K5VA 1PZID 4QUFA 1CT1D 1XTCD 2IT1A 3HKZB 3I3CA 2F0WA 3RMHA 3S1MB 1VDZA 2MP1A 2IL8A 4TSSA 4FXGC 3PUVA 3W2DA 2A5HA 3NPPA 2EY5A 4FYDA 1OXTA 4HAEA 5CV5A 1A3VA 4RFBA 2D9UA 1D5MC 3MA2B 3QWNA 1I6VC 5JVH3 2KEDA 5EPJA 4TRDA 1BQQT 2R7ZB 4C3HB 1H9KA 3RUZA 1WTWA 5A35A 5IT9E 1PTOB 5C44B 2NZ1D 3OOCA 2ICEC 2PZUA 5E1FA 2ZXOA 3D3RA 5JEAG 2CQAA 4ZUJA 3U9OA 4B9WA 1SDFA 4G7ZC 2F0SA 1SNDA 3C1FA 2WB1B 5C3EB 3I4NB 4H0LC 2B63B 4KKTA 1VMCA 1U4MA 4CBVA 3I4LA 2PPBC 2AUJD 1TY2A 2AWNA 5FO7B 1I4RA 4DNRB 4A3FB 1DM0B 3DXJC 3GTQB 2R61A 2XWJB 4RKBA 1GHJA 1HCZA 2FMCA 2EJGC 3H09A 4XDXA 3BVGA 4HR7B 4KD3A 2KVMA 1LTTD 5KRUA 4Q5VA 3S17B 2WV6D 3EQLC 4PMBA 3QJYA 2PYKA 5KNDA 5G3LD 4V190 1DCZA 1AP0A 1SMYC 4ZQ3A 4ZLTF 1TIID 3DEPA 5FLXE 2JA7B 3OSOA 2B2UA 2SNSA 1I4GA 1RDPD 5E4WC 5C0XI 5KEEA 4EGVA 1ENAA 3TP8A 3J80E 1SYEA 2L4NA 3L9AX 3NWTA 2EZVA 2B2VC 1FR3A 5I9OA 1G2SA 5EPKA 5EPLA 1BF4A 3EROA 2LS01 4A3KB 3NBIA 4RWSC 2LMCB 3RLFA 2A6ED 4FF3A 1BCPF 3FDTA 1OXUA 3BDOA 2F0LA 1HXYD 4G7OC 3GTJB 1HTLD 3CQZB 4G57A 1Q1BA 2DY7A 4FXDA 1QNKA 2KOLA 2VB2X 4NDXA 4Z9CB 1Z6HA 3FEWX 4KMUC 5I2YA 3OMCA 2EYJA 2HCIA 4WRDA 5IGFA 3K57A 1PTOH 3NTIA 1X32A 3VR6A 2DY8A 3S15B 5FO8B 1JR0D 1TWHB 1D5XC 2O5IC 4HN7A 4XTCS 5EKIA 2OEOA 2JEAI 2EYMA 5JEAJ 4M8AA 3V05A 3J7YW 1F77A 1S4ZA 1RTOA 2BCOA 1C48A 1RD9D 1CHQD 1TU2B 2F0VA 2A68D 5K36G 1Y8PB 4KK7A 3MWYW 5C4ZA 2E2HB 3NWSA 1JOOA 2WKCA 2KCCA 3S1RB 5I6WA 1LTID 1VMPA 1VF5C 1TS3A 4Q0FA 3V2TA 2NTSA 1F9SA 3BVMA 2RDGA 1IL8A 3HOWB 2B2YC 5LHY1 4QIWB 3V96A 5D14A 2EPBA 1V1PA 1FNVA 3N6RA 3BS1A 1I3QB 4HCEA 1JE4A 1T5EA 1DONA 2GA4B 4YIJA 1GUNA 5M9OA 2CVRA 4H7BA 1HRJA 5CBAE 1SNCA 3KLRA 2WACA 2MHVA 2F0DA 5CV8A 4QMGA 1FGBD 4A3BB 5DM73 2DN8A 1DOKA 3DWQA 1KLUD 2CW0C 3JAML 5JEAH 2RQXA 3TDQA 3GTKB 4KV6A 1MI2A 2F0NA 3IL8A 2K5QA 1SEBD 1Q8IA 5I9PA 2EYPA 5IT9L 5IOCA 4OIKA 1ESFA 1JQYD 1RTNA 4O42A 3HOVB 1AEXA 2RVLA 5CYUA 3P1HA 1WTRA 1D2BA 4IURA 4FF2A 1B9MA 4X3KA 2F4IA 4BY1B 2X69A 4BBSB 2IWHA 2NB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MD2 D;  1LTI D;  2G9H D;  4DXG A;  1TS3 A;  4BWG B;  1UUP A;  1PTO B;  2NTS A;  1SJH D;  1RF2 D;  1EU4 A;  3BVM A;  2RDG A;  1S5D D;  1FNU A;  4RGM A;  1L0X B;  1AW7 A;  1BCP C;  1JWU D;  2RDH A;  4RHS A;  3MC0 B;  1TS4 A;  1SJE D;  1M4V A;  1BCP F;  1V1P A;  1LLR D;  1LTS D;  1STE A;  1EEF D;  3DWP A;  5ELD A;  1FNV A;  1KTK A;  3SEB A;  1BCP B;  1BXT A;  3URY A;  1DJR D;  1FNW A;  5ELB A;  1HXY D;  1UNS A;  1G8Z D;  1EWC A;  1SBB B;  1S5C D;  3KLS X;  1HTL D;  1PZJ D;  1I4P A;  1LTA D;  4ZYS A;  4C56 C;  2AQ1 B;  3R8B A;  1JWS D;  1PRT B;  5ELF A;  1S5F D;  2Z8L A;  3TSS A;  4Z9C B;  1TY2 A;  2TSS A;  3EA6 A;  2NTT A;  1B1Z A;  1I4Q A;  1LT4 D;  1AN8 A;  2QIL A;  1I4R A;  1I4X A;  3GP7 A;  1PYW D;  2R61 A;  1HA5 A;  3EFX D;  1ENF A;  1FGB D;  2XRQ D;  1SE3 A;  1EFI D;  2AQ2 B;  4UDU C;  5I4D A;  1S5E D;  1FD7 D;  1PTO H;  5FKA C;  3BVG A;  1SE4 A;  1CQV A;  4RGT A;  3R2I A;  5D3D A;  5ELE A;  1PTO D;  1EEI D;  1HQR D;  3BVZ A;  4L63 B;  1LTT D;  4RH6 A;  3DWQ A;  3BYT B;  1TY0 A;  1LT6 D;  1KLG D;  2XN9 C;  2IPK D;  1SXT A;  2WV6 D;  1KLU D;  1TS2 A;  1PZI D;  2J4X A;  1JWM D;  1CT1 D;  1JR0 D;  2IJ0 A;  1XTC D;  2O2L D;  3MFG A;  4O1N A;  1D5X C;  1JCK B;  1S5B D;  1SEB D;  1TS5 A;  5ELC A;  2SEB D;  3OWE B;  1RCV D;  1LTG D;  1CHP D;  4RGO S;  1T5X D;  1ET9 A;  1LTR D;  3BYY B;  1V1P B;  1ESF A;  1PTO C;  1GOZ A;  1PZK D;  1SE2 A;  5TSS A;  1EU3 A;  2XNA C;  3BZD B;  1JQY D;  1PRT D;  5D3I B;  1B44 D;  1LO5 D;  4TSS A;  1PTO F;  1I4G A;  1D5Z C;  1RDP D;  4RHR A;  1L0Y B;  3O13 A;  4RGN A;  3V05 A;  3W2D A;  1F77 A;  4K6L A;  1V1O A;  1LT5 D;  1ET6 A;  1RD9 D;  1CHQ D;  3CHB D;  2CHB D;  1BCP D;  4RFB A;  1D6E C;  1D5M C;  1CK1 A;  2QEJ C;  1LT3 D;  2XRS D;  1I4H A;  4L6T B;  3R2T A;  4OHJ A;  2ICI A;  3DWA A;  4RCO A;  5FK9 C;  1LTB D;  1PRT C;  1QIL A;  2AQ3 B;  4DXF A;  1XXG A;  1DYQ A;  1PRT F; 
#chains in the Genus database with same CATH topology
 1UEA B;  2F1M A;  1TWH H;  2Y0S G;  4E6I A;  5EJW A;  1EQR A;  4A3M H;  2PI2 A;  3K81 C;  4B3S L;  4C2M B;  2UUB Q;  2R92 G;  2E76 C;  2WKD A;  3I55 A;  2A6H C;  3FHW A;  4XIG S;  1FNW A;  3URY A;  4RCN A;  4DV6 L;  4B3M Q;  3VR5 A;  3GO5 A;  3OIQ A;  2XIW A;  1F9Q A;  1YHA A;  2C9O A;  1IBK L;  3A0J A;  5CR3 A;  1CM9 A;  4JI4 L;  1KHI A;  1V43 A;  4LUZ A;  1P16 A;  3H91 A;  3HP3 A;  2E2H H;  1IW7 D;  1HH2 P;  1Z47 A;  4IFD I;  5FLX L;  3D6C A;  2YV5 A;  2BDN A;  2R3Z A;  3KUP A;  3MAQ A;  5BR8 Q;  3GV6 A;  3TZD A;  4GNX A;  1Y1W G;  2XRQ D;  1XWE A;  2IX0 A;  4CHT B;  2Z6K A;  3PO3 G;  2NVY B;  5DM6 3;  5D3D A;  2P5Z X;  5ELE A;  2BA0 A;  3M85 A;  1Q8K A;  1HQR D;  2D5D A;  3PF5 A;  1C9O A;  1KDC A;  3EJI A;  1N33 Q;  1QOH A;  5IP9 H;  1B3Q A;  1E2Z A;  2RDF A;  2HT1 A;  1XMO Q;  4ABN A;  1W3S A;  3M4Q A;  4X3T A;  4GLX A;  3ULL A;  2OTJ A;  3GTG B;  1Y1V G;  2F0K A;  3SK5 A;  1UE1 A;  5IT9 c;  1CA5 A;  3PGZ A;  5IE8 A;  4NPS A;  2IHF A;  5M3F G;  3BU2 A;  4N9T A;  4GZY C;  3BYY B;  1GM5 A;  1KDA A;  4CKB A;  1NR4 A;  3HOX B;  1SE2 A;  2H1E A;  4IJL A;  2TMP A;  4DV4 Q;  1PTO F;  3MXU A;  4UP9 A;  1EOV A;  3KBX A;  3OYY A;  3KK7 A;  2VXW A;  2Z9H A;  3OTO Q;  3TZU A;  1DXM A;  3VA5 A;  4LF6 L;  4A3B H;  4LJZ C;  4UPA A;  1HNZ L;  3DM1 A;  1Q46 A;  2F4V L;  4RCO A;  3T53 B;  2MNA A;  4JV5 Q;  1TWC B;  1PRT C;  5JPM C;  2QKI C;  3NSW A;  1BUV T;  1X3Q A;  1DYQ A;  3TME A;  2PQA B;  1A8V A;  3GTK H;  2GN5 A;  1H9J A;  2G9H D;  1KD1 C;  4YWM A;  4BWG B;  4DV2 Q;  3HOY B;  2E74 C;  4DR7 L;  1S5D D;  1XPO A;  2J0T D;  2ZT9 C;  3W3A A;  3U50 C;  1QVG A;  1QWY A;  5KNB A;  2K03 A;  4B3S Q;  1WTO A;  2XTI A;  2CWA A;  1CA6 A;  2R93 H;  3J7A F;  2EXD A;  3HOV H;  3FKI G;  5IGD A;  2DJF C;  5CV6 A;  4EQO A;  1S5C D;  2ZM6 L;  5IWA Q;  1YJN A;  3E6Z X;  2KBN A;  1WOC A;  2Q8I B;  2AQ1 B;  1I50 B;  4XYQ A;  1JWS D;  4M1U B;  3GV3 A;  1KC8 C;  1OXV A;  1VF7 A;  5FLX c;  2Z8L A;  1B2T A;  4BY1 H;  4LF5 Q;  4BBS H;  3AU7 A;  1AN8 A;  2AMC B;  2QIL A;  3F2U A;  3EFX D;  2F3V A;  3TRE A;  5I4D A;  2XGT A;  5L37 A;  3RN2 A;  3OIP A;  2HHH L;  2WB1 G;  5C3E G;  2B63 G;  2VQF L;  1CQV A;  3PO3 B;  1PH9 A;  4HCS A;  2VW9 A;  3BVZ A;  5ELO A;  2EXZ A;  4XQJ A;  4KKS A;  3J80 c;  2NBF A;  1EL0 A;  4C2M H;  1SMX A;  4KHZ A;  3M4P A;  3FPU B;  5EKL A;  4JBM A;  3Q0A A;  2IJ0 A;  1BDO A;  1ZEQ X;  3OHX C;  4KY6 A;  1S5B D;  4LF8 L;  1Y1V B;  1CKO A;  2HIX A;  3I4O A;  2NZO A;  2ALY B;  4YWL A;  1WD1 A;  1KXL A;  5M3F B;  4QGU A;  1EU3 A;  3X3M A;  2OWO A;  1L2F A;  3S1Q B;  2F0Q A;  2KUM A;  1WTV A;  3G7L A;  4N8X 1;  2B8G A;  1R9T H;  1Z9F A;  2K5H A;  2A74 C;  1I5F A;  1D1I A;  3PUY A;  4R1J A;  4UHV A;  1KAW A;  1E2W A;  5LMN W;  5JJL A;  1BCP D;  3SGI A;  2EJM A;  5KGU A;  1BNZ A;  2NVY H;  4LMQ D;  5E3F A;  4U68 A;  2MGS A;  3R2T A;  1HNZ Q;  4OO1 I;  1NSN S;  4DNI A;  2ICI A;  3UI2 A;  5FK9 C;  4K0K Q;  2AQ3 B;  2K6A A;  5C3W A;  1C4Q A;  1WCM B;  2MO0 A;  2UUC L;  1VQL A;  1CZW A;  3PUX A;  4DV0 L;  4LK1 C;  3RD4 A;  4J1M A;  3GTG H;  1S72 A;  3HOZ B;  2Z1C A;  3NQT A;  1EOT A;  3Q8D A;  5C4X B;  3GTO H;  3S2H B;  3NP8 A;  4CGY B;  4CJ2 C;  3I2Z A;  1LLR D;  3HOX H;  3VYT A;  4XT1 B;  1EEF D;  1GO3 E;  2E2D C;  1EQQ A;  1E24 A;  1GXD C;  2X6G A;  3NTK A;  5IYC G;  2IX1 A;  1ILQ A;  2RF4 A;  4B3T L;  3I70 A;  4JOI C;  3FKI B;  1SYD A;  2K14 A;  4YWK A;  2ZTE A;  1UE6 A;  1PYB A;  3S16 H;  4ULL A;  3UE0 A;  3J7A 5;  2L5T A;  2EY1 A;  4A3K G;  2Q2H A;  3KLW A;  1ZYR D;  3STB D;  1EYA A;  1VQ6 A;  1HUN A;  2D62 A;  5CGK A;  1O7Z A;  1SN8 A;  1TWC H;  1TXY A;  4XQQ A;  2F3W A;  3D0F A;  4CJ1 B;  1H9R A;  2EYF A;  1R4P B;  3F2C A;  4LWC A;  3IKJ A;  2UUA Q;  3H3V I;  3HOY H;  4IUQ A;  3J81 E;  3PIO A;  4DNT B;  2VQF Q;  1WVL A;  2EJF C;  4CDF C;  4X6A H;  5GAH C;  3EN2 A;  4RH6 A;  4HJ5 A;  1PV4 A;  1SNO A;  1K83 B;  1A2T A;  1KLG D;  5IYB G;  3HGB A;  2IPK D;  3IFT A;  1B7Y B;  2K33 A;  4L5T A;  1IKL A;  2YU9 B;  1HA6 A;  2Z6B A;  4A93 H;  5BN3 A;  1STB A;  4LAA A;  1YBY A;  2L1B A;  1EUJ A;  2XSC A;  3CRL C;  1WTH A;  3DEO A;  4F7X A;  3SR1 A;  4O0A A;  3S24 A;  4LF8 Q;  2C35 B;  2PI2 E;  3GTM B;  2UU9 L;  4DV5 L;  3UDF A;  5IGE A;  1BBX C;  1EY5 A;  4U67 3;  1PZK D;  1N34 L;  4NKL A;  2PMZ E;  2E2J B;  1TVX A;  1NCV A;  1LO5 D;  5CV7 A;  4CDC C;  4RHR A;  3G6J B;  5M5X B;  3LWU A;  3K80 C;  5COR A;  2MPM A;  1D7Q A;  5IOD A;  3K5O A;  5C6A A;  1U4P A;  2EVB A;  4KN7 C;  1IBL L;  3CHB D;  2PW7 A;  2RKS A;  4DR4 L;  4KJN A;  4A3M G;  4S3S A;  1VQP A;  1NY4 A;  2HQE A;  4X64 L;  4QJF A;  3S1N B;  2NVT B;  3UDI A;  5CC4 A;  3MXN A;  4AIM A;  3HRZ C;  1J5E Q;  2BOS A;  4MNO A;  2UUC Q;  2NVX H;  3TN2 A;  2K1B A;  2B2T A;  4RG1 A;  1QUQ B;  1EU4 A;  4DR1 L;  4KKU A;  2NUC A;  1AW7 A;  1UEB A;  3F2B A;  4IZ8 A;  3I73 A;  3HFZ B;  4PMW A;  5GQO A;  1SSO A;  3DWP A;  4PZ6 A;  1KTK A;  4A75 A;  4JI7 L;  3S1Q H;  2B2W A;  1VQJ A;  1HFG A;  1W6K A;  1X56 A;  2F0U A;  4J15 A;  1QVC A;  3NXW A;  4B3T Q;  1EWC A;  1PYS B;  5DEH A;  3PQI A;  5LL6 S;  1VQ4 A;  4Y7N H;  1MKH A;  3FPP A;  2ENB A;  3GD7 A;  3R8B A;  1VQ9 A;  1JJG A;  2OF1 A;  1VQ8 A;  1RHP A;  4L8J A;  3HOU G;  1IKM A;  3RZO B;  4H13 C;  2A6E C;  2F0O A;  1LT4 D;  3RZD B;  3A74 A;  5C5M A;  2WAQ B;  1YZ6 A;  3R93 A;  1WCM H;  4ZUI A;  4KY5 A;  3JAM i;  2G5D A;  3HOZ H;  4DKA C;  2UXD Q;  1EY4 A;  5F2D A;  1CKM A;  4RGT A;  4WJ3 M;  4C3J B;  3K5L A;  1CSP A;  3CD6 A;  5C4X H;  4P73 A;  3S2H H;  1TY0 A;  3TP7 A;  3H3V C;  4HTH A;  2F0H A;  4R4T A;  2L11 A;  1D1K A;  3I8Z A;  4JBW A;  2EE1 A;  1J8I A;  4I65 A;  1STN A;  4EQ5 A;  1ENC A;  2NZH A;  5IGB A;  1O78 A;  3AB9 A;  4O1N A;  1SYC A;  4LUV A;  4QUC A;  2HDL A;  3FKI H;  5C0X H;  4A3L G;  3HKZ E;  4R9W A;  3KF6 B;  5DAU A;  2UU9 Q;  4DV5 Q;  1NJI C;  2RCN A;  1X3F A;  2R7D A;  2XWB B;  4DUY L;  3ICE A;  2FMM A;  4HMJ A;  1D5Z C;  1L0Y B;  2SNM A;  4NB3 A;  4C1N I;  1UE7 A;  2QEX A;  1HR0 W;  1SYG A;  2E8G A;  1E3P A;  4ODG A;  4DR6 L;  5BN4 A;  4DR4 Q;  3HEJ A;  2HCC A;  3VR2 A;  1EZ8 A;  4LFB L;  4GS3 A;  4OIJ A;  3NHH A;  4IJH A;  2B3G A;  4A3M B;  2XRS D;  2YTY A;  4LF7 Q;  4L6T B;  1PMR A;  4JG2 A;  1K83 H;  2R93 G;  4XT3 B;  5GRO A;  1SYB A;  4OL7 A;  2YU9 H;  1TWA H;  1II3 A;  5I6Y A;  1K9M C;  2JA6 G;  5HGQ A;  4GOP C;  3SK4 A;  4DR5 L;  3E3X A;  2A68 C;  1FNU A;  1A3T A;  3GTM H;  4GLV B;  3ITP A;  4C1N K;  3I90 A;  2QF7 A;  1XYI A;  1Y8N B;  2N3S A;  1T9H A;  1MBY A;  1CFM A;  4X3S A;  1STE A;  4JI7 Q;  1JIC A;  3FVQ A;  4BBS G;  3LNN A;  5COY A;  4UP7 A;  5CV4 A;  3M7N A;  1VQB A;  5M5X H;  4PQX A;  2K01 A;  3GQB A;  1WD0 A;  4CJ0 B;  4A3D B;  1EY6 A;  1YNN D;  1LTA D;  4C3I G;  4X62 L;  1O7I A;  2A19 A;  2AWO A;  3MTS A;  4G7H C;  1PRT B;  4A76 A;  3HOU B;  1CUK A;  1O7L A;  2PO4 A;  3EA6 A;  3M9B A;  1HHV A;  2OXP A;  3S1N H;  2EYL A;  1JJC B;  1I4X A;  2UUB L;  1KRT A;  4IAL A;  4IN3 A;  1BR9 A;  2NN6 G;  2QDB A;  1N36 L;  1SNQ A;  3K7A H;  4DFA A;  1SE4 A;  1YNJ D;  1LAB A;  3CU7 A;  1N32 Q;  3SK6 A;  3BDC A;  4A3E B;  1PTO D;  3KBG A;  3BYT B;  1BBW A;  2K04 A;  3AQQ A;  3RLO A;  4R4I A;  1JWM D;  1U4L A;  1TR5 A;  5IYC H;  1A15 A;  1LV9 A;  3T13 A;  1AH9 A;  1Y8O B;  5EAY A;  2RHQ B;  1LTG D;  1YJ9 A;  3M7G A;  3AYH B;  3KJO A;  3M3Y B;  4GN4 B;  2OQK A;  2LKV A;  4FDB A;  4DUY Q;  3RZO H;  2BE5 D;  4XXE A;  1K28 A;  4DU9 A;  2AKW B;  3RZD H;  1N33 L;  2X6L A;  3VYU A;  3CMA A;  1H9S B;  1NMG A;  3TS2 A;  1QCB D;  1EQV A;  3TEH B;  4LFB Q;  3D8G A;  3ER0 A;  5FOB B;  4B3R Q;  1STA A;  2VL6 A;  4C3J H;  1H9M A;  3VYS A;  2JSO A;  3HZX A;  4R4Q A;  5DNF A;  2NYZ D;  1PH4 A;  5HY6 A;  3QO2 A;  1NTG A;  1QIL A;  1A6X A;  5IYB H;  2EYH A;  2R93 B;  4OXP A;  1MD2 D;  2HDM A;  2RSN A;  2JA6 B;  4K2L A;  1LYL A;  1MIU A;  4DR5 Q;  1Q3L A;  3Q6S A;  3QR8 A;  1RF2 D;  2JA5 H;  1E22 A;  4DAP A;  4A3I G;  2RDH A;  4QB4 A;  3NEN A;  2CFM A;  1H95 A;  1O80 A;  3J81 L;  2ES2 A;  4ME5 A;  1GUO A;  1BCP B;  2KHJ A;  1DJR D;  1E2V A;  2BH8 A;  5LL6 X;  4JV5 L;  1SBB B;  2RSO A;  3MVV A;  5C5L A;  2O4X A;  1CTM A;  4TQU S;  4I7Z C;  1YIT A;  1YNX A;  2BA1 A;  3VA7 A;  1PH1 A;  3HOY G;  3S14 B;  1GHK A;  5DLQ E;  1KAA A;  1LAC A;  3LWE A;  4C3I B;  1JB3 A;  1X65 A;  4DV2 L;  5JJI A;  3D4D A;  2JQO A;  1OO9 B;  3QOL A;  3M4Y A;  1Y14 B;  1PYW D;  4A93 G;  2DJG C;  2PQA A;  4QL5 A;  2A69 D;  1K8G A;  4LFA L;  4J8Q A;  1N36 Q;  1QG7 A;  4IUU A;  5IGC A;  3A5U A;  5IWA L;  2UXC L;  5ISR A;  1PA6 A;  2JA8 B;  4Y52 H;  1ZXT A;  4JI0 Q;  4V0B A;  3CPW A;  1IW7 C;  5HUR A;  1PLF A;  3I72 A;  4DAY B;  4LF5 L;  3MFG A;  1R9T B;  4WJ4 A;  1TS5 A;  4X3U A;  4A3D H;  2KCT A;  1TWF H;  3C46 A;  2VUM G;  3OWE B;  1RCV D;  4A3C G;  1UAP A;  5T1G A;  2JA9 A;  2Z4I A;  4JYA L;  1XNQ Q;  1HR0 L;  2F0J A;  2ZJQ A;  3HOU H;  2A73 B;  5HGT A;  2VZA A;  2PZT A;  3PO2 G;  4YHH L;  5KYI A;  1IHZ A;  2MJ8 A;  4QCL A;  3L7Z C;  3MXG A;  1HJP A;  4ZKB B;  3PUZ A;  4IUP A;  3J80 L;  1EIH A;  2QEJ C;  4A3E H;  4FXK C;  2JE6 I;  2FFK B;  1DOL A;  2FJ2 A;  3GTO B;  2K52 A;  3SVM A;  1LTB D;  3CPF A;  2VQE L;  2B2U C;  1JJ2 A;  4K14 A;  1RJT A;  3J81 c;  4ZAI A;  1AE3 A;  4OEM B;  1MSG A;  4HIM A;  1L0X B;  2L15 A;  3L0O A;  1DOM A;  1AZP A;  4A3L H;  3CC7 A;  3CAM A;  1V8Q A;  3S16 B;  4QIW E;  4A3I B;  1TS4 A;  3M3Y H;  2B2W C;  2LY7 A;  3PCO B;  4IFD H;  4HJ7 A;  4K0K L;  2FIN B;  1WCM G;  1GUG A;  3KLS X;  1EY7 A;  4JI3 Q;  3JC6 6;  3HOZ G;  1NBW A;  3CME A;  3D31 A;  2NVQ H;  5ELF A;  4R8N A;  1A0I A;  3U4Z A;  5C4X G;  3TSS A;  1R4Q B;  1YI2 A;  2HD3 A;  2N49 A;  4OGQ C;  2LXJ A;  4P71 A;  2EY2 A;  5J22 A;  1PFB A;  1GUS A;  4JI8 Q;  5J39 A;  5EGT A;  4A93 B;  2AHO B;  4LFA Q;  1SE3 A;  3K58 A;  2JA6 H;  3P75 A;  2PMZ B;  5C0X G;  4X62 Q;  2L55 A;  2KEC A;  2KQ3 A;  2UXC Q;  4P2C B;  2JN4 A;  2KEN A;  2O5J C;  4DA2 A;  1SXT A;  4NXM L;  2J4X A;  2QGQ A;  2O2L D;  3T1Y Q;  3NBH B;  1PXU A;  3QIA A;  1XMQ L;  5J1Z A;  4RGO S;  1Z7T A;  1KNA A;  4QF4 A;  2VUM B;  3RR5 A;  3S14 H;  2EOT A;  4JYA Q;  4C3I H;  2KCM A;  2UUA L;  1HR0 Q;  2FHT A;  3BZD B;  4IPH A;  5D3I B;  3C1E A;  3K0Y A;  4YHH Q;  1EZ6 A;  1A3U A;  3I4M G;  2ATW A;  3PO2 B;  3H0G B;  2F52 A;  2EIF A;  1NR2 A;  4XQN A;  2B2Y A;  2NVX B;  3QB3 A;  2I5L X;  4FP5 D;  2NN6 H;  1XPR A;  1HFN A;  1E0B A;  1LT3 D;  5A2Q E;  1IXR A;  4FF4 A;  4ZK9 B;  2JA8 H;  3CCM A;  1U4R A;  1G91 A;  2ZTD A;  2VQE Q;  4K5W A;  4DN4 M;  2Q8T A;  4WOR A;  2N8N A;  4ZKC B;  3NE5 B;  3DM3 A;  1PH8 A;  4Y7N B;  3S2D B;  1BCP C;  1KIX A;  2VY3 A;  1HZ9 A;  3CP0 A;  3ND8 A;  1TWG B;  3LX0 A;  1N9W A;  1M4V A;  4ZRZ A;  4FVM A;  2ZXP A;  2F0M A;  1BOS A;  4LF4 Q;  1J5E L;  1JC7 A;  3MHB A;  3Q22 A;  1ROD A;  4HMI A;  3S9W A;  5JPN C;  4IOA A;  2WFW A;  3J7Z C;  1VQN A;  4WFN 3;  2TSS A;  1F2M A;  1L1O C;  4GN3 B;  3SK8 A;  4GOP B;  1Q90 A;  3GP7 A;  2K32 A;  1GKH A;  3KF8 B;  2LFN A;  4O2D A;  4P72 A;  1IZ6 A;  1CQF A;  3G71 A;  1F2L A;  3SHL A;  1HUM A;  5ELN A;  1FD7 D;  1MJE A;  1NNX A;  3A7L A;  2CH4 A;  1WI5 A;  1QUQ A;  4CKC A;  4L63 B;  4FO2 A;  1IBM Q;  1VS0 A;  2Z4H A;  3QG1 A;  1SRO A;  3STB C;  1ZYR C;  2XN9 C;  4BBR H;  4A3I H;  2ID0 A;  5K5P A;  4L5S A;  4NXM Q;  4POG A;  1TS2 A;  1K73 C;  1N8R C;  3HKS A;  1EIG A;  2WAQ G;  1SNM A;  5IP7 H;  2RBM A;  3NUC A;  3JAM E;  3PSI A;  4HID A;  1XMQ Q;  1ET9 A;  1LTR D;  1U9R A;  2B39 A;  2UXD L;  3K7U C;  4C3J G;  4KN4 C;  2SOB A;  4OWX B;  2F0G A;  1W2B A;  4OO1 H;  2K50 A;  4YCV A;  4PNY A;  1CI3 M;  1ICW A;  2EQS A;  1F9P A;  3T16 A;  4HJ8 A;  3I4M B;  1JT8 A;  3NEL A;  4F8M A;  2JYO A;  1TWA B;  2AUK A;  4YCW A;  4FF1 A;  4AQY L;  3CCU A;  3T56 B;  2JA5 G;  4GKK Q;  1WJJ A;  2IX3 A;  5H1S E;  3FRP B;  3LGJ A;  3DHQ A;  4AYB G;  5BN5 A;  4F87 A;  1J9O A;  3PIP 3;  3L2P A;  3ERQ A;  4JI6 L;  4JCV E;  4HED A;  1PRT F;  1KAB A;  1JB7 A;  3A7A B;  5CBE E;  4BY7 G;  3NTH A;  5C0X J;  4PMC A;  4TKO B;  1UUP A;  2YYZ A;  1WTP A;  4A3G B;  4HSP A;  5C4J H;  4DF7 A;  1B50 A;  5D65 A;  2ASB A;  1HPC A;  2Y0S E;  2K4K A;  1JWU D;  1VQF A;  3KF6 A;  4R8I A;  5EBC A;  1PH6 A;  2VUM H;  4MZ9 A;  4A3C H;  1UE5 A;  1LTS D;  4KY7 A;  4PZ8 A;  4POF A;  4DV7 L;  4LF7 L;  3U9S A;  2D0P A;  3PO2 H;  3QOJ A;  2EY6 A;  3H0G H;  3MXP A;  2JEB I;  2ZTC A;  3G48 A;  4P75 A;  4C56 C;  1KDB A;  3H3V H;  3H6M A;  1XNR Q;  4UAI A;  1EIF A;  3K7A B;  3E5S A;  1B4O A;  5I2X A;  4RAU C;  4BA2 I;  4LFC Q;  2HIV A;  1ICF B;  2Q8R E;  1F2Z A;  2EYO A;  5JVG 3;  3AMU A;  1MHW C;  3KLS A;  5KNC A;  1I6H B;  3R3O A;  1QB5 D;  1QE6 A;  3P20 A;  2Q2U A;  5M3M H;  4A3D G;  1ONL A;  4BXX G;  1RIP A;  1SMY D;  5FKA C;  1WFQ A;  3UDX A;  1JOR A;  1SNP A;  1A2U A;  1E1O A;  2KEE A;  3ULJ A;  3S2D H;  4F88 A;  3CCL A;  1TWG H;  4IQZ A;  2K5W A;  3T4A C;  3UE1 A;  3ZYY X;  2F0E A;  3U58 A;  1LTL A;  5JOB A;  3G4S A;  3TP6 A;  3W5O A;  4JK1 C;  4I7A A;  2PCF B;  4GNX C;  3I7F A;  1KL9 A;  1K0S A;  2Z6K C;  1WTQ A;  3CCE A;  1GOZ A;  1VCI A;  4A3E G;  1B44 D;  1N32 L;  3D4R A;  1K8O A;  3RNU A;  4K6L A;  1STY A;  1LT5 D;  3CXC A;  2M9V A;  3G6E A;  2K05 A;  4X66 Q;  5EKK A;  3K6O A;  2J7Z A;  1G6P A;  1EY9 A;  2JK8 A;  2CKZ B;  4AQY Q;  4KLK A;  2F0F A;  5E4X A;  4WJW A;  1Q7Y C;  1B3A A;  2JA5 B;  4BS9 A;  1ILP A;  2R6G A;  2QA4 A;  2BDO A;  3J81 i;  4AYB B;  1FJG L;  2C5C A;  3I91 A;  1XXG A;  4JI6 Q;  3X3N A;  4IFD G;  1B53 A;  2K5V A;  5KYL A;  3AFP A;  5LMN L;  4B08 A;  4BY7 B;  3MEH A;  3IAY A;  4HJA A;  2HUG A;  3PV0 A;  4R4C A;  1ML0 D;  4DK1 A;  3NK9 A;  4C3H H;  2G9D A;  3A8K E;  5ELD A;  1EWH A;  2MQH A;  4LF9 L;  4B3R L;  4DV7 Q;  5ELB A;  2SDF A;  3PIP A;  5C44 H;  1UNS A;  2ZJP A;  1G8Z D;  3KDF B;  1EYC A;  3I4M H;  1OXX K;  1G51 A;  1PZJ D;  1I4P A;  1YEZ A;  1V9P A;  1H9S A;  2E75 C;  2HQL A;  4RKL A;  2K5N A;  3E0J A;  2OT2 A;  1JE5 A;  4HIO A;  3Q23 A;  1C0A A;  4LUO A;  1B1Z A;  1IYJ B;  3L3O C;  3DLL A;  1GUT A;  3E9H A;  1XX8 A;  3FP9 A;  4DK6 C;  3CKI B;  1K3B C;  1VQM A;  4OWW B;  1SYF A;  1B9N A;  5GAG C;  5JJZ A;  2MO1 A;  3Q24 A;  1M1K C;  3TRZ A;  1YNN C;  2N88 A;  4A3G H;  1CKN B;  1TWF B;  1EEI D;  2EDG A;  2WB1 E;  5FLM G;  2GVA A;  1KRS A;  4A3F H;  1GJX A;  2WII B;  5A2Q L;  1Q86 C;  1FVI A;  5KIX A;  2MUY A;  2ZJR A;  3W1G A;  3CRK C;  3VR3 A;  3WDN A;  2MFI A;  1YNJ C;  3J80 i;  1PTO C;  5TSS A;  4APV A;  2JA8 G;  2Q2I A;  1X3P A;  4KTA A;  2B8F A;  3A8J E;  5IGG A;  4JI0 L;  3A5Z B;  4DK3 C;  1I6H H;  1VQC A;  1PFM A;  1QNU A;  4MN3 A;  1HNX L;  2JA7 H;  1D6E C;  2V1C C;  3TBI B;  3C3L A;  5G3L F;  2F0P A;  2PW5 A;  2PQE A;  1XNQ L;  1VQA A;  2BE5 C;  3BG3 A;  1FJG Q;  4JOI A;  1DZ1 A;  4KHV A;  1NUC A;  3MZ5 A;  5C3X A;  1EY8 A;  4K8I A;  4YY3 L;  4CKE A;  2L12 A;  2A8V A;  4DXG A;  4DAY A;  5LMN Q;  3K59 A;  4PZ7 A;  2I46 A;  4DK0 A;  1W6J A;  3WOF A;  1X6O A;  5C4H A;  3MC0 B;  2Q2T A;  4DR2 Q;  4P74 A;  3PMF A;  1SJE D;  4CDD C;  2NVQ B;  2KA7 A;  3SEB A;  1Q12 A;  1MSH A;  2QCP X;  1CZG A;  4LF9 Q;  1STG A;  2I5H A;  1FGU A;  2R7F A;  2DNC A;  4MHE A;  3HG9 A;  3VYR A;  3D6W A;  2LXK A;  1QZG A;  1GVP A;  1L0W A;  2H4O A;  3OWF A;  2CW0 D;  3P7J A;  2I07 B;  2NTT A;  4BBR G;  1PH7 A;  2YTV A;  2WAQ E;  1ASZ A;  4K2K A;  4B9X A;  2M2L A;  1O7Y A;  4KI0 A;  1EFW A;  2E5L L;  3SDZ A;  4KHP Q;  5IP7 G;  3TP5 A;  1S5E D;  4R4O A;  1MJC A;  4BY7 H;  4IOC A;  4JI3 L;  4K8J A;  3H94 A;  5CMD A;  2GVB A;  1G2T A;  4IFD J;  4OO1 G;  4K5X A;  4H44 C;  5FJ8 G;  3HS0 C;  1SAP A;  4DV1 Q;  3VR4 A;  1ASY A;  4XYO A;  4JBJ A;  3GTP B;  1M8A A;  1PH3 A;  1JCK B;  1TT2 A;  2A69 C;  1VQK A;  3WOE A;  3A54 A;  4JI8 L;  1CHP D;  1L1O B;  1T5X D;  1PFN A;  1V1P B;  1HNW L;  2DUD A;  5T1I A;  1IYV A;  2PZW A;  4BA1 I;  1X54 A;  3O13 A;  2CH4 W;  1V1O A;  1PFS A;  2FXQ A;  3D4W A;  4NP5 A;  5GAE C;  3PUW A;  1VQE A;  1HNX Q;  3T1Y L;  5NUC A;  1ZKO A;  1EQT A;  4BXX H;  1AFP A;  1F2Y A;  1STH A;  5EQ0 A;  2WP8 J;  2F0T A;  2A6H D;  4K6D A;  2RHS B;  4GN5 A;  1C7Y A;  4YY3 Q;  3OW7 A;  2B2V A;  2E2I B;  3H0G G;  3NBH A;  5IYD H;  4JI1 L;  2K7V A;  1QJO A;  3KJP A;  4RGM A;  4RHS A;  1PHJ A;  1EY0 A;  3MFY A;  1RKN A;  4LW1 A;  2JJQ A;  1Q1E A;  3S1R H;  1BXT A;  3T51 B;  1HTP A;  3CF5 A;  2JP1 A;  2DNE A;  3HOW H;  3JAM c;  2V4D A;  4ZYS A;  5M3M G;  4A3J B;  4ALP A;  2QDL A;  1S5F D;  4GKJ L;  2B2T C;  4OON A;  4ID6 A;  1I3Q H;  4IUV A;  2XVS A;  3A8I E;  1I4Q A;  1K8M A;  3ND9 A;  2QW7 A;  2K5D A;  1EYG A;  4BBR B;  2D2C C;  2PNR C;  4HSV A;  1PDQ A;  3F2D A;  2IW3 A;  1JMC A;  2BH2 A;  2E5L Q;  1EFI D;  2AQ2 B;  1ESR A;  4N9P A;  1C8C A;  2F03 A;  1G29 1;  4LF4 L;  3M4O B;  4FNF A;  1OXS C;  2JXM B;  1LM0 A;  2IHE A;  1LT6 D;  1EYD A;  1TQO A;  1XTD A;  4KD4 A;  3PF4 A;  1HQM C;  2F3I A;  3A55 A;  2M00 A;  3NQI A;  4NMZ A;  4IUN A;  2VNU D;  3HKZ G;  4ILW A;  3J7A V;  4DGZ A;  3DMU A;  4RA8 A;  3N52 A;  3K5N A;  2I0Q A;  4IUT A;  5ELC A;  5J3B A;  1HZC A;  2SEB D;  2KHS A;  2WIN B;  3ONA B;  1JOQ A;  5M5W B;  1HNW Q;  2L0C A;  2XNA C;  1PRT D;  1IBM L;  5FO9 B;  4RGN A;  1S40 A;  4RMF A;  2NN6 I;  4GOP A;  2Y0S B;  3KYH C;  5EBD A;  1ET6 A;  3KF8 A;  3SXH A;  2KCN A;  3K5M A;  1F9R A;  3U4V A;  3BZC A;  1X3E A;  2CHB D;  2ZXR A;  5JAV A;  2R92 B;  1CK1 A;  2NWG A;  3DUZ A;  1I4H A;  5C4J B;  2CCZ A;  4DV6 Q;  4G4K A;  3GTL B;  1VQG A;  4OHJ A;  4EQN A;  4DAV A;  2R7Z G;  3DWA A;  3EVQ A;  4C3H G;  4NW2 A;  1KQS A;  1IBK Q;  5FLM H;  4DXF A;  1Q82 C;  3PIO 3;  1FYC A;  1DD2 A;  4GNX B;  2K28 A;  1D8L A;  1XJV A;  5C44 G;  4JI4 Q;  3GTP H;  5K36 H;  1SJH D;  4JI1 Q;  4HJ9 A;  1IYU A;  3OPO A;  4KJO A;  5M5Y B;  4DR3 L;  4UY8 C;  1NMF A;  1TKW B;  3TQY A;  1SFO B;  4GKK L;  4OEL B;  5CV9 A;  2N55 A;  2F0I A;  4J6H A;  2D0O A;  1AZQ A;  1V1Q A;  4X65 L;  1Y1W B;  3I4N G;  2VB3 X;  4MIU A;  1WTX A;  3FMC A;  3IFD A;  1BO0 A;  4EVO A;  1B8A A;  2RA4 A;  4A3G G;  4UP8 A;  5M3M B;  3RN5 A;  4GKJ Q;  3W1B A;  3C2P A;  2UXB L;  3A56 A;  4A3F G;  1JOK A;  3BDL A;  1KNE A;  1HA5 A;  1ENF A;  1VQI A;  4EQP A;  1NAP A;  4UDU C;  2KJX A;  2E2I H;  2A1A A;  4JC0 A;  1G6Z A;  1Y69 U;  2L9H A;  3R2I A;  1GUW A;  4HIK A;  3SE0 A;  3WWV A;  3H15 A;  1MGS A;  4PV1 C;  1I94 L;  1XNR L;  3OMG A;  5IIF A;  5AFW A;  4K5V A;  1PZI D;  4QUF A;  4LFC L;  1CT1 D;  1XTC D;  2IT1 A;  3NEM A;  4LF6 Q;  3HKZ B;  4DUZ L;  3I3C A;  2F0W A;  3RMH A;  2F4V Q;  3S1M B;  4L5R C;  1VDZ A;  2JA7 G;  4A3J H;  2MP1 A;  2IL8 A;  4TSS A;  4FXG C;  3PUV A;  3W2D A;  1CSQ A;  2A5H A;  3NPP A;  4DR7 Q;  2PNH A;  2EY5 A;  4FYD A;  1OXT A;  4HAE A;  5CV5 A;  4JBK A;  1A3V A;  4RFB A;  2D9U A;  1D5M C;  3M4O H;  3MA2 B;  3QWN A;  1XPU A;  1I6V C;  5JVH 3;  1BBU A;  2KED A;  5EPJ A;  2ZM6 Q;  4TRD A;  1BQQ T;  2R7Z B;  4C3H B;  1H9K A;  3RUZ A;  1WTW A;  5A35 A;  5FJ8 H;  1SLJ A;  5IT9 E;  1PTO B;  3E0E A;  5C44 B;  2Z0S A;  2RCF A;  2NZ1 D;  3OOC A;  4X66 L;  2ICE C;  2PZU A;  5GAD C;  4DR3 Q;  4PG3 A;  5E1F A;  2ZXO A;  3D3R A;  4JI2 L;  1A63 A;  5M5W H;  5JEA G;  2CQA A;  4ZUJ A;  1K3R A;  4OWT B;  3U9O A;  1QZH A;  4B9W A;  3B6Y A;  1SDF A;  4X65 Q;  2HHH Q;  4G7Z C;  2F0S A;  1SND A;  3C1F A;  2WB1 B;  5C3E B;  3I4N B;  4H0L C;  2B63 B;  4KKT A;  4JW0 A;  1SRU A;  1VMC A;  1U4M A;  4CBV A;  3BJU A;  3I4L A;  2PPB C;  2R92 H;  2AUJ D;  1TY2 A;  3IRB A;  3GTL H;  2UXB Q;  2AWN A;  5FO7 B;  3RLN A;  3EBE A;  4GLA C;  1I4R A;  4DNR B;  4A3F B;  1DM0 B;  3DXJ C;  3GTQ B;  2R61 A;  2XWJ B;  4RKB A;  1VQH A;  1GHJ A;  1HCZ A;  1I50 H;  2FMC A;  2EJG C;  3H09 A;  1YHQ A;  4XDX A;  3BVG A;  2H5X A;  3CCV A;  4HR7 B;  4KD3 A;  2KVM A;  1LTT D;  5KRU A;  4Q5V A;  5M5Y H;  1LUZ A;  3S17 B;  2WV6 D;  1I94 Q;  1YVC A;  3EQL C;  1SFO H;  1S3O A;  1Y1W H;  4PMB A;  1J6Q A;  3KDF A;  3QJY A;  2PYK A;  3PO3 H;  5KND A;  4DUZ Q;  5G3L D;  4V19 0;  1DCZ A;  1Q81 C;  1AP0 A;  4JVZ A;  1SMY C;  2VS1 A;  4ZQ3 A;  4ZLT F;  1TII D;  4MTK A;  3DEP A;  5FLX E;  2JA7 B;  4AH6 A;  3T1H L;  1HZA A;  3OSO A;  2B2U A;  1X9N A;  4DV0 Q;  2SNS A;  1I4G A;  4OX9 L;  1RDP D;  1EIY B;  3E9I A;  4QY7 A;  1Y1V H;  2LSS A;  5E4W C;  5C0X I;  5KEE A;  4EGV A;  1ENA A;  1E1T A;  2KHI A;  5M3F H;  5IYD G;  3CC4 A;  1CKN A;  4ME3 A;  3TP8 A;  3J80 E;  1SYE A;  2L4N A;  3L9A X;  3NWT A;  2EZV A;  5LMU L;  2B2V C;  1FR3 A;  5I9O A;  1VQO A;  2IY5 B;  1G2S A;  5EPK A;  1UWV A;  5EPL A;  3HOW G;  1BF4 A;  3ERO A;  5AJ3 L;  2LS0 1;  4A3K B;  3NBI A;  1X3G A;  4RWS C;  2I5M X;  2LMC B;  3ULP A;  1M90 C;  3S1M H;  5IP9 G;  3RLF A;  2A6E D;  4FF3 A;  4JI2 Q;  1BCP F;  3FDT A;  4DAM A;  3CCR A;  1WYD A;  1OXU A;  3BDO A;  2F0L A;  1HZB A;  1HXY D;  4G7O C;  3ZJY C;  3GTJ B;  1HTL D;  3CQZ B;  4G57 A;  1PH5 A;  1Q1B A;  1PVO A;  2DY7 A;  4FXD A;  1VQ7 A;  4L5Q A;  1QNK A;  2KOL A;  2VB2 X;  4NDX A;  5JJK A;  3CCS A;  4Z9C B;  1Z6H A;  3FEW X;  4KMU C;  4CDE C;  3KFU A;  5I2Y A;  4NXN L;  1VQ5 A;  4DR2 L;  3OMC A;  2R7Z H;  2EYJ A;  2OCE A;  2HCI A;  4WRD A;  5IGF A;  4A3B G;  3K57 A;  1PTO H;  3NTI A;  1N34 Q;  1X32 A;  3VR6 A;  1DGS A;  3K0X A;  3MXN B;  2DY8 A;  3UDG A;  4DV3 L;  3S15 B;  1A62 A;  1SE8 A;  1U0L A;  5FO8 B;  1IBL Q;  1BKB A;  1JR0 D;  4DPG A;  1TWH B;  1D5X C;  2O5I C;  4HN7 A;  4X64 Q;  3VDY A;  5C3E H;  1IL2 A;  3I4N H;  4XTC S;  5EKI A;  2OEO A;  4EX5 A;  2B63 H;  2N78 A;  2JEA I;  2EYM A;  3CC2 A;  5JEA J;  4KHP L;  3HOV G;  3T1H Q;  4M8A A;  4OX9 Q;  3ERS X;  3V05 A;  3J7Y W;  4JI5 L;  1F77 A;  1S4Z A;  1RTO A;  2BCO A;  1C48 A;  3GTQ H;  4DR1 Q;  1QVF A;  2OQ0 A;  4QQB X;  1RD9 D;  1CHQ D;  5IY0 A;  1TU2 B;  2F0V A;  4N8F A;  2A68 D;  4DV1 L;  1B70 B;  5K36 G;  1Y8P B;  4KK7 A;  4A4I A;  3MWY W;  1YIJ A;  2E2J H;  4BY1 G;  5C4Z A;  2E2H B;  1VQD A;  3NWS A;  3S17 H;  1JOO A;  2WKC A;  2KCC A;  2K75 A;  3F1Z A;  3S1R B;  5LMU Q;  5I6W A;  1LTI D;  1VMP A;  3F8T A;  1VF5 C;  1TS3 A;  4Q0F A;  3V2T A;  3CCJ A;  2NTS A;  1F9S A;  3BVM A;  5AJ3 Q;  2RDG A;  1IL8 A;  3HOW B;  2B2Y C;  5LHY 1;  4ZCK A;  4QIW B;  2NVT H;  2CQO A;  1L1O A;  3V96 A;  1P8L A;  5D14 A;  2EPB A;  1V1P A;  1YJW A;  1FNV A;  3N6R A;  3GDE A;  3BS1 A;  4IO9 A;  3AFQ A;  1I3Q B;  4B3M L;  1E7Z A;  4HCE A;  1JE4 A;  1T5E A;  3OW2 A;  1DON A;  1FL0 A;  2YTX A;  2GA4 B;  1NE3 A;  4YIJ A;  1GUN A;  4IPD A;  5M9O A;  2CVR A;  4H7B A;  1GD7 A;  1HRJ A;  5CBA E;  4IPG A;  3CW2 C;  3J81 j;  1SNC A;  3KLR A;  4NXN Q;  5E7N A;  1BVS A;  2WAC A;  2MHV A;  2F0D A;  4IPC A;  5CV8 A;  4QMG A;  5BR8 L;  1FGB D;  1K8A C;  3CCQ A;  4A3B B;  5DM7 3;  4A3K H;  3MEF A;  2DN8 A;  1X55 A;  4A3J G;  3DWQ A;  1DOK A;  1YHB A;  1KLU D;  2CW0 C;  1XMO L;  3AEV A;  4YCU A;  4DV3 Q;  1U5K A;  3K8A A;  5JEA H;  3JAM L;  1OTC A;  2RQX A;  3BZK A;  3TDQ A;  3GTK B;  4DR6 Q;  4KV6 A;  1MI2 A;  2F0N A;  3IL8 A;  2K5Q A;  1SEB D;  3GTJ H;  3CQZ H;  1Q8I A;  5I9P A;  2EYP A;  3HOX G;  5IT9 L;  1EWI A;  5IOC A;  4OIK A;  1ESF A;  1PH2 A;  1JQY D;  1RTN A;  4DV4 L;  4O42 A;  2OTL A;  3HOV B;  1AEX A;  4TVA B;  2B29 A;  2RVL A;  5CYU A;  4JI5 Q;  1SR3 A;  3I56 A;  1AE2 A;  4JPB W;  3P1H A;  1WTR A;  4H02 A;  1D2B A;  4IUR A;  3KOJ A;  4LNQ A;  4FF2 A;  1B9M A;  3OTO L;  1RL2 A;  4X3K A;  2F4I A;  4BY1 B;  2X69 A;  4BBS B;  4MTN A;  2DGY A;  2CWP A;  1K0R A;  4AYB E;  3S15 H;  2IWH A;  2NB0 A;  3EIV A;  3TS0 A; 
#chains in the Genus database with same CATH homology
 1UEA B;  2F1M A;  4E6I A;  5EJW A;  4C2M B;  2E76 C;  2WKD A;  2A6H C;  4XIG S;  3URY A;  1FNW A;  4RCN A;  3VR5 A;  3GO5 A;  3OIQ A;  2XIW A;  1F9Q A;  2C9O A;  5CR3 A;  1CM9 A;  1V43 A;  3H91 A;  3HP3 A;  1IW7 D;  1Z47 A;  4IFD I;  5FLX L;  3D6C A;  2BDN A;  2R3Z A;  3KUP A;  3MAQ A;  3TZD A;  3GV6 A;  2XRQ D;  1XWE A;  2IX0 A;  4CHT B;  2NVY B;  5DM6 3;  5D3D A;  5ELE A;  3M85 A;  2BA0 A;  1HQR D;  2D5D A;  1KDC A;  3EJI A;  1QOH A;  1E2Z A;  2RDF A;  4ABN A;  4X3T A;  3GTG B;  2F0K A;  3SK5 A;  1CA5 A;  4N9T A;  4GZY C;  3BYY B;  1KDA A;  4CKB A;  1NR4 A;  3HOX B;  1SE2 A;  2H1E A;  2TMP A;  1PTO F;  3MXU A;  3KBX A;  3KK7 A;  2VXW A;  3TZU A;  1DXM A;  3VA5 A;  4LJZ C;  3DM1 A;  4RCO A;  3T53 B;  5JPM C;  1TWC B;  1PRT C;  2QKI C;  3NSW A;  1BUV T;  1X3Q A;  1DYQ A;  3TME A;  1H9J A;  2G9H D;  4BWG B;  3HOY B;  2E74 C;  1S5D D;  2J0T D;  2ZT9 C;  3W3A A;  1QWY A;  5KNB A;  2K03 A;  1WTO A;  1CA6 A;  3J7A F;  5IGD A;  5CV6 A;  4EQO A;  1S5C D;  3E6Z X;  2Q8I B;  2AQ1 B;  1I50 B;  4XYQ A;  1JWS D;  4M1U B;  3GV3 A;  1OXV A;  1VF7 A;  2Z8L A;  1B2T A;  3AU7 A;  1AN8 A;  2QIL A;  3F2U A;  3EFX D;  2F3V A;  5I4D A;  3OIP A;  1CQV A;  3PO3 B;  4HCS A;  3BVZ A;  2EXZ A;  4XQJ A;  4KKS A;  1EL0 A;  2NBF A;  4KHZ A;  3FPU B;  5EKL A;  3Q0A A;  2IJ0 A;  1BDO A;  1ZEQ X;  3OHX C;  4KY6 A;  1S5B D;  1Y1V B;  1WD1 A;  5M3F B;  1EU3 A;  3X3M A;  3S1Q B;  2F0Q A;  2KUM A;  1WTV A;  3G7L A;  2B8G A;  2A74 C;  3PUY A;  1D1I A;  1E2W A;  1BCP D;  5KGU A;  2EJM A;  1BNZ A;  4LMQ D;  5E3F A;  4U68 A;  2MGS A;  3R2T A;  4OO1 I;  1NSN S;  2ICI A;  3UI2 A;  5FK9 C;  2AQ3 B;  2K6A A;  5C3W A;  1C4Q A;  1WCM B;  1CZW A;  3PUX A;  4LK1 C;  3RD4 A;  4J1M A;  3HOZ B;  2Z1C A;  3NQT A;  1EOT A;  5C4X B;  3S2H B;  3NP8 A;  4CGY B;  4CJ2 C;  1LLR D;  3VYT A;  4XT1 B;  1EEF D;  2E2D C;  1GXD C;  2X6G A;  3NTK A;  2IX1 A;  1ILQ A;  3I70 A;  3FKI B;  1SYD A;  4ULL A;  2L5T A;  2EY1 A;  1ZYR D;  1EYA A;  1HUN A;  2D62 A;  5CGK A;  1O7Z A;  4XQQ A;  4CJ1 B;  2F3W A;  1H9R A;  2EYF A;  1R4P B;  3IKJ A;  4IUQ A;  3J81 E;  4DNT B;  1WVL A;  2EJF C;  4RH6 A;  1SNO A;  1K83 B;  1A2T A;  1KLG D;  3HGB A;  2IPK D;  3IFT A;  2K33 A;  1IKL A;  2YU9 B;  1HA6 A;  5BN3 A;  1STB A;  4LAA A;  2L1B A;  2XSC A;  3CRL C;  3DEO A;  4F7X A;  3SR1 A;  3GTM B;  5IGE A;  1BBX C;  1EY5 A;  4U67 3;  1PZK D;  4NKL A;  2E2J B;  1TVX A;  1NCV A;  1LO5 D;  5CV7 A;  4RHR A;  3G6J B;  5M5X B;  3LWU A;  5COR A;  2MPM A;  5IOD A;  3K5O A;  5C6A A;  1U4P A;  2EVB A;  4KN7 C;  3CHB D;  2PW7 A;  2RKS A;  4KJN A;  4S3S A;  2HQE A;  3S1N B;  2NVT B;  5CC4 A;  3MXN A;  3HRZ C;  2BOS A;  3TN2 A;  2K1B A;  2B2T A;  1EU4 A;  4KKU A;  2NUC A;  1AW7 A;  4IZ8 A;  3I73 A;  4PMW A;  1SSO A;  3DWP A;  1KTK A;  2B2W A;  1W6K A;  1HFG A;  2F0U A;  3NXW A;  1EWC A;  5DEH A;  5LL6 S;  3FPP A;  2ENB A;  3GD7 A;  3R8B A;  2OF1 A;  1RHP A;  4L8J A;  1IKM A;  3RZO B;  4H13 C;  2A6E C;  2F0O A;  1LT4 D;  3RZD B;  5C5M A;  2WAQ B;  3R93 A;  4ZUI A;  4KY5 A;  1EY4 A;  5F2D A;  4RGT A;  4C3J B;  3K5L A;  1TY0 A;  3TP7 A;  3H3V C;  4HTH A;  2F0H A;  2L11 A;  1D1K A;  3I8Z A;  4JBW A;  2EE1 A;  1J8I A;  4I65 A;  1STN A;  1ENC A;  5IGB A;  1O78 A;  3AB9 A;  4O1N A;  1SYC A;  4QUC A;  2HDL A;  5C0X H;  4R9W A;  5DAU A;  2XWB B;  2FMM A;  4HMJ A;  1D5Z C;  1L0Y B;  2SNM A;  4C1N I;  1SYG A;  4ODG A;  5BN4 A;  3HEJ A;  2HCC A;  3VR2 A;  1EZ8 A;  4OIJ A;  3NHH A;  4A3M B;  2XRS D;  4L6T B;  1PMR A;  4XT3 B;  1SYB A;  4OL7 A;  5I6Y A;  1II3 A;  3SK4 A;  2A68 C;  1FNU A;  1A3T A;  3ITP A;  4C1N K;  3I90 A;  2QF7 A;  1XYI A;  1Y8N B;  1MBY A;  1CFM A;  4X3S A;  1STE A;  1JIC A;  3FVQ A;  3LNN A;  5COY A;  5CV4 A;  3M7N A;  4PQX A;  2K01 A;  3GQB A;  1WD0 A;  4CJ0 B;  4A3D B;  1EY6 A;  1YNN D;  1LTA D;  4C3I G;  2AWO A;  3MTS A;  4G7H C;  1PRT B;  3HOU B;  1O7L A;  2PO4 A;  3EA6 A;  1HHV A;  2OXP A;  2EYL A;  1I4X A;  4IAL A;  4IN3 A;  1BR9 A;  2NN6 G;  2QDB A;  1SNQ A;  4DFA A;  1SE4 A;  1YNJ D;  1LAB A;  3CU7 A;  3SK6 A;  3BDC A;  4A3E B;  1PTO D;  3KBG A;  3BYT B;  2K04 A;  1JWM D;  1U4L A;  1TR5 A;  1A15 A;  1LV9 A;  3T13 A;  1Y8O B;  1LTG D;  3M7G A;  3M3Y B;  2LKV A;  2BE5 D;  4XXE A;  4DU9 A;  2X6L A;  3VYU A;  1H9S B;  1QCB D;  1EQV A;  3D8G A;  5FOB B;  1STA A;  1H9M A;  3VYS A;  2JSO A;  3HZX A;  5DNF A;  2NYZ D;  3QO2 A;  1QIL A;  1A6X A;  2EYH A;  2R93 B;  1MD2 D;  2HDM A;  2RSN A;  2JA6 B;  4K2L A;  1Q3L A;  3Q6S A;  1RF2 D;  4DAP A;  2RDH A;  4QB4 A;  1O80 A;  3J81 L;  4ME5 A;  1GUO A;  1BCP B;  1DJR D;  1E2V A;  5LL6 X;  1SBB B;  2RSO A;  3MVV A;  5C5L A;  2O4X A;  1CTM A;  4TQU S;  4I7Z C;  2BA1 A;  3VA7 A;  1GHK A;  3S14 B;  1KAA A;  1LAC A;  3LWE A;  4C3I B;  1JB3 A;  3D4D A;  1OO9 B;  3QOL A;  3M4Y A;  1PYW D;  2A69 D;  4J8Q A;  1QG7 A;  4IUU A;  5IGC A;  5ISR A;  2JA8 B;  1ZXT A;  4V0B A;  1IW7 C;  5HUR A;  1PLF A;  3I72 A;  3MFG A;  1R9T B;  1TS5 A;  4X3U A;  3C46 A;  3OWE B;  1RCV D;  1UAP A;  5T1G A;  2Z4I A;  2F0J A;  2A73 B;  5HGT A;  2PZT A;  5KYI A;  1IHZ A;  2MJ8 A;  4QCL A;  3L7Z C;  3MXG A;  4ZKB B;  3PUZ A;  4IUP A;  3J80 L;  1EIH A;  2QEJ C;  2JE6 I;  4FXK C;  2FFK B;  1DOL A;  2FJ2 A;  3GTO B;  3SVM A;  1LTB D;  2B2U C;  4K14 A;  1RJT A;  4ZAI A;  1MSG A;  1L0X B;  1AZP A;  1DOM A;  1V8Q A;  3S16 B;  4A3I B;  1TS4 A;  2B2W C;  2LY7 A;  4IFD H;  2FIN B;  3KLS X;  1GUG A;  1EY7 A;  3D31 A;  5ELF A;  4R8N A;  3TSS A;  1R4Q B;  4OGQ C;  2EY2 A;  5J22 A;  1PFB A;  1GUS A;  5J39 A;  5EGT A;  4A93 B;  3K58 A;  1SE3 A;  3P75 A;  2PMZ B;  5C0X G;  2L55 A;  2KEC A;  2KQ3 A;  4P2C B;  2O5J C;  4DA2 A;  1SXT A;  2J4X A;  2O2L D;  1PXU A;  3QIA A;  5J1Z A;  4RGO S;  1Z7T A;  1KNA A;  4QF4 A;  2VUM B;  2EOT A;  2FHT A;  3BZD B;  5D3I B;  3C1E A;  3K0Y A;  1EZ6 A;  1A3U A;  3PO2 B;  3H0G B;  1NR2 A;  4XQN A;  2B2Y A;  2NVX B;  3QB3 A;  4FP5 D;  2NN6 H;  1HFN A;  1E0B A;  1LT3 D;  5A2Q E;  4FF4 A;  4ZK9 B;  1U4R A;  1G91 A;  4K5W A;  4DN4 M;  2Q8T A;  4WOR A;  4ZKC B;  3NE5 B;  4Y7N B;  3S2D B;  1BCP C;  3ND8 A;  1TWG B;  3LX0 A;  1M4V A;  4ZRZ A;  4FVM A;  2ZXP A;  2F0M A;  1BOS A;  1JC7 A;  3MHB A;  3Q22 A;  1ROD A;  4HMI A;  3S9W A;  5JPN C;  4WFN 3;  2TSS A;  1F2M A;  3SK8 A;  1Q90 A;  3GP7 A;  2K32 A;  2LFN A;  1CQF A;  1F2L A;  3SHL A;  1HUM A;  1FD7 D;  3A7L A;  4CKC A;  4L63 B;  4FO2 A;  2Z4H A;  3QG1 A;  1ZYR C;  2XN9 C;  2ID0 A;  5K5P A;  1TS2 A;  1EIG A;  1SNM A;  2RBM A;  3NUC A;  3JAM E;  1ET9 A;  1LTR D;  1U9R A;  2B39 A;  4C3J G;  4KN4 C;  2SOB A;  2F0G A;  4OO1 H;  4PNY A;  1CI3 M;  1ICW A;  1F9P A;  3T16 A;  3I4M B;  4F8M A;  2JYO A;  1TWA B;  2AUK A;  4FF1 A;  3T56 B;  2IX3 A;  3FRP B;  3DHQ A;  5BN5 A;  4F87 A;  1J9O A;  3PIP 3;  3ERQ A;  4HED A;  1PRT F;  1KAB A;  3A7A B;  5CBE E;  3NTH A;  5C0X J;  4PMC A;  4TKO B;  1UUP A;  2YYZ A;  1WTP A;  4A3G B;  4HSP A;  1B50 A;  4DF7 A;  5D65 A;  1HPC A;  1JWU D;  4R8I A;  5EBC A;  1LTS D;  4KY7 A;  3U9S A;  3QOJ A;  2EY6 A;  3MXP A;  2JEB I;  4C56 C;  1KDB A;  3H6M A;  4UAI A;  3K7A B;  3E5S A;  1B4O A;  5I2X A;  4RAU C;  4BA2 I;  2Q8R E;  1F2Z A;  2EYO A;  5JVG 3;  3AMU A;  3KLS A;  5KNC A;  1I6H B;  3R3O A;  1QB5 D;  1QE6 A;  3P20 A;  1ONL A;  1SMY D;  5FKA C;  1JOR A;  1SNP A;  1A2U A;  2KEE A;  4F88 A;  4IQZ A;  2K5W A;  3T4A C;  3ZYY X;  2F0E A;  5JOB A;  3TP6 A;  4JK1 C;  2PCF B;  1WTQ A;  1GOZ A;  1VCI A;  1B44 D;  3D4R A;  1K8O A;  4K6L A;  1STY A;  1LT5 D;  2M9V A;  2K05 A;  5EKK A;  3K6O A;  2J7Z A;  1EY9 A;  2F0F A;  5E4X A;  4WJW A;  1B3A A;  2JA5 B;  4BS9 A;  1ILP A;  2R6G A;  2BDO A;  4AYB B;  2C5C A;  3I91 A;  1XXG A;  3X3N A;  4IFD G;  1B53 A;  5KYL A;  4B08 A;  4BY7 B;  3MEH A;  3IAY A;  2HUG A;  3PV0 A;  1ML0 D;  4DK1 A;  3NK9 A;  2G9D A;  3A8K E;  5ELD A;  1EWH A;  5ELB A;  2SDF A;  1UNS A;  1G8Z D;  1EYC A;  1OXX K;  1PZJ D;  1I4P A;  1H9S A;  2E75 C;  4RKL A;  3E0J A;  2OT2 A;  3Q23 A;  1B1Z A;  3L3O C;  1GUT A;  1XX8 A;  3CKI B;  1SYF A;  1B9N A;  5JJZ A;  3Q24 A;  1YNN C;  2N88 A;  1TWF B;  1EEI D;  2EDG A;  1GJX A;  2WII B;  5A2Q L;  5KIX A;  2MUY A;  3CRK C;  3VR3 A;  3WDN A;  1YNJ C;  1PTO C;  5TSS A;  1X3P A;  4KTA A;  2B8F A;  3A8J E;  5IGG A;  1PFM A;  1QNU A;  4MN3 A;  1D6E C;  3TBI B;  3C3L A;  5G3L F;  2F0P A;  2PW5 A;  2PQE A;  2BE5 C;  3BG3 A;  1DZ1 A;  4KHV A;  1NUC A;  3MZ5 A;  5C3X A;  1EY8 A;  4K8I A;  4CKE A;  2L12 A;  4DXG A;  4DAY A;  3K59 A;  2I46 A;  4DK0 A;  1W6J A;  3WOF A;  5C4H A;  3MC0 B;  3PMF A;  1SJE D;  2NVQ B;  2KA7 A;  3SEB A;  1Q12 A;  1MSH A;  2QCP X;  1CZG A;  1STG A;  2DNC A;  4MHE A;  3HG9 A;  3VYR A;  3D6W A;  2H4O A;  3OWF A;  2CW0 D;  3P7J A;  2I07 B;  2NTT A;  4K2K A;  4B9X A;  2M2L A;  1O7Y A;  4KI0 A;  3SDZ A;  3TP5 A;  1S5E D;  4K8J A;  3H94 A;  5CMD A;  1G2T A;  4IFD J;  4OO1 G;  4K5X A;  4H44 C;  3HS0 C;  1SAP A;  3VR4 A;  4XYO A;  3GTP B;  1M8A A;  1JCK B;  1TT2 A;  2A69 C;  3WOE A;  3A54 A;  1CHP D;  1T5X D;  1PFN A;  1V1P B;  5T1I A;  1IYV A;  2PZW A;  4BA1 I;  3O13 A;  1V1O A;  3D4W A;  4NP5 A;  3PUW A;  5NUC A;  1ZKO A;  1EQT A;  1AFP A;  1F2Y A;  1STH A;  5EQ0 A;  2WP8 J;  2F0T A;  2A6H D;  4K6D A;  3OW7 A;  2B2V A;  2E2I B;  3NBH A;  2K7V A;  1QJO A;  4RGM A;  4RHS A;  1EY0 A;  3MFY A;  1RKN A;  1Q1E A;  1BXT A;  3T51 B;  1HTP A;  2JP1 A;  2DNE A;  2V4D A;  4ZYS A;  4A3J B;  1S5F D;  2B2T C;  4ID6 A;  4IUV A;  2XVS A;  3A8I E;  1I4Q A;  1K8M A;  3ND9 A;  2K5D A;  4BBR B;  2D2C C;  2PNR C;  4HSV A;  1PDQ A;  2IW3 A;  1EFI D;  2AQ2 B;  1ESR A;  4N9P A;  1C8C A;  2F03 A;  1G29 1;  3M4O B;  4FNF A;  1OXS C;  2JXM B;  1LT6 D;  1EYD A;  1TQO A;  4KD4 A;  1HQM C;  3A55 A;  2M00 A;  3NQI A;  4NMZ A;  4IUN A;  2VNU D;  4ILW A;  3J7A V;  4DGZ A;  3DMU A;  4RA8 A;  3N52 A;  3K5N A;  4IUT A;  5ELC A;  2SEB D;  2KHS A;  2WIN B;  3ONA B;  1JOQ A;  5M5W B;  2L0C A;  2XNA C;  1PRT D;  5FO9 B;  4RGN A;  2NN6 I;  2Y0S B;  5EBD A;  1ET6 A;  3KF8 A;  3SXH A;  2KCN A;  3K5M A;  1F9R A;  2CHB D;  2ZXR A;  5JAV A;  2R92 B;  1CK1 A;  2NWG A;  3DUZ A;  1I4H A;  5C4J B;  4G4K A;  3GTL B;  4OHJ A;  4EQN A;  4DAV A;  3DWA A;  3EVQ A;  4C3H G;  4NW2 A;  4DXF A;  3PIO 3;  1FYC A;  1DD2 A;  2K28 A;  5K36 H;  1SJH D;  1IYU A;  3OPO A;  4KJO A;  5M5Y B;  1TKW B;  1SFO B;  5CV9 A;  2N55 A;  2F0I A;  4J6H A;  1AZQ A;  1Y1W B;  2VB3 X;  4MIU A;  1WTX A;  3FMC A;  3IFD A;  1BO0 A;  4EVO A;  2RA4 A;  5M3M B;  3C2P A;  3A56 A;  1JOK A;  3BDL A;  1KNE A;  1HA5 A;  1ENF A;  4EQP A;  1NAP A;  4UDU C;  2KJX A;  1G6Z A;  1Y69 U;  2L9H A;  3R2I A;  1GUW A;  3SE0 A;  1MGS A;  4PV1 C;  3OMG A;  5IIF A;  5AFW A;  4K5V A;  1PZI D;  4QUF A;  1CT1 D;  1XTC D;  2IT1 A;  3HKZ B;  3I3C A;  2F0W A;  3RMH A;  3S1M B;  1VDZ A;  2MP1 A;  2IL8 A;  4TSS A;  4FXG C;  3PUV A;  3W2D A;  2A5H A;  3NPP A;  2EY5 A;  4FYD A;  1OXT A;  4HAE A;  5CV5 A;  1A3V A;  4RFB A;  2D9U A;  1D5M C;  3MA2 B;  3QWN A;  1I6V C;  5JVH 3;  2KED A;  5EPJ A;  4TRD A;  1BQQ T;  2R7Z B;  4C3H B;  1H9K A;  3RUZ A;  1WTW A;  5A35 A;  5IT9 E;  1PTO B;  5C44 B;  2NZ1 D;  3OOC A;  2ICE C;  2PZU A;  5E1F A;  2ZXO A;  3D3R A;  5JEA G;  2CQA A;  4ZUJ A;  3U9O A;  4B9W A;  1SDF A;  4G7Z C;  2F0S A;  1SND A;  3C1F A;  2WB1 B;  5C3E B;  3I4N B;  4H0L C;  2B63 B;  4KKT A;  1VMC A;  1U4M A;  4CBV A;  3I4L A;  2PPB C;  2AUJ D;  1TY2 A;  2AWN A;  5FO7 B;  1I4R A;  4DNR B;  4A3F B;  1DM0 B;  3DXJ C;  3GTQ B;  2R61 A;  2XWJ B;  4RKB A;  1GHJ A;  1HCZ A;  2FMC A;  2EJG C;  3H09 A;  4XDX A;  3BVG A;  4HR7 B;  4KD3 A;  2KVM A;  1LTT D;  5KRU A;  4Q5V A;  3S17 B;  2WV6 D;  3EQL C;  4PMB A;  3QJY A;  2PYK A;  5KND A;  5G3L D;  4V19 0;  1DCZ A;  1AP0 A;  1SMY C;  4ZQ3 A;  4ZLT F;  1TII D;  3DEP A;  5FLX E;  2JA7 B;  3OSO A;  2B2U A;  2SNS A;  1I4G A;  1RDP D;  5E4W C;  5C0X I;  5KEE A;  4EGV A;  1ENA A;  3TP8 A;  3J80 E;  1SYE A;  2L4N A;  3L9A X;  3NWT A;  2EZV A;  2B2V C;  1FR3 A;  5I9O A;  1G2S A;  5EPK A;  5EPL A;  1BF4 A;  3ERO A;  2LS0 1;  4A3K B;  3NBI A;  4RWS C;  2LMC B;  3RLF A;  2A6E D;  4FF3 A;  1BCP F;  3FDT A;  1OXU A;  3BDO A;  2F0L A;  1HXY D;  4G7O C;  3GTJ B;  1HTL D;  3CQZ B;  4G57 A;  1Q1B A;  2DY7 A;  4FXD A;  1QNK A;  2KOL A;  2VB2 X;  4NDX A;  4Z9C B;  1Z6H A;  3FEW X;  4KMU C;  5I2Y A;  3OMC A;  2EYJ A;  2HCI A;  4WRD A;  5IGF A;  3K57 A;  1PTO H;  3NTI A;  1X32 A;  3VR6 A;  2DY8 A;  3S15 B;  5FO8 B;  1JR0 D;  1TWH B;  1D5X C;  2O5I C;  4HN7 A;  4XTC S;  5EKI A;  2OEO A;  2JEA I;  2EYM A;  5JEA J;  4M8A A;  3V05 A;  3J7Y W;  1F77 A;  1S4Z A;  1RTO A;  2BCO A;  1C48 A;  1RD9 D;  1CHQ D;  1TU2 B;  2F0V A;  2A68 D;  5K36 G;  1Y8P B;  4KK7 A;  3MWY W;  5C4Z A;  2E2H B;  3NWS A;  1JOO A;  2WKC A;  2KCC A;  3S1R B;  5I6W A;  1LTI D;  1VMP A;  1VF5 C;  1TS3 A;  4Q0F A;  3V2T A;  2NTS A;  1F9S A;  3BVM A;  2RDG A;  1IL8 A;  3HOW B;  2B2Y C;  5LHY 1;  4QIW B;  3V96 A;  5D14 A;  2EPB A;  1V1P A;  1FNV A;  3N6R A;  3BS1 A;  1I3Q B;  4HCE A;  1JE4 A;  1T5E A;  1DON A;  2GA4 B;  4YIJ A;  1GUN A;  5M9O A;  2CVR A;  4H7B A;  1HRJ A;  5CBA E;  1SNC A;  3KLR A;  2WAC A;  2MHV A;  2F0D A;  5CV8 A;  4QMG A;  1FGB D;  4A3B B;  5DM7 3;  2DN8 A;  1DOK A;  3DWQ A;  1KLU D;  2CW0 C;  3JAM L;  5JEA H;  2RQX A;  3TDQ A;  3GTK B;  4KV6 A;  1MI2 A;  2F0N A;  3IL8 A;  2K5Q A;  1SEB D;  1Q8I A;  5I9P A;  2EYP A;  5IT9 L;  5IOC A;  4OIK A;  1ESF A;  1JQY D;  1RTN A;  4O42 A;  3HOV B;  1AEX A;  2RVL A;  5CYU A;  3P1H A;  1WTR A;  1D2B A;  4IUR A;  4FF2 A;  1B9M A;  4X3K A;  2F4I A;  4BY1 B;  2X69 A;  4BBS B;  2IWH A;  2NB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...