1S5LU

Architecture of the photosynthetic oxygen evolving center
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
105
Chain Sequence
b'AATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
total genus 21
structure length 105
sequence length 105
chains with identical sequence u
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 1s5lU01
4UB6U 3A0HU 1S5LU 5GTIU 5GTHU 4PJ0U 5H2FU 5B66U 5KAIU 3KZIU 5E79U 2DUYA 5B5EU 5KAFU 4UB8U 5TISU 2AXTU 4IL6U 3WU2U 3A0BU
chains in the Genus database with same CATH superfamily
4NWIA 1WUDA 5J2FA 2KV2A 3PO5A 4MFFA 2ZIUA 3EW9A 4KLFA 4KLMA 5KFQA 2VKQA 1RG6A 4HYKA 4NLZA 5KT6A 9ICUA 3H0LB 2MUTA 2DPJA 5F9LA 2KK0A 1PK1B 8ICIA 4KLOA 1T4GA 3I28A 4R66A 3K1RB 4KLUA 2QARA 3T5LA 5J2BA 3G6VA 1EXNA 2LM4A 7ICIA 3UM9A 3ISCA 3TAPA 3ISBA 4FZNA 3M9OB 1ZQWA 5ALSA 2UVVA 5HR7A 5DBAA 4I29A 1WG8A 2W7OA 1LB2B 1ZQAA 5J0YA 5DB9A 2KG5A 9ICLA 2W43A 3AN1A 2PXIA 4PGYA 4DOBA 4B9VA 2HBLA 4Y2YA 2KJ9A 4YP3A 3Q8PB 4UAZA 3KOOA 5HNKA 4YD2A 3RH5A 3GV7B 2XGQA 4F4KA 5GTIU 3DEEA 7ICNA 5C5JA 5KG2A 4MFAA 2ZUBA 8ICLA 4Y2XA 1Z19A 2Y1JA 4KN4A 4EELA 4KLGA 2HHVA 4QZCA 3PW7A 2K4HA 3PSFA 3Q8QB 1SWVA 2OWOA 2JRZA 1U45A 3T79A 7ICMA 4Z6DA 2F8KA 4EX6A 4U7CA 1IG6A 5ALXA 2W9CB 3C2KA 1JRPA 2HCFA 3SD7A 4QIWC 3EUB2 5ALVA 5AIBA 5J0QA 2CXYA 4RNMA 3TFRA 4DL7A 2FDRA 2E8MA 4EBDA 5A0LA 2K4PA 3NUQA 4KX3A 3UQ0A 4C8KA 4DFMA 4DFPA 1BPBA 2LKYA 4M2YA 2PFNA 2YB4A 3C29A 3V7KA 1Z00A 4ECZA 3SYZA 1CEZA 3IM1A 4EYIB 4IRCA 4UB5A 3RR7A 3EPIA 3Q8MA 3WKCA 2ZJ5A 3N7RC 5J0SA 3RRHA 3GZFA 3M6ZA 5KFZA 2OEHA 2WB1C 5KFJA 1NK5A 3B0XA 2ZUCA 3BZKA 4GXKA 3SV4A 4F5NA 1RQNA 2RQ5A 4RNOA 2KVSA 2BZFA 3MR5A 1ZRMA 1NNLA 2H3FA 5CEHA 2JEIA 5CR0A 2R8IA 5J2AA 1S10A 2XY5A 4F4WA 9ICTA 2XGPA 2ZJAA 1HUOA 2Z7JA 3WK6A 7ICPA 1XSNA 4U6PA 4M04A 4QZ9A 2F2AB 2W3RA 4F5QA 1OW5A 1ZQJA 1L7MA 8ICFA 1S0OA 1JI7A 3WKEA 2O6KA 7ICKA 4K4IA 1TKDA 8ICUA 2MRLA 3JPOA 3I1YA 7ICOA 3JPRA 1X42A 2YB1A 5KFLA 3OHAA 1S77D 3PNCA 5J2JA 5AI4A 1VLBA 1M6YA 4Z6FA 2FLLA 4DQPA 1PUZA 3AEVA 4JWMA 2NRVA 4F4YA 4ECRA 5JTIA 1N2XA 5KG4A 1A77A 4NLBA 1J97A 4WJ3B 3N7PD 1ZQMA 2MUTB 4UB6U 4ED6A 4E0DA 2I6XA 3RJKA 2RHFA 4RQ8A 5GTHU 3RB3A 2R8GA 5KFTA 3PX0A 4LZGA 3L4PA 3H7IA 5J2IA 3L3FX 4DS4A 2J6SA 3BQ0A 4UATA 4F8RA 1PVRA 3M6KA 4FO6A 3EYZA 2ISOA 4IRDA 3RB0A 2GWSA 2ES6A 8ICMA 3RAQA 1F5SA 4Q44A 5AKHA 5AKJA 1L3SA 2YMMA 2ZTDA 5ALZA 2ZTCA 3KHHA 1U9LA 2DUYA 2D3DA 2PI4A 7ICRA 5J2GA 5AKLA 3R9KA 4EBEA 1MA7A 2I9GA 2UVUA 5ALMA 2GH1A 1KTQA 3WK4A 3AU2A 4LJXA 4Q8FA 2P6UA 3PMLA 2LYAA 2AJQA 2DBYA 1SWWA 4MEXA 3SR6A 1NI3A 2LHTA 1ZD2P 2F1HA 3AQFA 4I2EA 3MDCA 4C4RA 1JXEA 2K8BB 4RQNA 4O3SA 5HHHA 3OPXA 2G08A 3DV9A 3MR3A 1P7DA 4K4HA 4P4OA 4MF2A 9ICFA 4O3NA 2E8NA 3BS5A 3H8WA 1DGSA 3SEIA 4GXJA 1NOMA 5JUMA 3MFIA 2ASLA 5AM4A 4EYHB 2OH2A 2FI1A 1Z00B 1F44A 3KTQA 4AP9A 4F2RA 2NO5A 3C1ZA 1ZRNA 5AI9A 4MEYA 5AM5A 2BQRA 3ETRA 4O3MA 5KTQA 1SB3C 4OJLA 5KFXA 4DSKA 2HBKA 5KG0A 1XC9A 2WHEA 4DLGA 8ICXA 1PK1A 2AU0A 2E1FA 3GIMA 5J0OA 1ZQOA 3V6JA 4P0QA 1MQ3A 2ZIWB 3KBBA 4NLNA 1MC8A 1OXJA 1N48A 2XI9A 9ICPA 2AQ4A 4BUGA 2H3ZA 2E8PA 5J0UA 2C2RA 3RFAA 1UPHA 1IXRA 4B9LA 4US8A 5BOLA 3KHGA 3D6JA 5IIMA 3RB6A 4RU9A 2NRWA 2VANA 4NM2A 4MF8A 2DKXA 2P66A 3ICXA 4QZEA 1NK4A 3B0YA 2WF8A 4EEYA 4Y2PA 5KAFU 3T5KA 2G5IB 1FO4A 4DSFA 3MDAA 3RJJA 1IM4A 4Z6EA 4DFDA 2KE7A 3AUOA 3CRXA 4NLCA 2ZTEA 1Q3UA 2R8HA 2KNJA 5KNIA 2GO7A 2JGAA 3MR2A 3PW5A 3JPQA 1MQ2A 4DL2A 4R63A 3UXOA 1JIHA 1QCKA 4C8MA 1SV0C 5KFSA 3GILA 2AXTU 2HHTA 1BNOA 5KL8B 4FE3A 1T3QA 4CE6A 5EWEA 4Y2QA 2W9CA 4DEZA 4F4ZA 4DSEA 1ZQDA 1T94A 3C28A 3VCBA 5KFUA 3Q8SB 3TAQA 2W9MA 4J03A 1MN8A 8ICWA 2A1AA 1TVAA 3QU9A 2ZG6A 3D2NA 5TISU 3UMBA 4DOAA 2MU2A 4UAYA 3J81j 3F2CA 4KTQA 2Y9TA 2ZIVB 3SI8A 1XU4A 1VJ5A 4FS1A 1KLNA 1NK7A 2ALZA 3RRGA 1ZJNA 5AM2A 5JU5A 3JPNA 1X66A 3M7DA 4Y2JA 4DL6A 2EAOA 5J8YA 5J29A 3M1YA 5FP0A 2A1JA 1ZJMA 2AGOA 3A0BU 3QU4A 3MR6A 4EBCA 4R64A 1WCLA 4Y2RA 4UAUA 1U4BA 4O5EA 5IINA 1MSWD 5D46A 5H2FU 5IIJA 4M9LA 2QKQA 4NLKA 2JMGA 4UBBA 3HJEA 1HEKA 3AM9A 5J2KA 2DQNB 4YMMA 1XS9D 2HVHA 5AM3A 4DF8A 3HW8A 4G3IA 2ASJA 1JMSA 4UARA 3V7LA 3BS7A 2XVTA 3O0FA 1S97A 3QEAZ 3ZD8A 5DQHA 3AQEA 1A0PA 4DQRA 5D49A 4DL3A 1X6JA 3OSPA 4QZGA 8ICRA 2FMQA 2KJ8A 4FZMA 3BS5B 2LI6A 5AK4A 2J6UA 1Z4NA 1K1SA 2EZXA 2RDIA 2KP7A 4M6WB 4DF4A 3IRUA 1JROA 5ALUA 4NXZA 4Q8EA 4CDGA 4EENA 2KSOB 2HBJA 5ALTA 1UT5A 2EZZA 4Z6CA 1HJPA 1L7PA 3AL0B 4I2FA 4J9PA 4RT2A 3ED5A 3PSPA 1DRGA 4P0QB 1X9XA 1C7YA 3G6YA 4PJ0U 4O3PA 3MGIA 7ICJA 1ZOLA 1QH9A 3PSIA 3HT3A 4ED1A 1RXWA 5HMMA 5F3XB 4KLHA 3SZ2A 4RQ4A 5DG9A 1HIWA 3H4DA 2JV3A 4M0AA 2V4QA 2KZMA 4I2DA 2Q4TA 2XY6A 4CF4A 5HHIA 1S0VA 3JPSA 9ICOA 1ZQZA 3TACB 1L8OA 1PVPA 5L1JA 3ORYA 1TK5A 3QU5A 2YMQA 5AK5A 1L3TA 1TK8A 4B9MA 3TKAA 4NL9C 4QWDA 3FAHA 4DLEA 1V9PA 2VJ5A 9ICMA 3GDXA 2KZZA 1BGXT 3MC1A 2NRXA 4PGXA 1PZNA 1RQLA 4RQ3A 3MGHA 3ZDEA 3FDSA 3NRWA 2D8CA 1TAMA 1N61A 2AQ0A 4DQSA 1FFUA 2RLTA 4OJOA 5AHXA 3ZI4A 4ECQA 2H3VA 3C1YA 2G06A 5KFHA 5J2EA 4YR3A 2G5HB 2W54A 3CW2C 3KZIU 5AKZA 1KL9A 4YXJA 2WTFA 3F5EA 4RQ1A 2BCSA 5CWRA 5K4LA 1FFVA 1SL1A 2BDUA 3CYMA 8ICPA 1Y88A 4C4SA 4F5RA 1X6IA 4IR9A 1IV8A 3QU2A 3GV8B 4Y2UA 5J0XA 3TARA 4G9BA 4DSIA 2FPLA 2E1EA 1NK9A 7ICQA 1ZQVA 2A1JB 1LKYB 1UA1A 5ALIA 1L8LA 4YFKA 4ED8A 3A0HU 2ZIWA 1ZQQA 1ZQKA 5KFYA 1RZTA 1B0XA 8ICYA 1HUZA 1QTMA 1ZQNA 2F77X 5KG7A 3KKAC 4GC6A 3L5KA 4F93B 1ZQFA 3V72A 2HHWA 3TI0A 1NKBA 2E5SA 4J9OA 2IHNA 3IV6A 1ZQCA 4ECVA 3QU7A 3RJHA 1ZQGA 1RDFA 4QZBA 4MHVA 3RTVA 4ELTA 2KVCA 4P4MA 4EZ9A 1COKA 5DDYA 3HILA 4DFJA 1ZQHA 9ICJA 3H8JA 4QJFB 1Q8KA 1KQQA 5KT2A 3OJSA 4B9TA 3C5FA 4YVZA 3PZPA 4C8OA 4PHDA 3V7JA 2A19A 3BZCA 5KT3A 2LPEA 2B21A 2H5XA 4RUCA 1WWUA 2BDPA 5DGAA 2DWQA 1S0NA 1NJXA 2VIXA 4QZHA 4EEKA 4I27A 1KFDA 1F0MA 1NZBA 4JB3A 1SGGA 1JN3A 1N5XA 1IIPA 4DFKA 9ICWA 1XSPA 1LVHA 4K4GA 4YQWA 1DXSA 3CNHA 4I2GA 4NM1A 1QQ7A 5T14A 3WU2U 4YR0A 3NVWA 3GQCA 5L1LA 8ICVA 2IMWP 2ZIVA 2JZBA 4DQQA 2XICA 2EH9A 4OD0A 1Z3EB 3IG8A 4P4PA 4M9NA 3ONNA 2OHFA 2DGZA 1ZQBA 2DPIA 1KFTA 2KMDA 5L9XA 1Z4OA 3E0FA 2PFOA 1YZ6A 4Q45A 1D8BA 4DWIA 7ICEA 3G6XA 1N5WA 4DCCA 1KRPA 3RR8A 5CJ7A 2QB1A 8ICTA 1LV5A 3KFUF 1N63A 4J9LA 3MBYA 5KG1A 2F1JA 3ZDBA 3WK8A 1CUKA 2NO4A 2K60A 5KFIA 3KHLA 1BNPA 5DKWA 3GIKA 4BXOB 1KKXA 2KFNA 3U26A 4C4TA 5KFWA 4ECUA 1ZQTA 1RXVA 1ZYQA 3ETLA 3PW2A 4B6JA 5ALQA 2BCVA 4QW9A 3NTUA 3M8SA 2P6RA 3GIIA 5J2HA 3QYPA 3C2MA 1UHUA 1JXLA 5KT7A 3Q8LA 3QNMA 1L3UA 2C22A 3E2EA 3PSTA 4P2HA 4KLJA 1N56A 8ICSA 1XNSA 2KOBA 5AICA 2G0AA 2YQEA 1U48A 3RJFA 1QQ5A 2BCQA 1J2MA 2HI0A 3PMNA 1ZQXA 4M6WA 4ZH4A 2AH5A 4YCXA 5DLFA 1BPZA 3LDAA 2VA8A 3BQ1A 2KSOA 5KAIU 4KLIA 2K89A 3T5JA 5TZVA 5J0RA 4RT3A 2FMPA 4CNQA 4YG2A 2LYHA 1T3NA 4YMNA 5EOZA 4KMOB 1YT3A 5L1KA 4O3OA 4RQ6A 4EZ6A 1NK0A 1K1QA 2DKZA 4XQ8A 2W11A 3TADC 2AGPA 1K5OA 1A6SA 1KDHA 2W03A 1S9FA 4J9KA 4IS7A 1CI4A 4M47A 5KFAA 4C8NA 3HP6A 2FPKA 1OUQA 5F9NA 4JWNA 5L1MA 2RP5A 3PO4A 2HVIA 1N62A 4P0PA 2OCEA 5DBCA 9ICNA 2UVWA 4DQIA 3SAHA 1SL0A 1SKSA 4LVSA 1QLNA 4US9A 1ED1A 5KG3A 3M9MB 1SL2A 1V97A 5CA7A 4UW9A 2NRZA 2J6TA 4PHPA 4ED7A 8ICOA 2V4RA 2Y9UA 3K4GA 1BPYA 4I2HA 2Q0ZX 2WAQF 4ECXA 2LM1A 4GFJA 4Y2SA 2BQ3A 2B6GA 3N97B 3BDPA 4TURA 2AHOB 5ALHA 1ZQPA 5EE1A 2RDJA 4OCZA 1TFRA 3N4MB 2IOHA 5DB7A 1DK3A 4YMOA 3HKZF 2VA2A 3K75D 2YN4A 1XO0A 2IOFA 2HHXA 5EWGA 1ZQUA 9ICCA 5ALGA 4F71A 9ICGA 5AI0A 2BCUA 4Y2TA 5KL1B 3FYHA 4UB3A 1T7PA 2WFAA 9ICSA 2F1IA 3F5AA 4OJ6A 3WK9A 2K4IA 3S6JA 1D8LA 1X9MA 2JZBB 3UQ2A 3NRZA 2OXOA 2W9BB 4J9NA 1Q3VA 2HDOA 5E79U 4I2IA 3PW4A 3QE9Y 7ICTA 4KLLA 3B9JA 3K1ZA 2CN1A 1ZD4A 3H0MB 4RPYA 3IG5A 3ALRA 4DL5A 9ICHA 3HWTA 4QNLA 1T8EA 1ZQSA 4A8EA 1LKYA 2FJ6A 1PVQA 1AROP 2WF6A 2B0CA 4PZNA 2Y0SF 3H0RB 5AIAA 3I76A 4UB2A 1A76A 4RNNA 4PHEA 5EWFA 2A3VA 4HAIA 4OJPA 2HMXA 3RBDA 2YX8A 5DB6A 4RPZA 5D4BA 1RM6C 4Y2VA 2JHDA 3QEBZ 4X5VA 3BQ2A 5ALWA 1QQ6A 3EWAA 5AM1A 3TFSA 2BPGA 4I28A 1ZD3A 7ICLA 2PI5A 1RYUA 2VA3A 4NJ8A 5HMLA 1ZQYA 3GFKB 4UAWA 1NKEA 4Q43A 4IC9A 1WYGA 2G09A 8ICNA 1RYRA 3H4BA 3SAFA 5HP4A 4ELUA 4JK1A 5KFMA 3C2LA 2GLEA 4KLSA 2EANA 1ZQEA 3IHQB 4XRHA 1JUDA 2OM6A 3F2BA 4AYBF 5KFNA 2ZIXA 4ECSA 4M9GA 4J9RA 2JR5A 3V6KA 1ZD5A 3LVVA 4UB1A 3QUBA 4ED3A 2PMZF 2PFQA 2GOLA 2AGQA 5DB8A 3M9NB 4IQVA 4XA5A 2E3TA 4ACOA 3KHRA 4DL4A 1U49A 3GU3A 1SV4A 2R18A 1U47A 1NJWA 4R8UB 4I2AA 4PGQA 4MFCA 4LZDA 1JALA 3OGUA 3SAGA 2XCAA 4P0PB 4M9JA 2JH7A 5ALOA 2ASDA 2N1RA 4JV2A 2F8LA 1O03A 1SV0A 3EZ5A 3C21A 5JRTA 2BPFA 1UQVA 1H38A 2FMSA 2P35A 4O5KA 5EE0A 4QZDA 1TAQA 2ATLA 9ICQA 1NZPA 2FLNA 3Q8KA 3OHBA 4FBUA 1Z1VA 4J9MA 3UMCA 5DGBA 3Q8RB 3TANA 2YMLA 4KLDA 7ICUA 4GC7A 4FFDA 5BPCA 7ICVA 3JPTA 4DS5A 5KFFA 3OJUA 4BXOA 1COOA 4DSJA 3BQ7A 2HHUA 1V85A 1X2IA 2DF4B 4PPXA 2BPCA 4TQRA 1L7OA 1SXDA 2JEGA 5IILA 3BJYA 1V38A 1B4FA 1BPXA 2F76X 1FEZA 2BR0A 5AI6A 5KFCA 4ED0A 2EZYA 1QSYA 3T3FA 5IIOA 1ZQIA 4I2BA 4JV1A 4IQUA 2ISPA 5KFBA 1N60A 3SMVA 4QW8A 3WK5A 3QZ8A 2MA1A 4FZLA 4UB8U 2R8JA 4O9MA 2HHSA 8ICQA 3SQIA 3LYSA 8ICJA 4KITB 4GXIA 2R8KA 2KKVA 3RJIA 3IP4B 4ED2A 1L3VA 3PY8A 1FIQA 2HW3A 5DG8A 2HOIA 3GIJA 2XIDA 3H8MA 1SZHA 1D9DA 1ZQLA 4IQWA 4ECWA 3QUQA 2NV3A 2OYYA 4O3RA 7ICFA 2KKPA 4F4XA 1S5LU 3SENA 1NKCA 4QWEA 4BJQA 3NS1A 4J9QA 1XSLA 4CGZA 4TUPA 3UMGA 2BHNA 4C7ZA 7ICSA 2RRDA 1DOQA 3NASA 2KZ3A 2ZUDA 3DDHA 1VDVA 4YXMA 1DGJA 3WKAA 2W04A 3HPOA 4ECYA 3F53A 2KHVA 1O08A 4PZOA 3ZD9A 3FC4A 4I2JA 4RQMA 5AK3A 2W8KA 3N28A 4KLTA 5AKGA 9ICXA 8ICBA 4F5OA 8ICCA 3PX4A 2KIWA 5G5HA 3LWLA 2M0NA 4C80A 5CB1A 2KJ5A 1KBUA 5AM0A 4NV0A 2KHQA 5AKIA 3N7SC 1XO1A 2DFLA 1SKWA 2WF7A 3PR4A 2XC9A 1KN5A 3VC8A 1WCNA 5DG7A 1UT8A 2MAXA 5CRXA 2WAQC 4KMUA 5KG6A 5J0WA 3FM9A 2KFZA 3PX6A 2EDUA 2D6FC 2ZIXB 1XWLA 4CCHA 8ICHA 2K4EA 3QUCA 2MSNA 5DBBA 1L7NA 2XCPA 4J9SA 2ODGA 4RZRA 2ZIUB 1X9SA 1NJZA 4OO1J 5KT5A 4NL9A 9ICBA 5J0PA 5HR6A 3HKZC 2YTUA 2HOQA 3SV3A 2K8CB 3ZDDA 3ZDCA 4GIBA 4KLQA 2YY6A 1NJYA 1KW4A 2HHQA 4PL1A 4B9SA 2Y1IA 5DDMA 2QARB 2W9BA 1SIJA 3QUTA 7ICHA 4ELVA 7ICGA 3PR5B 5J0TA 1RYSA 1Q46A 3C23A 3E58A 4JV0A 5KG5A 3NGDA 1S76D 2QB0A 5J2DA 2CPRA 1L6NA 3NVVA 4ECTA 4IR1A 2NYVA 2PKEA 4UASA 1ZQRA 2F44A 2K8AA 3LVWA 2EAMA 5KFOA 2Y0SC 5L1IA 1KSPA 3RF9A 2FE9A 3NVYA 4PHAA 2C2EA 2BCRA 5CHGA 1TAUA 1X40A 3MGVA 4EX7A 1NK8A 1D8YA 3RB4A 2BQUA 2IA6A 9ICIA 3QZ7A 2HSZA 1ECWA 1S8OA 2W55A 3QX7A 3RH6A 2PFPA 4QWCA 1Z1BA 2H3IA 4F72A 3AU6A 4KX5A 4KLEA 4QIWF 2H3QA 2V9WA 5DLGA 1TE2A 2UVRA 2WF9A 5J8YC 3D2SA 4R65A 2W3SA 1BPEA 1URJA 4CF3A 9ICRA 4BX9C 4RQ5A 1UCVA 5EE3A 3KKAA 9ICAA 2KTQA 2NRTA 5B66U 3RH4A 4IQTA 3M8RA 2KIVA 3OTQA 5AK6A 5ALDA 4BGDA 4JMUA 1GO3F 2EQYA 5G5GA 1TV9A 4DSLA 1J2NA 3UPQA 4M9HA 1JX4A 5KFRA 3V6HA 3JPPA 2WB1F 2WF5A 4UQGA 1QSSA 1ZXIA 3H40A 4AYBC 4JUZA 4F92B 4QZ8A 5AKXA 2VJ4A 4QZAA 4R8UA 2ZXHA 3QXGA 3PVXA 2PMZC 3MFHA 2XO7A 3IDWA 4F2SA 3RJGA 4C0ZA 4F3OA 2FPMA 3GV5B 5AKYA 5ALFA 2IHMA 9ICKA 1YZ7A 3UXNA 4DOCA 2JH1A 2ZXIA 4QZIA 3PW0A 1S0MA 4UBCA 1SXEA 8ICGA 3ZDAA 2I5HA 2I1QA 4QZFA 4QWBA 4FS2A 4UB4A 4XUSA 4RQ0A 5AI8A 3D2QA 1C20A 2E8OA 3F2DA 5DQIA 3MABA 5ALYA 2XY7A 3THVA 4BWJA 3RBEA 5ALNA 5ALJA 3OSNA 2JEJA 2LBOA 3WKBA 4IL6U 2HOFA 3IN5A 5C0YA 4RUAA 5IIKA 4F5PA 2IOFK 1KFSA 4USAA 3T5HA 4NY8A 4IRKA 4UAVA 1UA0A 5KFKA 2HBMA 1ZETA 1L5UA 9ICVA 1AQ6A 2EAPA 1BVSA 4NLGA 2LMRA 4C7YA 4RPXA 2ZJ8A 2W9AA 5ALEA 9ICEA 4B9UA 5AI5A 5ALKA 1WWVA 2W8LA 2QLTA 5AKKA 1SKRA 4YN4A 1D9FA 4CF5A 4F50A 5KFGA 3LK9A 5B5EU 4YR2A 2CRXA 2KN7A 3PV8A 4O3QA 3CP8A 2YMPA 4RQ7A 3EPGA 1SZPA 2QB0B 4C8LA 1ZQ1C 2DL0A 4O0IA 5KFVA 4F91B 1KEJA 3WK7A 2ESEA 4BDPA 8ICAA 1BPDA 2KEYA 3AMZA 3UXPA 5BOMA 8ICEA 5IIIA 2LYBA 3BQTA 3C5GA 4PL2A 5KFPA 1TK0A 4DO9A 3NVZA 5KFEA 3KD3A 3RJEA 5KT4A 3H8SA 8ICZA 5J2CA 1B43A 2G07A 4PH5A 5DQGA 1CRXA 3ISDA 4QWAA 3WKDA 1NK6A 4KN7A 2L5YA 5CP2A 3LWMA 3TQ1A 2M9NA 3HRDD 2FLPA 4OJ5A 5KFDA 2C28A 4TQSA 4ZOHC 1RPLA 4YD1A 4I2CA 8ICKA 2KD1A 3HX0A 3TADA 4B9NA 2BGWA 2W7PA 3KZXA 5ALRA 4BWMA 1DK2A 2BKEA 1X9WA 3RAXA 2C2DA 4GLXA 5AKEA 1PK3A 5ALPA 4O5CA 5ALLA 2KICA 5EE9A 1QSLA 4ICAA 1B22A 2JEFA 4TUQA 2IBKA 4CRXA 4TUSA 2JXJA 4RQ2A 2F3NA 4FBTA
chains in the Genus database with same CATH topology
4UB6U 3A0HU 1S5LU 5GTIU 5GTHU 4PJ0U 5H2FU 5B66U 5KAIU 3KZIU 5E79U 2DUYA 5B5EU 5KAFU 4UB8U 5TISU 2AXTU 4IL6U 3WU2U 3A0BU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 U;  3A0H U;  1S5L U;  5GTI U;  5GTH U;  4PJ0 U;  5H2F U;  5B66 U;  5KAI U;  3KZI U;  5E79 U;  2DUY A;  5B5E U;  5KAF U;  4UB8 U;  5TIS U;  2AXT U;  4IL6 U;  3WU2 U;  3A0B U; 
#chains in the Genus database with same CATH topology
 4NWI A;  1WUD A;  5J2F A;  2KV2 A;  3PO5 A;  4MFF A;  2ZIU A;  3EW9 A;  4KLF A;  4KLM A;  5KFQ A;  2VKQ A;  1RG6 A;  4HYK A;  4NLZ A;  5KT6 A;  9ICU A;  3H0L B;  2MUT A;  2DPJ A;  5F9L A;  2KK0 A;  1PK1 B;  8ICI A;  4KLO A;  1T4G A;  3I28 A;  4R66 A;  3K1R B;  4KLU A;  2QAR A;  3T5L A;  5J2B A;  3G6V A;  1EXN A;  2LM4 A;  7ICI A;  3UM9 A;  3ISC A;  3TAP A;  3ISB A;  4FZN A;  3M9O B;  1ZQW A;  5ALS A;  2UVV A;  5HR7 A;  5DBA A;  4I29 A;  1WG8 A;  2W7O A;  1LB2 B;  1ZQA A;  5J0Y A;  5DB9 A;  2KG5 A;  9ICL A;  2W43 A;  3AN1 A;  2PXI A;  4PGY A;  4DOB A;  4B9V A;  2HBL A;  4Y2Y A;  2KJ9 A;  4YP3 A;  3Q8P B;  4UAZ A;  3KOO A;  5HNK A;  4YD2 A;  3RH5 A;  3GV7 B;  2XGQ A;  4F4K A;  5GTI U;  3DEE A;  7ICN A;  5C5J A;  5KG2 A;  4MFA A;  2ZUB A;  8ICL A;  4Y2X A;  1Z19 A;  2Y1J A;  4KN4 A;  4EEL A;  4KLG A;  2HHV A;  4QZC A;  3PW7 A;  2K4H A;  3PSF A;  3Q8Q B;  1SWV A;  2OWO A;  2JRZ A;  1U45 A;  3T79 A;  7ICM A;  4Z6D A;  2F8K A;  4EX6 A;  4U7C A;  1IG6 A;  5ALX A;  2W9C B;  3C2K A;  1JRP A;  2HCF A;  3SD7 A;  4QIW C;  3EUB 2;  5ALV A;  5AIB A;  5J0Q A;  2CXY A;  4RNM A;  3TFR A;  4DL7 A;  2FDR A;  2E8M A;  4EBD A;  5A0L A;  2K4P A;  3NUQ A;  4KX3 A;  3UQ0 A;  4C8K A;  4DFM A;  4DFP A;  1BPB A;  2LKY A;  4M2Y A;  2PFN A;  2YB4 A;  3C29 A;  3V7K A;  1Z00 A;  4ECZ A;  3SYZ A;  1CEZ A;  3IM1 A;  4EYI B;  4IRC A;  4UB5 A;  3RR7 A;  3EPI A;  3Q8M A;  3WKC A;  2ZJ5 A;  3N7R C;  5J0S A;  3RRH A;  3GZF A;  3M6Z A;  5KFZ A;  2OEH A;  2WB1 C;  5KFJ A;  1NK5 A;  3B0X A;  2ZUC A;  3BZK A;  4GXK A;  3SV4 A;  4F5N A;  1RQN A;  2RQ5 A;  4RNO A;  2KVS A;  2BZF A;  3MR5 A;  1ZRM A;  1NNL A;  2H3F A;  5CEH A;  2JEI A;  5CR0 A;  2R8I A;  5J2A A;  1S10 A;  2XY5 A;  4F4W A;  9ICT A;  2XGP A;  2ZJA A;  1HUO A;  2Z7J A;  3WK6 A;  7ICP A;  1XSN A;  4U6P A;  4M04 A;  4QZ9 A;  2F2A B;  2W3R A;  4F5Q A;  1OW5 A;  1ZQJ A;  1L7M A;  8ICF A;  1S0O A;  1JI7 A;  3WKE A;  2O6K A;  7ICK A;  4K4I A;  1TKD A;  8ICU A;  2MRL A;  3JPO A;  3I1Y A;  7ICO A;  3JPR A;  1X42 A;  2YB1 A;  5KFL A;  3OHA A;  1S77 D;  3PNC A;  5J2J A;  5AI4 A;  1VLB A;  1M6Y A;  4Z6F A;  2FLL A;  4DQP A;  1PUZ A;  3AEV A;  4JWM A;  2NRV A;  4F4Y A;  4ECR A;  5JTI A;  1N2X A;  5KG4 A;  1A77 A;  4NLB A;  1J97 A;  4WJ3 B;  3N7P D;  1ZQM A;  2MUT B;  4UB6 U;  4ED6 A;  4E0D A;  2I6X A;  3RJK A;  2RHF A;  4RQ8 A;  5GTH U;  3RB3 A;  2R8G A;  5KFT A;  3PX0 A;  4LZG A;  3L4P A;  3H7I A;  5J2I A;  3L3F X;  4DS4 A;  2J6S A;  3BQ0 A;  4UAT A;  4F8R A;  1PVR A;  3M6K A;  4FO6 A;  3EYZ A;  2ISO A;  4IRD A;  3RB0 A;  2GWS A;  2ES6 A;  8ICM A;  3RAQ A;  1F5S A;  4Q44 A;  5AKH A;  5AKJ A;  1L3S A;  2YMM A;  2ZTD A;  5ALZ A;  2ZTC A;  3KHH A;  1U9L A;  2DUY A;  2D3D A;  2PI4 A;  7ICR A;  5J2G A;  5AKL A;  3R9K A;  4EBE A;  1MA7 A;  2I9G A;  2UVU A;  5ALM A;  2GH1 A;  1KTQ A;  3WK4 A;  3AU2 A;  4LJX A;  4Q8F A;  2P6U A;  3PML A;  2LYA A;  2AJQ A;  2DBY A;  1SWW A;  4MEX A;  3SR6 A;  1NI3 A;  2LHT A;  1ZD2 P;  2F1H A;  3AQF A;  4I2E A;  3MDC A;  4C4R A;  1JXE A;  2K8B B;  4RQN A;  4O3S A;  5HHH A;  3OPX A;  2G08 A;  3DV9 A;  3MR3 A;  1P7D A;  4K4H A;  4P4O A;  4MF2 A;  9ICF A;  4O3N A;  2E8N A;  3BS5 A;  3H8W A;  1DGS A;  3SEI A;  4GXJ A;  1NOM A;  5JUM A;  3MFI A;  2ASL A;  5AM4 A;  4EYH B;  2OH2 A;  2FI1 A;  1Z00 B;  1F44 A;  3KTQ A;  4AP9 A;  4F2R A;  2NO5 A;  3C1Z A;  1ZRN A;  5AI9 A;  4MEY A;  5AM5 A;  2BQR A;  3ETR A;  4O3M A;  5KTQ A;  1SB3 C;  4OJL A;  5KFX A;  4DSK A;  2HBK A;  5KG0 A;  1XC9 A;  2WHE A;  4DLG A;  8ICX A;  1PK1 A;  2AU0 A;  2E1F A;  3GIM A;  5J0O A;  1ZQO A;  3V6J A;  4P0Q A;  1MQ3 A;  2ZIW B;  3KBB A;  4NLN A;  1MC8 A;  1OXJ A;  1N48 A;  2XI9 A;  9ICP A;  2AQ4 A;  4BUG A;  2H3Z A;  2E8P A;  5J0U A;  2C2R A;  3RFA A;  1UPH A;  1IXR A;  4B9L A;  4US8 A;  5BOL A;  3KHG A;  3D6J A;  5IIM A;  3RB6 A;  4RU9 A;  2NRW A;  2VAN A;  4NM2 A;  4MF8 A;  2DKX A;  2P66 A;  3ICX A;  4QZE A;  1NK4 A;  3B0Y A;  2WF8 A;  4EEY A;  4Y2P A;  5KAF U;  3T5K A;  2G5I B;  1FO4 A;  4DSF A;  3MDA A;  3RJJ A;  1IM4 A;  4Z6E A;  4DFD A;  2KE7 A;  3AUO A;  3CRX A;  4NLC A;  2ZTE A;  1Q3U A;  2R8H A;  2KNJ A;  5KNI A;  2GO7 A;  2JGA A;  3MR2 A;  3PW5 A;  3JPQ A;  1MQ2 A;  4DL2 A;  4R63 A;  3UXO A;  1JIH A;  1QCK A;  4C8M A;  1SV0 C;  5KFS A;  3GIL A;  2AXT U;  2HHT A;  1BNO A;  5KL8 B;  4FE3 A;  1T3Q A;  4CE6 A;  5EWE A;  4Y2Q A;  2W9C A;  4DEZ A;  4F4Z A;  4DSE A;  1ZQD A;  1T94 A;  3C28 A;  3VCB A;  5KFU A;  3Q8S B;  3TAQ A;  2W9M A;  4J03 A;  1MN8 A;  8ICW A;  2A1A A;  1TVA A;  3QU9 A;  2ZG6 A;  3D2N A;  5TIS U;  3UMB A;  4DOA A;  2MU2 A;  4UAY A;  3J81 j;  3F2C A;  4KTQ A;  2Y9T A;  2ZIV B;  3SI8 A;  1XU4 A;  1VJ5 A;  4FS1 A;  1KLN A;  1NK7 A;  2ALZ A;  3RRG A;  1ZJN A;  5AM2 A;  5JU5 A;  3JPN A;  1X66 A;  3M7D A;  4Y2J A;  4DL6 A;  2EAO A;  5J8Y A;  5J29 A;  3M1Y A;  5FP0 A;  2A1J A;  1ZJM A;  2AGO A;  3A0B U;  3QU4 A;  3MR6 A;  4EBC A;  4R64 A;  1WCL A;  4Y2R A;  4UAU A;  1U4B A;  4O5E A;  5IIN A;  1MSW D;  5D46 A;  5H2F U;  5IIJ A;  4M9L A;  2QKQ A;  4NLK A;  2JMG A;  4UBB A;  3HJE A;  1HEK A;  3AM9 A;  5J2K A;  2DQN B;  4YMM A;  1XS9 D;  2HVH A;  5AM3 A;  4DF8 A;  3HW8 A;  4G3I A;  2ASJ A;  1JMS A;  4UAR A;  3V7L A;  3BS7 A;  2XVT A;  3O0F A;  1S97 A;  3QEA Z;  3ZD8 A;  5DQH A;  3AQE A;  1A0P A;  4DQR A;  5D49 A;  4DL3 A;  1X6J A;  3OSP A;  4QZG A;  8ICR A;  2FMQ A;  2KJ8 A;  4FZM A;  3BS5 B;  2LI6 A;  5AK4 A;  2J6U A;  1Z4N A;  1K1S A;  2EZX A;  2RDI A;  2KP7 A;  4M6W B;  4DF4 A;  3IRU A;  1JRO A;  5ALU A;  4NXZ A;  4Q8E A;  4CDG A;  4EEN A;  2KSO B;  2HBJ A;  5ALT A;  1UT5 A;  2EZZ A;  4Z6C A;  1HJP A;  1L7P A;  3AL0 B;  4I2F A;  4J9P A;  4RT2 A;  3ED5 A;  3PSP A;  1DRG A;  4P0Q B;  1X9X A;  1C7Y A;  3G6Y A;  4PJ0 U;  4O3P A;  3MGI A;  7ICJ A;  1ZOL A;  1QH9 A;  3PSI A;  3HT3 A;  4ED1 A;  1RXW A;  5HMM A;  5F3X B;  4KLH A;  3SZ2 A;  4RQ4 A;  5DG9 A;  1HIW A;  3H4D A;  2JV3 A;  4M0A A;  2V4Q A;  2KZM A;  4I2D A;  2Q4T A;  2XY6 A;  4CF4 A;  5HHI A;  1S0V A;  3JPS A;  9ICO A;  1ZQZ A;  3TAC B;  1L8O A;  1PVP A;  5L1J A;  3ORY A;  1TK5 A;  3QU5 A;  2YMQ A;  5AK5 A;  1L3T A;  1TK8 A;  4B9M A;  3TKA A;  4NL9 C;  4QWD A;  3FAH A;  4DLE A;  1V9P A;  2VJ5 A;  9ICM A;  3GDX A;  2KZZ A;  1BGX T;  3MC1 A;  2NRX A;  4PGX A;  1PZN A;  1RQL A;  4RQ3 A;  3MGH A;  3ZDE A;  3FDS A;  3NRW A;  2D8C A;  1TAM A;  1N61 A;  2AQ0 A;  4DQS A;  1FFU A;  2RLT A;  4OJO A;  5AHX A;  3ZI4 A;  4ECQ A;  2H3V A;  3C1Y A;  2G06 A;  5KFH A;  5J2E A;  4YR3 A;  2G5H B;  2W54 A;  3CW2 C;  3KZI U;  5AKZ A;  1KL9 A;  4YXJ A;  2WTF A;  3F5E A;  4RQ1 A;  2BCS A;  5CWR A;  5K4L A;  1FFV A;  1SL1 A;  2BDU A;  3CYM A;  8ICP A;  1Y88 A;  4C4S A;  4F5R A;  1X6I A;  4IR9 A;  1IV8 A;  3QU2 A;  3GV8 B;  4Y2U A;  5J0X A;  3TAR A;  4G9B A;  4DSI A;  2FPL A;  2E1E A;  1NK9 A;  7ICQ A;  1ZQV A;  2A1J B;  1LKY B;  1UA1 A;  5ALI A;  1L8L A;  4YFK A;  4ED8 A;  3A0H U;  2ZIW A;  1ZQQ A;  1ZQK A;  5KFY A;  1RZT A;  1B0X A;  8ICY A;  1HUZ A;  1QTM A;  1ZQN A;  2F77 X;  5KG7 A;  3KKA C;  4GC6 A;  3L5K A;  4F93 B;  1ZQF A;  3V72 A;  2HHW A;  3TI0 A;  1NKB A;  2E5S A;  4J9O A;  2IHN A;  3IV6 A;  1ZQC A;  4ECV A;  3QU7 A;  3RJH A;  1ZQG A;  1RDF A;  4QZB A;  4MHV A;  3RTV A;  4ELT A;  2KVC A;  4P4M A;  4EZ9 A;  1COK A;  5DDY A;  3HIL A;  4DFJ A;  1ZQH A;  9ICJ A;  3H8J A;  4QJF B;  1Q8K A;  1KQQ A;  5KT2 A;  3OJS A;  4B9T A;  3C5F A;  4YVZ A;  3PZP A;  4C8O A;  4PHD A;  3V7J A;  2A19 A;  3BZC A;  5KT3 A;  2LPE A;  2B21 A;  2H5X A;  4RUC A;  1WWU A;  2BDP A;  5DGA A;  2DWQ A;  1S0N A;  1NJX A;  2VIX A;  4QZH A;  4EEK A;  4I27 A;  1KFD A;  1F0M A;  1NZB A;  4JB3 A;  1SGG A;  1JN3 A;  1N5X A;  1IIP A;  4DFK A;  9ICW A;  1XSP A;  1LVH A;  4K4G A;  4YQW A;  1DXS A;  3CNH A;  4I2G A;  4NM1 A;  1QQ7 A;  5T14 A;  3WU2 U;  4YR0 A;  3NVW A;  3GQC A;  5L1L A;  8ICV A;  2IMW P;  2ZIV A;  2JZB A;  4DQQ A;  2XIC A;  2EH9 A;  4OD0 A;  1Z3E B;  3IG8 A;  4P4P A;  4M9N A;  3ONN A;  2OHF A;  2DGZ A;  1ZQB A;  2DPI A;  1KFT A;  2KMD A;  5L9X A;  1Z4O A;  3E0F A;  2PFO A;  1YZ6 A;  4Q45 A;  1D8B A;  4DWI A;  7ICE A;  3G6X A;  1N5W A;  4DCC A;  1KRP A;  3RR8 A;  5CJ7 A;  2QB1 A;  8ICT A;  1LV5 A;  3KFU F;  1N63 A;  4J9L A;  3MBY A;  5KG1 A;  2F1J A;  3ZDB A;  3WK8 A;  1CUK A;  2NO4 A;  2K60 A;  5KFI A;  3KHL A;  1BNP A;  5DKW A;  3GIK A;  4BXO B;  1KKX A;  2KFN A;  3U26 A;  4C4T A;  5KFW A;  4ECU A;  1ZQT A;  1RXV A;  1ZYQ A;  3ETL A;  3PW2 A;  4B6J A;  5ALQ A;  2BCV A;  4QW9 A;  3NTU A;  3M8S A;  2P6R A;  3GII A;  5J2H A;  3QYP A;  3C2M A;  1UHU A;  1JXL A;  5KT7 A;  3Q8L A;  3QNM A;  1L3U A;  2C22 A;  3E2E A;  3PST A;  4P2H A;  4KLJ A;  1N56 A;  8ICS A;  1XNS A;  2KOB A;  5AIC A;  2G0A A;  2YQE A;  1U48 A;  3RJF A;  1QQ5 A;  2BCQ A;  1J2M A;  2HI0 A;  3PMN A;  1ZQX A;  4M6W A;  4ZH4 A;  2AH5 A;  4YCX A;  5DLF A;  1BPZ A;  3LDA A;  2VA8 A;  3BQ1 A;  2KSO A;  5KAI U;  4KLI A;  2K89 A;  3T5J A;  5TZV A;  5J0R A;  4RT3 A;  2FMP A;  4CNQ A;  4YG2 A;  2LYH A;  1T3N A;  4YMN A;  5EOZ A;  4KMO B;  1YT3 A;  5L1K A;  4O3O A;  4RQ6 A;  4EZ6 A;  1NK0 A;  1K1Q A;  2DKZ A;  4XQ8 A;  2W11 A;  3TAD C;  2AGP A;  1K5O A;  1A6S A;  1KDH A;  2W03 A;  1S9F A;  4J9K A;  4IS7 A;  1CI4 A;  4M47 A;  5KFA A;  4C8N A;  3HP6 A;  2FPK A;  1OUQ A;  5F9N A;  4JWN A;  5L1M A;  2RP5 A;  3PO4 A;  2HVI A;  1N62 A;  4P0P A;  2OCE A;  5DBC A;  9ICN A;  2UVW A;  4DQI A;  3SAH A;  1SL0 A;  1SKS A;  4LVS A;  1QLN A;  4US9 A;  1ED1 A;  5KG3 A;  3M9M B;  1SL2 A;  1V97 A;  5CA7 A;  4UW9 A;  2NRZ A;  2J6T A;  4PHP A;  4ED7 A;  8ICO A;  2V4R A;  2Y9U A;  3K4G A;  1BPY A;  4I2H A;  2Q0Z X;  2WAQ F;  4ECX A;  2LM1 A;  4GFJ A;  4Y2S A;  2BQ3 A;  2B6G A;  3N97 B;  3BDP A;  4TUR A;  2AHO B;  5ALH A;  1ZQP A;  5EE1 A;  2RDJ A;  4OCZ A;  1TFR A;  3N4M B;  2IOH A;  5DB7 A;  1DK3 A;  4YMO A;  3HKZ F;  2VA2 A;  3K75 D;  2YN4 A;  1XO0 A;  2IOF A;  2HHX A;  5EWG A;  1ZQU A;  9ICC A;  5ALG A;  4F71 A;  9ICG A;  5AI0 A;  2BCU A;  4Y2T A;  5KL1 B;  3FYH A;  4UB3 A;  1T7P A;  2WFA A;  9ICS A;  2F1I A;  3F5A A;  4OJ6 A;  3WK9 A;  2K4I A;  3S6J A;  1D8L A;  1X9M A;  2JZB B;  3UQ2 A;  3NRZ A;  2OXO A;  2W9B B;  4J9N A;  1Q3V A;  2HDO A;  5E79 U;  4I2I A;  3PW4 A;  3QE9 Y;  7ICT A;  4KLL A;  3B9J A;  3K1Z A;  2CN1 A;  1ZD4 A;  3H0M B;  4RPY A;  3IG5 A;  3ALR A;  4DL5 A;  9ICH A;  3HWT A;  4QNL A;  1T8E A;  1ZQS A;  4A8E A;  1LKY A;  2FJ6 A;  1PVQ A;  1ARO P;  2WF6 A;  2B0C A;  4PZN A;  2Y0S F;  3H0R B;  5AIA A;  3I76 A;  4UB2 A;  1A76 A;  4RNN A;  4PHE A;  5EWF A;  2A3V A;  4HAI A;  4OJP A;  2HMX A;  3RBD A;  2YX8 A;  5DB6 A;  4RPZ A;  5D4B A;  1RM6 C;  4Y2V A;  2JHD A;  3QEB Z;  4X5V A;  3BQ2 A;  5ALW A;  1QQ6 A;  3EWA A;  5AM1 A;  3TFS A;  2BPG A;  4I28 A;  1ZD3 A;  7ICL A;  2PI5 A;  1RYU A;  2VA3 A;  4NJ8 A;  5HML A;  1ZQY A;  3GFK B;  4UAW A;  1NKE A;  4Q43 A;  4IC9 A;  1WYG A;  2G09 A;  8ICN A;  1RYR A;  3H4B A;  3SAF A;  5HP4 A;  4ELU A;  4JK1 A;  5KFM A;  3C2L A;  2GLE A;  4KLS A;  2EAN A;  1ZQE A;  3IHQ B;  4XRH A;  1JUD A;  2OM6 A;  3F2B A;  4AYB F;  5KFN A;  2ZIX A;  4ECS A;  4M9G A;  4J9R A;  2JR5 A;  3V6K A;  1ZD5 A;  3LVV A;  4UB1 A;  3QUB A;  4ED3 A;  2PMZ F;  2PFQ A;  2GOL A;  2AGQ A;  5DB8 A;  3M9N B;  4IQV A;  4XA5 A;  2E3T A;  4ACO A;  3KHR A;  4DL4 A;  1U49 A;  3GU3 A;  1SV4 A;  2R18 A;  1U47 A;  1NJW A;  4R8U B;  4I2A A;  4PGQ A;  4MFC A;  4LZD A;  1JAL A;  3OGU A;  3SAG A;  2XCA A;  4P0P B;  4M9J A;  2JH7 A;  5ALO A;  2ASD A;  2N1R A;  4JV2 A;  2F8L A;  1O03 A;  1SV0 A;  3EZ5 A;  3C21 A;  5JRT A;  2BPF A;  1UQV A;  1H38 A;  2FMS A;  2P35 A;  4O5K A;  5EE0 A;  4QZD A;  1TAQ A;  2ATL A;  9ICQ A;  1NZP A;  2FLN A;  3Q8K A;  3OHB A;  4FBU A;  1Z1V A;  4J9M A;  3UMC A;  5DGB A;  3Q8R B;  3TAN A;  2YML A;  4KLD A;  7ICU A;  4GC7 A;  4FFD A;  5BPC A;  7ICV A;  3JPT A;  4DS5 A;  5KFF A;  3OJU A;  4BXO A;  1COO A;  4DSJ A;  3BQ7 A;  2HHU A;  1V85 A;  1X2I A;  2DF4 B;  4PPX A;  2BPC A;  4TQR A;  1L7O A;  1SXD A;  2JEG A;  5IIL A;  3BJY A;  1V38 A;  1B4F A;  1BPX A;  2F76 X;  1FEZ A;  2BR0 A;  5AI6 A;  5KFC A;  4ED0 A;  2EZY A;  1QSY A;  3T3F A;  5IIO A;  1ZQI A;  4I2B A;  4JV1 A;  4IQU A;  2ISP A;  5KFB A;  1N60 A;  3SMV A;  4QW8 A;  3WK5 A;  3QZ8 A;  2MA1 A;  4FZL A;  4UB8 U;  2R8J A;  4O9M A;  2HHS A;  8ICQ A;  3SQI A;  3LYS A;  8ICJ A;  4KIT B;  4GXI A;  2R8K A;  2KKV A;  3RJI A;  3IP4 B;  4ED2 A;  1L3V A;  3PY8 A;  1FIQ A;  2HW3 A;  5DG8 A;  2HOI A;  3GIJ A;  2XID A;  3H8M A;  1SZH A;  1D9D A;  1ZQL A;  4IQW A;  4ECW A;  3QUQ A;  2NV3 A;  2OYY A;  4O3R A;  7ICF A;  2KKP A;  4F4X A;  1S5L U;  3SEN A;  1NKC A;  4QWE A;  4BJQ A;  3NS1 A;  4J9Q A;  1XSL A;  4CGZ A;  4TUP A;  3UMG A;  2BHN A;  4C7Z A;  7ICS A;  2RRD A;  1DOQ A;  3NAS A;  2KZ3 A;  2ZUD A;  3DDH A;  1VDV A;  4YXM A;  1DGJ A;  3WKA A;  2W04 A;  3HPO A;  4ECY A;  3F53 A;  2KHV A;  1O08 A;  4PZO A;  3ZD9 A;  3FC4 A;  4I2J A;  4RQM A;  5AK3 A;  2W8K A;  3N28 A;  4KLT A;  5AKG A;  9ICX A;  8ICB A;  4F5O A;  8ICC A;  3PX4 A;  2KIW A;  5G5H A;  3LWL A;  2M0N A;  4C80 A;  5CB1 A;  2KJ5 A;  1KBU A;  5AM0 A;  4NV0 A;  2KHQ A;  5AKI A;  3N7S C;  1XO1 A;  2DFL A;  1SKW A;  2WF7 A;  3PR4 A;  2XC9 A;  1KN5 A;  3VC8 A;  1WCN A;  5DG7 A;  1UT8 A;  2MAX A;  5CRX A;  2WAQ C;  4KMU A;  5KG6 A;  5J0W A;  3FM9 A;  2KFZ A;  3PX6 A;  2EDU A;  2D6F C;  2ZIX B;  1XWL A;  4CCH A;  8ICH A;  2K4E A;  3QUC A;  2MSN A;  5DBB A;  1L7N A;  2XCP A;  4J9S A;  2ODG A;  4RZR A;  2ZIU B;  1X9S A;  1NJZ A;  4OO1 J;  5KT5 A;  4NL9 A;  9ICB A;  5J0P A;  5HR6 A;  3HKZ C;  2YTU A;  2HOQ A;  3SV3 A;  2K8C B;  3ZDD A;  3ZDC A;  4GIB A;  4KLQ A;  2YY6 A;  1NJY A;  1KW4 A;  2HHQ A;  4PL1 A;  4B9S A;  2Y1I A;  5DDM A;  2QAR B;  2W9B A;  1SIJ A;  3QUT A;  7ICH A;  4ELV A;  7ICG A;  3PR5 B;  5J0T A;  1RYS A;  1Q46 A;  3C23 A;  3E58 A;  4JV0 A;  5KG5 A;  3NGD A;  1S76 D;  2QB0 A;  5J2D A;  2CPR A;  1L6N A;  3NVV A;  4ECT A;  4IR1 A;  2NYV A;  2PKE A;  4UAS A;  1ZQR A;  2F44 A;  2K8A A;  3LVW A;  2EAM A;  5KFO A;  2Y0S C;  5L1I A;  1KSP A;  3RF9 A;  2FE9 A;  3NVY A;  4PHA A;  2C2E A;  2BCR A;  5CHG A;  1TAU A;  1X40 A;  3MGV A;  4EX7 A;  1NK8 A;  1D8Y A;  3RB4 A;  2BQU A;  2IA6 A;  9ICI A;  3QZ7 A;  2HSZ A;  1ECW A;  1S8O A;  2W55 A;  3QX7 A;  3RH6 A;  2PFP A;  4QWC A;  1Z1B A;  2H3I A;  4F72 A;  3AU6 A;  4KX5 A;  4KLE A;  4QIW F;  2H3Q A;  2V9W A;  5DLG A;  1TE2 A;  2UVR A;  2WF9 A;  5J8Y C;  3D2S A;  4R65 A;  2W3S A;  1BPE A;  1URJ A;  4CF3 A;  9ICR A;  4BX9 C;  4RQ5 A;  1UCV A;  5EE3 A;  3KKA A;  9ICA A;  2KTQ A;  2NRT A;  5B66 U;  3RH4 A;  4IQT A;  3M8R A;  2KIV A;  3OTQ A;  5AK6 A;  5ALD A;  4BGD A;  4JMU A;  1GO3 F;  2EQY A;  5G5G A;  1TV9 A;  4DSL A;  1J2N A;  3UPQ A;  4M9H A;  1JX4 A;  5KFR A;  3V6H A;  3JPP A;  2WB1 F;  2WF5 A;  4UQG A;  1QSS A;  1ZXI A;  3H40 A;  4AYB C;  4JUZ A;  4F92 B;  4QZ8 A;  5AKX A;  2VJ4 A;  4QZA A;  4R8U A;  2ZXH A;  3QXG A;  3PVX A;  2PMZ C;  3MFH A;  2XO7 A;  3IDW A;  4F2S A;  3RJG A;  4C0Z A;  4F3O A;  2FPM A;  3GV5 B;  5AKY A;  5ALF A;  2IHM A;  9ICK A;  1YZ7 A;  3UXN A;  4DOC A;  2JH1 A;  2ZXI A;  4QZI A;  3PW0 A;  1S0M A;  4UBC A;  1SXE A;  8ICG A;  3ZDA A;  2I5H A;  2I1Q A;  4QZF A;  4QWB A;  4FS2 A;  4UB4 A;  4XUS A;  4RQ0 A;  5AI8 A;  3D2Q A;  1C20 A;  2E8O A;  3F2D A;  5DQI A;  3MAB A;  5ALY A;  2XY7 A;  3THV A;  4BWJ A;  3RBE A;  5ALN A;  5ALJ A;  3OSN A;  2JEJ A;  2LBO A;  3WKB A;  4IL6 U;  2HOF A;  3IN5 A;  5C0Y A;  4RUA A;  5IIK A;  4F5P A;  2IOF K;  1KFS A;  4USA A;  3T5H A;  4NY8 A;  4IRK A;  4UAV A;  1UA0 A;  5KFK A;  2HBM A;  1ZET A;  1L5U A;  9ICV A;  1AQ6 A;  2EAP A;  1BVS A;  4NLG A;  2LMR A;  4C7Y A;  4RPX A;  2ZJ8 A;  2W9A A;  5ALE A;  9ICE A;  4B9U A;  5AI5 A;  5ALK A;  1WWV A;  2W8L A;  2QLT A;  5AKK A;  1SKR A;  4YN4 A;  1D9F A;  4CF5 A;  4F50 A;  5KFG A;  3LK9 A;  5B5E U;  4YR2 A;  2CRX A;  2KN7 A;  3PV8 A;  4O3Q A;  3CP8 A;  2YMP A;  4RQ7 A;  3EPG A;  1SZP A;  2QB0 B;  4C8L A;  1ZQ1 C;  2DL0 A;  4O0I A;  5KFV A;  4F91 B;  1KEJ A;  3WK7 A;  2ESE A;  4BDP A;  8ICA A;  1BPD A;  2KEY A;  3AMZ A;  3UXP A;  5BOM A;  8ICE A;  5III A;  2LYB A;  3BQT A;  3C5G A;  4PL2 A;  5KFP A;  1TK0 A;  4DO9 A;  3NVZ A;  5KFE A;  3KD3 A;  3RJE A;  5KT4 A;  3H8S A;  8ICZ A;  5J2C A;  1B43 A;  2G07 A;  4PH5 A;  5DQG A;  1CRX A;  3ISD A;  4QWA A;  3WKD A;  1NK6 A;  4KN7 A;  2L5Y A;  5CP2 A;  3LWM A;  3TQ1 A;  2M9N A;  3HRD D;  2FLP A;  4OJ5 A;  5KFD A;  2C28 A;  4TQS A;  4ZOH C;  1RPL A;  4YD1 A;  4I2C A;  8ICK A;  2KD1 A;  3HX0 A;  3TAD A;  4B9N A;  2BGW A;  2W7P A;  3KZX A;  5ALR A;  4BWM A;  1DK2 A;  2BKE A;  1X9W A;  3RAX A;  2C2D A;  4GLX A;  5AKE A;  1PK3 A;  5ALP A;  4O5C A;  5ALL A;  2KIC A;  5EE9 A;  1QSL A;  4ICA A;  1B22 A;  2JEF A;  4TUQ A;  2IBK A;  4CRX A;  4TUS A;  2JXJ A;  4RQ2 A;  2F3N A;  4FBT A; 
#chains in the Genus database with same CATH homology
 4UB6 U;  3A0H U;  1S5L U;  5GTI U;  5GTH U;  4PJ0 U;  5H2F U;  5B66 U;  5KAI U;  3KZI U;  5E79 U;  2DUY A;  5B5E U;  5KAF U;  4UB8 U;  5TIS U;  2AXT U;  4IL6 U;  3WU2 U;  3A0B U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...