1S5ED

Cholera holotoxin, crystal form 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase,toxin
molecule keywords Cholera enterotoxin, A chain precursor
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, J, K, L, M, N
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s5eD00
1RCVD 1L0YB 2XNAC 1I4GA 1V1PA 4RGNA 5FKAC 3R2TA 2IPKD 2XRQD 1S5CD 1G8ZD 1SE3A 1PZID 2AQ2B 1B44D 2IJ0A 1TY2A 3URYA 1HA5A 1LTSD 1DYQA 4RGTA 3O13A 1EEFD 1SEBD 1PZJD 2RDHA 1FD7D 1PRTC 1PTOF 2AQ1B 2AQ3B 1ENFA 4UDUC 1GOZA 1LTTD 5I4DA 1JWMD 4RHRA 2QILA 1I4PA 1TY0A 1HQRD 4Z9CB 1QILA 3W2DA 1T5XD 3SEBA 1S5ED 3BYYB 1I4QA 2O2LD 1KLGD 1L0XB 1KLUD 1D5MC 2NTSA 1LTBD 1JWSD 2TSSA 1PTOB 4RFBA 4RGMA 1XTCD 1CT1D 1EU4A 2WV6D 3GP7A 5ELFA 5FK9C 1D5ZC 4RHSA 1BCPF 5ELCA 1D5XC 1STEA 1PRTB 1LTAD 1RDPD 2CHBD 1EU3A 3BVGA 2QEJC 1LT6D 2NTTA 1S5DD 2XRSD 1UNSA 1V1OA 5D3DA 1HXYD 5D3IB 3DWQA 1I4RA 1BCPC 1EWCA 1CQVA 3MC0B 1S5BD 1CHPD 1TS3A 3CHBD 1HTLD 4RCOA 4DXGA 1AW7A 1FGBD 3OWEB 1LT4D 1BCPB 1ESFA 5ELEA 1TS5A 3EA6A 4BWGB 3R8BA 4ZYSA 1JQYD 1AN8A 2J4XA 3DWPA 1CHQD 1LTRD 4K6LA 1JWUD 1SXTA 1M4VA 3BVMA 4L6TB 1SE4A 4DXFA 1FNWA 2SEBD 1B1ZA 1PYWD 3V05A 1EFID 2ICIA 4C56C 3BZDB 3DWAA 1V1PB 3BVZA 4O1NA 1PTOD 1LT3D 1PRTF 1CK1A 1PTOC 1RD9D 1MD2D 1KTKA 2R61A 3EFXD 4L63B 1I4HA 1PZKD 1F77A 1JR0D 1PTOH 1EEID 1DJRD 1FNVA 2Z8LA 3KLSX 4RGOS 1PRTD 4RH6A 2RDGA 5ELBA 1I4XA 1LO5D 1RF2D 1LTID 1LLRD 1TS4A 1FNUA 1XXGA 1LT5D 3TSSA 1D6EC 1ET9A 1SBBB 4OHJA 3R2IA 4TSSA 1SE2A 1S5FD 1SJHD 1SJED 5TSSA 1JCKB 1TS2A 1BCPD 2G9HD 1UUPA 5ELDA 1LTGD 1BXTA 3MFGA 1ET6A 3BYTB 2XN9C
chains in the Genus database with same CATH superfamily
3DEPA 2M00A 1EQVA 2OTJA 5FKAC 2CFMA 4OO1I 3JC66 4JI8Q 4HJ7A 1CFMA 2UUAQ 4Y7NB 5K5PA 2QEXA 1Q86C 1HNWQ 4OWTB 3CCUA 4C2MH 4FVMA 1VQ9A 1JJGA 3PUWA 2KUMA 1SEBD 1S4ZA 2MO0A 3HOVH 1VQIA 2A6HC 3M4OB 4DR5L 1WD1A 5CMDA 2BDOA 3J81i 1CI3M 1NMFA 4HN7A 5KGUA 3GTJB 3CPFA 5IWAL 3CRLC 4GOPA 2JA8H 1WTXA 1AEXA 1HQRD 1E2VA 2K33A 2B39A 4F7XA 4B08A 1KHIA 2LS01 2NVXH 4A3FH 4A3DG 1IKLA 5JVG3 1PFBA 1HRJA 3U4VA 1BCPF 1YHAA 1ENCA 2F0GA 2PCFB 5M3MH 4KN7C 4JI6L 3I4LA 2VQEL 1GUGA 4JI2L 2BOSA 4G57A 5IGDA 3GTPB 4BBSB 1BCPC 2KCNA 3E6ZX 5M9OA 3HOVG 3PF4A 3S2DH 1HTLD 2NB0A 5JAVA 1BCPB 4FXGC 1J6QA 1TWGB 4FDBA 4ILWA 1PH8A 3C2PA 3J7A5 2B8FA 4LF4Q 1HCZA 3CAMA 1FYCA 3MEFA 1E24A 3H3VI 4K6LA 3MA2B 1DGSA 3BVMA 1WD0A 1DXMA 3A7LA 1K3RA 3T1HL 3V96A 2UUBQ 1V1PB 1GUNA 3LGJA 4L63B 3CXCA 3TZUA 1EEID 1SYCA 1I4XA 4LF5Q 4RAUC 3K57A 2D2CC 1YITA 5M3FH 3PSIA 3TBIB 1E22A 4BY1G 3NPPA 4GKJL 4DK1A 1S5FD 5IE8A 3NWSA 3NTKA 2FMCA 3MFGA 2R93G 3H0GB 3Q8DA 1SNCA 1XNRL 1XNQL 1EOTA 3GDEA 1FR3A 2JA7H 3H0GG 2EXZA 3HOZH 2Z1CA 2VZAA 1QE6A 2HDLA 1A3TA 4X65L 1W6KA 3K7AH 2FMMA 1FD7D 2Y0SG 1XWEA 5EPLA 4LF5L 1IXRA 2EOTA 1EY7A 2ZJPA 2ATWA 3U9SA 1QNUA 3D31A 1IHZA 2QILA 4RHRA 3V2TA 1GUWA 2NZHA 4RA8A 2A6ED 3EVQA 2LMCB 5GQOA 3FP9A 1AH9A 1PTOB 5E7NA 3KBGA 1B9MA 4IOCA 5J39A 3HOXG 4RKLA 2R93H 1F2MA 3D4DA 4EX5A 4HJ8A 4N8X1 3FKIH 2A1AA 2B63B 4U68A 1UNSA 2N55A 3G71A 2YTXA 4LFAL 4X62Q 5BR8Q 1GHKA 2PZUA 4HIOA 4PG3A 3MXUA 4F8MA 3S2DB 4GNXB 4OL7A 2Q2UA 4ZK9B 4C3IH 4Q5VA 4ME5A 4B3SL 2KEDA 1Y69U 3PO3H 1PHJA 4P72A 2WB1E 1KAWA 2F0OA 3GD7A 1VQ6A 5FOBB 1JMCA 2IY5B 1IL2A 3I4NB 1N9WA 1XX8A 2SEBD 2PI2A 3ERQA 4AQYQ 3U9OA 5KYLA 1KDAA 4DUYL 4UAIA 3I91A 1XPOA 2R61A 2TMPA 4KI0A 3EFXD 3KDFB 1EYCA 4WFN3 2YTYA 2L1BA 2K32A 3G4SA 4A75A 2M9VA 3BS1A 1N8RC 1NNXA 4K8IA 1S72A 1SFOH 1NR2A 5FLXL 1SMYC 3SDZA 5FO9B 5KEEA 4LMQD 1PH7A 2RCFA 3MXGA 4G7OC 3TZDA 5KYIA 3HRZC 4OO1G 1GHJA 2CW0C 2JN4A 5IP9G 5KNDA 2B2WC 2B2YC 2AUKA 2LY7A 1KDCA 3UDXA 4DR3Q 1HTPA 5A35A 1CQFA 2B29A 2EY1A 1VQ8A 1I4GA 4ZLTF 3FKIG 5FO8B 4IQZA 3CMAA 5BN3A 4DR2L 4IFDI 4LFBL 1C8CA 5HGTA 1R4PB 1X3EA 1MJEA 4DV4L 3JAMc 1OTCA 3EBEA 3M7GA 5CV7A 1Y1VB 3RD4A 1PXUA 2BCOA 1PFNA 1PZJD 3VYTA 1A0IA 5IGGA 5BN4A 3HOWB 4ULLA 3BDOA 2WFWA 4IFDJ 3I4NG 2E76C 4QF4A 3HS0C 4KJNA 2E2HH 3D8GA 3K0XA 1KLGD 1K0SA 1SNDA 1JWSD 4KY5A 1PH4A 4NW2A 2WIIB 3ZYYX 1TWAB 1LACA 1Q82C 5GAHC 3S1QH 1Y14B 2HIVA 3CU7A 1V1QA 1M1KC 5LMUQ 5D65A 2JSOA 2WKCA 2QEJC 2UU9Q 3F2UA 1Y1WG 4CDFC 4XTCS 3TREA 3L7ZC 4A93B 3NK9A 2F0IA 2NN6H 2IHFA 4GLVB 1PH3A 4H13C 1CZGA 4UHVA 2R7ZG 4A93H 4JI6Q 5GROA 2D0OA 2QA4A 1WTOA 3CF5A 1LTRD 5C4JB 1HNXQ 2RSNA 5EBCA 1XMQQ 4YHHQ 4A3IG 3DHQA 1B1ZA 2I46A 1AZPA 4FP5D 5C3XA 1MHWC 1VCIA 1G291 1PTOD 1LT3D 4JI5L 4KY6A 4KK7A 2EDGA 3S1QB 1OO9B 2UXBQ 2Z4IA 3FDTA 1EY6A 1FNVA 2VS1A 3M9BA 1YJ9A 2VB3X 2CWPA 3W5OA 1CA5A 1EQTA 2F0SA 2WAQG 1X9NA 1HZAA 1QVGA 4IUPA 2KCTA 1E7ZA 1SBBB 3A8IE 1OXTA 3SK8A 5CYUA 4TSSA 3K81C 5M3MB 2WAQB 5CGKA 4RMFA 1U5KA 3PMFA 2KBNA 2NN6G 2YU9B 1I94L 4UY8C 3T13A 4A3FB 4LF4L 2H5XA 1GUSA 3DM3A 3BYTB 1X65A 1XTDA 4DR4L 1V1PA 4RGNA 2OXPA 4XT1B 3E0EA 4DV3Q 3NXWA 2K03A 4A3IB 3AMUA 3STBD 1I6HB 3HKZG 4LJZC 1SLJA 3J81E 2LKVA 4R4TA 3QG1A 4NXNL 1EUJA 1SNQA 1CKOA 2RDHA 4DV7L 3H3VC 4DV0L 1X55A 4IURA 4UP7A 3H3VH 2BA0A 1O7ZA 4OELB 2I07B 2ZJQA 4NXMQ 4C3HB 3RN5A 1MJCA 2AMCB 2KENA 4DPGA 5EGTA 5M3FG 2VB2X 1TY0A 2K5HA 5C4HA 2KOLA 1N33Q 5BR8L 4DU9A 4DV6L 5JJIA 1E3PA 3TDQA 3M4PA 3Q24A 4A3EG 4DR4Q 2JEAI 5NUCA 2VY3A 4R8IA 4BY7B 1K8AC 2K5WA 3E9HA 3S14H 2NWGA 3DXJC 3QJYA 4LK1C 3LNNA 1H95A 1HXYD 2Z4HA 1HH2P 1IBML 1V43A 1QCBD 4K0KQ 1CSQA 3P20A 5IGFA 3CHBD 5GADC 4JOIC 2F0LA 1Q8KA 1ESFA 4G7HC 1G51A 2A5HA 3R8BA 2A8VA 1LYLA 2X6LA 1TWHB 2EYHA 2K01A 2SOBA 4C1NI 1ICWA 4L6TB 3I4MG 1DD2A 1E2ZA 1SYDA 2B2YA 2B2WA 4C56C 1X56A 2CH4W 4O1NA 1PTOC 1YEZA 4JI7Q 5FLXc 1HNXL 1B50A 3HKZE 4LUVA 4MHEA 1PTOH 2DJFC 3PUXA 1CSPA 3OMCA 1DJRD 3BDCA 1G2TA 4RGOS 1XMQL 2VXWA 2J7ZA 4YIJA 1ILQA 3QOLA 2DJGC 3SK4A 3S15H 1WCMH 3GTQH 3OTOL 2OQKA 1SYEA 1JB3A 3HOUH 4B3MQ 1YNJC 2F0HA 1A62A 3PUYA 4I65A 1LABA 1ML0D 4L8JA 3CC4A 1QVCA 2IX3A 3SGIA 5C3WA 1ET6A 4GZYC 2JA7B 3DLLA 1Y8NB 5IYCG 2Q2IA 4A3GB 5CBEE 4TQUS 2F0MA 1OXUA 4PMBA 2O5IC 5K36G 3CQZB 2PPBC 2N8NA 4LF6Q 1PRTC 2JA5H 1SR3A 2AQ3B 3MEHA 1B7YB 2F0TA 3SXHA 4A3MH 3OWFA 2KECA 1JWMD 2VNUD 3I72A 1L0WA 2NTSA 2L55A 1H9RA 4BBRH 2I5LX 1XTCD 1CT1D 1EU4A 5FK9C 1AE3A 1LUZA 3HOUB 2JA5G 4IFDG 4K2KA 3CCJA 1PRTB 4DR2Q 3VR5A 3VYSA 1EY5A 3L0OA 3K5NA 4IUUA 5M3MG 1RDPD 4OONA 1XNQQ 3F2BA 2OWOA 2K05A 1Q90A 1STHA 1RTNA 3BG3A 1FGUA 4HIMA 1A6XA 1CQVA 5I6WA 5K36H 1TWGH 4ODGA 2E2JH 1N32Q 3IKJA 4LF9L 5ELEA 4O2DA 1HR0W 1B3AA 1TS5A 5L37A 4JI5Q 3S1MB 4OIJA 4BWGB 4S3SA 4ZYSA 3KOJA 3RZDB 4A3BH 4M1UB 3GTMB 4XQNA 2F0KA 4V0BA 1SE4A 4EQPA 2Q2HA 5C4XH 1X3GA 4CJ0B 3ZJYC 4DXGA 1STBA 4A3CH 3W1BA 4LF7Q 2NVXB 4AQYL 2RHQB 3H91A 4NB3A 2VUMB 3RN2A 1XMOQ 1N36Q 4X66L 3M4QA 1L1OC 4AYBE 5I9OA 4B3RQ 4CDDC 1Y1WH 2MP1A 1KL9A 3RLOA 3TP8A 3C3LA 2E5LQ 4BY7H 3U58A 3DEOA 3RZOB 5C44B 3R3OA 1LM0A 1M8AA 1JCKB 4NDXA 4DUZQ 4CGYB 4GLXA 3W3AA 1HPCA 3PIO3 3HEJA 4ME3A 5DNFA 3S1RB 1W3SA 2VQEQ 1SE3A 4CJ1B 2N78A 1LV9A 2HD3A 5DLQE 3SK6A 4DV5Q 3GTOH 1EL0A 2ZXPA 5DM73 1TY2A 3OIQA 1I5FA 2XVSA 3ER0A 4K6DA 3D6WA 2AQ1B 3S1NB 4B3SQ 5IYDH 1Y1VG 4QJFA 1JE4A 5IODA 4NPSA 4X3TA 3RZOH 2CKZB 1TIID 1STAA 1ZXTA 5C0XH 2C9OA 1K8MA 1KNEA 1QILA 1K28A 2LFNA 3BYYB 2UUBL 4PNYA 2K6AA 4AH6A 4RGMA 1DOLA 1PV4A 3U4ZA 2OEOA 4LUZA 5M5WH 2YU9H 4KKTA 1WOCA 1Z47A 4KV6A 3A0JA 1G6PA 5M5WB 1SNMA 3HZXA 4A3KH 5EKIA 1LT6D 3HKZB 2Z6KA 1VQJA 1X54A 3D6CA 3H94A 5M5XH 2X69A 1SYFA 4YY3L 3MC0B 3A74A 1KNAA 2PQEA 1KQSA 3CCEA 4PV1C 1B2TA 3EA6A 1BBWA 1VF7A 2JYOA 3SR1A 2F3VA 2L4NA 2QGQA 3I2ZA 5JEAH 3SK5A 1X3FA 2J4XA 2A6EC 4HMIA 4GNXC 4A3GG 3PIP3 4DXFA 2YV5A 4DK0A 4DAPA 1EFID 3OSOA 3DWAA 1PLFA 1VMPA 1PRTF 2ZM6Q 3G6JB 1MD2D 3VA5A 4ZKBB 5LL6X 2IHEA 4BBRB 2RDGA 1E0BA 3KK7A 5M5XB 3PO3G 1AZQA 2F0JA 4A3KB 3CCMA 5HURA 1GJXA 1VQPA 2RHSB 4IJHA 5G3LD 5IY0A 4DV4Q 1PH1A 2R7ZB 5A2QE 1STNA 1VQKA 2KHIA 1BCPD 3NSWA 1EY9A 1F9RA 4OGQC 2JA5B 3KFUA 4KHVA 1UUPA 4NKLA 3RLNA 4R4CA 5IGEA 2RVLA 5C3EB 4FXDA 2XNAC 1R9TB 3UDIA 1S5CD 1DONA 1EYDA 4QUCA 2XSCA 4KHPL 3K59A 4X3SA 5E4XA 2MPMA 1JJ2A 2WAQE 1XJVA 1BUVT 2J0TD 4BBSG 5E4WC 3QB3A 5T1IA 1BR9A 3OTOQ 3FEWX 3NBIA 3FVQA 4P75A 2OT2A 2E2IB 2PW7A 4V190 2CQAA 1WVLA 2R92H 1H9SB 3EROA 3W2DA 1S5ED 2KJXA 5IP9H 4IZ8A 1QWYA 4L5TA 3CC7A 2D0PA 5EKLA 2ICEC 3P75A 4RHSA 1YNND 4PMWA 3X3MA 1N33L 1SFOB 2K4KA 1S3OA 5CV4A 4DV1Q 2Y0SE 3TMEA 1ZYRD 1TWHH 1IBLL 4LF6L 5C0XG 1HZBA 2VUMH 3T56B 1U4MA 1CZWA 1H9JA 4X65Q 3VR4A 1QZGA 3K7UC 3D4WA 2EQSA 1JC7A 1FGBD 3J81c 1IBMQ 4M8AA 1JQYD 3OMGA 1NE3A 3I4NH 3ERSX 3D3RA 3HGBA 4RKBA 4CKCA 4A3BB 3S9WA 4WRDA 3BVZA 2B2VA 1RD9D 2OQ0A 4R1JA 1O7YA 2K04A 3AQQA 3LWEA 4N9TA 1SE8A 1R4QB 4JW0A 2R6GA 4C1NK 1F2ZA 3K0YA 4DK6C 3PUZA 5C6AA 4FNFA 4MNOA 3T4AC 2A73B 2E2IH 4JI2Q 4NXML 4DR3L 1I3QB 3MTSA 4EVOA 1VF5C 2CH4A 3F1ZA 1VQCA 1NY4A 3D0FA 3NHHA 2NVYB 5BN5A 5C44G 1JICA 3OW2A 2C35B 2WP8J 1HNZQ 2F0VA 2XRQD 2NVQH 2E5LL 1I6HH 2JA6H 1KABA 4A3IH 3NBHA 4A3MB 5LMNL 1I94Q 3OPOA 1D1IA 4C3HG 1Z6HA 4DA2A 1JOKA 1Q8IA 4JI3Q 1BDOA 1Q12A 1XPUA 3HOZB 1K83H 4GN5A 4P71A 3GQBA 5IP7G 1D8LA 2Q2TA 3J7AF 1P8LA 5EPKA 2K50A 2L9HA 2WKDA 4DV7Q 4N9PA 4CDEC 2O2LD 4YCUA 2SDFA 3KLWA 3M3YH 5LMUL 4BS9A 3NELA 3F2CA 2V4DA 2JQOA 4HAEA 4JBMA 3QWNA 1O78A 5M3FB 1BQQT 4IPCA 3WDNA 2JA9A 3A54A 3I8ZA 2EJFC 1HFGA 1L2FA 3NTIA 4AYBB 3E5SA 4KY7A 5D14A 5IYDG 1UE6A 3NQIA 1H9SA 2EYJA 3KLRA 1IBKQ 1ONLA 5IGCA 2EYPA 2PW5A 1U9RA 1SXTA 2GVAA 4FF1A 1B4OA 4MTNA 3SVMA 1SAPA 3BZDB 3P1HA 1RIPA 1DM0B 3HOXB 1B8AA 3ITPA 4IPGA 2VUMG 2NZOA 2DGYA 3S16B 4H0LC 1VQ5A 3IFTA 1EIYB 3PO2B 4JVZA 1LLRD 3FPUB 1LT5D 3I90A 4YY3Q 3JAMi 1PH6A 1FL0A 1GO3E 1DZ1A 2KHJA 2QDBA 4L5QA 1TS2A 2PZTA 4ZRZA 4A3DB 4DR1L 4UP8A 2D5DA 3CPWA 2B2TC 2VL6A 3C1EA 4HIDA 1VQBA 3R2TA 4G4KA 5DAUA 3GTKH 4A3JG 2N3SA 2IT1A 3HOZG 4UPAA 3M4OH 4XT3B 2A68D 3AYHB 3NP8A 4PZ8A 4AYBG 4X64Q 4B9XA 4LF7L 2EZVA 5C4ZA 2OTLA 3I4MB 3J7ZC 1U4LA 2BE5D 3RUZA 2PQAB 1PFSA 1Y1WB 4BY7G 4QIWB 2F0QA 4QMGA 3CMEA 3K8AA 3N52A 4KHPQ 2A6HD 2R3ZA 2ZT9C 4JCVE 4EGVA 5C5MA 1YHQA 4H44C 1EY4A 3DUZA 1D5MC 4YHHL 1GM5A 4KTAA 4A3FG 4A3DH 4JI0Q 4A76A 3GP7A 5ELFA 1JOQA 4A3EH 5JEAG 4RG1A 4UP9A 4DGZA 2LSSA 4CBVA 3CW2C 3A55A 1NSNS 1PYSB 2DN8A 5IT9L 5IYCH 3I73A 3PCOB 5C0XI 3PO2H 1QZHA 4A3JH 4HTHA 2FJ2A 1ENAA 4R4QA 2BH8A 4O0AA 1CKNA 1JT8A 4P2CB 4DKAC 5EPJA 4B3TL 3PO3B 3RMHA 2CW0D 1CHPD 1YNNC 1VQLA 1QUQA 2DNEA 1KIXA 2NBFA 4OWXB 4YWMA 5HY6A 1VQHA 2XIWA 1VQOA 5AFWA 2ZM6L 4X66Q 2B63H 3FKIB 5CR3A 3TP6A 4ABNA 1GUOA 2R7DA 1Q1BA 2ZTEA 4L5SA 5C3EG 4RCNA 1RHPA 1Z9FA 4A3CG 3CP0A 5C0XJ 1PZKD 4IFDH 2MGSA 1VQMA 2IW3A 3KUPA 4RH6A 3QR8A 2K5NA 2M2LA 1YZ6A 5ELBA 1EZ6A 4JYAQ 4A4IA 4KD4A 5IYBG 5CV9A 1VQNA 1ET9A 4B3TQ 3EJIA 4DV3L 2EYLA 3A8KE 4IUTA 3HKSA 4DAMA 3CD6A 4OX9L 5M5YB 5TSSA 3RR5A 1TWAH 1KC8C 1ZKOA 4OWWB 1XMOL 4B3ML 1MBYA 4FYDA 1SDFA 1EWHA 4A3GH 5JEAJ 1O7IA 5EQ0A 4YWKA 2GN5A 2JE6I 3L9AX 2XWJB 2VQFQ 1F9SA 1K83B 4AIMA 1YVCA 2L11A 3O13A 1PH9A 1CKMA 4MIUA 1NMGA 2UXBL 3OOCA 4DV6Q 3ULPA 4MN3A 4DNRB 1EY0A 3LX0A 1HA6A 5HGQA 5IYBH 4DV2Q 4R9WA 3T53B 2JA6B 4X64L 1IKMA 3KF6A 4B3RL 1Q3LA 2Z9HA 1U4RA 4Z9CB 2NVYH 3SEBA 5EAYA 3J80E 1L0XB 3I3CA 3OIPA 4RFBA 5IOCA 2WV6D 2HCIA 4DFAA 5IGBA 1EYGA 3NBHB 1STEA 3HOYG 2AHOB 1YJNA 4H02A 3PIPA 5I2XA 4KJOA 4GS3A 4BY1H 1EWCA 3KF8B 2PNHA 4K5VA 2NYZD 1TS3A 1VQEA 3AU7A 4C3IG 3A5ZB 2XGTA 3IL8A 1A3VA 4A3BG 3ICEA 3CCVA 4J15A 4A3JB 1YBYA 1D2BA 2R92G 1MSGA 3H15A 1PYWD 5FLXE 1X3PA 2Q8TA 1EIFA 1I6VC 1UE7A 2B8GA 1TWCH 2EYOA 4A3EB 2CCZA 1Q81C 2SNSA 1PFMA 4HCEA 3OHXC 5COYA 1MIUA 4KKUA 3S17B 2FINB 2AKWB 1CKNB 2MO1A 3NUCA 5FLMG 5J3BA 4TVAB 1LO5D 1LTID 3I4OA 3K5MA 3CCRA 1W2BA 2UXCL 3WWVA 3GTJH 1QUQB 2K1BA 1SYGA 4C3HH 4FF2A 3VA7A 1SE2A 2C5CA 4LFCL 1KRSA 2QCPX 2EE1A 1RJTA 1MKHA 5JOBA 1BO0A 4IJLA 1HQMC 1STGA 4QQBX 3EN2A 4IUNA 4DR7Q 1LTGD 4IN3A 1ZYRC 3J81L 1J8IA 2YTVA 3AEVA 2CVRA 3L3OC 3FMCA 2R92B 3F8TA 3J81j 1CM9A 4PMCA 1N34Q 1FJGQ 5JJZA 4KN4C 1V8QA 4N8FA 3TQYA 1IBLQ 1WFQA 4MTKA 1B70B 1J5EL 2UU9L 4KLKA 1QNKA 3BDLA 2IJ0A 4QY7A 5KNCA 2JK8A 1D7QA 1HA5A 2F03A 5E1FA 1K73C 2F0PA 4QB4A 4DAYA 5JPNC 1Z7TA 1A3UA 2E2DC 4XQJA 3KYHC 1N36L 2I5HA 1NTGA 1VQ4A 2JP1A 3S24A 3Q22A 2UXDQ 2N88A 1I4QA 4QGUA 4JBKA 1LTBD 2A68C 1RKNA 3QOJA 5JVH3 1X6OA 5M5YH 3DM1A 3HOXH 1JJCB 1N32L 3PV0A 1O80A 3QO2A 5IT9E 3SE0A 5JJKA 2JEBI 1UEAB 4X3UA 3K5LA 1EU3A 3BVGA 1F9QA 2ASBA 1PMRA 4DV5L 3BZKA 3VDYA 1TR5A 1GXDC 1WTRA 1A15A 1STYA 3A5UA 3GTLB 2P5ZX 3G48A 3HP3A 1KRTA 2HT1A 1UEBA 2HUGA 1YNJD 2NN6I 3BU2A 4NMZA 2QDLA 5IT9c 3ULLA 2PQAA 3NTHA 1BVSA 2WB1B 3KF6B 5AJ3Q 2HHHL 1BBXC 2F4VQ 1ILPA 3NWTA 1PVOA 1EY8A 1UE1A 3Q6SA 4DV1L 1GKHA 3MHBA 4IUVA 4I7ZC 4XDXA 3V05A 1HJPA 2BE5C 2YYZA 3G7LA 4XXEA 5FJ8H 1IYVA 3CC2A 3T51B 1EFWA 1SNOA 2LXKA 3CCLA 1F77A 4QIWE 4R8NA 1HZCA 1JOOA 1V9PA 3GTPH 1P16A 1GUTA 2H4OA 4MZ9A 4QCLA 5KRUA 2K52A 4JI1Q 1GVPA 4TRDA 2QW7A 2F3IA 4GOPC 4HJ5A 2A74C 2A69D 1YIJA 2WB1G 2B2VC 1A2UA 3T1YL 1H9KA 1L1OA 2F1MA 2NVTB 5G3LF 1WTHA 2Z6BA 1Y8OB 4LF9Q 2HQLA 1JE5A 1DOKA 1HHVA 2ZJRA 1KAAA 4DR1Q 2BH2A 5I9PA 5FO7B 3I4MH 2NVQB 4DAVA 2EPBA 1NCVA 5FJ8G 3IFDA 1S40A 4C3JG 2B2TA 3PQIA 4RGTA 3HOVB 1EEFD 2EVBA 5JJLA 4YCWA 3CCSA 4P74A 5ISRA 2Q8RE 1Y8PB 1VQGA 1T9HA 2K7VA 1I3QH 4A93G 4GN3B 2GVBA 3VYUA 3GTKB 4Y7NH 2JJQA 3J80c 1WYDA 1RTOA 5GAGC 1K8GA 3HOUG 4WJWA 1UWVA 1T5XD 4JV5L 2EXDA 2KVMA 5ELOA 2E74C 2EY5A 2Q8IB 1EIGA 1HNZL 1TWCB 3GO5A 5C44H 1EQRA 3UI2A 2CHBD 2CQOA 2MNAA 3KF8A 1V1OA 5IP7H 5D3IB 3DWQA 4JI4Q 1VQ7A 1I4RA 3S16H 4FF3A 4HSVA 2FFKB 4POGA 3HOWG 4RCOA 4JOIA 4F87A 4A3LH 3NQTA 4YWLA 4LNQA 1ESRA 3VR3A 2UUCL 3MFYA 3X3NA 3NENA 2A19A 4BBRG 4LF8L 4C3JH 3TN2A 1KTKA 3P7JA 5H1SE 3A56A 1JR0D 3MVVA 4GKKQ 3T1HQ 1IBKL 2RSOA 1IZ6A 4A3LG 1OXXK 2Z0SA 1FNUA 3K6OA 1VQAA 4DNTB 2UUAL 5J1ZA 5KNBA 3C1FA 4OXPA 1SN8A 2F0UA 3E9IA 4JPBW 3J7YW 1J9OA 1J5EQ 2O4XA 5JPMC 3ONAB 1TWFH 2UUCQ 3MWYW 1I50B 3R2IA 3OW7A 2XN9C 1PYBA 1L0YB 5IIFA 2ZTCA 3L2PA 4DUYQ 2B63G 1PZID 3R93A 3H0GH 4IPHA 1K3BC 2PNRC 3RNUA 3M85A 2F0FA 4P73A 1XPRA 3K58A 1BNZA 2F4VL 2UXCQ 2KCMA 4IO9A 4A3MG 4KMUC 4PZ7A 3T16A 2IX0A 3N6RA 1TXYA 3CCQA 1I50H 4FO2A 1TWFB 4GLAC 3A8JE 2ZXRA 2B2UC 3TS0A 5CC4A 1HR0L 3HFZB 4EQ5A 1D5ZC 1N34L 1SROA 3KJOA 5ELCA 1NR4A 1HNWL 2ZXOA 5J22A 2D62A 4ID6A 1XNRQ 3GTQB 2HHHQ 4E6IA 1G91A 1WCMB 1MSHA 1NAPA 2XRSD 3J80i 5T1GA 2UXDL 1VMCA 1UE5A 4JG2A 4JI0L 1BBUA 1NBWA 3M7NA 3HG9A 2L12A 4ZKCB 3RLFA 4JK1C 1PA6A 4DR6Q 3PIOA 4IPDA 3FHWA 4PQXA 4X62L 5I2YA 1L1OB 4GNXA 2ID0A 4JYAL 4TKOB 4XIGS 2FXQA 3KBXA 1K9MC 2MQHA 2E75C 5IWAQ 3AFQA 1BF4A 2QF7A 3PO2G 4YCVA 2RDFA 1K0RA 1TKWB 3IRBA 1SSOA 4LUOA 2RQXA 4DV0Q 4K5XA 1HFNA 2Z6KC 3HOYH 1OXSC 4DV2L 4CKEA 2XWBB 3VR2A 2JA8B 2JA7G 4JI3L 1T5EA 4F88A 4WJ3M 1M90C 1D6EC 3PGZA 4FXKC 2HCCA 4OHJA 1C4QA 1VQDA 4L5RC 2JA8G 5CV6A 1WJJA 3AB9A 2RBMA 3NE5B 1HUNA 1F2YA 1A2TA 4X3KA 1BXTA 2FHTA 4C2MB 2HQEA 1RCVD 3CRKC 3GTOB 1YI2A 2AQ2B 3MXPA 1E1OA 3S1RH 1ICFB 2G5DA 2QKIC 3ULJA 1C0AA 1KDBA 1LTSD 2L5TA 1CUKA 5E3FA 4BA2I 4LW1A 1EYAA 4LFAQ 3WOEA 1IYUA 4J6HA 4DN4M 5CV8A 5CBAE 4UDUC 3AFPA 1WI5A 1LTTD 3W1GA 2KQ3A 3EQLC 4LWCA 5LMNQ 3KJPA 3GTGB 1H9MA 1I4PA 3MXNA 4DR5Q 3EIVA 1Q1EA 2MHVA 1IL8A 3NEMA 2EJMA 3HOYB 2H1EA 3MAQA 2D9UA 2TSSA 3D4RA 3VYRA 4IUQA 1RODA 1JB7A 2O5JC 1QVFA 1G6ZA 3E0JA 1MI2A 1EWIA 3STBC 3GV3A 4K5WA 5LMNW 3I56A 1LTAD 4JI8L 1E2WA 2I0QA 4A3KG 4JC0A 1YJWA 1EZ8A 2PYKA 3K80C 3GTMH 1XYIA 1WTWA 3I7FA 2EY6A 4HSPA 2MJ8A 1CTMA 3UDFA 2K14A 1QB5D 3S1MH 2IL8A 3G6EA 4KHZA 4CHTB 1AP0A 1CA6A 2ES2A 1TT2A 1BKBA 4JBWA 4HR7B 2MFIA 1LTLA 3TP5A 1G2SA 1OXVA 2OCEA 2VQFL 4OO1H 5C4XG 4IALA 2DNCA 3B6YA 1Q46A 4XYOA 2N49A 4LFCQ 3J80L 1I4HA 1TQOA 5A2QL 3M3YB 2XTIA 2MUYA 1F2LA 3GTLH 3TS2A 4OX9Q 1U0LA 1RF2D 1XXGA 2RKSA 1B9NA 4K0KL 2ZTDA 2RF4A 3UDGA 4WJ4A 2L0CA 2DUDA 1ASYA 1EIHA 2EIFA 3CQZH 1ZEQX 4U673 1EQQA 2E2HB 1D1KA 1BOSA 1SRUA 2NUCA 4H7BA 2RA4A 2V1CC 4DUZL 3GTGH 2K75A 1GD7A 4OIKA 1PH5A 1X32A 5DEHA 2AUJD 1B44D 4EQOA 3J7AV 3URYA 4HCSA 1PTOF 1QOHA 2LXJA 1Y1VH 1DCZA 1ENFA 2AWOA 1C48A 3GV6A 4HIKA 2EYMA 1GOZA 4LAAA 5EBDA 3JAME 4XQQA 1NJIC 3H6MA 3S15B 1VQFA 3F2DA 4POFA 1KXLA 4BA1I 2KCCA 4I7AA 2IX1A 2GA4B 1KLUD 3Q23A 2DY8A 4PZ6A 4ZQ3A 3SHLA 3WOFA 1VDZA 2ALYB 2F0EA 4GN4B 3U50C 2AWNA 4Q0FA 5CORA 3IAYA 5D3DA 2K5QA 3DMUA 4LFBQ 4K2LA 1AE2A 4K8JA 3S2HH 1II3A 3S17H 4NP5A 1YHBA 1C7YA 1WTVA 1E1TA 3PUVA 2PZWA 4HEDA 1AW7A 1LT4D 4QL5A 2NZ1D 1SMYD 3I55A 3QIAA 4R4OA 2PO4A 5C4XB 2KHSA 3S2HB 2I5MX 3LWUA 3UE0A 2BDNA 3DWPA 2OF1A 2WINB 2WACA 4JI7L 4CKBA 5F2DA 3M4YA 2X6GA 3S14B 3PF5A 4OEMB 2EYFA 4DF7A 1FNWA 3RZDH 1HR0Q 5LHY1 1DOMA 3JAML 4C3IB 4NXNQ 4O42A 1CK1A 4JBJA 1B3QA 2CWAA 4DR6L 4KD3A 2E2JB 1FVIA 5GAEC 3KLSX 4CDCC 4BY1B 1PRTD 3BZCA 3TP7A 3UE1A 3K5OA 5EKKA 2B2UA 5FLMH 2ENBA 3BJUA 1TS4A 1WCMG 1IW7C 3E3XA 4HJ9A 2R93B 3A7AB 1HUMA 1SJHD 1JORA 2E8GA 1X3QA 2G9DA 4ZAIA 5KIXA 4GOPB 5ELDA 4ZUIA 1PDQA 1YNXA 1UAPA 1RL2A 2IPKD 4WORA 3Q0AA 2EY2A 4GKJQ 1C9OA 1G8ZD 2HDMA 2JA6G 1R9TH 3I70A 2K5VA 1ASZA 1A63A 5C3EH 4X6AH 2F4IA 4DAYB 1K8OA 1DYQA 4ZCKA 1O7LA 3ND8A 2NVTH 1U4PA 3K7AB 4GKKL 1SMXA 2PI2E 4BXXH 2EJGC 5AJ3L 2R7ZH 4DNIA 3MXNB 5I4DA 1TVXA 3KLSA 5LL6S 3C46A 2F0NA 2JXMB 1MGSA 4R4IA 3ND9A 1PH2A 2F0WA 1WTQA 5ELNA 2VW9A 3TRZA 2SNMA 5EJWA 2PMZE 5I6YA 2K5DA 1D5XC 1SYBA 2L15A 3OYYA 2K28A 3FPPA 4FF4A 1FJGL 1VS0A 2NTTA 1S5DD 4JV5Q 2BA1A 5C4JH 2B3GA 2IWHA 3CKIB 1TU2B 1QJOA 3FRPB 3H09A 3T1YQ 1S5BD 2A69C 2HIXA 4BXXG 1Q7YC 4C3JB 3OWEB 5C5LA 1IW7D 4LF8Q 1WTPA 3VR6A 1AN8A 1A8VA 1CHQD 4B9WA 2R7FA 1JWUD 1M4VA 1QG7A 4KKSA 3TEHB 1NUCA 2ICIA 1F9PA 2Y0SB 4RWSC 4HMJA 5DM63 4APVA 4CJ2C 2F3WA 2Z8LA 4JI1L 4XYQA 4DK3C 2DY7A 4BBSH 4DR7L 4ALPA 2F0DA 3KDFA 4JI4L 4EQNA 2PMZB 4K14A 5CV5A 1W6JA 4G7ZC 3TSSA 4HJAA 4J8QA 4Y52H 2RCNA 2F52A 4IOAA 1B53A 4ZUJA 1SNPA 3HOWH 1SJED 4J1MA 2KA7A 3S1NH 2G9HD 1EOVA 1AFPA 2KEEA 1HZ9A 1IYJB 4QUFA 1KD1C 3MZ5A
chains in the Genus database with same CATH topology
3DEPA 2M00A 1EQVA 5FKAC 4OO1I 1CFMA 4Y7NB 5K5PA 4FVMA 3PUWA 2KUMA 1SEBD 1S4ZA 2A6HC 3M4OB 1WD1A 5CMDA 2BDOA 1CI3M 4HN7A 5KGUA 3GTJB 3CRLC 1WTXA 1AEXA 1HQRD 1E2VA 2K33A 2B39A 4F7XA 4B08A 2LS01 1IKLA 5JVG3 1PFBA 1HRJA 1BCPF 1ENCA 2F0GA 2PCFB 4KN7C 3I4LA 1GUGA 2BOSA 4G57A 5IGDA 3GTPB 4BBSB 1BCPC 2KCNA 3E6ZX 5M9OA 1HTLD 2NB0A 5JAVA 1BCPB 4FXGC 1TWGB 4ILWA 3C2PA 2B8FA 1HCZA 1FYCA 4K6LA 3MA2B 3BVMA 1WD0A 1DXMA 3A7LA 3V96A 1V1PB 1GUNA 4L63B 3TZUA 1EEID 1SYCA 1I4XA 4RAUC 3K57A 2D2CC 3TBIB 3NPPA 4DK1A 1S5FD 3NWSA 3NTKA 2FMCA 3MFGA 3H0GB 1SNCA 1EOTA 1FR3A 2EXZA 2Z1CA 1QE6A 2HDLA 1A3TA 1W6KA 2FMMA 1FD7D 1XWEA 5EPLA 2EOTA 1EY7A 3U9SA 1QNUA 3D31A 1IHZA 2QILA 4RHRA 3V2TA 1GUWA 4RA8A 2A6ED 3EVQA 2LMCB 1PTOB 3KBGA 1B9MA 5J39A 4RKLA 1F2MA 3D4DA 2B63B 4U68A 1UNSA 2N55A 1GHKA 2PZUA 3MXUA 4F8MA 3S2DB 4OL7A 4ZK9B 4Q5VA 4ME5A 2KEDA 1Y69U 2F0OA 3GD7A 5FOBB 3I4NB 1XX8A 2SEBD 3ERQA 5KYLA 3U9OA 1KDAA 4UAIA 3I91A 2R61A 2TMPA 4KI0A 3EFXD 1EYCA 4WFN3 2L1BA 2K32A 2M9VA 3BS1A 4K8IA 1NR2A 5FLXL 1SMYC 3SDZA 5FO9B 5KEEA 4LMQD 3MXGA 4G7OC 3TZDA 5KYIA 3HRZC 4OO1G 1GHJA 2CW0C 5KNDA 2B2WC 2B2YC 2AUKA 2LY7A 1KDCA 1HTPA 5A35A 1CQFA 2EY1A 1I4GA 4ZLTF 5FO8B 4IQZA 5BN3A 4IFDI 1C8CA 5HGTA 1R4PB 3M7GA 5CV7A 1Y1VB 3RD4A 1PXUA 2BCOA 1PFNA 1PZJD 3VYTA 5IGGA 5BN4A 3HOWB 4ULLA 3BDOA 4IFDJ 2E76C 4QF4A 3HS0C 4KJNA 3D8GA 1KLGD 1SNDA 1JWSD 4KY5A 4NW2A 2WIIB 3ZYYX 1TWAB 1LACA 3CU7A 5D65A 2JSOA 2WKCA 2QEJC 3F2UA 4XTCS 3L7ZC 4A93B 3NK9A 2F0IA 2NN6H 4H13C 1CZGA 1WTOA 1LTRD 5C4JB 2RSNA 5EBCA 3DHQA 1B1ZA 1AZPA 2I46A 4FP5D 5C3XA 1VCIA 1G291 1PTOD 1LT3D 4KY6A 2EDGA 4KK7A 3S1QB 1OO9B 2Z4IA 3FDTA 1EY6A 1FNVA 2VB3X 1CA5A 1EQTA 2F0SA 4IUPA 3A8IE 3SK8A 1SBBB 5M3MB 1OXTA 5CYUA 4TSSA 2WAQB 5CGKA 3PMFA 2NN6G 2YU9B 3T13A 4A3FB 1GUSA 3BYTB 1V1PA 4RGNA 2OXPA 4XT1B 4A3IB 3NXWA 2K03A 3AMUA 1I6HB 4LJZC 3J81E 2LKVA 3QG1A 1SNQA 2RDHA 3H3VC 4IURA 2BA0A 1O7ZA 2I07B 4C3HB 5EGTA 2VB2X 1TY0A 5C4HA 2KOLA 4DU9A 3TDQA 3Q24A 2JEAI 5NUCA 4R8IA 4BY7B 2K5WA 2NWGA 3DXJC 3QJYA 4LK1C 3LNNA 1HXYD 2Z4HA 1V43A 1QCBD 3P20A 5IGFA 3CHBD 2F0LA 1ESFA 4G7HC 2A5HA 3R8BA 2X6LA 1TWHB 2EYHA 2K01A 2SOBA 4C1NI 1ICWA 4L6TB 1DD2A 1E2ZA 1SYDA 2B2YA 2B2WA 4C56C 4O1NA 1PTOC 1B50A 4MHEA 1PTOH 3PUXA 3OMCA 1DJRD 3BDCA 1G2TA 4RGOS 2VXWA 2J7ZA 4YIJA 1ILQA 3QOLA 3SK4A 1SYEA 1JB3A 1YNJC 2F0HA 3PUYA 4I65A 1LABA 1ML0D 4L8JA 2IX3A 5C3WA 1ET6A 4GZYC 2JA7B 1Y8NB 4A3GB 5CBEE 4TQUS 2F0MA 1OXUA 4PMBA 2O5IC 5K36G 3CQZB 2PPBC 1PRTC 2AQ3B 3MEHA 2F0TA 3SXHA 3OWFA 2KECA 1JWMD 2VNUD 3I72A 2NTSA 2L55A 1H9RA 1XTCD 1CT1D 1EU4A 5FK9C 3HOUB 4IFDG 4K2KA 1PRTB 3K5NA 3VYSA 1EY5A 3VR5A 4IUUA 1RDPD 2K05A 1Q90A 1STHA 1RTNA 3BG3A 1A6XA 1CQVA 5I6WA 5K36H 4ODGA 3IKJA 5ELEA 1B3AA 1TS5A 3S1MB 4OIJA 4BWGB 4S3SA 4ZYSA 3RZDB 4M1UB 3GTMB 4XQNA 2F0KA 4V0BA 1SE4A 4EQPA 4CJ0B 4DXGA 1STBA 2NVXB 3H91A 2VUMB 5I9OA 2MP1A 3C3LA 3TP8A 3DEOA 3RZOB 5C44B 3R3OA 1M8AA 1JCKB 4NDXA 4CGYB 3W3AA 1HPCA 3PIO3 3HEJA 5DNFA 3S1RB 1SE3A 4CJ1B 1LV9A 3SK6A 1EL0A 2ZXPA 5DM73 1TY2A 3OIQA 2XVSA 4K6DA 3D6WA 2AQ1B 3S1NB 1JE4A 5IODA 4X3TA 1TIID 1STAA 1ZXTA 5C0XH 2C9OA 1K8MA 1KNEA 1QILA 2LFNA 3BYYB 4PNYA 2K6AA 4RGMA 1DOLA 2OEOA 4KKTA 1Z47A 4KV6A 5M5WB 1SNMA 3HZXA 5EKIA 1LT6D 3HKZB 3D6CA 3H94A 2X69A 1SYFA 3MC0B 1KNAA 2PQEA 4PV1C 1B2TA 3EA6A 1VF7A 2JYOA 3SR1A 2F3VA 2L4NA 5JEAH 3SK5A 2J4XA 2A6EC 4HMIA 3PIP3 4DXFA 4DK0A 4DAPA 1EFID 3OSOA 1PLFA 3DWAA 1VMPA 1PRTF 3G6JB 1MD2D 3VA5A 4ZKBB 5LL6X 4BBRB 2RDGA 1E0BA 3KK7A 5M5XB 1AZQA 2F0JA 4A3KB 5HURA 1GJXA 5G3LD 2R7ZB 5A2QE 1STNA 1BCPD 4OGQC 3NSWA 1EY9A 1F9RA 2JA5B 4KHVA 1UUPA 4NKLA 5IGEA 2RVLA 5C3EB 4FXDA 2XNAC 1R9TB 1S5CD 1DONA 1EYDA 4QUCA 2XSCA 3K59A 4X3SA 5E4XA 2MPMA 1BUVT 2J0TD 5E4WC 3QB3A 5T1IA 1BR9A 3FEWX 3NBIA 3FVQA 2OT2A 2E2IB 2PW7A 4V190 2CQAA 1WVLA 1H9SB 3EROA 3W2DA 1S5ED 2KJXA 4IZ8A 1QWYA 5EKLA 2ICEC 3P75A 4RHSA 1YNND 4PMWA 3X3MA 1SFOB 5CV4A 3TMEA 1ZYRD 5C0XG 3T56B 1U4MA 1CZWA 1H9JA 3VR4A 3D4WA 1JC7A 1FGBD 4M8AA 1JQYD 3OMGA 3D3RA 3HGBA 4RKBA 4CKCA 4A3BB 3S9WA 4WRDA 3BVZA 2B2VA 1RD9D 1O7YA 2K04A 3LWEA 4N9TA 1R4QB 2R6GA 4C1NK 1F2ZA 3K0YA 3PUZA 5C6AA 4FNFA 3T4AC 2A73B 1I3QB 3MTSA 4EVOA 1VF5C 3NHHA 2NVYB 5BN5A 1JICA 2WP8J 2F0VA 2XRQD 1KABA 3NBHA 4A3MB 3OPOA 1D1IA 4C3HG 1Z6HA 4DA2A 1JOKA 1Q8IA 1BDOA 1Q12A 3HOZB 3GQBA 3J7AF 5EPKA 2L9HA 2WKDA 4N9PA 2O2LD 2SDFA 4BS9A 2V4DA 4HAEA 1O78A 3QWNA 5M3FB 1BQQT 3WDNA 3A54A 3I8ZA 2EJFC 1HFGA 3NTIA 4AYBB 3E5SA 4KY7A 5D14A 3NQIA 1H9SA 2EYJA 3KLRA 1ONLA 5IGCA 2EYPA 2PW5A 1U9RA 1SXTA 4FF1A 1B4OA 3SVMA 1SAPA 3BZDB 3P1HA 1DM0B 3HOXB 3ITPA 3S16B 4H0LC 3IFTA 3PO2B 1LLRD 3FPUB 1LT5D 3I90A 1DZ1A 2QDBA 1TS2A 2PZTA 4ZRZA 4A3DB 2D5DA 2B2TC 3C1EA 4G4KA 3R2TA 5DAUA 2IT1A 4XT3B 2A68D 3NP8A 4B9XA 2EZVA 5C4ZA 3I4MB 1U4LA 2BE5D 3RUZA 1Y1WB 4QIWB 2F0QA 4QMGA 3N52A 2A6HD 2R3ZA 2ZT9C 4EGVA 5C5MA 4H44C 1EY4A 3DUZA 1D5MC 4KTAA 3GP7A 5ELFA 1JOQA 5JEAG 4DGZA 4CBVA 3A55A 1NSNS 2DN8A 5IT9L 3I73A 5C0XI 4HTHA 2FJ2A 1ENAA 4P2CB 5EPJA 3PO3B 3RMHA 2CW0D 1CHPD 1YNNC 2DNEA 2NBFA 2XIWA 5AFWA 3FKIB 5CR3A 3TP6A 4ABNA 1GUOA 1Q1BA 4RCNA 1RHPA 5C0XJ 1PZKD 4IFDH 2MGSA 2IW3A 3KUPA 4RH6A 2M2LA 5ELBA 1EZ6A 4KD4A 5CV9A 1ET9A 3EJIA 2EYLA 3A8KE 4IUTA 5M5YB 5TSSA 1ZKOA 1MBYA 4FYDA 1SDFA 1EWHA 5JEAJ 5EQ0A 2JE6I 3L9AX 2XWJB 1F9SA 1K83B 2L11A 3O13A 4MIUA 3OOCA 4MN3A 4DNRB 1EY0A 3LX0A 1HA6A 4R9WA 3T53B 2JA6B 1IKMA 1Q3LA 1U4RA 4Z9CB 3SEBA 3J80E 1L0XB 3I3CA 3OIPA 4RFBA 5IOCA 2WV6D 2HCIA 4DFAA 5IGBA 1STEA 5I2XA 4KJOA 1EWCA 4K5VA 2NYZD 1TS3A 3AU7A 4C3IG 3IL8A 1A3VA 4A3JB 1D2BA 1MSGA 1PYWD 5FLXE 1X3PA 2Q8TA 1I6VC 2B8GA 2EYOA 4A3EB 2SNSA 1PFMA 4HCEA 3OHXC 5COYA 4KKUA 3S17B 2FINB 3NUCA 1LO5D 1LTID 3K5MA 2K1BA 1SYGA 4FF2A 3VA7A 1SE2A 2C5CA 2QCPX 2EE1A 1RJTA 5JOBA 1BO0A 1HQMC 1STGA 4IUNA 1LTGD 4IN3A 1ZYRC 3J81L 1J8IA 2CVRA 3L3OC 3FMCA 2R92B 1CM9A 4PMCA 5JJZA 4KN4C 1V8QA 1QNKA 3BDLA 2IJ0A 5KNCA 1HA5A 2F03A 5E1FA 2F0PA 4QB4A 4DAYA 5JPNC 1Z7TA 1A3UA 2E2DC 4XQJA 2JP1A 3Q22A 2N88A 1I4QA 1LTBD 2A68C 1RKNA 3QOJA 5JVH3 3DM1A 3PV0A 1O80A 3QO2A 5IT9E 3SE0A 2JEBI 1UEAB 4X3UA 3K5LA 1EU3A 3BVGA 1F9QA 1PMRA 1TR5A 1GXDC 1WTRA 1A15A 1STYA 3GTLB 3HP3A 2HUGA 1YNJD 2NN6I 4NMZA 3NTHA 2WB1B 1BBXC 1ILPA 3NWTA 1EY8A 3Q6SA 3MHBA 4IUVA 4I7ZC 4XDXA 3V05A 2BE5C 2YYZA 3G7LA 4XXEA 1IYVA 3T51B 1SNOA 1F77A 4R8NA 1JOOA 1GUTA 2H4OA 4QCLA 5KRUA 4TRDA 2A74C 2A69D 2B2VC 1A2UA 1H9KA 2F1MA 2NVTB 5G3LF 1Y8OB 1DOKA 1HHVA 1KAAA 5I9PA 5FO7B 2NVQB 4DAVA 2EPBA 1NCVA 3IFDA 4C3JG 2B2TA 4RGTA 3HOVB 1EEFD 2EVBA 5ISRA 2Q8RE 1Y8PB 2K7VA 3VYUA 3GTKB 1RTOA 4WJWA 1T5XD 2KVMA 2E74C 2EY5A 2Q8IB 1EIGA 1TWCB 3GO5A 3UI2A 3KF8A 1V1OA 5D3IB 3DWQA 1I4RA 4FF3A 4HSVA 2FFKB 4RCOA 4F87A 3NQTA 1ESRA 3VR3A 3MFYA 3X3NA 3TN2A 1KTKA 3P7JA 3A56A 1JR0D 3MVVA 2RSOA 1OXXK 1FNUA 3K6OA 4DNTB 5J1ZA 5KNBA 3C1FA 2F0UA 3J7YW 1J9OA 2O4XA 5JPMC 3ONAB 3MWYW 1I50B 3R2IA 3OW7A 2XN9C 1L0YB 5IIFA 1PZID 3R93A 2PNRC 3M85A 2F0FA 3K58A 1BNZA 4KMUC 3T16A 2IX0A 3N6RA 4FO2A 1TWFB 3A8JE 2ZXRA 2B2UC 5CC4A 1D5ZC 5ELCA 1NR4A 2ZXOA 5J22A 2D62A 4ID6A 3GTQB 4E6IA 1G91A 1WCMB 1MSHA 1NAPA 2XRSD 5T1GA 1VMCA 3M7NA 3HG9A 2L12A 4ZKCB 3RLFA 4JK1C 4PQXA 5I2YA 2ID0A 4TKOB 4XIGS 3KBXA 2E75C 1BF4A 2QF7A 2RDFA 1TKWB 1SSOA 2RQXA 4K5XA 1HFNA 1OXSC 4CKEA 2XWBB 3VR2A 2JA8B 1T5EA 4F88A 1D6EC 4FXKC 2HCCA 4OHJA 1C4QA 5CV6A 3AB9A 2RBMA 3NE5B 1HUNA 1F2YA 1A2TA 4X3KA 1BXTA 2FHTA 4C2MB 2HQEA 1RCVD 3CRKC 3GTOB 2AQ2B 3MXPA 2QKIC 1KDBA 1LTSD 2L5TA 5E3FA 4BA2I 1EYAA 3WOEA 1IYUA 4J6HA 4DN4M 5CV8A 5CBAE 4UDUC 1LTTD 2KQ3A 3EQLC 3GTGB 1H9MA 1I4PA 3MXNA 1Q1EA 2MHVA 1IL8A 2EJMA 3HOYB 2H1EA 3MAQA 2D9UA 2TSSA 3D4RA 3VYRA 4IUQA 1RODA 2O5JC 1G6ZA 3E0JA 1MI2A 3GV3A 4K5WA 1LTAD 1E2WA 1EZ8A 2PYKA 1XYIA 1WTWA 2EY6A 4HSPA 2MJ8A 1CTMA 1QB5D 2IL8A 4KHZA 4CHTB 1AP0A 1CA6A 1TT2A 4JBWA 4HR7B 3TP5A 1G2SA 1OXVA 4OO1H 4IALA 2DNCA 4XYOA 3J80L 1I4HA 1TQOA 5A2QL 3M3YB 2MUYA 1F2LA 2RKSA 1RF2D 1XXGA 1B9NA 2L0CA 1EIHA 1ZEQX 4U673 2E2HB 1D1KA 1BOSA 2NUCA 4H7BA 2RA4A 4OIKA 1X32A 5DEHA 2AUJD 1B44D 4EQOA 3J7AV 3URYA 4HCSA 1PTOF 1QOHA 1DCZA 1ENFA 2AWOA 1C48A 3GV6A 2EYMA 1GOZA 4LAAA 5EBDA 3JAME 4XQQA 3H6MA 3S15B 4BA1I 2KCCA 2IX1A 2GA4B 1KLUD 3Q23A 2DY8A 4ZQ3A 3SHLA 3WOFA 1VDZA 2F0EA 3IAYA 2AWNA 4Q0FA 5CORA 5D3DA 2K5QA 3DMUA 4K2LA 4K8JA 1II3A 4NP5A 1WTVA 3PUVA 2PZWA 4HEDA 1AW7A 1LT4D 2NZ1D 1SMYD 3QIAA 5C4XB 2PO4A 2KHSA 3S2HB 3LWUA 2BDNA 3DWPA 2OF1A 2WINB 2WACA 4CKBA 5F2DA 3M4YA 2X6GA 3S14B 2EYFA 4DF7A 1FNWA 5LHY1 1DOMA 3JAML 4C3IB 4O42A 1CK1A 4KD3A 2E2JB 3KLSX 4BY1B 1PRTD 3TP7A 3K5OA 5EKKA 2B2UA 2ENBA 1TS4A 1IW7C 2R93B 3A7AB 1HUMA 1SJHD 1JORA 1X3QA 2G9DA 4ZAIA 5KIXA 5ELDA 4ZUIA 1PDQA 1UAPA 2IPKD 4WORA 3Q0AA 2EY2A 1G8ZD 2HDMA 3I70A 2F4IA 1K8OA 1DYQA 1O7LA 3ND8A 1U4PA 3K7AB 2EJGC 5I4DA 1TVXA 3KLSA 5LL6S 3C46A 2F0NA 2JXMB 1MGSA 3ND9A 2F0WA 1WTQA 2SNMA 5EJWA 5I6YA 2K5DA 1D5XC 1SYBA 2K28A 3FPPA 4FF4A 2NTTA 1S5DD 2BA1A 2IWHA 3CKIB 1TU2B 1QJOA 3FRPB 3H09A 1S5BD 2A69C 4C3JB 3OWEB 5C5LA 1IW7D 1WTPA 3VR6A 1AN8A 1CHQD 4B9WA 1JWUD 1M4VA 1QG7A 4KKSA 1NUCA 2ICIA 1F9PA 2Y0SB 4RWSC 4HMJA 5DM63 4CJ2C 2F3WA 2Z8LA 4XYQA 2DY7A 2F0DA 4EQNA 2PMZB 4K14A 5CV5A 1W6JA 4G7ZC 3TSSA 4J8QA 1B53A 4ZUJA 1SNPA 1SJED 4J1MA 2KA7A 2G9HD 1AFPA 2KEEA 2CHBD 4QUFA 3MZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCV D;  1L0Y B;  2XNA C;  1I4G A;  1V1P A;  4RGN A;  5FKA C;  3R2T A;  2IPK D;  2XRQ D;  1S5C D;  1G8Z D;  1SE3 A;  1PZI D;  2AQ2 B;  1B44 D;  2IJ0 A;  1TY2 A;  3URY A;  1HA5 A;  1LTS D;  1DYQ A;  4RGT A;  3O13 A;  1EEF D;  1SEB D;  1PZJ D;  2RDH A;  1FD7 D;  1PRT C;  1PTO F;  2AQ1 B;  2AQ3 B;  1ENF A;  4UDU C;  1GOZ A;  1LTT D;  5I4D A;  1JWM D;  4RHR A;  2QIL A;  1I4P A;  1TY0 A;  1HQR D;  4Z9C B;  1QIL A;  3W2D A;  1T5X D;  3SEB A;  1S5E D;  3BYY B;  1I4Q A;  2O2L D;  1KLG D;  1L0X B;  1KLU D;  1D5M C;  2NTS A;  1LTB D;  1JWS D;  2TSS A;  1PTO B;  4RFB A;  4RGM A;  1XTC D;  1CT1 D;  1EU4 A;  2WV6 D;  3GP7 A;  5ELF A;  5FK9 C;  1D5Z C;  4RHS A;  1BCP F;  5ELC A;  1D5X C;  1STE A;  1PRT B;  1LTA D;  1RDP D;  2CHB D;  1EU3 A;  3BVG A;  2QEJ C;  1LT6 D;  2NTT A;  1S5D D;  2XRS D;  1UNS A;  1V1O A;  5D3D A;  1HXY D;  5D3I B;  3DWQ A;  1I4R A;  1BCP C;  1EWC A;  1CQV A;  3MC0 B;  1S5B D;  1CHP D;  1TS3 A;  3CHB D;  1HTL D;  4RCO A;  4DXG A;  1AW7 A;  1FGB D;  3OWE B;  1LT4 D;  1BCP B;  1ESF A;  5ELE A;  1TS5 A;  3EA6 A;  4BWG B;  3R8B A;  4ZYS A;  1JQY D;  1AN8 A;  2J4X A;  3DWP A;  1CHQ D;  1LTR D;  4K6L A;  1JWU D;  1SXT A;  1M4V A;  3BVM A;  4L6T B;  1SE4 A;  4DXF A;  1FNW A;  2SEB D;  1B1Z A;  1PYW D;  3V05 A;  1EFI D;  2ICI A;  4C56 C;  3BZD B;  3DWA A;  1V1P B;  3BVZ A;  4O1N A;  1PTO D;  1LT3 D;  1PRT F;  1CK1 A;  1PTO C;  1RD9 D;  1MD2 D;  1KTK A;  2R61 A;  3EFX D;  4L63 B;  1I4H A;  1PZK D;  1F77 A;  1JR0 D;  1PTO H;  1EEI D;  1DJR D;  1FNV A;  2Z8L A;  3KLS X;  4RGO S;  1PRT D;  4RH6 A;  2RDG A;  5ELB A;  1I4X A;  1LO5 D;  1RF2 D;  1LTI D;  1LLR D;  1TS4 A;  1FNU A;  1XXG A;  1LT5 D;  3TSS A;  1D6E C;  1ET9 A;  1SBB B;  4OHJ A;  3R2I A;  4TSS A;  1SE2 A;  1S5F D;  1SJH D;  1SJE D;  5TSS A;  1JCK B;  1TS2 A;  1BCP D;  2G9H D;  1UUP A;  5ELD A;  1LTG D;  1BXT A;  3MFG A;  1ET6 A;  3BYT B;  2XN9 C; 
#chains in the Genus database with same CATH topology
 3DEP A;  2M00 A;  1EQV A;  2OTJ A;  5FKA C;  2CFM A;  4OO1 I;  3JC6 6;  4JI8 Q;  4HJ7 A;  1CFM A;  2UUA Q;  4Y7N B;  5K5P A;  2QEX A;  1Q86 C;  1HNW Q;  4OWT B;  3CCU A;  4C2M H;  4FVM A;  1VQ9 A;  1JJG A;  3PUW A;  2KUM A;  1SEB D;  1S4Z A;  2MO0 A;  3HOV H;  1VQI A;  2A6H C;  3M4O B;  4DR5 L;  1WD1 A;  5CMD A;  2BDO A;  3J81 i;  1CI3 M;  1NMF A;  4HN7 A;  5KGU A;  3GTJ B;  3CPF A;  5IWA L;  3CRL C;  4GOP A;  2JA8 H;  1WTX A;  1AEX A;  1HQR D;  1E2V A;  2K33 A;  2B39 A;  4F7X A;  4B08 A;  1KHI A;  2LS0 1;  2NVX H;  4A3F H;  4A3D G;  1IKL A;  5JVG 3;  1PFB A;  1HRJ A;  3U4V A;  1BCP F;  1YHA A;  1ENC A;  2F0G A;  2PCF B;  5M3M H;  4KN7 C;  4JI6 L;  3I4L A;  2VQE L;  1GUG A;  4JI2 L;  2BOS A;  4G57 A;  5IGD A;  3GTP B;  4BBS B;  1BCP C;  2KCN A;  3E6Z X;  5M9O A;  3HOV G;  3PF4 A;  3S2D H;  1HTL D;  2NB0 A;  5JAV A;  1BCP B;  4FXG C;  1J6Q A;  1TWG B;  4FDB A;  4ILW A;  1PH8 A;  3C2P A;  3J7A 5;  2B8F A;  4LF4 Q;  1HCZ A;  3CAM A;  1FYC A;  3MEF A;  1E24 A;  3H3V I;  4K6L A;  3MA2 B;  1DGS A;  3BVM A;  1WD0 A;  1DXM A;  3A7L A;  1K3R A;  3T1H L;  3V96 A;  2UUB Q;  1V1P B;  1GUN A;  3LGJ A;  4L63 B;  3CXC A;  3TZU A;  1EEI D;  1SYC A;  1I4X A;  4LF5 Q;  4RAU C;  3K57 A;  2D2C C;  1YIT A;  5M3F H;  3PSI A;  3TBI B;  1E22 A;  4BY1 G;  3NPP A;  4GKJ L;  4DK1 A;  1S5F D;  5IE8 A;  3NWS A;  3NTK A;  2FMC A;  3MFG A;  2R93 G;  3H0G B;  3Q8D A;  1SNC A;  1XNR L;  1XNQ L;  1EOT A;  3GDE A;  1FR3 A;  2JA7 H;  3H0G G;  2EXZ A;  3HOZ H;  2Z1C A;  2VZA A;  1QE6 A;  2HDL A;  1A3T A;  4X65 L;  1W6K A;  3K7A H;  2FMM A;  1FD7 D;  2Y0S G;  1XWE A;  5EPL A;  4LF5 L;  1IXR A;  2EOT A;  1EY7 A;  2ZJP A;  2ATW A;  3U9S A;  1QNU A;  3D31 A;  1IHZ A;  2QIL A;  4RHR A;  3V2T A;  1GUW A;  2NZH A;  4RA8 A;  2A6E D;  3EVQ A;  2LMC B;  5GQO A;  3FP9 A;  1AH9 A;  1PTO B;  5E7N A;  3KBG A;  1B9M A;  4IOC A;  5J39 A;  3HOX G;  4RKL A;  2R93 H;  1F2M A;  3D4D A;  4EX5 A;  4HJ8 A;  4N8X 1;  3FKI H;  2A1A A;  2B63 B;  4U68 A;  1UNS A;  2N55 A;  3G71 A;  2YTX A;  4LFA L;  4X62 Q;  5BR8 Q;  1GHK A;  2PZU A;  4HIO A;  4PG3 A;  3MXU A;  4F8M A;  3S2D B;  4GNX B;  4OL7 A;  2Q2U A;  4ZK9 B;  4C3I H;  4Q5V A;  4ME5 A;  4B3S L;  2KED A;  1Y69 U;  3PO3 H;  1PHJ A;  4P72 A;  2WB1 E;  1KAW A;  2F0O A;  3GD7 A;  1VQ6 A;  5FOB B;  1JMC A;  2IY5 B;  1IL2 A;  3I4N B;  1N9W A;  1XX8 A;  2SEB D;  2PI2 A;  3ERQ A;  4AQY Q;  3U9O A;  5KYL A;  1KDA A;  4DUY L;  4UAI A;  3I91 A;  1XPO A;  2R61 A;  2TMP A;  4KI0 A;  3EFX D;  3KDF B;  1EYC A;  4WFN 3;  2YTY A;  2L1B A;  2K32 A;  3G4S A;  4A75 A;  2M9V A;  3BS1 A;  1N8R C;  1NNX A;  4K8I A;  1S72 A;  1SFO H;  1NR2 A;  5FLX L;  1SMY C;  3SDZ A;  5FO9 B;  5KEE A;  4LMQ D;  1PH7 A;  2RCF A;  3MXG A;  4G7O C;  3TZD A;  5KYI A;  3HRZ C;  4OO1 G;  1GHJ A;  2CW0 C;  2JN4 A;  5IP9 G;  5KND A;  2B2W C;  2B2Y C;  2AUK A;  2LY7 A;  1KDC A;  3UDX A;  4DR3 Q;  1HTP A;  5A35 A;  1CQF A;  2B29 A;  2EY1 A;  1VQ8 A;  1I4G A;  4ZLT F;  3FKI G;  5FO8 B;  4IQZ A;  3CMA A;  5BN3 A;  4DR2 L;  4IFD I;  4LFB L;  1C8C A;  5HGT A;  1R4P B;  1X3E A;  1MJE A;  4DV4 L;  3JAM c;  1OTC A;  3EBE A;  3M7G A;  5CV7 A;  1Y1V B;  3RD4 A;  1PXU A;  2BCO A;  1PFN A;  1PZJ D;  3VYT A;  1A0I A;  5IGG A;  5BN4 A;  3HOW B;  4ULL A;  3BDO A;  2WFW A;  4IFD J;  3I4N G;  2E76 C;  4QF4 A;  3HS0 C;  4KJN A;  2E2H H;  3D8G A;  3K0X A;  1KLG D;  1K0S A;  1SND A;  1JWS D;  4KY5 A;  1PH4 A;  4NW2 A;  2WII B;  3ZYY X;  1TWA B;  1LAC A;  1Q82 C;  5GAH C;  3S1Q H;  1Y14 B;  2HIV A;  3CU7 A;  1V1Q A;  1M1K C;  5LMU Q;  5D65 A;  2JSO A;  2WKC A;  2QEJ C;  2UU9 Q;  3F2U A;  1Y1W G;  4CDF C;  4XTC S;  3TRE A;  3L7Z C;  4A93 B;  3NK9 A;  2F0I A;  2NN6 H;  2IHF A;  4GLV B;  1PH3 A;  4H13 C;  1CZG A;  4UHV A;  2R7Z G;  4A93 H;  4JI6 Q;  5GRO A;  2D0O A;  2QA4 A;  1WTO A;  3CF5 A;  1LTR D;  5C4J B;  1HNX Q;  2RSN A;  5EBC A;  1XMQ Q;  4YHH Q;  4A3I G;  3DHQ A;  1B1Z A;  2I46 A;  1AZP A;  4FP5 D;  5C3X A;  1MHW C;  1VCI A;  1G29 1;  1PTO D;  1LT3 D;  4JI5 L;  4KY6 A;  4KK7 A;  2EDG A;  3S1Q B;  1OO9 B;  2UXB Q;  2Z4I A;  3FDT A;  1EY6 A;  1FNV A;  2VS1 A;  3M9B A;  1YJ9 A;  2VB3 X;  2CWP A;  3W5O A;  1CA5 A;  1EQT A;  2F0S A;  2WAQ G;  1X9N A;  1HZA A;  1QVG A;  4IUP A;  2KCT A;  1E7Z A;  1SBB B;  3A8I E;  1OXT A;  3SK8 A;  5CYU A;  4TSS A;  3K81 C;  5M3M B;  2WAQ B;  5CGK A;  4RMF A;  1U5K A;  3PMF A;  2KBN A;  2NN6 G;  2YU9 B;  1I94 L;  4UY8 C;  3T13 A;  4A3F B;  4LF4 L;  2H5X A;  1GUS A;  3DM3 A;  3BYT B;  1X65 A;  1XTD A;  4DR4 L;  1V1P A;  4RGN A;  2OXP A;  4XT1 B;  3E0E A;  4DV3 Q;  3NXW A;  2K03 A;  4A3I B;  3AMU A;  3STB D;  1I6H B;  3HKZ G;  4LJZ C;  1SLJ A;  3J81 E;  2LKV A;  4R4T A;  3QG1 A;  4NXN L;  1EUJ A;  1SNQ A;  1CKO A;  2RDH A;  4DV7 L;  3H3V C;  4DV0 L;  1X55 A;  4IUR A;  4UP7 A;  3H3V H;  2BA0 A;  1O7Z A;  4OEL B;  2I07 B;  2ZJQ A;  4NXM Q;  4C3H B;  3RN5 A;  1MJC A;  2AMC B;  2KEN A;  4DPG A;  5EGT A;  5M3F G;  2VB2 X;  1TY0 A;  2K5H A;  5C4H A;  2KOL A;  1N33 Q;  5BR8 L;  4DU9 A;  4DV6 L;  5JJI A;  1E3P A;  3TDQ A;  3M4P A;  3Q24 A;  4A3E G;  4DR4 Q;  2JEA I;  5NUC A;  2VY3 A;  4R8I A;  4BY7 B;  1K8A C;  2K5W A;  3E9H A;  3S14 H;  2NWG A;  3DXJ C;  3QJY A;  4LK1 C;  3LNN A;  1H95 A;  1HXY D;  2Z4H A;  1HH2 P;  1IBM L;  1V43 A;  1QCB D;  4K0K Q;  1CSQ A;  3P20 A;  5IGF A;  3CHB D;  5GAD C;  4JOI C;  2F0L A;  1Q8K A;  1ESF A;  4G7H C;  1G51 A;  2A5H A;  3R8B A;  2A8V A;  1LYL A;  2X6L A;  1TWH B;  2EYH A;  2K01 A;  2SOB A;  4C1N I;  1ICW A;  4L6T B;  3I4M G;  1DD2 A;  1E2Z A;  1SYD A;  2B2Y A;  2B2W A;  4C56 C;  1X56 A;  2CH4 W;  4O1N A;  1PTO C;  1YEZ A;  4JI7 Q;  5FLX c;  1HNX L;  1B50 A;  3HKZ E;  4LUV A;  4MHE A;  1PTO H;  2DJF C;  3PUX A;  1CSP A;  3OMC A;  1DJR D;  3BDC A;  1G2T A;  4RGO S;  1XMQ L;  2VXW A;  2J7Z A;  4YIJ A;  1ILQ A;  3QOL A;  2DJG C;  3SK4 A;  3S15 H;  1WCM H;  3GTQ H;  3OTO L;  2OQK A;  1SYE A;  1JB3 A;  3HOU H;  4B3M Q;  1YNJ C;  2F0H A;  1A62 A;  3PUY A;  4I65 A;  1LAB A;  1ML0 D;  4L8J A;  3CC4 A;  1QVC A;  2IX3 A;  3SGI A;  5C3W A;  1ET6 A;  4GZY C;  2JA7 B;  3DLL A;  1Y8N B;  5IYC G;  2Q2I A;  4A3G B;  5CBE E;  4TQU S;  2F0M A;  1OXU A;  4PMB A;  2O5I C;  5K36 G;  3CQZ B;  2PPB C;  2N8N A;  4LF6 Q;  1PRT C;  2JA5 H;  1SR3 A;  2AQ3 B;  3MEH A;  1B7Y B;  2F0T A;  3SXH A;  4A3M H;  3OWF A;  2KEC A;  1JWM D;  2VNU D;  3I72 A;  1L0W A;  2NTS A;  2L55 A;  1H9R A;  4BBR H;  2I5L X;  1XTC D;  1CT1 D;  1EU4 A;  5FK9 C;  1AE3 A;  1LUZ A;  3HOU B;  2JA5 G;  4IFD G;  4K2K A;  3CCJ A;  1PRT B;  4DR2 Q;  3VR5 A;  3VYS A;  1EY5 A;  3L0O A;  3K5N A;  4IUU A;  5M3M G;  1RDP D;  4OON A;  1XNQ Q;  3F2B A;  2OWO A;  2K05 A;  1Q90 A;  1STH A;  1RTN A;  3BG3 A;  1FGU A;  4HIM A;  1A6X A;  1CQV A;  5I6W A;  5K36 H;  1TWG H;  4ODG A;  2E2J H;  1N32 Q;  3IKJ A;  4LF9 L;  5ELE A;  4O2D A;  1HR0 W;  1B3A A;  1TS5 A;  5L37 A;  4JI5 Q;  3S1M B;  4OIJ A;  4BWG B;  4S3S A;  4ZYS A;  3KOJ A;  3RZD B;  4A3B H;  4M1U B;  3GTM B;  4XQN A;  2F0K A;  4V0B A;  1SE4 A;  4EQP A;  2Q2H A;  5C4X H;  1X3G A;  4CJ0 B;  3ZJY C;  4DXG A;  1STB A;  4A3C H;  3W1B A;  4LF7 Q;  2NVX B;  4AQY L;  2RHQ B;  3H91 A;  4NB3 A;  2VUM B;  3RN2 A;  1XMO Q;  1N36 Q;  4X66 L;  3M4Q A;  1L1O C;  4AYB E;  5I9O A;  4B3R Q;  4CDD C;  1Y1W H;  2MP1 A;  1KL9 A;  3RLO A;  3TP8 A;  3C3L A;  2E5L Q;  4BY7 H;  3U58 A;  3DEO A;  3RZO B;  5C44 B;  3R3O A;  1LM0 A;  1M8A A;  1JCK B;  4NDX A;  4DUZ Q;  4CGY B;  4GLX A;  3W3A A;  1HPC A;  3PIO 3;  3HEJ A;  4ME3 A;  5DNF A;  3S1R B;  1W3S A;  2VQE Q;  1SE3 A;  4CJ1 B;  2N78 A;  1LV9 A;  2HD3 A;  5DLQ E;  3SK6 A;  4DV5 Q;  3GTO H;  1EL0 A;  2ZXP A;  5DM7 3;  1TY2 A;  3OIQ A;  1I5F A;  2XVS A;  3ER0 A;  4K6D A;  3D6W A;  2AQ1 B;  3S1N B;  4B3S Q;  5IYD H;  1Y1V G;  4QJF A;  1JE4 A;  5IOD A;  4NPS A;  4X3T A;  3RZO H;  2CKZ B;  1TII D;  1STA A;  1ZXT A;  5C0X H;  2C9O A;  1K8M A;  1KNE A;  1QIL A;  1K28 A;  2LFN A;  3BYY B;  2UUB L;  4PNY A;  2K6A A;  4AH6 A;  4RGM A;  1DOL A;  1PV4 A;  3U4Z A;  2OEO A;  4LUZ A;  5M5W H;  2YU9 H;  4KKT A;  1WOC A;  1Z47 A;  4KV6 A;  3A0J A;  1G6P A;  5M5W B;  1SNM A;  3HZX A;  4A3K H;  5EKI A;  1LT6 D;  3HKZ B;  2Z6K A;  1VQJ A;  1X54 A;  3D6C A;  3H94 A;  5M5X H;  2X69 A;  1SYF A;  4YY3 L;  3MC0 B;  3A74 A;  1KNA A;  2PQE A;  1KQS A;  3CCE A;  4PV1 C;  1B2T A;  3EA6 A;  1BBW A;  1VF7 A;  2JYO A;  3SR1 A;  2F3V A;  2L4N A;  2QGQ A;  3I2Z A;  5JEA H;  3SK5 A;  1X3F A;  2J4X A;  2A6E C;  4HMI A;  4GNX C;  4A3G G;  3PIP 3;  4DXF A;  2YV5 A;  4DK0 A;  4DAP A;  1EFI D;  3OSO A;  3DWA A;  1PLF A;  1VMP A;  1PRT F;  2ZM6 Q;  3G6J B;  1MD2 D;  3VA5 A;  4ZKB B;  5LL6 X;  2IHE A;  4BBR B;  2RDG A;  1E0B A;  3KK7 A;  5M5X B;  3PO3 G;  1AZQ A;  2F0J A;  4A3K B;  3CCM A;  5HUR A;  1GJX A;  1VQP A;  2RHS B;  4IJH A;  5G3L D;  5IY0 A;  4DV4 Q;  1PH1 A;  2R7Z B;  5A2Q E;  1STN A;  1VQK A;  2KHI A;  1BCP D;  3NSW A;  1EY9 A;  1F9R A;  4OGQ C;  2JA5 B;  3KFU A;  4KHV A;  1UUP A;  4NKL A;  3RLN A;  4R4C A;  5IGE A;  2RVL A;  5C3E B;  4FXD A;  2XNA C;  1R9T B;  3UDI A;  1S5C D;  1DON A;  1EYD A;  4QUC A;  2XSC A;  4KHP L;  3K59 A;  4X3S A;  5E4X A;  2MPM A;  1JJ2 A;  2WAQ E;  1XJV A;  1BUV T;  2J0T D;  4BBS G;  5E4W C;  3QB3 A;  5T1I A;  1BR9 A;  3OTO Q;  3FEW X;  3NBI A;  3FVQ A;  4P75 A;  2OT2 A;  2E2I B;  2PW7 A;  4V19 0;  2CQA A;  1WVL A;  2R92 H;  1H9S B;  3ERO A;  3W2D A;  1S5E D;  2KJX A;  5IP9 H;  4IZ8 A;  1QWY A;  4L5T A;  3CC7 A;  2D0P A;  5EKL A;  2ICE C;  3P75 A;  4RHS A;  1YNN D;  4PMW A;  3X3M A;  1N33 L;  1SFO B;  2K4K A;  1S3O A;  5CV4 A;  4DV1 Q;  2Y0S E;  3TME A;  1ZYR D;  1TWH H;  1IBL L;  4LF6 L;  5C0X G;  1HZB A;  2VUM H;  3T56 B;  1U4M A;  1CZW A;  1H9J A;  4X65 Q;  3VR4 A;  1QZG A;  3K7U C;  3D4W A;  2EQS A;  1JC7 A;  1FGB D;  3J81 c;  1IBM Q;  4M8A A;  1JQY D;  3OMG A;  1NE3 A;  3I4N H;  3ERS X;  3D3R A;  3HGB A;  4RKB A;  4CKC A;  4A3B B;  3S9W A;  4WRD A;  3BVZ A;  2B2V A;  1RD9 D;  2OQ0 A;  4R1J A;  1O7Y A;  2K04 A;  3AQQ A;  3LWE A;  4N9T A;  1SE8 A;  1R4Q B;  4JW0 A;  2R6G A;  4C1N K;  1F2Z A;  3K0Y A;  4DK6 C;  3PUZ A;  5C6A A;  4FNF A;  4MNO A;  3T4A C;  2A73 B;  2E2I H;  4JI2 Q;  4NXM L;  4DR3 L;  1I3Q B;  3MTS A;  4EVO A;  1VF5 C;  2CH4 A;  3F1Z A;  1VQC A;  1NY4 A;  3D0F A;  3NHH A;  2NVY B;  5BN5 A;  5C44 G;  1JIC A;  3OW2 A;  2C35 B;  2WP8 J;  1HNZ Q;  2F0V A;  2XRQ D;  2NVQ H;  2E5L L;  1I6H H;  2JA6 H;  1KAB A;  4A3I H;  3NBH A;  4A3M B;  5LMN L;  1I94 Q;  3OPO A;  1D1I A;  4C3H G;  1Z6H A;  4DA2 A;  1JOK A;  1Q8I A;  4JI3 Q;  1BDO A;  1Q12 A;  1XPU A;  3HOZ B;  1K83 H;  4GN5 A;  4P71 A;  3GQB A;  5IP7 G;  1D8L A;  2Q2T A;  3J7A F;  1P8L A;  5EPK A;  2K50 A;  2L9H A;  2WKD A;  4DV7 Q;  4N9P A;  4CDE C;  2O2L D;  4YCU A;  2SDF A;  3KLW A;  3M3Y H;  5LMU L;  4BS9 A;  3NEL A;  3F2C A;  2V4D A;  2JQO A;  4HAE A;  4JBM A;  3QWN A;  1O78 A;  5M3F B;  1BQQ T;  4IPC A;  3WDN A;  2JA9 A;  3A54 A;  3I8Z A;  2EJF C;  1HFG A;  1L2F A;  3NTI A;  4AYB B;  3E5S A;  4KY7 A;  5D14 A;  5IYD G;  1UE6 A;  3NQI A;  1H9S A;  2EYJ A;  3KLR A;  1IBK Q;  1ONL A;  5IGC A;  2EYP A;  2PW5 A;  1U9R A;  1SXT A;  2GVA A;  4FF1 A;  1B4O A;  4MTN A;  3SVM A;  1SAP A;  3BZD B;  3P1H A;  1RIP A;  1DM0 B;  3HOX B;  1B8A A;  3ITP A;  4IPG A;  2VUM G;  2NZO A;  2DGY A;  3S16 B;  4H0L C;  1VQ5 A;  3IFT A;  1EIY B;  3PO2 B;  4JVZ A;  1LLR D;  3FPU B;  1LT5 D;  3I90 A;  4YY3 Q;  3JAM i;  1PH6 A;  1FL0 A;  1GO3 E;  1DZ1 A;  2KHJ A;  2QDB A;  4L5Q A;  1TS2 A;  2PZT A;  4ZRZ A;  4A3D B;  4DR1 L;  4UP8 A;  2D5D A;  3CPW A;  2B2T C;  2VL6 A;  3C1E A;  4HID A;  1VQB A;  3R2T A;  4G4K A;  5DAU A;  3GTK H;  4A3J G;  2N3S A;  2IT1 A;  3HOZ G;  4UPA A;  3M4O H;  4XT3 B;  2A68 D;  3AYH B;  3NP8 A;  4PZ8 A;  4AYB G;  4X64 Q;  4B9X A;  4LF7 L;  2EZV A;  5C4Z A;  2OTL A;  3I4M B;  3J7Z C;  1U4L A;  2BE5 D;  3RUZ A;  2PQA B;  1PFS A;  1Y1W B;  4BY7 G;  4QIW B;  2F0Q A;  4QMG A;  3CME A;  3K8A A;  3N52 A;  4KHP Q;  2A6H D;  2R3Z A;  2ZT9 C;  4JCV E;  4EGV A;  5C5M A;  1YHQ A;  4H44 C;  1EY4 A;  3DUZ A;  1D5M C;  4YHH L;  1GM5 A;  4KTA A;  4A3F G;  4A3D H;  4JI0 Q;  4A76 A;  3GP7 A;  5ELF A;  1JOQ A;  4A3E H;  5JEA G;  4RG1 A;  4UP9 A;  4DGZ A;  2LSS A;  4CBV A;  3CW2 C;  3A55 A;  1NSN S;  1PYS B;  2DN8 A;  5IT9 L;  5IYC H;  3I73 A;  3PCO B;  5C0X I;  3PO2 H;  1QZH A;  4A3J H;  4HTH A;  2FJ2 A;  1ENA A;  4R4Q A;  2BH8 A;  4O0A A;  1CKN A;  1JT8 A;  4P2C B;  4DKA C;  5EPJ A;  4B3T L;  3PO3 B;  3RMH A;  2CW0 D;  1CHP D;  1YNN C;  1VQL A;  1QUQ A;  2DNE A;  1KIX A;  2NBF A;  4OWX B;  4YWM A;  5HY6 A;  1VQH A;  2XIW A;  1VQO A;  5AFW A;  2ZM6 L;  4X66 Q;  2B63 H;  3FKI B;  5CR3 A;  3TP6 A;  4ABN A;  1GUO A;  2R7D A;  1Q1B A;  2ZTE A;  4L5S A;  5C3E G;  4RCN A;  1RHP A;  1Z9F A;  4A3C G;  3CP0 A;  5C0X J;  1PZK D;  4IFD H;  2MGS A;  1VQM A;  2IW3 A;  3KUP A;  4RH6 A;  3QR8 A;  2K5N A;  2M2L A;  1YZ6 A;  5ELB A;  1EZ6 A;  4JYA Q;  4A4I A;  4KD4 A;  5IYB G;  5CV9 A;  1VQN A;  1ET9 A;  4B3T Q;  3EJI A;  4DV3 L;  2EYL A;  3A8K E;  4IUT A;  3HKS A;  4DAM A;  3CD6 A;  4OX9 L;  5M5Y B;  5TSS A;  3RR5 A;  1TWA H;  1KC8 C;  1ZKO A;  4OWW B;  1XMO L;  4B3M L;  1MBY A;  4FYD A;  1SDF A;  1EWH A;  4A3G H;  5JEA J;  1O7I A;  5EQ0 A;  4YWK A;  2GN5 A;  2JE6 I;  3L9A X;  2XWJ B;  2VQF Q;  1F9S A;  1K83 B;  4AIM A;  1YVC A;  2L11 A;  3O13 A;  1PH9 A;  1CKM A;  4MIU A;  1NMG A;  2UXB L;  3OOC A;  4DV6 Q;  3ULP A;  4MN3 A;  4DNR B;  1EY0 A;  3LX0 A;  1HA6 A;  5HGQ A;  5IYB H;  4DV2 Q;  4R9W A;  3T53 B;  2JA6 B;  4X64 L;  1IKM A;  3KF6 A;  4B3R L;  1Q3L A;  2Z9H A;  1U4R A;  4Z9C B;  2NVY H;  3SEB A;  5EAY A;  3J80 E;  1L0X B;  3I3C A;  3OIP A;  4RFB A;  5IOC A;  2WV6 D;  2HCI A;  4DFA A;  5IGB A;  1EYG A;  3NBH B;  1STE A;  3HOY G;  2AHO B;  1YJN A;  4H02 A;  3PIP A;  5I2X A;  4KJO A;  4GS3 A;  4BY1 H;  1EWC A;  3KF8 B;  2PNH A;  4K5V A;  2NYZ D;  1TS3 A;  1VQE A;  3AU7 A;  4C3I G;  3A5Z B;  2XGT A;  3IL8 A;  1A3V A;  4A3B G;  3ICE A;  3CCV A;  4J15 A;  4A3J B;  1YBY A;  1D2B A;  2R92 G;  1MSG A;  3H15 A;  1PYW D;  5FLX E;  1X3P A;  2Q8T A;  1EIF A;  1I6V C;  1UE7 A;  2B8G A;  1TWC H;  2EYO A;  4A3E B;  2CCZ A;  1Q81 C;  2SNS A;  1PFM A;  4HCE A;  3OHX C;  5COY A;  1MIU A;  4KKU A;  3S17 B;  2FIN B;  2AKW B;  1CKN B;  2MO1 A;  3NUC A;  5FLM G;  5J3B A;  4TVA B;  1LO5 D;  1LTI D;  3I4O A;  3K5M A;  3CCR A;  1W2B A;  2UXC L;  3WWV A;  3GTJ H;  1QUQ B;  2K1B A;  1SYG A;  4C3H H;  4FF2 A;  3VA7 A;  1SE2 A;  2C5C A;  4LFC L;  1KRS A;  2QCP X;  2EE1 A;  1RJT A;  1MKH A;  5JOB A;  1BO0 A;  4IJL A;  1HQM C;  1STG A;  4QQB X;  3EN2 A;  4IUN A;  4DR7 Q;  1LTG D;  4IN3 A;  1ZYR C;  3J81 L;  1J8I A;  2YTV A;  3AEV A;  2CVR A;  3L3O C;  3FMC A;  2R92 B;  3F8T A;  3J81 j;  1CM9 A;  4PMC A;  1N34 Q;  1FJG Q;  5JJZ A;  4KN4 C;  1V8Q A;  4N8F A;  3TQY A;  1IBL Q;  1WFQ A;  4MTK A;  1B70 B;  1J5E L;  2UU9 L;  4KLK A;  1QNK A;  3BDL A;  2IJ0 A;  4QY7 A;  5KNC A;  2JK8 A;  1D7Q A;  1HA5 A;  2F03 A;  5E1F A;  1K73 C;  2F0P A;  4QB4 A;  4DAY A;  5JPN C;  1Z7T A;  1A3U A;  2E2D C;  4XQJ A;  3KYH C;  1N36 L;  2I5H A;  1NTG A;  1VQ4 A;  2JP1 A;  3S24 A;  3Q22 A;  2UXD Q;  2N88 A;  1I4Q A;  4QGU A;  4JBK A;  1LTB D;  2A68 C;  1RKN A;  3QOJ A;  5JVH 3;  1X6O A;  5M5Y H;  3DM1 A;  3HOX H;  1JJC B;  1N32 L;  3PV0 A;  1O80 A;  3QO2 A;  5IT9 E;  3SE0 A;  5JJK A;  2JEB I;  1UEA B;  4X3U A;  3K5L A;  1EU3 A;  3BVG A;  1F9Q A;  2ASB A;  1PMR A;  4DV5 L;  3BZK A;  3VDY A;  1TR5 A;  1GXD C;  1WTR A;  1A15 A;  1STY A;  3A5U A;  3GTL B;  2P5Z X;  3G48 A;  3HP3 A;  1KRT A;  2HT1 A;  1UEB A;  2HUG A;  1YNJ D;  2NN6 I;  3BU2 A;  4NMZ A;  2QDL A;  5IT9 c;  3ULL A;  2PQA A;  3NTH A;  1BVS A;  2WB1 B;  3KF6 B;  5AJ3 Q;  2HHH L;  1BBX C;  2F4V Q;  1ILP A;  3NWT A;  1PVO A;  1EY8 A;  1UE1 A;  3Q6S A;  4DV1 L;  1GKH A;  3MHB A;  4IUV A;  4I7Z C;  4XDX A;  3V05 A;  1HJP A;  2BE5 C;  2YYZ A;  3G7L A;  4XXE A;  5FJ8 H;  1IYV A;  3CC2 A;  3T51 B;  1EFW A;  1SNO A;  2LXK A;  3CCL A;  1F77 A;  4QIW E;  4R8N A;  1HZC A;  1JOO A;  1V9P A;  3GTP H;  1P16 A;  1GUT A;  2H4O A;  4MZ9 A;  4QCL A;  5KRU A;  2K52 A;  4JI1 Q;  1GVP A;  4TRD A;  2QW7 A;  2F3I A;  4GOP C;  4HJ5 A;  2A74 C;  2A69 D;  1YIJ A;  2WB1 G;  2B2V C;  1A2U A;  3T1Y L;  1H9K A;  1L1O A;  2F1M A;  2NVT B;  5G3L F;  1WTH A;  2Z6B A;  1Y8O B;  4LF9 Q;  2HQL A;  1JE5 A;  1DOK A;  1HHV A;  2ZJR A;  1KAA A;  4DR1 Q;  2BH2 A;  5I9P A;  5FO7 B;  3I4M H;  2NVQ B;  4DAV A;  2EPB A;  1NCV A;  5FJ8 G;  3IFD A;  1S40 A;  4C3J G;  2B2T A;  3PQI A;  4RGT A;  3HOV B;  1EEF D;  2EVB A;  5JJL A;  4YCW A;  3CCS A;  4P74 A;  5ISR A;  2Q8R E;  1Y8P B;  1VQG A;  1T9H A;  2K7V A;  1I3Q H;  4A93 G;  4GN3 B;  2GVB A;  3VYU A;  3GTK B;  4Y7N H;  2JJQ A;  3J80 c;  1WYD A;  1RTO A;  5GAG C;  1K8G A;  3HOU G;  4WJW A;  1UWV A;  1T5X D;  4JV5 L;  2EXD A;  2KVM A;  5ELO A;  2E74 C;  2EY5 A;  2Q8I B;  1EIG A;  1HNZ L;  1TWC B;  3GO5 A;  5C44 H;  1EQR A;  3UI2 A;  2CHB D;  2CQO A;  2MNA A;  3KF8 A;  1V1O A;  5IP7 H;  5D3I B;  3DWQ A;  4JI4 Q;  1VQ7 A;  1I4R A;  3S16 H;  4FF3 A;  4HSV A;  2FFK B;  4POG A;  3HOW G;  4RCO A;  4JOI A;  4F87 A;  4A3L H;  3NQT A;  4YWL A;  4LNQ A;  1ESR A;  3VR3 A;  2UUC L;  3MFY A;  3X3N A;  3NEN A;  2A19 A;  4BBR G;  4LF8 L;  4C3J H;  3TN2 A;  1KTK A;  3P7J A;  5H1S E;  3A56 A;  1JR0 D;  3MVV A;  4GKK Q;  3T1H Q;  1IBK L;  2RSO A;  1IZ6 A;  4A3L G;  1OXX K;  2Z0S A;  1FNU A;  3K6O A;  1VQA A;  4DNT B;  2UUA L;  5J1Z A;  5KNB A;  3C1F A;  4OXP A;  1SN8 A;  2F0U A;  3E9I A;  4JPB W;  3J7Y W;  1J9O A;  1J5E Q;  2O4X A;  5JPM C;  3ONA B;  1TWF H;  2UUC Q;  3MWY W;  1I50 B;  3R2I A;  3OW7 A;  2XN9 C;  1PYB A;  1L0Y B;  5IIF A;  2ZTC A;  3L2P A;  4DUY Q;  2B63 G;  1PZI D;  3R93 A;  3H0G H;  4IPH A;  1K3B C;  2PNR C;  3RNU A;  3M85 A;  2F0F A;  4P73 A;  1XPR A;  3K58 A;  1BNZ A;  2F4V L;  2UXC Q;  2KCM A;  4IO9 A;  4A3M G;  4KMU C;  4PZ7 A;  3T16 A;  2IX0 A;  3N6R A;  1TXY A;  3CCQ A;  1I50 H;  4FO2 A;  1TWF B;  4GLA C;  3A8J E;  2ZXR A;  2B2U C;  3TS0 A;  5CC4 A;  1HR0 L;  3HFZ B;  4EQ5 A;  1D5Z C;  1N34 L;  1SRO A;  3KJO A;  5ELC A;  1NR4 A;  1HNW L;  2ZXO A;  5J22 A;  2D62 A;  4ID6 A;  1XNR Q;  3GTQ B;  2HHH Q;  4E6I A;  1G91 A;  1WCM B;  1MSH A;  1NAP A;  2XRS D;  3J80 i;  5T1G A;  2UXD L;  1VMC A;  1UE5 A;  4JG2 A;  4JI0 L;  1BBU A;  1NBW A;  3M7N A;  3HG9 A;  2L12 A;  4ZKC B;  3RLF A;  4JK1 C;  1PA6 A;  4DR6 Q;  3PIO A;  4IPD A;  3FHW A;  4PQX A;  4X62 L;  5I2Y A;  1L1O B;  4GNX A;  2ID0 A;  4JYA L;  4TKO B;  4XIG S;  2FXQ A;  3KBX A;  1K9M C;  2MQH A;  2E75 C;  5IWA Q;  3AFQ A;  1BF4 A;  2QF7 A;  3PO2 G;  4YCV A;  2RDF A;  1K0R A;  1TKW B;  3IRB A;  1SSO A;  4LUO A;  2RQX A;  4DV0 Q;  4K5X A;  1HFN A;  2Z6K C;  3HOY H;  1OXS C;  4DV2 L;  4CKE A;  2XWB B;  3VR2 A;  2JA8 B;  2JA7 G;  4JI3 L;  1T5E A;  4F88 A;  4WJ3 M;  1M90 C;  1D6E C;  3PGZ A;  4FXK C;  2HCC A;  4OHJ A;  1C4Q A;  1VQD A;  4L5R C;  2JA8 G;  5CV6 A;  1WJJ A;  3AB9 A;  2RBM A;  3NE5 B;  1HUN A;  1F2Y A;  1A2T A;  4X3K A;  1BXT A;  2FHT A;  4C2M B;  2HQE A;  1RCV D;  3CRK C;  3GTO B;  1YI2 A;  2AQ2 B;  3MXP A;  1E1O A;  3S1R H;  1ICF B;  2G5D A;  2QKI C;  3ULJ A;  1C0A A;  1KDB A;  1LTS D;  2L5T A;  1CUK A;  5E3F A;  4BA2 I;  4LW1 A;  1EYA A;  4LFA Q;  3WOE A;  1IYU A;  4J6H A;  4DN4 M;  5CV8 A;  5CBA E;  4UDU C;  3AFP A;  1WI5 A;  1LTT D;  3W1G A;  2KQ3 A;  3EQL C;  4LWC A;  5LMN Q;  3KJP A;  3GTG B;  1H9M A;  1I4P A;  3MXN A;  4DR5 Q;  3EIV A;  1Q1E A;  2MHV A;  1IL8 A;  3NEM A;  2EJM A;  3HOY B;  2H1E A;  3MAQ A;  2D9U A;  2TSS A;  3D4R A;  3VYR A;  4IUQ A;  1ROD A;  1JB7 A;  2O5J C;  1QVF A;  1G6Z A;  3E0J A;  1MI2 A;  1EWI A;  3STB C;  3GV3 A;  4K5W A;  5LMN W;  3I56 A;  1LTA D;  4JI8 L;  1E2W A;  2I0Q A;  4A3K G;  4JC0 A;  1YJW A;  1EZ8 A;  2PYK A;  3K80 C;  3GTM H;  1XYI A;  1WTW A;  3I7F A;  2EY6 A;  4HSP A;  2MJ8 A;  1CTM A;  3UDF A;  2K14 A;  1QB5 D;  3S1M H;  2IL8 A;  3G6E A;  4KHZ A;  4CHT B;  1AP0 A;  1CA6 A;  2ES2 A;  1TT2 A;  1BKB A;  4JBW A;  4HR7 B;  2MFI A;  1LTL A;  3TP5 A;  1G2S A;  1OXV A;  2OCE A;  2VQF L;  4OO1 H;  5C4X G;  4IAL A;  2DNC A;  3B6Y A;  1Q46 A;  4XYO A;  2N49 A;  4LFC Q;  3J80 L;  1I4H A;  1TQO A;  5A2Q L;  3M3Y B;  2XTI A;  2MUY A;  1F2L A;  3GTL H;  3TS2 A;  4OX9 Q;  1U0L A;  1RF2 D;  1XXG A;  2RKS A;  1B9N A;  4K0K L;  2ZTD A;  2RF4 A;  3UDG A;  4WJ4 A;  2L0C A;  2DUD A;  1ASY A;  1EIH A;  2EIF A;  3CQZ H;  1ZEQ X;  4U67 3;  1EQQ A;  2E2H B;  1D1K A;  1BOS A;  1SRU A;  2NUC A;  4H7B A;  2RA4 A;  2V1C C;  4DUZ L;  3GTG H;  2K75 A;  1GD7 A;  4OIK A;  1PH5 A;  1X32 A;  5DEH A;  2AUJ D;  1B44 D;  4EQO A;  3J7A V;  3URY A;  4HCS A;  1PTO F;  1QOH A;  2LXJ A;  1Y1V H;  1DCZ A;  1ENF A;  2AWO A;  1C48 A;  3GV6 A;  4HIK A;  2EYM A;  1GOZ A;  4LAA A;  5EBD A;  3JAM E;  4XQQ A;  1NJI C;  3H6M A;  3S15 B;  1VQF A;  3F2D A;  4POF A;  1KXL A;  4BA1 I;  2KCC A;  4I7A A;  2IX1 A;  2GA4 B;  1KLU D;  3Q23 A;  2DY8 A;  4PZ6 A;  4ZQ3 A;  3SHL A;  3WOF A;  1VDZ A;  2ALY B;  2F0E A;  4GN4 B;  3U50 C;  2AWN A;  4Q0F A;  5COR A;  3IAY A;  5D3D A;  2K5Q A;  3DMU A;  4LFB Q;  4K2L A;  1AE2 A;  4K8J A;  3S2H H;  1II3 A;  3S17 H;  4NP5 A;  1YHB A;  1C7Y A;  1WTV A;  1E1T A;  3PUV A;  2PZW A;  4HED A;  1AW7 A;  1LT4 D;  4QL5 A;  2NZ1 D;  1SMY D;  3I55 A;  3QIA A;  4R4O A;  2PO4 A;  5C4X B;  2KHS A;  3S2H B;  2I5M X;  3LWU A;  3UE0 A;  2BDN A;  3DWP A;  2OF1 A;  2WIN B;  2WAC A;  4JI7 L;  4CKB A;  5F2D A;  3M4Y A;  2X6G A;  3S14 B;  3PF5 A;  4OEM B;  2EYF A;  4DF7 A;  1FNW A;  3RZD H;  1HR0 Q;  5LHY 1;  1DOM A;  3JAM L;  4C3I B;  4NXN Q;  4O42 A;  1CK1 A;  4JBJ A;  1B3Q A;  2CWA A;  4DR6 L;  4KD3 A;  2E2J B;  1FVI A;  5GAE C;  3KLS X;  4CDC C;  4BY1 B;  1PRT D;  3BZC A;  3TP7 A;  3UE1 A;  3K5O A;  5EKK A;  2B2U A;  5FLM H;  2ENB A;  3BJU A;  1TS4 A;  1WCM G;  1IW7 C;  3E3X A;  4HJ9 A;  2R93 B;  3A7A B;  1HUM A;  1SJH D;  1JOR A;  2E8G A;  1X3Q A;  2G9D A;  4ZAI A;  5KIX A;  4GOP B;  5ELD A;  4ZUI A;  1PDQ A;  1YNX A;  1UAP A;  1RL2 A;  2IPK D;  4WOR A;  3Q0A A;  2EY2 A;  4GKJ Q;  1C9O A;  1G8Z D;  2HDM A;  2JA6 G;  1R9T H;  3I70 A;  2K5V A;  1ASZ A;  1A63 A;  5C3E H;  4X6A H;  2F4I A;  4DAY B;  1K8O A;  1DYQ A;  4ZCK A;  1O7L A;  3ND8 A;  2NVT H;  1U4P A;  3K7A B;  4GKK L;  1SMX A;  2PI2 E;  4BXX H;  2EJG C;  5AJ3 L;  2R7Z H;  4DNI A;  3MXN B;  5I4D A;  1TVX A;  3KLS A;  5LL6 S;  3C46 A;  2F0N A;  2JXM B;  1MGS A;  4R4I A;  3ND9 A;  1PH2 A;  2F0W A;  1WTQ A;  5ELN A;  2VW9 A;  3TRZ A;  2SNM A;  5EJW A;  2PMZ E;  5I6Y A;  2K5D A;  1D5X C;  1SYB A;  2L15 A;  3OYY A;  2K28 A;  3FPP A;  4FF4 A;  1FJG L;  1VS0 A;  2NTT A;  1S5D D;  4JV5 Q;  2BA1 A;  5C4J H;  2B3G A;  2IWH A;  3CKI B;  1TU2 B;  1QJO A;  3FRP B;  3H09 A;  3T1Y Q;  1S5B D;  2A69 C;  2HIX A;  4BXX G;  1Q7Y C;  4C3J B;  3OWE B;  5C5L A;  1IW7 D;  4LF8 Q;  1WTP A;  3VR6 A;  1AN8 A;  1A8V A;  1CHQ D;  4B9W A;  2R7F A;  1JWU D;  1M4V A;  1QG7 A;  4KKS A;  3TEH B;  1NUC A;  2ICI A;  1F9P A;  2Y0S B;  4RWS C;  4HMJ A;  5DM6 3;  4APV A;  4CJ2 C;  2F3W A;  2Z8L A;  4JI1 L;  4XYQ A;  4DK3 C;  2DY7 A;  4BBS H;  4DR7 L;  4ALP A;  2F0D A;  3KDF A;  4JI4 L;  4EQN A;  2PMZ B;  4K14 A;  5CV5 A;  1W6J A;  4G7Z C;  3TSS A;  4HJA A;  4J8Q A;  4Y52 H;  2RCN A;  2F52 A;  4IOA A;  1B53 A;  4ZUJ A;  1SNP A;  3HOW H;  1SJE D;  4J1M A;  2KA7 A;  3S1N H;  2G9H D;  1EOV A;  1AFP A;  2KEE A;  1HZ9 A;  1IYJ B;  4QUF A;  1KD1 C;  3MZ5 A; 
#chains in the Genus database with same CATH homology
 3DEP A;  2M00 A;  1EQV A;  5FKA C;  4OO1 I;  1CFM A;  4Y7N B;  5K5P A;  4FVM A;  3PUW A;  2KUM A;  1SEB D;  1S4Z A;  2A6H C;  3M4O B;  1WD1 A;  5CMD A;  2BDO A;  1CI3 M;  4HN7 A;  5KGU A;  3GTJ B;  3CRL C;  1WTX A;  1AEX A;  1HQR D;  1E2V A;  2K33 A;  2B39 A;  4F7X A;  4B08 A;  2LS0 1;  1IKL A;  5JVG 3;  1PFB A;  1HRJ A;  1BCP F;  1ENC A;  2F0G A;  2PCF B;  4KN7 C;  3I4L A;  1GUG A;  2BOS A;  4G57 A;  5IGD A;  3GTP B;  4BBS B;  1BCP C;  2KCN A;  3E6Z X;  5M9O A;  1HTL D;  2NB0 A;  5JAV A;  1BCP B;  4FXG C;  1TWG B;  4ILW A;  3C2P A;  2B8F A;  1HCZ A;  1FYC A;  4K6L A;  3MA2 B;  3BVM A;  1WD0 A;  1DXM A;  3A7L A;  3V96 A;  1V1P B;  1GUN A;  4L63 B;  3TZU A;  1EEI D;  1SYC A;  1I4X A;  4RAU C;  3K57 A;  2D2C C;  3TBI B;  3NPP A;  4DK1 A;  1S5F D;  3NWS A;  3NTK A;  2FMC A;  3MFG A;  3H0G B;  1SNC A;  1EOT A;  1FR3 A;  2EXZ A;  2Z1C A;  1QE6 A;  2HDL A;  1A3T A;  1W6K A;  2FMM A;  1FD7 D;  1XWE A;  5EPL A;  2EOT A;  1EY7 A;  3U9S A;  1QNU A;  3D31 A;  1IHZ A;  2QIL A;  4RHR A;  3V2T A;  1GUW A;  4RA8 A;  2A6E D;  3EVQ A;  2LMC B;  1PTO B;  3KBG A;  1B9M A;  5J39 A;  4RKL A;  1F2M A;  3D4D A;  2B63 B;  4U68 A;  1UNS A;  2N55 A;  1GHK A;  2PZU A;  3MXU A;  4F8M A;  3S2D B;  4OL7 A;  4ZK9 B;  4Q5V A;  4ME5 A;  2KED A;  1Y69 U;  2F0O A;  3GD7 A;  5FOB B;  3I4N B;  1XX8 A;  2SEB D;  3ERQ A;  5KYL A;  3U9O A;  1KDA A;  4UAI A;  3I91 A;  2R61 A;  2TMP A;  4KI0 A;  3EFX D;  1EYC A;  4WFN 3;  2L1B A;  2K32 A;  2M9V A;  3BS1 A;  4K8I A;  1NR2 A;  5FLX L;  1SMY C;  3SDZ A;  5FO9 B;  5KEE A;  4LMQ D;  3MXG A;  4G7O C;  3TZD A;  5KYI A;  3HRZ C;  4OO1 G;  1GHJ A;  2CW0 C;  5KND A;  2B2W C;  2B2Y C;  2AUK A;  2LY7 A;  1KDC A;  1HTP A;  5A35 A;  1CQF A;  2EY1 A;  1I4G A;  4ZLT F;  5FO8 B;  4IQZ A;  5BN3 A;  4IFD I;  1C8C A;  5HGT A;  1R4P B;  3M7G A;  5CV7 A;  1Y1V B;  3RD4 A;  1PXU A;  2BCO A;  1PFN A;  1PZJ D;  3VYT A;  5IGG A;  5BN4 A;  3HOW B;  4ULL A;  3BDO A;  4IFD J;  2E76 C;  4QF4 A;  3HS0 C;  4KJN A;  3D8G A;  1KLG D;  1SND A;  1JWS D;  4KY5 A;  4NW2 A;  2WII B;  3ZYY X;  1TWA B;  1LAC A;  3CU7 A;  5D65 A;  2JSO A;  2WKC A;  2QEJ C;  3F2U A;  4XTC S;  3L7Z C;  4A93 B;  3NK9 A;  2F0I A;  2NN6 H;  4H13 C;  1CZG A;  1WTO A;  1LTR D;  5C4J B;  2RSN A;  5EBC A;  3DHQ A;  1B1Z A;  1AZP A;  2I46 A;  4FP5 D;  5C3X A;  1VCI A;  1G29 1;  1PTO D;  1LT3 D;  4KY6 A;  2EDG A;  4KK7 A;  3S1Q B;  1OO9 B;  2Z4I A;  3FDT A;  1EY6 A;  1FNV A;  2VB3 X;  1CA5 A;  1EQT A;  2F0S A;  4IUP A;  3A8I E;  3SK8 A;  1SBB B;  5M3M B;  1OXT A;  5CYU A;  4TSS A;  2WAQ B;  5CGK A;  3PMF A;  2NN6 G;  2YU9 B;  3T13 A;  4A3F B;  1GUS A;  3BYT B;  1V1P A;  4RGN A;  2OXP A;  4XT1 B;  4A3I B;  3NXW A;  2K03 A;  3AMU A;  1I6H B;  4LJZ C;  3J81 E;  2LKV A;  3QG1 A;  1SNQ A;  2RDH A;  3H3V C;  4IUR A;  2BA0 A;  1O7Z A;  2I07 B;  4C3H B;  5EGT A;  2VB2 X;  1TY0 A;  5C4H A;  2KOL A;  4DU9 A;  3TDQ A;  3Q24 A;  2JEA I;  5NUC A;  4R8I A;  4BY7 B;  2K5W A;  2NWG A;  3DXJ C;  3QJY A;  4LK1 C;  3LNN A;  1HXY D;  2Z4H A;  1V43 A;  1QCB D;  3P20 A;  5IGF A;  3CHB D;  2F0L A;  1ESF A;  4G7H C;  2A5H A;  3R8B A;  2X6L A;  1TWH B;  2EYH A;  2K01 A;  2SOB A;  4C1N I;  1ICW A;  4L6T B;  1DD2 A;  1E2Z A;  1SYD A;  2B2Y A;  2B2W A;  4C56 C;  4O1N A;  1PTO C;  1B50 A;  4MHE A;  1PTO H;  3PUX A;  3OMC A;  1DJR D;  3BDC A;  1G2T A;  4RGO S;  2VXW A;  2J7Z A;  4YIJ A;  1ILQ A;  3QOL A;  3SK4 A;  1SYE A;  1JB3 A;  1YNJ C;  2F0H A;  3PUY A;  4I65 A;  1LAB A;  1ML0 D;  4L8J A;  2IX3 A;  5C3W A;  1ET6 A;  4GZY C;  2JA7 B;  1Y8N B;  4A3G B;  5CBE E;  4TQU S;  2F0M A;  1OXU A;  4PMB A;  2O5I C;  5K36 G;  3CQZ B;  2PPB C;  1PRT C;  2AQ3 B;  3MEH A;  2F0T A;  3SXH A;  3OWF A;  2KEC A;  1JWM D;  2VNU D;  3I72 A;  2NTS A;  2L55 A;  1H9R A;  1XTC D;  1CT1 D;  1EU4 A;  5FK9 C;  3HOU B;  4IFD G;  4K2K A;  1PRT B;  3K5N A;  3VYS A;  1EY5 A;  3VR5 A;  4IUU A;  1RDP D;  2K05 A;  1Q90 A;  1STH A;  1RTN A;  3BG3 A;  1A6X A;  1CQV A;  5I6W A;  5K36 H;  4ODG A;  3IKJ A;  5ELE A;  1B3A A;  1TS5 A;  3S1M B;  4OIJ A;  4BWG B;  4S3S A;  4ZYS A;  3RZD B;  4M1U B;  3GTM B;  4XQN A;  2F0K A;  4V0B A;  1SE4 A;  4EQP A;  4CJ0 B;  4DXG A;  1STB A;  2NVX B;  3H91 A;  2VUM B;  5I9O A;  2MP1 A;  3C3L A;  3TP8 A;  3DEO A;  3RZO B;  5C44 B;  3R3O A;  1M8A A;  1JCK B;  4NDX A;  4CGY B;  3W3A A;  1HPC A;  3PIO 3;  3HEJ A;  5DNF A;  3S1R B;  1SE3 A;  4CJ1 B;  1LV9 A;  3SK6 A;  1EL0 A;  2ZXP A;  5DM7 3;  1TY2 A;  3OIQ A;  2XVS A;  4K6D A;  3D6W A;  2AQ1 B;  3S1N B;  1JE4 A;  5IOD A;  4X3T A;  1TII D;  1STA A;  1ZXT A;  5C0X H;  2C9O A;  1K8M A;  1KNE A;  1QIL A;  2LFN A;  3BYY B;  4PNY A;  2K6A A;  4RGM A;  1DOL A;  2OEO A;  4KKT A;  1Z47 A;  4KV6 A;  5M5W B;  1SNM A;  3HZX A;  5EKI A;  1LT6 D;  3HKZ B;  3D6C A;  3H94 A;  2X69 A;  1SYF A;  3MC0 B;  1KNA A;  2PQE A;  4PV1 C;  1B2T A;  3EA6 A;  1VF7 A;  2JYO A;  3SR1 A;  2F3V A;  2L4N A;  5JEA H;  3SK5 A;  2J4X A;  2A6E C;  4HMI A;  3PIP 3;  4DXF A;  4DK0 A;  4DAP A;  1EFI D;  3OSO A;  1PLF A;  3DWA A;  1VMP A;  1PRT F;  3G6J B;  1MD2 D;  3VA5 A;  4ZKB B;  5LL6 X;  4BBR B;  2RDG A;  1E0B A;  3KK7 A;  5M5X B;  1AZQ A;  2F0J A;  4A3K B;  5HUR A;  1GJX A;  5G3L D;  2R7Z B;  5A2Q E;  1STN A;  1BCP D;  4OGQ C;  3NSW A;  1EY9 A;  1F9R A;  2JA5 B;  4KHV A;  1UUP A;  4NKL A;  5IGE A;  2RVL A;  5C3E B;  4FXD A;  2XNA C;  1R9T B;  1S5C D;  1DON A;  1EYD A;  4QUC A;  2XSC A;  3K59 A;  4X3S A;  5E4X A;  2MPM A;  1BUV T;  2J0T D;  5E4W C;  3QB3 A;  5T1I A;  1BR9 A;  3FEW X;  3NBI A;  3FVQ A;  2OT2 A;  2E2I B;  2PW7 A;  4V19 0;  2CQA A;  1WVL A;  1H9S B;  3ERO A;  3W2D A;  1S5E D;  2KJX A;  4IZ8 A;  1QWY A;  5EKL A;  2ICE C;  3P75 A;  4RHS A;  1YNN D;  4PMW A;  3X3M A;  1SFO B;  5CV4 A;  3TME A;  1ZYR D;  5C0X G;  3T56 B;  1U4M A;  1CZW A;  1H9J A;  3VR4 A;  3D4W A;  1JC7 A;  1FGB D;  4M8A A;  1JQY D;  3OMG A;  3D3R A;  3HGB A;  4RKB A;  4CKC A;  4A3B B;  3S9W A;  4WRD A;  3BVZ A;  2B2V A;  1RD9 D;  1O7Y A;  2K04 A;  3LWE A;  4N9T A;  1R4Q B;  2R6G A;  4C1N K;  1F2Z A;  3K0Y A;  3PUZ A;  5C6A A;  4FNF A;  3T4A C;  2A73 B;  1I3Q B;  3MTS A;  4EVO A;  1VF5 C;  3NHH A;  2NVY B;  5BN5 A;  1JIC A;  2WP8 J;  2F0V A;  2XRQ D;  1KAB A;  3NBH A;  4A3M B;  3OPO A;  1D1I A;  4C3H G;  1Z6H A;  4DA2 A;  1JOK A;  1Q8I A;  1BDO A;  1Q12 A;  3HOZ B;  3GQB A;  3J7A F;  5EPK A;  2L9H A;  2WKD A;  4N9P A;  2O2L D;  2SDF A;  4BS9 A;  2V4D A;  4HAE A;  1O78 A;  3QWN A;  5M3F B;  1BQQ T;  3WDN A;  3A54 A;  3I8Z A;  2EJF C;  1HFG A;  3NTI A;  4AYB B;  3E5S A;  4KY7 A;  5D14 A;  3NQI A;  1H9S A;  2EYJ A;  3KLR A;  1ONL A;  5IGC A;  2EYP A;  2PW5 A;  1U9R A;  1SXT A;  4FF1 A;  1B4O A;  3SVM A;  1SAP A;  3BZD B;  3P1H A;  1DM0 B;  3HOX B;  3ITP A;  3S16 B;  4H0L C;  3IFT A;  3PO2 B;  1LLR D;  3FPU B;  1LT5 D;  3I90 A;  1DZ1 A;  2QDB A;  1TS2 A;  2PZT A;  4ZRZ A;  4A3D B;  2D5D A;  2B2T C;  3C1E A;  4G4K A;  3R2T A;  5DAU A;  2IT1 A;  4XT3 B;  2A68 D;  3NP8 A;  4B9X A;  2EZV A;  5C4Z A;  3I4M B;  1U4L A;  2BE5 D;  3RUZ A;  1Y1W B;  4QIW B;  2F0Q A;  4QMG A;  3N52 A;  2A6H D;  2R3Z A;  2ZT9 C;  4EGV A;  5C5M A;  4H44 C;  1EY4 A;  3DUZ A;  1D5M C;  4KTA A;  3GP7 A;  5ELF A;  1JOQ A;  5JEA G;  4DGZ A;  4CBV A;  3A55 A;  1NSN S;  2DN8 A;  5IT9 L;  3I73 A;  5C0X I;  4HTH A;  2FJ2 A;  1ENA A;  4P2C B;  5EPJ A;  3PO3 B;  3RMH A;  2CW0 D;  1CHP D;  1YNN C;  2DNE A;  2NBF A;  2XIW A;  5AFW A;  3FKI B;  5CR3 A;  3TP6 A;  4ABN A;  1GUO A;  1Q1B A;  4RCN A;  1RHP A;  5C0X J;  1PZK D;  4IFD H;  2MGS A;  2IW3 A;  3KUP A;  4RH6 A;  2M2L A;  5ELB A;  1EZ6 A;  4KD4 A;  5CV9 A;  1ET9 A;  3EJI A;  2EYL A;  3A8K E;  4IUT A;  5M5Y B;  5TSS A;  1ZKO A;  1MBY A;  4FYD A;  1SDF A;  1EWH A;  5JEA J;  5EQ0 A;  2JE6 I;  3L9A X;  2XWJ B;  1F9S A;  1K83 B;  2L11 A;  3O13 A;  4MIU A;  3OOC A;  4MN3 A;  4DNR B;  1EY0 A;  3LX0 A;  1HA6 A;  4R9W A;  3T53 B;  2JA6 B;  1IKM A;  1Q3L A;  1U4R A;  4Z9C B;  3SEB A;  3J80 E;  1L0X B;  3I3C A;  3OIP A;  4RFB A;  5IOC A;  2WV6 D;  2HCI A;  4DFA A;  5IGB A;  1STE A;  5I2X A;  4KJO A;  1EWC A;  4K5V A;  2NYZ D;  1TS3 A;  3AU7 A;  4C3I G;  3IL8 A;  1A3V A;  4A3J B;  1D2B A;  1MSG A;  1PYW D;  5FLX E;  1X3P A;  2Q8T A;  1I6V C;  2B8G A;  2EYO A;  4A3E B;  2SNS A;  1PFM A;  4HCE A;  3OHX C;  5COY A;  4KKU A;  3S17 B;  2FIN B;  3NUC A;  1LO5 D;  1LTI D;  3K5M A;  2K1B A;  1SYG A;  4FF2 A;  3VA7 A;  1SE2 A;  2C5C A;  2QCP X;  2EE1 A;  1RJT A;  5JOB A;  1BO0 A;  1HQM C;  1STG A;  4IUN A;  1LTG D;  4IN3 A;  1ZYR C;  3J81 L;  1J8I A;  2CVR A;  3L3O C;  3FMC A;  2R92 B;  1CM9 A;  4PMC A;  5JJZ A;  4KN4 C;  1V8Q A;  1QNK A;  3BDL A;  2IJ0 A;  5KNC A;  1HA5 A;  2F03 A;  5E1F A;  2F0P A;  4QB4 A;  4DAY A;  5JPN C;  1Z7T A;  1A3U A;  2E2D C;  4XQJ A;  2JP1 A;  3Q22 A;  2N88 A;  1I4Q A;  1LTB D;  2A68 C;  1RKN A;  3QOJ A;  5JVH 3;  3DM1 A;  3PV0 A;  1O80 A;  3QO2 A;  5IT9 E;  3SE0 A;  2JEB I;  1UEA B;  4X3U A;  3K5L A;  1EU3 A;  3BVG A;  1F9Q A;  1PMR A;  1TR5 A;  1GXD C;  1WTR A;  1A15 A;  1STY A;  3GTL B;  3HP3 A;  2HUG A;  1YNJ D;  2NN6 I;  4NMZ A;  3NTH A;  2WB1 B;  1BBX C;  1ILP A;  3NWT A;  1EY8 A;  3Q6S A;  3MHB A;  4IUV A;  4I7Z C;  4XDX A;  3V05 A;  2BE5 C;  2YYZ A;  3G7L A;  4XXE A;  1IYV A;  3T51 B;  1SNO A;  1F77 A;  4R8N A;  1JOO A;  1GUT A;  2H4O A;  4QCL A;  5KRU A;  4TRD A;  2A74 C;  2A69 D;  2B2V C;  1A2U A;  1H9K A;  2F1M A;  2NVT B;  5G3L F;  1Y8O B;  1DOK A;  1HHV A;  1KAA A;  5I9P A;  5FO7 B;  2NVQ B;  4DAV A;  2EPB A;  1NCV A;  3IFD A;  4C3J G;  2B2T A;  4RGT A;  3HOV B;  1EEF D;  2EVB A;  5ISR A;  2Q8R E;  1Y8P B;  2K7V A;  3VYU A;  3GTK B;  1RTO A;  4WJW A;  1T5X D;  2KVM A;  2E74 C;  2EY5 A;  2Q8I B;  1EIG A;  1TWC B;  3GO5 A;  3UI2 A;  3KF8 A;  1V1O A;  5D3I B;  3DWQ A;  1I4R A;  4FF3 A;  4HSV A;  2FFK B;  4RCO A;  4F87 A;  3NQT A;  1ESR A;  3VR3 A;  3MFY A;  3X3N A;  3TN2 A;  1KTK A;  3P7J A;  3A56 A;  1JR0 D;  3MVV A;  2RSO A;  1OXX K;  1FNU A;  3K6O A;  4DNT B;  5J1Z A;  5KNB A;  3C1F A;  2F0U A;  3J7Y W;  1J9O A;  2O4X A;  5JPM C;  3ONA B;  3MWY W;  1I50 B;  3R2I A;  3OW7 A;  2XN9 C;  1L0Y B;  5IIF A;  1PZI D;  3R93 A;  2PNR C;  3M85 A;  2F0F A;  3K58 A;  1BNZ A;  4KMU C;  3T16 A;  2IX0 A;  3N6R A;  4FO2 A;  1TWF B;  3A8J E;  2ZXR A;  2B2U C;  5CC4 A;  1D5Z C;  5ELC A;  1NR4 A;  2ZXO A;  5J22 A;  2D62 A;  4ID6 A;  3GTQ B;  4E6I A;  1G91 A;  1WCM B;  1MSH A;  1NAP A;  2XRS D;  5T1G A;  1VMC A;  3M7N A;  3HG9 A;  2L12 A;  4ZKC B;  3RLF A;  4JK1 C;  4PQX A;  5I2Y A;  2ID0 A;  4TKO B;  4XIG S;  3KBX A;  2E75 C;  1BF4 A;  2QF7 A;  2RDF A;  1TKW B;  1SSO A;  2RQX A;  4K5X A;  1HFN A;  1OXS C;  4CKE A;  2XWB B;  3VR2 A;  2JA8 B;  1T5E A;  4F88 A;  1D6E C;  4FXK C;  2HCC A;  4OHJ A;  1C4Q A;  5CV6 A;  3AB9 A;  2RBM A;  3NE5 B;  1HUN A;  1F2Y A;  1A2T A;  4X3K A;  1BXT A;  2FHT A;  4C2M B;  2HQE A;  1RCV D;  3CRK C;  3GTO B;  2AQ2 B;  3MXP A;  2QKI C;  1KDB A;  1LTS D;  2L5T A;  5E3F A;  4BA2 I;  1EYA A;  3WOE A;  1IYU A;  4J6H A;  4DN4 M;  5CV8 A;  5CBA E;  4UDU C;  1LTT D;  2KQ3 A;  3EQL C;  3GTG B;  1H9M A;  1I4P A;  3MXN A;  1Q1E A;  2MHV A;  1IL8 A;  2EJM A;  3HOY B;  2H1E A;  3MAQ A;  2D9U A;  2TSS A;  3D4R A;  3VYR A;  4IUQ A;  1ROD A;  2O5J C;  1G6Z A;  3E0J A;  1MI2 A;  3GV3 A;  4K5W A;  1LTA D;  1E2W A;  1EZ8 A;  2PYK A;  1XYI A;  1WTW A;  2EY6 A;  4HSP A;  2MJ8 A;  1CTM A;  1QB5 D;  2IL8 A;  4KHZ A;  4CHT B;  1AP0 A;  1CA6 A;  1TT2 A;  4JBW A;  4HR7 B;  3TP5 A;  1G2S A;  1OXV A;  4OO1 H;  4IAL A;  2DNC A;  4XYO A;  3J80 L;  1I4H A;  1TQO A;  5A2Q L;  3M3Y B;  2MUY A;  1F2L A;  2RKS A;  1RF2 D;  1XXG A;  1B9N A;  2L0C A;  1EIH A;  1ZEQ X;  4U67 3;  2E2H B;  1D1K A;  1BOS A;  2NUC A;  4H7B A;  2RA4 A;  4OIK A;  1X32 A;  5DEH A;  2AUJ D;  1B44 D;  4EQO A;  3J7A V;  3URY A;  4HCS A;  1PTO F;  1QOH A;  1DCZ A;  1ENF A;  2AWO A;  1C48 A;  3GV6 A;  2EYM A;  1GOZ A;  4LAA A;  5EBD A;  3JAM E;  4XQQ A;  3H6M A;  3S15 B;  4BA1 I;  2KCC A;  2IX1 A;  2GA4 B;  1KLU D;  3Q23 A;  2DY8 A;  4ZQ3 A;  3SHL A;  3WOF A;  1VDZ A;  2F0E A;  3IAY A;  2AWN A;  4Q0F A;  5COR A;  5D3D A;  2K5Q A;  3DMU A;  4K2L A;  4K8J A;  1II3 A;  4NP5 A;  1WTV A;  3PUV A;  2PZW A;  4HED A;  1AW7 A;  1LT4 D;  2NZ1 D;  1SMY D;  3QIA A;  5C4X B;  2PO4 A;  2KHS A;  3S2H B;  3LWU A;  2BDN A;  3DWP A;  2OF1 A;  2WIN B;  2WAC A;  4CKB A;  5F2D A;  3M4Y A;  2X6G A;  3S14 B;  2EYF A;  4DF7 A;  1FNW A;  5LHY 1;  1DOM A;  3JAM L;  4C3I B;  4O42 A;  1CK1 A;  4KD3 A;  2E2J B;  3KLS X;  4BY1 B;  1PRT D;  3TP7 A;  3K5O A;  5EKK A;  2B2U A;  2ENB A;  1TS4 A;  1IW7 C;  2R93 B;  3A7A B;  1HUM A;  1SJH D;  1JOR A;  1X3Q A;  2G9D A;  4ZAI A;  5KIX A;  5ELD A;  4ZUI A;  1PDQ A;  1UAP A;  2IPK D;  4WOR A;  3Q0A A;  2EY2 A;  1G8Z D;  2HDM A;  3I70 A;  2F4I A;  1K8O A;  1DYQ A;  1O7L A;  3ND8 A;  1U4P A;  3K7A B;  2EJG C;  5I4D A;  1TVX A;  3KLS A;  5LL6 S;  3C46 A;  2F0N A;  2JXM B;  1MGS A;  3ND9 A;  2F0W A;  1WTQ A;  2SNM A;  5EJW A;  5I6Y A;  2K5D A;  1D5X C;  1SYB A;  2K28 A;  3FPP A;  4FF4 A;  2NTT A;  1S5D D;  2BA1 A;  2IWH A;  3CKI B;  1TU2 B;  1QJO A;  3FRP B;  3H09 A;  1S5B D;  2A69 C;  4C3J B;  3OWE B;  5C5L A;  1IW7 D;  1WTP A;  3VR6 A;  1AN8 A;  1CHQ D;  4B9W A;  1JWU D;  1M4V A;  1QG7 A;  4KKS A;  1NUC A;  2ICI A;  1F9P A;  2Y0S B;  4RWS C;  4HMJ A;  5DM6 3;  4CJ2 C;  2F3W A;  2Z8L A;  4XYQ A;  2DY7 A;  2F0D A;  4EQN A;  2PMZ B;  4K14 A;  5CV5 A;  1W6J A;  4G7Z C;  3TSS A;  4J8Q A;  1B53 A;  4ZUJ A;  1SNP A;  1SJE D;  4J1M A;  2KA7 A;  2G9H D;  1AFP A;  2KEE A;  2CHB D;  4QUF A;  3MZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...