1S5LE

Architecture of the photosynthetic oxygen evolving center
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
PFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
total genus 17
structure length 76
sequence length 76
chains with identical sequence e
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 1s5lE00
3KZIE 5B5EE 5KAFE 5KAIE 5B66E 3WU2E 2AXTE 3A0HE 4IL6E 5GTHE 3JCUE 4UB8E 1S5LE 5GTIE 4UB6E 5TISE 5E79E 1W5CE 4PJ0E 3A0BE 5H2FE
chains in the Genus database with same CATH superfamily
1SQQJ 3MUDC 5CBNA 1S1CX 2ZFCA 3WUVA 1R5LA 1J1DC 3AEGC 1NU1K 5B66H 2BEZF 3F5HA 2B88A 3FXEA 2O3JA 2QJYB 1JO5A 1KORA 1LTIC 3RK3B 1LWUB 1KYOE 3K5BA 2E76C 3L72G 4ZKUA 5KJ7D 1NTKJ 1RF0C 3A0HH 1VQ8P 1OVVA 4QMAA 4U7JA 2E43A 1Z56A 1BCCJ 3L71G 1USEA 1NTMD 2A45I 1M56D 4EI2A 2KI7B 3HUSC 1P84D 5B5EH 1IFMA 3MTUE 2E74B 5L8RJ 2XDJA 3TNUB 2IDBA 3KZIE 1NKNA 1W2EA 1PZQA 1YHQP 3AEEC 4C7RA 5AW5B 2ZXEB 3CCLP 3OAKA 5KAFH 2E5YA 2C0WA 1FC2C 3L35A 1FZBA 1P84H 4DZOA 3VYIA 3TGUD 3LW5J 2M5AB 1KMIZ 1BDDA 1VL2A 2Z4EA 5AVTB 2ZT9B 2E76D 1X9VA 1T8ZA 1PGQA 3RL0g 5EFWB 3B5ND 3KYQA 1L4AC 1EQ7A 1KQFB 2WZ7A 3RBZA 1SS1A 2QJKC 1VDFA 3G3ZA 3RL0C 2Q9IA 2WSEH 4IL6E 4OGQB 3A0BH 3H1IJ 2KP8A 3R2PA 4OVNF 2AXCA 1DIPA 1L0NJ 3BCCE 5KLVJ 1PP9E 2V4HA 2XNXA 3GF7A 3CD6P 3CWBJ 3FWNA 2A06E 1FZCA 4YXWH 1RE3A 4LGDE 1SQVD 2G3AA 2YKOA 5APSA 3M9QA 1HGZA 4RESB 3II6A 3CLQA 4NPDA 3D6ZA 4PV1B 3H1LE 1QX8A 2AEFA 2OARA 2WT7B 1HTLC 3A0HE 3CL3D 5APYA 5AW8B 1BSNA 1JY3P 5CCHD 4GKGA 1EXIA 1K05A 1L4AD 2QM7A 3L73J 1SQXE 1YBKA 2BEQD 2JR8A 1DH3A 3O6QB 4L75A 3RL0D 2IYPA 3HD7A 2Y0DA 3O8ZA 1EDIA 1LTGC 1WRGA 1NOHA 3MP7B 5AVWB 2QVAA 3AE7C 2P67A 2R3CA 3BCCG 1N7SD 1YJNP 1FZCC 1RE3C 3AE6C 2A45H 2A06G 3H1KD 4B86A 5AW2B 1FJPA 5AVVB 2WITA 1OXZA 1KB9I 2BCCJ 1DEEG 5KLIB 2KSJA 1PPJD 1EXJA 1L0LE 4EDFA 3CC4P 3ZDMA 2RN0A 3FX0A 3H1LG 3USSA 1AQ5A 4L73A 5C39A 1EDLA 4EIJA 1PGJA 4C46A 3CC2P 5AW4B 1SFCB 1VQ9P 1G1IA 4JQ0D 2QJPC 3RK2C 3H1JG 3HD7C 5AVYB 1OVRA 1SQXG 3A0BE 4ZNCA 2K37A 1NU1J 2LKMA 5KTBA 4R4MA 3TSIA 1KILB 1J1EC 2WMMA 3LW5H 2Q6QA 3PTZA 2J59M 3P8CE 4A7PA 1SQBE 4PV1D 1LJ2A 2QRXA 4JPZB 2Z5IA 5CJ4A 3CMAP 4YTPC 1GL2D 2NPSA 2Q1KA 1GW3A 1VQ6P 2Q7CA 1IFDA 1OFCX 4GODA 1JB0J 2YKQA 1L0LG 3D71A 1BGYJ 1S5LX 1SQQE 2W27A 4WY4A 1LNQA 4GT1A 1RQUA 2Q3IA 1USDA 2GUVA 1M1JA 3L74J 1VQ4P 3RK3E 1T2KC 1JUNA 4OH8B 4AYCA 3E7KA 3L71D 3KHUA 2KB7P 2KYVA 3CC7P 1N8RQ 3KDPB 3PH0A 4WBAA 1FZEA 1H0TB 1RE4A 2YIUB 2YNYA 3CCSP 3AEDC 1NTKE 2V7QH 2Y0CA 2N1TA 3CXHI 2QEXP 1HJBA 1SQBG 3I55P 1D7MA 2FYUK 2MKVA 1BCCE 2NPSC 1W5CE 3W67A 1LTSC 3IR9A 5BU5A 1S5LH 2YXRB 2FY8A 3N4XA 4WY4C 1M1JC 3L75J 1Y8AA 2Y0EA 1KYOD 1CSBA 1SQQG 4C7NA 3RBXA 1A02J 4DCKA 1KB9H 3AEFC 1X0TA 5BVZA 1IFIA 4U3FJ 2KZJA 4I6MC 1KD1Q 1RE4C 2R5BA 3SWKA 1QL2A 5GTIE 2CPSA 2OTLP 3CPWO 4H0LC 1KYOH 3TK1A 2FFDA 5KJ7A 1EZVI 1QVGO 1NTKG 2R3SA 2GUSA 3L4FA 3CMEP 4GOFA 2A45G 4JBZA 2OYIB 1BCCG 3PP5A 1JCDA 1CI6B 3H1IE 3HE5A 1FU1A 4KHXA 1KQGB 3U1AA 3AECC 2Q3EA 1L0NE 2KNCB 5KLVE 1MV8A 3CWBE 1PV3A 2W8ZA 2IYOA 3PRJA 3HTKA 5APTA 1X79B 4H44B 3VN0A 3OA7A 2FXMA 1VF5D 2FFDC 1JEKA 1S3JA 4H0LD 4OWFA 3BCCD 5KJ7C 1PP9D 5APWA 1BDCA 2M8RA 2B9BA 1K73Q 3H1HJ 2A06D 3B5NA 5CCGD 1KQLA 2J58A 2XNDH 3L73E 3JC22 4RKUJ 1S5LE 2WSFH 2K3RA 4YXDC 5AVRB 3I5CA 1YIJP 4H13B 4O9BA 4GDOA 3H1IG 2PRRA 3H1LD 3CXHH 1L0NG 5KLVG 4DJGA 4KJMA 5H2FH 2PP6A 2ZYDA 3ITKA 1KB9E 2W6JH 4KT0J 3CWBG 4N78E 1X8YA 2QE7H 1LWUA 1L2PA 1JTHB 1SQXD 2P10A 2BCCE 3H32B 3SWYA 2N9BA 3HE4B 3HUSB 2Y9YA 5AVUB 3B5NC 1KILE 4JYCA 5CCHA 2O01J 4EOTA 1L4AA 1JY2P 3Q2YA 3TNUA 3L73G 2P2UA 1YQ4C 4ASVA 1NU1E 2W83C 1L0LD 1IK7A 4W7YA 1Q86Q 2XU6A 4IFDK 1BE3J 3BASA 2OGUA 1IK9A 2ZYAA 1N7SA 1Q82Q 4I2LC 1N2DC 1LWUC 4BRYB 1FE6A 1Q7YQ 1W2BO 2C9LY 2UWJE 1OMIA 4Y99C 1IZNB 2FYUJ 1Y47A 4TLFA 2QJKB 1JY3O 2ZVNB 1IJDB 2BCCG 4AQRD 5CBOA 5KAIE 1NTZD 3TDKA 1T3UA 1BGYE 1JMBA 4EYYQ 3D6YA 4WVZA 1GZLA 1SQPK 3P8CD 5CCHC 4GOEA 1SQBD 1WT6A 1GW4A 1VQKP 1H88A 1LT1A 2L91A 2JEEA 1HGVA 2WSSH 3AE3C 2PAJA 1IFJA 1NU1G 2E42A 2KXPB 2I1JA 1ZMEC 4Z1MH 2M3BA 3CXHE 2OYHB 1M7LA 1N7SC 1SQQD 5H2FE 1HF9A 3ABVC 2R32A 3RK3D 3WUTA 2ZT9C 3C9IA 3BRTB 2WT7A 2WSCH 1GL2A 3G6EP 1ZW0A 3KXDA 1LGHB 1FDIA 1LP1A 2WVRA 3V4QA 2W90A 3M06A 1YJ9P 3NFQA 3L75E 1AJYA 1ZP0C 1BGYG 4OGQC 1H89A 2DW3A 1NTKD 3BVHA 3W68A 1NYHA 1FZCB 1GK6A 3H1JE 1M1KQ 1Y9BA 2E74D 3L74G 4N6JA 1T6AA 1BCCD 4U3FE 2FXPA 3G71P 5AVSB 3Q1MA 3MD0A 1NKZB 5CHXA 1NTMK 3KQGA 2KUBA 3CCRP 4N3YB 2OTKE 3Q3DA 1EZVE 1BSHA 5GTHH 1HWTC 1G2CA 3GF3A 2KS1B 4PV1C 3Q5RA 1ZR2A 1U7MA 1FBMA 5APXA 3CCEP 2ZT9D 2R5DA 2QJPB 3P32A 3P7KA 1GL2C 4GIFA 3RK2B 1MUUA 3A5TA 2O01H 1ZV8A 3HD7B 1JOCA 1S2EA 1FAVA 1LTTC 3V2PA 4HB1A 1MFTA 4HYTB 1J1EB 1NTZK 3L75G 4OGQD 3VP8A 5KKZC 2PFXA 2D2CB 1HBWA 2I1KA 2AXTH 3E1RA 3MGNA 2HR3A 2OQQA 3EWKA 4U3FG 1UIXA 2WPQA 3CCVP 3EFGA 1KZUB 5GTIH 4I1LA 3G9RA 2WPRA 3H1ID 2YKPA 2AEMA 1S9KE 2QIWA 3P8MC 2ZYGA 3HRNA 1L0ND 3KPEA 1PL5A 1EZVG 4YPCA 5KLIC 5KLVD 1IFNA 5AW1B 1QEXA 2I8DA 1OVUA 1SQQK 2HODA 1OWAA 1ZLLA 3CWBD 3H1HE 3AEBC 2FYNC 1SQVK 1KFNA 2K9JB 5E79H 1FZGA 2ITAA 2M0BA 1LTBC 1U57A 4UB8E 1EDJA 2IBZI 1G1JA 3L72D 1VQNP 2KOGA 4PD4I 3H6PA 3B71A 1LTJA 1NAFA 4DT0A 1NWQA 1GMJA 3NTNA 5BU8B 3L73D 2NPSB 2HPCA 4IFFA 1QL1A 5APQA 1RH5B 2JO1A 2J5UA 3FGAD 3S4RA 4UB6H 2B87B 3GW6A 3GMAA 4WY4B 1LT9A 5GTHE 2FBWC 3CX5I 2H88C 2O1KA 2QM8A 1KB9D 1M90Q 5CCGA 2Z5HA 3H1HG 4PJ0E 1SQPJ 3SWFA 1PP9J 4N78D 4XE5B 1MFZA 2C0XA 1SFCD 4D6TJ 4ASWA 2BCCD 3A2AA 3GHGA 1VQ7P 3CCUP 2IX7C 1OZHA 3I56P 3CI9A 2D2CD 2OYOA 2Q5UA 1NH4A 1BE3E 1LTJC 2YXQB 2N1TB 1KILD 1YI2P 1S72P 3L70J 1FZAA 2AXTE 2LXBA 3N7NA 5APUA 1URQB 2XZRA 2FYUE 2E75B 2NRGA 5M1BA 1VF5C 4L76A 1NU1D 2QA4P 1ZR4A 1LT9C 4C7NB 1SP4A 3M0DA 1PPJE 4JYBA 1H8AA 5CCGC 3TF5A 5E79E 2KNCA 3GHGC 3R4YA 2VRSA 1KC8Q 1NTMJ 2O01N 1BGYD 1GD2E 2FFDB 1AVYA 4NPEA 1JCCA 1BE3G 3AE4C 3L37A 3T97A 3VMZA 1JMMA 1NHLA 1N73B 1PGPA 4BWNA 3S1KA 1GDTA 2JKVA 2LR2A 2NZ2A 2FYUG 3HE5B 1FOSE 4UB6E 1KFMA 5KAIH 3FWLA 1HVVA 1RF1B 4ZMDA 1M57D 4PD4H 3M0DC 1JY2O 3CXHD 2WSEJ 3TGUJ 1MZ9A 1EDKA 4JF7A 1NTZJ 1PPJG 2RKLA 3HTKB 1J1DB 4IFMA 3CCJP 3MHVA 1U7JA 2HG5D 4TT3H 3G4SP 2GA1A 3CX5H 2FYZA 1DX7A 3L75D 1JY3N 2E76B 2E75D 3B5NB 3H1JD 1VQLP 3PHLA 3VMYA 4RJTA 2JDIH 1VQOP 4U3FD 1FS0E 2CPBA 3S9OA 3V4WA 3AE1C 1SQVJ 3NMDA 1PIXA 1EZVD 1LTAC 3V2RA 1TU3F 4I7ZC 2FKWB 3AEAC 2GM4A 4H13C 3IFMA 1IFPA 5TJHA 2KSEA 4HJGH 1VPCA 1HH0A 3B4SA 1FJKA 4HKZH 3LIEA 1R8EA 4Y99B 1JNMA 5DJTB 1RY3A 5AVXB 3FXDA 4BRYA 3AE2C 1AVOA 3M91A 3C8VA 1YJWP 2QJYC 4H44D 4R4LA 3M0AA 1SVFA 2SPZA 3RK3C 2M5AA 1L4AB 1QVFO 2IBZE 3OJAB 1R5SA 3RL0B 2K88A 3H1KJ 2WPSA 2WWWA 2QSIA 4PD4E 3GLMA 4W7ZA 5APVA 3E1IA 1S9KD 3M9BA 1N7SB 3L74E 3QWOC 3EFFK 2E74C 1EC5A 4H13D 3SFDC 3H1HD 5TISH 3WU2E 2W6BA 2OYHA 3BRVB 5AW3B 1ZRTE 2ZXXA 3V2NA 3CX5E 3LIDA 2YO3A 1YITP 5AW0B 1DEBA 1A02F 4L74A 1X22A 1SQPE 4K35A 2C9NY 2IBZG 4D6TE 1SQXK 2IPPA 4HH2A 4UB8H 3VP9A 5B66E 2HLOA 3GG2A 1T3JA 4XA4A 4CPGA 3CCMP 1KQSO 3B8EB 3O6QA 2JJLA 3A7OA 1CZQA 2IZ0A 3L70E 3L72J 1VQMP 2OYHC 3M9HA 5CMZA 3U1CA 2H89C 2V7QJ 1GL2B 1VQ5P 3L71J 1LP1B 3TYYA 2KS1A 3PJSK 3VMAA 3PLNA 1L0LK 1ZXGA 3U59A 1BE3D 3V6IA 5DJUB 2YMYA 5B5EE 5KKZB 4PJ0H 2B89A 2K9YA 1SQPG 1PP9G 2QG4A 2FYUD 1NAYA 1SFCA 1CW5A 4D6TG 3JCUH 1HJ0A 2WQYC 1NTME 5KAFE 2M3EA 3V5BA 1G2CB 3WUUA 1P84E 1QGKB 1GK4A 1GTWA 1KILA 5TISE 3L70G 1SQBK 1YYCA 1QLED 2FYNB 2HYNA 4ZKPA 3QH9A 2PGDA 3F89A 1KYOI 2N9YB 2POHA 1RHZB 4NPFX 4LC1A 2K9JA 2CK3H 1FDMA 3TGUE 1FDOA 1NTZE 3BATA 3Q5SA 2IZ1A 1SFCC 2KK7A 4K3AA 5AVQB 1WMKA 1OW8A 1VQPP 2D2CC 4LLHA 2Y9ZA 2WTYA 3AE5C 2K1AA 1NTMG 4WWIA 1XTCC 1KV4A 1KILC 2HODB 1H0TA 2JP3A 1PFIA 4M3LA 1KN7A 1NTKK 1Q81Q 3A3YB 2B87A 4MN4C 3Q5PA 1NO4A 1K8AQ 4BXLA 1N7LA 2IFMA 2BASA 1SQVE 1E79H 1GU5A 2YO2A 3RK2D 2WSFJ 2AEJA 2XV5A 3WMM0 1S4XA 3HD7D 1M1JB 1GU4A 1K9MQ 1AV1A 3AE8C 1FZFA 2P7JA 1LTJB 1Q90D 3TGUG 2JWDA 1NTZG 3BCCJ 3MIWA 2HPCB 5AVZB 3VOPA 2IFNA 5K5GB 1NVOA 1AA0A 1DD4A 3NXSA 3JCUE 1E5WA 5AW9B 3AE9C 1VF5B 1KTMA 4XFJA 1LT9B 2OTJP 4H0LB 5AW6B 1YQ3C 4W80A 1URQA 2YIUC 1DD3A 3SSUA 2O1JA 3H1LJ 1JY2N 2H8PD 1YTZT 3D70A 2G8YA 3GHGB 2H43A 2KLVA 3H1JJ 3H1KE 1T2KD 2ZVOB 1SQVG 1J2JB 1NJIQ 2OYIA 2JWAA 1SQXJ 1MKMA 5CJ0A 1K04A 1OIPA 3IN6A 3SFEC 2HFED 1YTZI 4IOIH 1L0NK 3IAOA 5KLVK 2KIKA 1CI6A 1ZN5A 4Y28J 2RMZA 2H7HA 2E5TA 2N1TC 2IBZD 2XKMA 3MZWB 2W6AA 1Q2NA 3RGUA 1FOSF 1JM0A 2KZIA 1ZOYC 4PD4D 4WB4A 5AW7B 1URQC 2NPSD 2R44A 2RH0A 1N73A 2E75C 1L0LJ 3L74D 1OW7A 3VTPC 2YMKA 4RO0A 1P84I 1RF1A 4WY4D 1HUCA 4AUWA 4IL6X 4DOJA 3L36A 3MUDA 1SLQA 3KZIH 2FXOA 2ZJSE 3OW2O 1OX3A 2OYIC 1ZRTD 2P58A 3H1KG 3CX5D 3UIAA 2MJZA 3IF4A 3VMXA 1AFOA 1PGOA 3T97B 2LXCB 1N86A 3L72E 1AQTA 1IC2A 3WU2H 1OW6A 2L5GB 1UIIA 1SQPD 2N1TD 1SQBJ 3C1LA 4D6TD 3L71E 3JSVC 1NGMB 1RF0A 2P1JA 3V2QA 1N73C 3EQ2A 1RQVA 4H44C 1URQD 1JTHA 2WSCJ 3H32A 3H25A 1IO4A 3CCQP 2ZAEB 4IL6H 2KLUA 1RF1C 4I7ZB 3L70D 2WPVB 3HE4A 3HUSA 1XTGB 1M8OB
chains in the Genus database with same CATH topology
3KZIE 5B5EE 5KAFE 5KAIE 5B66E 3WU2E 2AXTE 3A0HE 4IL6E 5GTHE 3JCUE 4UB8E 1S5LE 5GTIE 4UB6E 5TISE 5E79E 1W5CE 4PJ0E 3A0BE 5H2FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI E;  5B5E E;  5KAF E;  5KAI E;  5B66 E;  3WU2 E;  2AXT E;  3A0H E;  4IL6 E;  5GTH E;  3JCU E;  4UB8 E;  1S5L E;  5GTI E;  4UB6 E;  5TIS E;  5E79 E;  1W5C E;  4PJ0 E;  3A0B E;  5H2F E; 
#chains in the Genus database with same CATH topology
 1SQQ J;  3MUD C;  5CBN A;  1S1C X;  2ZFC A;  3WUV A;  1R5L A;  1J1D C;  3AEG C;  1NU1 K;  5B66 H;  2BEZ F;  3F5H A;  2B88 A;  3FXE A;  2O3J A;  2QJY B;  1JO5 A;  1KOR A;  1LTI C;  3RK3 B;  1LWU B;  1KYO E;  3K5B A;  2E76 C;  3L72 G;  4ZKU A;  5KJ7 D;  1NTK J;  1RF0 C;  3A0H H;  1VQ8 P;  1OVV A;  4QMA A;  4U7J A;  2E43 A;  1Z56 A;  1BCC J;  3L71 G;  1USE A;  1NTM D;  2A45 I;  1M56 D;  4EI2 A;  2KI7 B;  3HUS C;  1P84 D;  5B5E H;  1IFM A;  3MTU E;  2E74 B;  5L8R J;  2XDJ A;  3TNU B;  2IDB A;  3KZI E;  1NKN A;  1W2E A;  1PZQ A;  1YHQ P;  3AEE C;  4C7R A;  5AW5 B;  2ZXE B;  3CCL P;  3OAK A;  5KAF H;  2E5Y A;  2C0W A;  1FC2 C;  3L35 A;  1FZB A;  1P84 H;  4DZO A;  3VYI A;  3TGU D;  3LW5 J;  2M5A B;  1KMI Z;  1BDD A;  1VL2 A;  2Z4E A;  5AVT B;  2ZT9 B;  2E76 D;  1X9V A;  1T8Z A;  1PGQ A;  3RL0 g;  5EFW B;  3B5N D;  3KYQ A;  1L4A C;  1EQ7 A;  1KQF B;  2WZ7 A;  3RBZ A;  1SS1 A;  2QJK C;  1VDF A;  3G3Z A;  3RL0 C;  2Q9I A;  2WSE H;  4IL6 E;  4OGQ B;  3A0B H;  3H1I J;  2KP8 A;  3R2P A;  4OVN F;  2AXC A;  1DIP A;  1L0N J;  3BCC E;  5KLV J;  1PP9 E;  2V4H A;  2XNX A;  3GF7 A;  3CD6 P;  3CWB J;  3FWN A;  2A06 E;  1FZC A;  4YXW H;  1RE3 A;  4LGD E;  1SQV D;  2G3A A;  2YKO A;  5APS A;  3M9Q A;  1HGZ A;  4RES B;  3II6 A;  3CLQ A;  4NPD A;  3D6Z A;  4PV1 B;  3H1L E;  1QX8 A;  2AEF A;  2OAR A;  2WT7 B;  1HTL C;  3A0H E;  3CL3 D;  5APY A;  5AW8 B;  1BSN A;  1JY3 P;  5CCH D;  4GKG A;  1EXI A;  1K05 A;  1L4A D;  2QM7 A;  3L73 J;  1SQX E;  1YBK A;  2BEQ D;  2JR8 A;  1DH3 A;  3O6Q B;  4L75 A;  3RL0 D;  2IYP A;  3HD7 A;  2Y0D A;  3O8Z A;  1EDI A;  1LTG C;  1WRG A;  1NOH A;  3MP7 B;  5AVW B;  2QVA A;  3AE7 C;  2P67 A;  2R3C A;  3BCC G;  1N7S D;  1YJN P;  1FZC C;  1RE3 C;  3AE6 C;  2A45 H;  2A06 G;  3H1K D;  4B86 A;  5AW2 B;  1FJP A;  5AVV B;  2WIT A;  1OXZ A;  1KB9 I;  2BCC J;  1DEE G;  5KLI B;  2KSJ A;  1PPJ D;  1EXJ A;  1L0L E;  4EDF A;  3CC4 P;  3ZDM A;  2RN0 A;  3FX0 A;  3H1L G;  3USS A;  1AQ5 A;  4L73 A;  5C39 A;  1EDL A;  4EIJ A;  1PGJ A;  4C46 A;  3CC2 P;  5AW4 B;  1SFC B;  1VQ9 P;  1G1I A;  4JQ0 D;  2QJP C;  3RK2 C;  3H1J G;  3HD7 C;  5AVY B;  1OVR A;  1SQX G;  3A0B E;  4ZNC A;  2K37 A;  1NU1 J;  2LKM A;  5KTB A;  4R4M A;  3TSI A;  1KIL B;  1J1E C;  2WMM A;  3LW5 H;  2Q6Q A;  3PTZ A;  2J59 M;  3P8C E;  4A7P A;  1SQB E;  4PV1 D;  1LJ2 A;  2QRX A;  4JPZ B;  2Z5I A;  5CJ4 A;  3CMA P;  4YTP C;  1GL2 D;  2NPS A;  2Q1K A;  1GW3 A;  1VQ6 P;  2Q7C A;  1IFD A;  1OFC X;  4GOD A;  1JB0 J;  2YKQ A;  1L0L G;  3D71 A;  1BGY J;  1S5L X;  1SQQ E;  2W27 A;  4WY4 A;  1LNQ A;  4GT1 A;  1RQU A;  2Q3I A;  1USD A;  2GUV A;  1M1J A;  3L74 J;  1VQ4 P;  3RK3 E;  1T2K C;  1JUN A;  4OH8 B;  4AYC A;  3E7K A;  3L71 D;  3KHU A;  2KB7 P;  2KYV A;  3CC7 P;  1N8R Q;  3KDP B;  3PH0 A;  4WBA A;  1FZE A;  1H0T B;  1RE4 A;  2YIU B;  2YNY A;  3CCS P;  3AED C;  1NTK E;  2V7Q H;  2Y0C A;  2N1T A;  3CXH I;  2QEX P;  1HJB A;  1SQB G;  3I55 P;  1D7M A;  2FYU K;  2MKV A;  1BCC E;  2NPS C;  1W5C E;  3W67 A;  1LTS C;  3IR9 A;  5BU5 A;  1S5L H;  2YXR B;  2FY8 A;  3N4X A;  4WY4 C;  1M1J C;  3L75 J;  1Y8A A;  2Y0E A;  1KYO D;  1CSB A;  1SQQ G;  4C7N A;  3RBX A;  1A02 J;  4DCK A;  1KB9 H;  3AEF C;  1X0T A;  5BVZ A;  1IFI A;  4U3F J;  2KZJ A;  4I6M C;  1KD1 Q;  1RE4 C;  2R5B A;  3SWK A;  1QL2 A;  5GTI E;  2CPS A;  2OTL P;  3CPW O;  4H0L C;  1KYO H;  3TK1 A;  2FFD A;  5KJ7 A;  1EZV I;  1QVG O;  1NTK G;  2R3S A;  2GUS A;  3L4F A;  3CME P;  4GOF A;  2A45 G;  4JBZ A;  2OYI B;  1BCC G;  3PP5 A;  1JCD A;  1CI6 B;  3H1I E;  3HE5 A;  1FU1 A;  4KHX A;  1KQG B;  3U1A A;  3AEC C;  2Q3E A;  1L0N E;  2KNC B;  5KLV E;  1MV8 A;  3CWB E;  1PV3 A;  2W8Z A;  2IYO A;  3PRJ A;  3HTK A;  5APT A;  1X79 B;  4H44 B;  3VN0 A;  3OA7 A;  2FXM A;  1VF5 D;  2FFD C;  1JEK A;  1S3J A;  4H0L D;  4OWF A;  3BCC D;  5KJ7 C;  1PP9 D;  5APW A;  1BDC A;  2M8R A;  2B9B A;  1K73 Q;  3H1H J;  2A06 D;  3B5N A;  5CCG D;  1KQL A;  2J58 A;  2XND H;  3L73 E;  3JC2 2;  4RKU J;  1S5L E;  2WSF H;  2K3R A;  4YXD C;  5AVR B;  3I5C A;  1YIJ P;  4H13 B;  4O9B A;  4GDO A;  3H1I G;  2PRR A;  3H1L D;  3CXH H;  1L0N G;  5KLV G;  4DJG A;  4KJM A;  5H2F H;  2PP6 A;  2ZYD A;  3ITK A;  1KB9 E;  2W6J H;  4KT0 J;  3CWB G;  4N78 E;  1X8Y A;  2QE7 H;  1LWU A;  1L2P A;  1JTH B;  1SQX D;  2P10 A;  2BCC E;  3H32 B;  3SWY A;  2N9B A;  3HE4 B;  3HUS B;  2Y9Y A;  5AVU B;  3B5N C;  1KIL E;  4JYC A;  5CCH A;  2O01 J;  4EOT A;  1L4A A;  1JY2 P;  3Q2Y A;  3TNU A;  3L73 G;  2P2U A;  1YQ4 C;  4ASV A;  1NU1 E;  2W83 C;  1L0L D;  1IK7 A;  4W7Y A;  1Q86 Q;  2XU6 A;  4IFD K;  1BE3 J;  3BAS A;  2OGU A;  1IK9 A;  2ZYA A;  1N7S A;  1Q82 Q;  4I2L C;  1N2D C;  1LWU C;  4BRY B;  1FE6 A;  1Q7Y Q;  1W2B O;  2C9L Y;  2UWJ E;  1OMI A;  4Y99 C;  1IZN B;  2FYU J;  1Y47 A;  4TLF A;  2QJK B;  1JY3 O;  2ZVN B;  1IJD B;  2BCC G;  4AQR D;  5CBO A;  5KAI E;  1NTZ D;  3TDK A;  1T3U A;  1BGY E;  1JMB A;  4EYY Q;  3D6Y A;  4WVZ A;  1GZL A;  1SQP K;  3P8C D;  5CCH C;  4GOE A;  1SQB D;  1WT6 A;  1GW4 A;  1VQK P;  1H88 A;  1LT1 A;  2L91 A;  2JEE A;  1HGV A;  2WSS H;  3AE3 C;  2PAJ A;  1IFJ A;  1NU1 G;  2E42 A;  2KXP B;  2I1J A;  1ZME C;  4Z1M H;  2M3B A;  3CXH E;  2OYH B;  1M7L A;  1N7S C;  1SQQ D;  5H2F E;  1HF9 A;  3ABV C;  2R32 A;  3RK3 D;  3WUT A;  2ZT9 C;  3C9I A;  3BRT B;  2WT7 A;  2WSC H;  1GL2 A;  3G6E P;  1ZW0 A;  3KXD A;  1LGH B;  1FDI A;  1LP1 A;  2WVR A;  3V4Q A;  2W90 A;  3M06 A;  1YJ9 P;  3NFQ A;  3L75 E;  1AJY A;  1ZP0 C;  1BGY G;  4OGQ C;  1H89 A;  2DW3 A;  1NTK D;  3BVH A;  3W68 A;  1NYH A;  1FZC B;  1GK6 A;  3H1J E;  1M1K Q;  1Y9B A;  2E74 D;  3L74 G;  4N6J A;  1T6A A;  1BCC D;  4U3F E;  2FXP A;  3G71 P;  5AVS B;  3Q1M A;  3MD0 A;  1NKZ B;  5CHX A;  1NTM K;  3KQG A;  2KUB A;  3CCR P;  4N3Y B;  2OTK E;  3Q3D A;  1EZV E;  1BSH A;  5GTH H;  1HWT C;  1G2C A;  3GF3 A;  2KS1 B;  4PV1 C;  3Q5R A;  1ZR2 A;  1U7M A;  1FBM A;  5APX A;  3CCE P;  2ZT9 D;  2R5D A;  2QJP B;  3P32 A;  3P7K A;  1GL2 C;  4GIF A;  3RK2 B;  1MUU A;  3A5T A;  2O01 H;  1ZV8 A;  3HD7 B;  1JOC A;  1S2E A;  1FAV A;  1LTT C;  3V2P A;  4HB1 A;  1MFT A;  4HYT B;  1J1E B;  1NTZ K;  3L75 G;  4OGQ D;  3VP8 A;  5KKZ C;  2PFX A;  2D2C B;  1HBW A;  2I1K A;  2AXT H;  3E1R A;  3MGN A;  2HR3 A;  2OQQ A;  3EWK A;  4U3F G;  1UIX A;  2WPQ A;  3CCV P;  3EFG A;  1KZU B;  5GTI H;  4I1L A;  3G9R A;  2WPR A;  3H1I D;  2YKP A;  2AEM A;  1S9K E;  2QIW A;  3P8M C;  2ZYG A;  3HRN A;  1L0N D;  3KPE A;  1PL5 A;  1EZV G;  4YPC A;  5KLI C;  5KLV D;  1IFN A;  5AW1 B;  1QEX A;  2I8D A;  1OVU A;  1SQQ K;  2HOD A;  1OWA A;  1ZLL A;  3CWB D;  3H1H E;  3AEB C;  2FYN C;  1SQV K;  1KFN A;  2K9J B;  5E79 H;  1FZG A;  2ITA A;  2M0B A;  1LTB C;  1U57 A;  4UB8 E;  1EDJ A;  2IBZ I;  1G1J A;  3L72 D;  1VQN P;  2KOG A;  4PD4 I;  3H6P A;  3B71 A;  1LTJ A;  1NAF A;  4DT0 A;  1NWQ A;  1GMJ A;  3NTN A;  5BU8 B;  3L73 D;  2NPS B;  2HPC A;  4IFF A;  1QL1 A;  5APQ A;  1RH5 B;  2JO1 A;  2J5U A;  3FGA D;  3S4R A;  4UB6 H;  2B87 B;  3GW6 A;  3GMA A;  4WY4 B;  1LT9 A;  5GTH E;  2FBW C;  3CX5 I;  2H88 C;  2O1K A;  2QM8 A;  1KB9 D;  1M90 Q;  5CCG A;  2Z5H A;  3H1H G;  4PJ0 E;  1SQP J;  3SWF A;  1PP9 J;  4N78 D;  4XE5 B;  1MFZ A;  2C0X A;  1SFC D;  4D6T J;  4ASW A;  2BCC D;  3A2A A;  3GHG A;  1VQ7 P;  3CCU P;  2IX7 C;  1OZH A;  3I56 P;  3CI9 A;  2D2C D;  2OYO A;  2Q5U A;  1NH4 A;  1BE3 E;  1LTJ C;  2YXQ B;  2N1T B;  1KIL D;  1YI2 P;  1S72 P;  3L70 J;  1FZA A;  2AXT E;  2LXB A;  3N7N A;  5APU A;  1URQ B;  2XZR A;  2FYU E;  2E75 B;  2NRG A;  5M1B A;  1VF5 C;  4L76 A;  1NU1 D;  2QA4 P;  1ZR4 A;  1LT9 C;  4C7N B;  1SP4 A;  3M0D A;  1PPJ E;  4JYB A;  1H8A A;  5CCG C;  3TF5 A;  5E79 E;  2KNC A;  3GHG C;  3R4Y A;  2VRS A;  1KC8 Q;  1NTM J;  2O01 N;  1BGY D;  1GD2 E;  2FFD B;  1AVY A;  4NPE A;  1JCC A;  1BE3 G;  3AE4 C;  3L37 A;  3T97 A;  3VMZ A;  1JMM A;  1NHL A;  1N73 B;  1PGP A;  4BWN A;  3S1K A;  1GDT A;  2JKV A;  2LR2 A;  2NZ2 A;  2FYU G;  3HE5 B;  1FOS E;  4UB6 E;  1KFM A;  5KAI H;  3FWL A;  1HVV A;  1RF1 B;  4ZMD A;  1M57 D;  4PD4 H;  3M0D C;  1JY2 O;  3CXH D;  2WSE J;  3TGU J;  1MZ9 A;  1EDK A;  4JF7 A;  1NTZ J;  1PPJ G;  2RKL A;  3HTK B;  1J1D B;  4IFM A;  3CCJ P;  3MHV A;  1U7J A;  2HG5 D;  4TT3 H;  3G4S P;  2GA1 A;  3CX5 H;  2FYZ A;  1DX7 A;  3L75 D;  1JY3 N;  2E76 B;  2E75 D;  3B5N B;  3H1J D;  1VQL P;  3PHL A;  3VMY A;  4RJT A;  2JDI H;  1VQO P;  4U3F D;  1FS0 E;  2CPB A;  3S9O A;  3V4W A;  3AE1 C;  1SQV J;  3NMD A;  1PIX A;  1EZV D;  1LTA C;  3V2R A;  1TU3 F;  4I7Z C;  2FKW B;  3AEA C;  2GM4 A;  4H13 C;  3IFM A;  1IFP A;  5TJH A;  2KSE A;  4HJG H;  1VPC A;  1HH0 A;  3B4S A;  1FJK A;  4HKZ H;  3LIE A;  1R8E A;  4Y99 B;  1JNM A;  5DJT B;  1RY3 A;  5AVX B;  3FXD A;  4BRY A;  3AE2 C;  1AVO A;  3M91 A;  3C8V A;  1YJW P;  2QJY C;  4H44 D;  4R4L A;  3M0A A;  1SVF A;  2SPZ A;  3RK3 C;  2M5A A;  1L4A B;  1QVF O;  2IBZ E;  3OJA B;  1R5S A;  3RL0 B;  2K88 A;  3H1K J;  2WPS A;  2WWW A;  2QSI A;  4PD4 E;  3GLM A;  4W7Z A;  5APV A;  3E1I A;  1S9K D;  3M9B A;  1N7S B;  3L74 E;  3QWO C;  3EFF K;  2E74 C;  1EC5 A;  4H13 D;  3SFD C;  3H1H D;  5TIS H;  3WU2 E;  2W6B A;  2OYH A;  3BRV B;  5AW3 B;  1ZRT E;  2ZXX A;  3V2N A;  3CX5 E;  3LID A;  2YO3 A;  1YIT P;  5AW0 B;  1DEB A;  1A02 F;  4L74 A;  1X22 A;  1SQP E;  4K35 A;  2C9N Y;  2IBZ G;  4D6T E;  1SQX K;  2IPP A;  4HH2 A;  4UB8 H;  3VP9 A;  5B66 E;  2HLO A;  3GG2 A;  1T3J A;  4XA4 A;  4CPG A;  3CCM P;  1KQS O;  3B8E B;  3O6Q A;  2JJL A;  3A7O A;  1CZQ A;  2IZ0 A;  3L70 E;  3L72 J;  1VQM P;  2OYH C;  3M9H A;  5CMZ A;  3U1C A;  2H89 C;  2V7Q J;  1GL2 B;  1VQ5 P;  3L71 J;  1LP1 B;  3TYY A;  2KS1 A;  3PJS K;  3VMA A;  3PLN A;  1L0L K;  1ZXG A;  3U59 A;  1BE3 D;  3V6I A;  5DJU B;  2YMY A;  5B5E E;  5KKZ B;  4PJ0 H;  2B89 A;  2K9Y A;  1SQP G;  1PP9 G;  2QG4 A;  2FYU D;  1NAY A;  1SFC A;  1CW5 A;  4D6T G;  3JCU H;  1HJ0 A;  2WQY C;  1NTM E;  5KAF E;  2M3E A;  3V5B A;  1G2C B;  3WUU A;  1P84 E;  1QGK B;  1GK4 A;  1GTW A;  1KIL A;  5TIS E;  3L70 G;  1SQB K;  1YYC A;  1QLE D;  2FYN B;  2HYN A;  4ZKP A;  3QH9 A;  2PGD A;  3F89 A;  1KYO I;  2N9Y B;  2POH A;  1RHZ B;  4NPF X;  4LC1 A;  2K9J A;  2CK3 H;  1FDM A;  3TGU E;  1FDO A;  1NTZ E;  3BAT A;  3Q5S A;  2IZ1 A;  1SFC C;  2KK7 A;  4K3A A;  5AVQ B;  1WMK A;  1OW8 A;  1VQP P;  2D2C C;  4LLH A;  2Y9Z A;  2WTY A;  3AE5 C;  2K1A A;  1NTM G;  4WWI A;  1XTC C;  1KV4 A;  1KIL C;  2HOD B;  1H0T A;  2JP3 A;  1PFI A;  4M3L A;  1KN7 A;  1NTK K;  1Q81 Q;  3A3Y B;  2B87 A;  4MN4 C;  3Q5P A;  1NO4 A;  1K8A Q;  4BXL A;  1N7L A;  2IFM A;  2BAS A;  1SQV E;  1E79 H;  1GU5 A;  2YO2 A;  3RK2 D;  2WSF J;  2AEJ A;  2XV5 A;  3WMM 0;  1S4X A;  3HD7 D;  1M1J B;  1GU4 A;  1K9M Q;  1AV1 A;  3AE8 C;  1FZF A;  2P7J A;  1LTJ B;  1Q90 D;  3TGU G;  2JWD A;  1NTZ G;  3BCC J;  3MIW A;  2HPC B;  5AVZ B;  3VOP A;  2IFN A;  5K5G B;  1NVO A;  1AA0 A;  1DD4 A;  3NXS A;  3JCU E;  1E5W A;  5AW9 B;  3AE9 C;  1VF5 B;  1KTM A;  4XFJ A;  1LT9 B;  2OTJ P;  4H0L B;  5AW6 B;  1YQ3 C;  4W80 A;  1URQ A;  2YIU C;  1DD3 A;  3SSU A;  2O1J A;  3H1L J;  1JY2 N;  2H8P D;  1YTZ T;  3D70 A;  2G8Y A;  3GHG B;  2H43 A;  2KLV A;  3H1J J;  3H1K E;  1T2K D;  2ZVO B;  1SQV G;  1J2J B;  1NJI Q;  2OYI A;  2JWA A;  1SQX J;  1MKM A;  5CJ0 A;  1K04 A;  1OIP A;  3IN6 A;  3SFE C;  2HFE D;  1YTZ I;  4IOI H;  1L0N K;  3IAO A;  5KLV K;  2KIK A;  1CI6 A;  1ZN5 A;  4Y28 J;  2RMZ A;  2H7H A;  2E5T A;  2N1T C;  2IBZ D;  2XKM A;  3MZW B;  2W6A A;  1Q2N A;  3RGU A;  1FOS F;  1JM0 A;  2KZI A;  1ZOY C;  4PD4 D;  4WB4 A;  5AW7 B;  1URQ C;  2NPS D;  2R44 A;  2RH0 A;  1N73 A;  2E75 C;  1L0L J;  3L74 D;  1OW7 A;  3VTP C;  2YMK A;  4RO0 A;  1P84 I;  1RF1 A;  4WY4 D;  1HUC A;  4AUW A;  4IL6 X;  4DOJ A;  3L36 A;  3MUD A;  1SLQ A;  3KZI H;  2FXO A;  2ZJS E;  3OW2 O;  1OX3 A;  2OYI C;  1ZRT D;  2P58 A;  3H1K G;  3CX5 D;  3UIA A;  2MJZ A;  3IF4 A;  3VMX A;  1AFO A;  1PGO A;  3T97 B;  2LXC B;  1N86 A;  3L72 E;  1AQT A;  1IC2 A;  3WU2 H;  1OW6 A;  2L5G B;  1UII A;  1SQP D;  2N1T D;  1SQB J;  3C1L A;  4D6T D;  3L71 E;  3JSV C;  1NGM B;  1RF0 A;  2P1J A;  3V2Q A;  1N73 C;  3EQ2 A;  1RQV A;  4H44 C;  1URQ D;  1JTH A;  2WSC J;  3H32 A;  3H25 A;  1IO4 A;  3CCQ P;  2ZAE B;  4IL6 H;  2KLU A;  1RF1 C;  4I7Z B;  3L70 D;  2WPV B;  3HE4 A;  3HUS A;  1XTG B;  1M8O B; 
#chains in the Genus database with same CATH homology
 3KZI E;  5B5E E;  5KAF E;  5KAI E;  5B66 E;  3WU2 E;  2AXT E;  3A0H E;  4IL6 E;  5GTH E;  3JCU E;  4UB8 E;  1S5L E;  5GTI E;  4UB6 E;  5TIS E;  5E79 E;  1W5C E;  4PJ0 E;  3A0B E;  5H2F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...