1S5LO

Architecture of the photosynthetic oxygen evolving center
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
246
structure length
246
Chain Sequence
AKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 27
structure length 246
sequence length 246
chains with identical sequence o
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 1s5lO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 1s5lO02
5E79O 5B5EO 3JCUO 4UB8O 5TISO 5KAIO 4IL6O 2AXTO 5GTHO 3A0BO 5G3AA 3A0HO 4PJ0O 5H2FO 5GTIO 5B66O 5KAFO 5G38A 4UB6O 3KZIO 5G39A 3WU2O 1S5LO
chains in the Genus database with same CATH superfamily
5E79O 4O4UA 4AKRB 2XE2A 4LSIA 2F1CX 1BXWA 3VZWX 3AAAB 5B5EO 2Y0LA 4LSFA 3FYXA 7PRNA 5EE2A 5KAIO 2R88A 2K0LA 4O3ZA 2JMMA 2X27X 3PQSA 2R4LA 3RBHA 4AUIA 4GCQA 3SZVA 5ADXL 4AKMA 3VY8X 4PJ0O 1T16A 2R89A 2KZ7B 3AA0A 5PRNA 5T5FA 3V8UA 4D65A 5GTIO 2K4TA 3T20A 1HXXA 4G75A 4D5UA 2MHLA 3AA7B 5DL7A 1YS5A 5IYUA 2FGRA 2LFUA 2KC0A 2KXPA 4C4VA 2XE1A 5DL6A 2JQYA 4N75A 3LK3B 4E1TA 3A2SX 5G26A 1GFMA 4N58A 3LK2B 2F1TA 4FRTA 2WJRA 2XTQA 3LK2A 1PRNA 4FSPA 4AKRA 4CTDA 4N59A 3PF1A 4AYDC 1BH3A 3PORA 4XNKA 4AFKA 4G76A 2O4VA 1MM5A 2XMXA 4D64A 4RL9A 1ORMA 4U9CA 3WI4A 3AA0B 4IL6O 1BT9A 2AXTO 2QTKA 3SZDA 3GP6A 3PGSA 3BRYA 4GHBA 4Z3TA 4O3YA 2YPVA 4AYID 4JFBA 3PRNA 4FUVA 4FZNA 3KVDD 3DA4A 3PQUA 5D5DA 4B61A 5B66O 3DA3A 2IWVA 2WVPA 3EMNX 4FRXA 4LSEA 3SY9A 2N2MA 6PRNA 2XG6A 3WI5A 3T0SA 4PUXA 3LK42 3BRZA 3VE2A 3QRCA 1MM4A 5G38A 2Y0HA 1IZNA 3VY9X 3HWBA 3HW9A 5DL8A 1QJPA 2PORA 2R4NA 3NJTA 1Q9FA 4O3XB 5G39A 4JCHA 1ZHXA 3WU2O 2OMFA 4LSHA 4F4BA 2WJQA 3AA6B 4PR7A 3QRAA 4KRAA 1THQA 5TISO 2ERVA 4FZLA 4BUMX 4FSOA 3TZGA 1H6S1 2KDYA 2M06A 4AZLA 5GTHO 2MNHA 3A0HO 2KXPB 4C4VB 3LK41 3UPGA 4GF4A 3T24A 1PHOA 1P4TA 2X9KA 2XE5A 3AA1A 1E54A 3AAEB 3K19A 3AAEA 3JTYA 4FOZA 2ODJA 8PRNA 3POUA 5AFUL 4FT6A 4AYMC 3SY7A 4C00A 2Y0KA 1ZHWA 3PGUA 3UU2A 4RJXA 4AYEC 3AA6A 3DZMA 3HOLA 4GCPA 3SYSA 1MPFA 2R8AA 3VZTX 4RJWA 4FMSA 4O49A 2W80C 4RLBA 3UAQA 2ZLDA 4C69X 2J1NA 3BS0A 3DWOX 4FESA 1HXTA 1GFQA 3AA7A 1GFPA 2XE3A 1GFOA 2FGQX 3G7GA 3JCUO 4K3CA 2ZFGA 4KR4A 4UB8O 2IWWA 2Y2XA 3NSGA 3POXA 2M07A 4O4XA 2W81C 1Q9GA 1T1LA 2R4OA 1IZNB 3C5OA 4XNLA 5AFUK 3LK3A 3O0EA 2J4UP 2YNKA 3A0BO 2N2LA 5G3AA 1HXUA 3SYBA 4FQEA 4E1SA 2XTRA 5H2FO 3AAAA 4RLCA 3AA1B 4GCSA 2R4PA 5GV0A 5KAFO 3DWNA 1QJ8A 4AYNA 1ZHYA 3VE1A 2KZ7A 3HOEA 2GE4A 2Y7SA 1ZHZA 3PGRA 3POQA 4K3BA 5DL5A 1OPFA 5FVNA 5ADXK 1G90A 4UB6O 1ZHTA 2F1VA 4FZMA 3VZUX 2PRNA 4N74A 2LHFA 1QJ9A 3KZIO 4KR8A 1GFNA 5JDPA 4O3WA 1OSMA 1S5LO 4QQ1A
chains in the Genus database with same CATH topology
5E79O 5B5EO 3JCUO 4UB8O 5TISO 5KAIO 4IL6O 2AXTO 5GTHO 3A0BO 5G3AA 3A0HO 4PJ0O 5H2FO 5GTIO 5B66O 5KAFO 5G38A 4UB6O 3KZIO 5G39A 3WU2O 1S5LO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 O;  5B5E O;  3JCU O;  4UB8 O;  5TIS O;  5KAI O;  4IL6 O;  2AXT O;  5GTH O;  3A0B O;  5G3A A;  3A0H O;  4PJ0 O;  5H2F O;  5GTI O;  5B66 O;  5KAF O;  5G38 A;  4UB6 O;  3KZI O;  5G39 A;  3WU2 O;  1S5L O; 
#chains in the Genus database with same CATH topology
 5E79 O;  4O4U A;  4AKR B;  2XE2 A;  4LSI A;  2F1C X;  1BXW A;  3VZW X;  3AAA B;  5B5E O;  2Y0L A;  4LSF A;  3FYX A;  7PRN A;  5EE2 A;  5KAI O;  2R88 A;  2K0L A;  4O3Z A;  2JMM A;  2X27 X;  3PQS A;  2R4L A;  3RBH A;  4AUI A;  4GCQ A;  3SZV A;  5ADX L;  4AKM A;  3VY8 X;  4PJ0 O;  1T16 A;  2R89 A;  2KZ7 B;  3AA0 A;  5PRN A;  5T5F A;  3V8U A;  4D65 A;  5GTI O;  2K4T A;  3T20 A;  1HXX A;  4G75 A;  4D5U A;  2MHL A;  3AA7 B;  5DL7 A;  1YS5 A;  5IYU A;  2FGR A;  2LFU A;  2KC0 A;  2KXP A;  4C4V A;  2XE1 A;  5DL6 A;  2JQY A;  4N75 A;  3LK3 B;  4E1T A;  3A2S X;  5G26 A;  1GFM A;  4N58 A;  3LK2 B;  2F1T A;  4FRT A;  2WJR A;  2XTQ A;  3LK2 A;  1PRN A;  4FSP A;  4AKR A;  4CTD A;  4N59 A;  3PF1 A;  4AYD C;  1BH3 A;  3POR A;  4XNK A;  4AFK A;  4G76 A;  2O4V A;  1MM5 A;  2XMX A;  4D64 A;  4RL9 A;  1ORM A;  4U9C A;  3WI4 A;  3AA0 B;  4IL6 O;  1BT9 A;  2AXT O;  2QTK A;  3SZD A;  3GP6 A;  3PGS A;  3BRY A;  4GHB A;  4Z3T A;  4O3Y A;  2YPV A;  4AYI D;  4JFB A;  3PRN A;  4FUV A;  4FZN A;  3KVD D;  3DA4 A;  3PQU A;  5D5D A;  4B61 A;  5B66 O;  3DA3 A;  2IWV A;  2WVP A;  3EMN X;  4FRX A;  4LSE A;  3SY9 A;  2N2M A;  6PRN A;  2XG6 A;  3WI5 A;  3T0S A;  4PUX A;  3LK4 2;  3BRZ A;  3VE2 A;  3QRC A;  1MM4 A;  5G38 A;  2Y0H A;  1IZN A;  3VY9 X;  3HWB A;  3HW9 A;  5DL8 A;  1QJP A;  2POR A;  2R4N A;  3NJT A;  1Q9F A;  4O3X B;  5G39 A;  4JCH A;  1ZHX A;  3WU2 O;  2OMF A;  4LSH A;  4F4B A;  2WJQ A;  3AA6 B;  4PR7 A;  3QRA A;  4KRA A;  1THQ A;  5TIS O;  2ERV A;  4FZL A;  4BUM X;  4FSO A;  3TZG A;  1H6S 1;  2KDY A;  2M06 A;  4AZL A;  5GTH O;  2MNH A;  3A0H O;  2KXP B;  4C4V B;  3LK4 1;  3UPG A;  4GF4 A;  3T24 A;  1PHO A;  1P4T A;  2X9K A;  2XE5 A;  3AA1 A;  1E54 A;  3AAE B;  3K19 A;  3AAE A;  3JTY A;  4FOZ A;  2ODJ A;  8PRN A;  3POU A;  5AFU L;  4FT6 A;  4AYM C;  3SY7 A;  4C00 A;  2Y0K A;  1ZHW A;  3PGU A;  3UU2 A;  4RJX A;  4AYE C;  3AA6 A;  3DZM A;  3HOL A;  4GCP A;  3SYS A;  1MPF A;  2R8A A;  3VZT X;  4RJW A;  4FMS A;  4O49 A;  2W80 C;  4RLB A;  3UAQ A;  2ZLD A;  4C69 X;  2J1N A;  3BS0 A;  3DWO X;  4FES A;  1HXT A;  1GFQ A;  3AA7 A;  1GFP A;  2XE3 A;  1GFO A;  2FGQ X;  3G7G A;  3JCU O;  4K3C A;  2ZFG A;  4KR4 A;  4UB8 O;  2IWW A;  2Y2X A;  3NSG A;  3POX A;  2M07 A;  4O4X A;  2W81 C;  1Q9G A;  1T1L A;  2R4O A;  1IZN B;  3C5O A;  4XNL A;  5AFU K;  3LK3 A;  3O0E A;  2J4U P;  2YNK A;  3A0B O;  2N2L A;  5G3A A;  1HXU A;  3SYB A;  4FQE A;  4E1S A;  2XTR A;  5H2F O;  3AAA A;  4RLC A;  3AA1 B;  4GCS A;  2R4P A;  5GV0 A;  5KAF O;  3DWN A;  1QJ8 A;  4AYN A;  1ZHY A;  3VE1 A;  2KZ7 A;  3HOE A;  2GE4 A;  2Y7S A;  1ZHZ A;  3PGR A;  3POQ A;  4K3B A;  5DL5 A;  1OPF A;  5FVN A;  5ADX K;  1G90 A;  4UB6 O;  1ZHT A;  2F1V A;  4FZM A;  3VZU X;  2PRN A;  4N74 A;  2LHF A;  1QJ9 A;  3KZI O;  4KR8 A;  1GFN A;  5JDP A;  4O3W A;  1OSM A;  1S5L O;  4QQ1 A; 
#chains in the Genus database with same CATH homology
 5E79 O;  5B5E O;  3JCU O;  4UB8 O;  5TIS O;  5KAI O;  4IL6 O;  2AXT O;  5GTH O;  3A0B O;  5G3A A;  3A0H O;  4PJ0 O;  5H2F O;  5GTI O;  5B66 O;  5KAF O;  5G38 A;  4UB6 O;  3KZI O;  5G39 A;  3WU2 O;  1S5L O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...