1S5LO

Architecture of the photosynthetic oxygen evolving center
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
246
structure length
246
Chain Sequence
AKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 27
structure length 246
sequence length 246
chains with identical sequence o
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 1s5lO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 1s5lO02
3WU2O 4IL6O 3KZIO 3A0HO 5G39A 5G38A 5G3AA 2AXTO 5TISO 5E79O 1S5LO 5GTIO 5KAIO 4UB8O 5B66O 5KAFO 4UB6O 3JCUO 5B5EO 4PJ0O 5H2FO 5GTHO 3A0BO
chains in the Genus database with same CATH superfamily
4O4XA 5IYUA 1QJ9A 2KXPB 3A0HO 2O4VA 3HW9A 2FGQX 3AA1B 3DWOX 3SZDA 4E1TA 2W80C 2M06A 1QJ8A 1T1LA 3VY9X 2ERVA 3HOLA 4XNKA 4GCSA 4U9CA 1E54A 4KR8A 4RL9A 1HXUA 4N58A 3POXA 4O3ZA 4UB8O 1Q9GA 5EE2A 5ADXL 4QQ1A 1MM5A 2R89A 1ZHZA 4F4BA 2XTQA 2F1VA 2KXPA 4BUMX 1P4TA 2LFUA 2Y0KA 4GCPA 3UU2A 4AUIA 4FESA 1IZNA 1QJPA 4AZLA 5T5FA 1PHOA 5KAIO 1HXXA 4AFKA 4AKMA 4FQEA 3VZTX 4O3YA 4N75A 4FUVA 2M07A 2XG6A 3LK41 1ORMA 1OPFA 2WJQA 3SYSA 3AA6A 3HOEA 4CTDA 3AAAA 2R4OA 5JDPA 5PRNA 3LK42 4O49A 4AYID 3AA0A 3WU2O 2QTKA 3KZIO 2WJRA 3PRNA 3QRCA 5G3AA 2XE3A 3BS0A 4G76A 3TZGA 4C00A 5TISO 1GFOA 4AKRA 4O3WA 4GHBA 2Y0HA 2R8AA 3EMNX 5DL7A 1ZHXA 3RBHA 3WI4A 8PRNA 1HXTA 2N2LA 1BH3A 4LSEA 4C69X 1GFMA 1ZHWA 4FZMA 1G90A 4D5UA 3PGRA 4O3XB 4RJXA 5AFUL 5DL8A 3LK3B 2KC0A 2MNHA 2X9KA 3VZWX 3PORA 3PF1A 4AYMC 1MPFA 4FRTA 5ADXK 1THQA 2WVPA 1BT9A 4G75A 5DL6A 4AYNA 4FT6A 2Y2XA 3JCUO 2F1TA 2R88A 2OMFA 4LSFA 4PJ0O 4E1SA 5FVNA 4K3CA 2YNKA 3DZMA 4C4VB 3NSGA 5GTHO 4FMSA 5D5DA 5GV0A 1GFNA 1MM4A 4FRXA 3JTYA 3UPGA 2X27X 1ZHYA 2XE1A 2W81C 1IZNB 3AA6B 2LHFA 3SYBA 2XMXA 2ZLDA 4IL6O 2JMMA 6PRNA 2J4UP 4O4UA 4N59A 5G38A 2AXTO 2XE5A 4JCHA 4FOZA 4LSIA 4XNLA 2K4TA 2MHLA 1Q9FA 2PORA 3AA7B 3DWNA 1PRNA 3HWBA 3VZUX 7PRNA 4PR7A 2K0LA 2IWWA 2GE4A 2XE2A 3T20A 3DA4A 3VE1A 1BXWA 3AA1A 3SY7A 4LSHA 1GFPA 3O0EA 3AA7A 2KDYA 4PUXA 2ZFGA 2JQYA 3T24A 5KAFO 3UAQA 3VE2A 5AFUK 4N74A 4AYDC 1GFQA 4KR4A 4FZLA 5H2FO 3LK2B 2KZ7A 3KVDD 2F1CX 3WI5A 4K3BA 4RLCA 4B61A 2R4LA 5G26A 3POUA 4JFBA 4C4VA 1OSMA 3DA3A 3PGUA 3FYXA 3GP6A 5G39A 1T16A 2Y0LA 3LK3A 4FSOA 4RLBA 3V8UA 2R4PA 5E79O 2IWVA 3PQSA 1S5LO 3C5OA 3NJTA 5GTIO 3AAEB 1H6S1 3G7GA 3BRZA 4AKRB 2Y7SA 2J1NA 4KRAA 4D65A 3AAEA 4FZNA 4FSPA 3QRAA 3BRYA 4RJWA 5B66O 2R4NA 1ZHTA 3AA0B 4UB6O 4GF4A 3SY9A 3T0SA 5B5EO 2ODJA 3K19A 2YPVA 3SZVA 3AAAB 3VY8X 4Z3TA 3PGSA 4D64A 2FGRA 4GCQA 5DL5A 4AYEC 3PQUA 2PRNA 1YS5A 2N2MA 2XTRA 3A0BO 3A2SX 2KZ7B 3POQA 3LK2A
chains in the Genus database with same CATH topology
3WU2O 4IL6O 3KZIO 3A0HO 5G39A 5G38A 5G3AA 2AXTO 5TISO 5E79O 1S5LO 5GTIO 5KAIO 4UB8O 5B66O 5KAFO 4UB6O 3JCUO 5B5EO 4PJ0O 5H2FO 5GTHO 3A0BO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 O;  4IL6 O;  3KZI O;  3A0H O;  5G39 A;  5G38 A;  5G3A A;  2AXT O;  5TIS O;  5E79 O;  1S5L O;  5GTI O;  5KAI O;  4UB8 O;  5B66 O;  5KAF O;  4UB6 O;  3JCU O;  5B5E O;  4PJ0 O;  5H2F O;  5GTH O;  3A0B O; 
#chains in the Genus database with same CATH topology
 4O4X A;  5IYU A;  1QJ9 A;  2KXP B;  3A0H O;  2O4V A;  3HW9 A;  2FGQ X;  3AA1 B;  3DWO X;  3SZD A;  4E1T A;  2W80 C;  2M06 A;  1QJ8 A;  1T1L A;  3VY9 X;  2ERV A;  3HOL A;  4XNK A;  4GCS A;  4U9C A;  1E54 A;  4KR8 A;  4RL9 A;  1HXU A;  4N58 A;  3POX A;  4O3Z A;  4UB8 O;  1Q9G A;  5EE2 A;  5ADX L;  4QQ1 A;  1MM5 A;  2R89 A;  1ZHZ A;  4F4B A;  2XTQ A;  2F1V A;  2KXP A;  4BUM X;  1P4T A;  2LFU A;  2Y0K A;  4GCP A;  3UU2 A;  4AUI A;  4FES A;  1IZN A;  1QJP A;  4AZL A;  5T5F A;  1PHO A;  5KAI O;  1HXX A;  4AFK A;  4AKM A;  4FQE A;  3VZT X;  4O3Y A;  4N75 A;  4FUV A;  2M07 A;  2XG6 A;  3LK4 1;  1ORM A;  1OPF A;  2WJQ A;  3SYS A;  3AA6 A;  3HOE A;  4CTD A;  3AAA A;  2R4O A;  5JDP A;  5PRN A;  3LK4 2;  4O49 A;  4AYI D;  3AA0 A;  3WU2 O;  2QTK A;  3KZI O;  2WJR A;  3PRN A;  3QRC A;  5G3A A;  2XE3 A;  3BS0 A;  4G76 A;  3TZG A;  4C00 A;  5TIS O;  1GFO A;  4AKR A;  4O3W A;  4GHB A;  2Y0H A;  2R8A A;  3EMN X;  5DL7 A;  1ZHX A;  3RBH A;  3WI4 A;  8PRN A;  1HXT A;  2N2L A;  1BH3 A;  4LSE A;  4C69 X;  1GFM A;  1ZHW A;  4FZM A;  1G90 A;  4D5U A;  3PGR A;  4O3X B;  4RJX A;  5AFU L;  5DL8 A;  3LK3 B;  2KC0 A;  2MNH A;  2X9K A;  3VZW X;  3POR A;  3PF1 A;  4AYM C;  1MPF A;  4FRT A;  5ADX K;  1THQ A;  2WVP A;  1BT9 A;  4G75 A;  5DL6 A;  4AYN A;  4FT6 A;  2Y2X A;  3JCU O;  2F1T A;  2R88 A;  2OMF A;  4LSF A;  4PJ0 O;  4E1S A;  5FVN A;  4K3C A;  2YNK A;  3DZM A;  4C4V B;  3NSG A;  5GTH O;  4FMS A;  5D5D A;  5GV0 A;  1GFN A;  1MM4 A;  4FRX A;  3JTY A;  3UPG A;  2X27 X;  1ZHY A;  2XE1 A;  2W81 C;  1IZN B;  3AA6 B;  2LHF A;  3SYB A;  2XMX A;  2ZLD A;  4IL6 O;  2JMM A;  6PRN A;  2J4U P;  4O4U A;  4N59 A;  5G38 A;  2AXT O;  2XE5 A;  4JCH A;  4FOZ A;  4LSI A;  4XNL A;  2K4T A;  2MHL A;  1Q9F A;  2POR A;  3AA7 B;  3DWN A;  1PRN A;  3HWB A;  3VZU X;  7PRN A;  4PR7 A;  2K0L A;  2IWW A;  2GE4 A;  2XE2 A;  3T20 A;  3DA4 A;  3VE1 A;  1BXW A;  3AA1 A;  3SY7 A;  4LSH A;  1GFP A;  3O0E A;  3AA7 A;  2KDY A;  4PUX A;  2ZFG A;  2JQY A;  3T24 A;  5KAF O;  3UAQ A;  3VE2 A;  5AFU K;  4N74 A;  4AYD C;  1GFQ A;  4KR4 A;  4FZL A;  5H2F O;  3LK2 B;  2KZ7 A;  3KVD D;  2F1C X;  3WI5 A;  4K3B A;  4RLC A;  4B61 A;  2R4L A;  5G26 A;  3POU A;  4JFB A;  4C4V A;  1OSM A;  3DA3 A;  3PGU A;  3FYX A;  3GP6 A;  5G39 A;  1T16 A;  2Y0L A;  3LK3 A;  4FSO A;  4RLB A;  3V8U A;  2R4P A;  5E79 O;  2IWV A;  3PQS A;  1S5L O;  3C5O A;  3NJT A;  5GTI O;  3AAE B;  1H6S 1;  3G7G A;  3BRZ A;  4AKR B;  2Y7S A;  2J1N A;  4KRA A;  4D65 A;  3AAE A;  4FZN A;  4FSP A;  3QRA A;  3BRY A;  4RJW A;  5B66 O;  2R4N A;  1ZHT A;  3AA0 B;  4UB6 O;  4GF4 A;  3SY9 A;  3T0S A;  5B5E O;  2ODJ A;  3K19 A;  2YPV A;  3SZV A;  3AAA B;  3VY8 X;  4Z3T A;  3PGS A;  4D64 A;  2FGR A;  4GCQ A;  5DL5 A;  4AYE C;  3PQU A;  2PRN A;  1YS5 A;  2N2M A;  2XTR A;  3A0B O;  3A2S X;  2KZ7 B;  3POQ A;  3LK2 A; 
#chains in the Genus database with same CATH homology
 3WU2 O;  4IL6 O;  3KZI O;  3A0H O;  5G39 A;  5G38 A;  5G3A A;  2AXT O;  5TIS O;  5E79 O;  1S5L O;  5GTI O;  5KAI O;  4UB8 O;  5B66 O;  5KAF O;  4UB6 O;  3JCU O;  5B5E O;  4PJ0 O;  5H2F O;  5GTH O;  3A0B O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...