1S5LU

Architecture of the photosynthetic oxygen evolving center
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
105
Chain Sequence
AATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
total genus 21
structure length 105
sequence length 105
chains with identical sequence u
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 1s5lU01
4UB6U 4PJ0U 5GTHU 5H2FU 5GTIU 3A0HU 4UB8U 5B5EU 5B66U 5TISU 5KAIU 3A0BU 3KZIU 4IL6U 2DUYA 5KAFU 1S5LU 2AXTU 5E79U 3WU2U
chains in the Genus database with same CATH superfamily
1UT8A 4CF5A 8ICPA 2YY6A 2W9CA 4F93B 4MF2A 2W3SA 1F5SA 4C8OA 3SD7A 5DBAA 2OXOA 4CF3A 1ZQGA 3BQ1A 4U6PA 4O3QA 5J2DA 1FFVA 2DUYA 8ICIA 5J2JA 2B6GA 1JX4A 4UAVA 4Q8FA 3GU3A 2BCUA 3BS7A 4R64A 1NI3A 2DPIA 1JALA 1ZQNA 4CE6A 3QU2A 3ED5A 3H0MB 2KHQA 2KE7A 1DOQA 4PHAA 2VJ5A 5HHIA 4UAYA 3NRZA 5AM2A 3FYHA 1ZQQA 5DQGA 4PL2A 5HNKA 3JPRA 3I28A 5EWFA 1S0MA 2FLPA 3KKAA 4XQ8A 2Y9TA 5J0TA 2ZUBA 1NJZA 5AI4A 3ZDBA 2R8HA 1QSSA 4TUPA 3BS5A 2WHEA 2H3VA 2XGPA 5HMMA 3ZDAA 5AKIA 2BCVA 2ZIVA 4Y2JA 1ZD4A 1SKWA 4YMMA 1D8LA 1T3QA 2AHOB 4M0AA 4CRXA 5ALMA 1YZ6A 4J9SA 4C8NA 2KFZA 2P6RA 9ICNA 1TAQA 3C2LA 5ALFA 2KJ5A 3SENA 2F3NA 4PH5A 3TANA 2ZUCA 2DL0A 4R65A 7ICSA 3ISDA 1V38A 5KG2A 2WB1F 1MC8A 3WKAA 5KFXA 3CYMA 3NASA 1DXSA 4FS1A 3UMGA 3GIMA 4KX5A 4P0QB 5DDMA 4UAWA 2ZIWA 1XO0A 5DB8A 4I2IA 5AIAA 2FMPA 5CEHA 3WU2U 4UB2A 2K8AA 1SKRA 4F2SA 9ICRA 4C7ZA 1DK3A 5DKWA 2ASJA 4KTQA 4NJ8A 1ZD2P 2R8JA 5B66U 5DG8A 2KIWA 4DFPA 5AI9A 5AKXA 3SV4A 3RB3A 5KFFA 3CRXA 1BGXT 4LZGA 3JPSA 4O9MA 5ALZA 2JZBA 2B21A 2ES6A 4AP9A 2JEGA 3PX0A 3M6ZA 3IRUA 4P0PA 4GFJA 2HHQA 4KITB 5AK4A 4BJQA 5CA7A 3RF9A 2AGPA 1XO1A 4B9TA 2PXIA 3B0XA 2PMZC 1NK5A 1ZETA 3PW5A 3GILA 2KD1A 3PO4A 2KZZA 1D8BA 1PK1B 3A0HU 1X6IA 3C1ZA 4AYBF 1U49A 4M9LA 1K5OA 4IR1A 2QKQA 2PFNA 2BGWA 4DS4A 2BQUA 4ED2A 1XU4A 2KN7A 2FPMA 5BOMA 4F2RA 7ICTA 1KBUA 1U45A 2HOQA 3T79A 1H38A 4O0IA 1RYRA 3RRGA 3WKBA 1JIHA 4K4IA 3D2SA 1KSPA 4DSJA 4DQRA 4KLDA 2JXJA 2HHTA 1F0MA 1K1QA 4MFCA 3QX7A 5AI0A 3Q8SB 3TARA 1OXJA 1SXDA 8ICGA 3HJEA 2DGZA 1BPZA 1QQ7A 4DSKA 4O3MA 5EE9A 4M6WB 1LVHA 4PJ0U 3ZDCA 1ZQIA 3OSPA 2W04A 5GTIU 1WG8A 4RQ7A 1ZYQA 2VA2A 2LI6A 4QIWF 3UXNA 1NK4A 2WF5A 2NRWA 3SAFA 5KNIA 2M0NA 1UHUA 3TACB 2YMQA 1N56A 4EBCA 2D8CA 4UASA 2I5HA 2UVVA 4ED8A 8ICTA 2FPKA 4UATA 1X9XA 3PR4A 5KFSA 4HAIA 4QZFA 1Z19A 1ZD5A 4F92B 2ZJ8A 2W7OA 3HILA 3RAXA 2HOFA 5KT6A 3C2MA 1JXEA 4EEKA 4BWJA 3IG8A 3QUQA 4F4XA 1NNLA 1UCVA 1WUDA 5DB9A 5L1LA 1N48A 3QU4A 2XCPA 4DF8A 1A6SA 2LKYA 1TVAA 1ZQEA 5J2KA 3THVA 4GXKA 1FFUA 4I2EA 1ZRMA 4ELTA 2DBYA 1N5WA 2ODGA 2BPGA 3R9KA 4RQ3A 3M9NB 3U26A 2CPRA 1ZQJA 4NXZA 2BPFA 3FC4A 3H8SA 4BDPA 3GIIA 3BS5B 3OHAA 3KKAC 5KT5A 4QNLA 4IRCA 4FE3A 3KHLA 3DV9A 4U7CA 1TV9A 5BOLA 5CHGA 4OJ6A 1QQ6A 4M9JA 5B5EU 2ZTEA 1S0VA 2W9AA 4J9MA 2R8IA 2BKEA 4JWMA 4KX3A 4OO1J 2DKXA 3IDWA 2K4HA 1LV5A 4J9RA 1RYUA 3RH6A 4I2DA 2J6UA 4DO9A 5GTHU 4C8LA 3TFSA 2JV3A 1HIWA 3OJSA 1ZJMA 3N28A 5DQHA 2GLEA 3PSIA 4YR0A 1T3NA 2AQ0A 3V7KA 5DB6A 4DQIA 3H8WA 3QU5A 5KFJA 7ICEA 2YB1A 9ICQA 3EZ5A 1VJ5A 5KFVA 4F3OA 4DF4A 4EYIB 4PZOA 3PSTA 4DFJA 3SZ2A 3S6JA 3RTVA 4QWBA 4NWIA 1L3TA 3MDAA 2NO4A 5TZVA 5L1KA 8ICHA 1S9FA 1ZQLA 1O03A 2IHNA 1JI7A 3AEVA 1L5UA 3NVZA 5KT3A 2DF4B 3SAHA 4Q43A 5ALJA 2RP5A 4Y2XA 4RUCA 5L1MA 1SKSA 1S0NA 4KLSA 5HP4A 1X42A 4Y2TA 4YCXA 4OCZA 1QQ5A 5KFWA 4DOBA 3UQ0A 3LVWA 2K4IA 4ECXA 3ORYA 4DS5A 5BPCA 1ZQZA 3N7RC 7ICUA 4P0PB 1ZD3A 5KFNA 5KFAA 4ED7A 3PNCA 2ZUDA 4P2HA 5J0OA 4EX7A 3RJJA 3MABA 3RBDA 9ICUA 4Z6EA 3TI0A 4KLFA 3ISBA 3L5KA 4QW9A 4JWNA 5CR0A 4IQVA 2RDJA 2KIVA 5AI5A 5J2FA 5J0PA 2HHVA 1NK9A 4KLGA 4KLUA 2LYAA 4Q8EA 2E1FA 2C2RA 3JPTA 3IM1A 8ICBA 2EH9A 4XA5A 2XY7A 4MEYA 4US8A 5AKKA 2KMDA 4Y2VA 5F9LA 8ICUA 1A77A 2YN4A 3QYPA 5IIMA 3IP4B 8ICAA 5DLGA 2LHTA 2Z7JA 1UA1A 2F2AB 2YTUA 5KG4A 2G07A 5ALTA 5DG9A 1Y88A 2IOFK 5KAIU 2L5YA 4DQPA 1TK0A 2RDIA 4QZ8A 4QZIA 2LPEA 2LM4A 3NUQA 5IIIA 5FP0A 5ALQA 3ZD9A 5JUMA 5J8YA 2Y0SF 2MSNA 3F53A 2ISOA 5EE1A 4KLQA 2IMWP 4YQWA 5AM4A 1SL0A 1KKXA 1KN5A 1ZQRA 3HKZF 5JU5A 2UVUA 4Z6DA 2HHUA 2KJ8A 3HPOA 1YZ7A 3F5AA 4FS2A 3NS1A 2BCQA 1X9WA 2ATLA 3HWTA 4M2YA 2VJ4A 2W11A 1U47A 3DDHA 4XUSA 9ICFA 3M9OB 4PL1A 4EEYA 1KDHA 3ZI4A 3K4GA 5J0RA 3BQ7A 2B0CA 5AK3A 5DLFA 2BCRA 1NK8A 2HHWA 5KFEA 1SV4A 1SV0A 4KLOA 2BR0A 1QTMA 4B9SA 3MFIA 4FZMA 3V7JA 2QB1A 5KFLA 4JV0A 2PMZF 9ICPA 3Q8QB 3L4PA 5AM3A 3GV7B 3WKEA 4P4PA 2FMQA 4RPZA 1EXNA 3Q8KA 1NK7A 2W43A 4ECRA 1HEKA 1T8EA 3I76A 4B9LA 5KFYA 2EAMA 4CGZA 5KG7A 2KHVA 3D6JA 4IQUA 9ICVA 4G3IA 4YXJA 3ISCA 3T3FA 1NKEA 3ETRA 4B9UA 2G0AA 5IIKA 4DSIA 2GO7A 2RLTA 9ICKA 2ZIXB 5CRXA 2AXTU 4JMUA 4P4OA 4DFKA 1C20A 2G09A 5HHHA 1MA7A 1B0XA 2A3VA 2BDPA 4UB4A 9ICTA 3KHHA 1RM6C 4MFAA 3C28A 4DLGA 3WK9A 1SXEA 2JEIA 5KT4A 4J9KA 4RQ4A 2AJQA 4GLXA 4NLZA 7ICMA 1ZQOA 2W9BA 5KFRA 3KFUF 1J2MA 2ZIUA 4OJ5A 2H5XA 4QZDA 5ALKA 3IG5A 5AIBA 9ICAA 3RAQA 2WAQF 9ICLA 2YMLA 3EPIA 4DSEA 4QZ9A 3PO5A 1BNPA 5KFKA 3HW8A 3EPGA 3G6XA 2GOLA 1L7OA 1URJA 1Q3VA 4EZ9A 2RRDA 1N62A 4NM1A 2WTFA 4UBCA 2BHNA 3FM9A 5IILA 3Q8LA 4DEZA 4PZNA 4FBUA 4RPXA 4R66A 5AI6A 8ICLA 5AK5A 8ICOA 4I2GA 4MFFA 3ZDEA 5ALWA 4RQMA 2AU0A 2LM1A 4DCCA 1TKDA 4M47A 2K8CB 2F8KA 2F8LA 4I28A 7ICIA 4I2AA 1PUZA 5ALEA 1Q8KA 1QLNA 1L6NA 1Z4OA 2F77X 3WK5A 2I9GA 3H4BA 5E79U 2Y1IA 2BQRA 4JV1A 5ALGA 5KG6A 5CJ7A 3N7SC 1SL2A 3C1YA 5ALOA 2HBLA 2KKVA 4GC7A 1BPBA 3D2NA 5TISU 4UW9A 1ZQMA 1KFSA 2A1JB 2FJ6A 1NK6A 4NLGA 4QZEA 3L3FX 4QWAA 1NZPA 2FI1A 1FEZA 4PHDA 1X66A 1X2IA 4UB6U 2E8NA 2PKEA 2ESEA 1JUDA 1Z00A 3HP6A 2HVHA 3B9JA 5IIOA 1KTQA 3SQIA 1N2XA 4RT3A 1NOMA 3PW4A 5J8YC 5EWGA 3GFKB 3PY8A 4K4HA 5ALUA 4F4ZA 5A0LA 2YQEA 1QSLA 3T5HA 4UAUA 1S8OA 1B4FA 4I2FA 4KN4A 3AU6A 3C2KA 3GV5B 4QZCA 3V72A 1JXLA 4DWIA 2XCAA 1F44A 4O3PA 1KLNA 4YP3A 2H3ZA 5DG7A 2MUTA 4PGYA 2KK0A 4IR9A 5H2FU 2FMSA 2DKZA 2M9NA 1XSPA 2F1IA 1TAMA 2G08A 5AHXA 2IA6A 4BXOA 4GIBA 3UXPA 2R8KA 3UXOA 2V4QA 2W9CB 3PVXA 3PW2A 1L8LA 1SV0C 4Y2YA 2XVTA 3N4MB 7ICLA 5J2HA 4MEXA 4WJ3B 5ALIA 4ECTA 7ICJA 1Z1BA 5KFOA 3EW9A 3H7IA 1ZQVA 2KFNA 2EAOA 3M1YA 5DB7A 1KW4A 3H0LB 4R8UA 2OCEA 4B9NA 3ONNA 3C21A 1ZQCA 2J6SA 2N1RA 1OUQA 1L3SA 1N5XA 3GQCA 7ICGA 1Z3EB 2WF6A 9ICEA 2FDRA 3FAHA 2PI4A 2FLNA 2BDUA 2F1JA 2KNJA 9ICHA 4K4GA 1ZQYA 3V6KA 4I2HA 1Q3UA 4BX9C 4M9NA 2EZYA 5AK6A 3H0RB 4TUQA 2WB1C 3TAQA 1MQ3A 4DFMA 4PHEA 2PFPA 4YVZA 2D3DA 3GIJA 4M9HA 1RYSA 4GC6A 2W9BB 2E8PA 2ZIVB 3SMVA 4RT2A 2ZIUB 5JTIA 5EE0A 1KRPA 2JEFA 4F4KA 4YN4A 2PI5A 4I2BA 4OD0A 1LB2B 5AKZA 2NRXA 2AQ4A 1L7MA 2YMPA 3HT3A 3NTUA 2OEHA 5J2EA 4ICAA 4ZOHC 2KP7A 2KVSA 4Z6FA 2MAXA 8ICZA 1BNOA 4IRDA 2NRZA 1IV8A 1N61A 3JPPA 1RQNA 4G9BA 9ICXA 2QB0A 1NZBA 3PSPA 4Z6CA 4RZRA 1X40A 2K8BB 4DOCA 2HVIA 4EBEA 4J9QA 1SL1A 3MR3A 4J03A 1SWWA 2ZIWB 5J0WA 4E0DA 4ECSA 2XC9A 5AKEA 5EWEA 2XO7A 4IS7A 4USAA 5IIJA 1IG6A 3C29A 3QNMA 1BPDA 2CN1A 1COOA 2IHMA 4EELA 2OM6A 3BQ2A 3A0BU 4NY8A 1ZQWA 2P35A 1T4GA 5L1IA 3JPOA 5J0XA 5C0YA 1RQLA 1X9MA 2A1AA 3SYZA 4KLTA 4ZH4A 3V7LA 2OYYA 3UMCA 4AYBC 3MFHA 2G5HB 2JZBB 3KTQA 4ED6A 4ACOA 5J2CA 4DQQA 4LZDA 8ICNA 1JROA 2P6UA 3N7PD 4F4YA 4J9PA 5KG0A 4YMOA 1V85A 1IM4A 3QZ8A 2XI9A 4NM2A 2E1EA 3BQTA 3ETLA 2CRXA 1Z00B 3M9MB 9ICIA 1RPLA 3SI8A 2LMRA 3NVYA 4RQ1A 3RJIA 5EOZA 3F2CA 2V9WA 4IRKA 3HRDD 1V9PA 4TUSA 1T7PA 4A8EA 2HHXA 2HSZA 3NGDA 2ZJAA 5DBBA 2MRLA 1X6JA 2EZXA 2WF8A 2GH1A 3MR2A 4YXMA 4QIWC 1D9DA 2NV3A 3FDSA 3KBBA 3H8MA 2XICA 4ED1A 1O08A 3OHBA 2CXYA 1XS9D 3RB4A 5KG3A 1NKCA 3I1YA 4QWCA 4YD2A 3AN1A 1D9FA 3KOOA 5KFZA 3UMBA 4YFKA 2WF9A 4O3OA 4RQ2A 2MUTB 4KLEA 2VA8A 5KL8B 2F76X 5C5JA 5KFBA 2KZ3A 2Q0ZX 1TAUA 3WK7A 2BPCA 2W55A 2K60A 2J6TA 4F72A 1S77D 4BXOB 3UQ2A 2I1QA 2ZXIA 2EANA 3KD3A 3H4DA 2K89A 5ALYA 3JPQA 3QEAZ 4MHVA 1ZQ1C 4ECQA 3D2QA 1WCNA 3TKAA 4DFDA 2W7PA 5G5GA 3CP8A 4UB1A 3RB0A 3TQ1A 2DPJA 3O0FA 4F71A 2KEYA 2KZMA 4FO6A 3OGUA 1KQQA 2AH5A 1LKYA 1UA0A 8ICJA 1U4BA 5J0YA 4KMOB 3NRWA 4QZBA 1L3VA 4UARA 2XY5A 4B9MA 5ALVA 1NJYA 4DSFA 1NK0A 7ICVA 5L1JA 4NLNA 8ICFA 2I6XA 4US9A 3PX6A 9ICCA 1TE2A 5CB1A 5KFGA 4KLHA 4DQSA 3K75D 1ZRNA 2EQYA 9ICOA 9ICBA 4CCHA 1ZQUA 3F5EA 1J97A 4F5NA 1PVPA 2XIDA 3M6KA 3N97B 2AGQA 2OH2A 3QZ7A 2HDOA 4M6WA 5KT2A 5KFHA 3K1RB 5CWRA 1S0OA 4IC9A 4UBBA 5HR7A 2JEJA 5J2AA 5T14A 7ICQA 3KZXA 3VCBA 2C22A 1S10A 5L9XA 4DL7A 2QB0B 3AUOA 1WWVA 1QSYA 5AM0A 2HHSA 2EZZA 3BZCA 4RQ8A 4IQTA 4EENA 2E8OA 1SWVA 4FZNA 5AI8A 4KMUA 3M7DA 4R63A 3E0FA 3MBYA 4KN7A 1K1SA 2KJ9A 4ED3A 4DOAA 3KZIU 1ZQPA 2HI0A 3C23A 9ICGA 8ICCA 5K4LA 3OSNA 2IOFA 3RFAA 1ZJNA 2DFLA 5CP2A 1AQ6A 1CRXA 2KKPA 7ICHA 8ICXA 5F3XB 3G6VA 5DDYA 4JUZA 4UB3A 8ICVA 2KVCA 3PR5B 3M8RA 3RH4A 8ICKA 2ASDA 2WFAA 2R18A 2WF7A 7ICNA 3AQEA 4Y2UA 3E58A 2ZJ5A 2HBKA 3OTQA 2E5SA 2ALZA 3TADA 4MF8A 3LK9A 4OJOA 5HMLA 3KHRA 3V6HA 5J2IA 1UPHA 3ALRA 5AKHA 4P4MA 3IN5A 1PVQA 3QXGA 3Q8PB 1KFTA 1MQ2A 3E2EA 5KG1A 3WK4A 3SEIA 3F2BA 2ZTCA 2BZFA 2NYVA 3RB6A 1M6YA 4Q45A 4NL9C 1CEZA 3EWAA 5KFIA 1ECWA 1D8YA 3NVWA 2W03A 4KLJA 5DGBA 2ZTDA 4F4WA 3PV8A 3PZPA 2ZXHA 8ICWA 4C80A 4UQGA 2Y0SC 2W3RA 4M9GA 2DQNB 4C8MA 2MA1A 2F1HA 2MU2A 1TK8A 1VLBA 1C7YA 4ELVA 4NV0A 4Y2QA 4J9NA 1TFRA 3HKZC 1MN8A 3MGHA 1HUZA 4BWMA 3QUBA 5EE3A 4JV2A 2O6KA 5J2GA 5D4BA 3SV3A 2A19A 4TQSA 4GXIA 1P7DA 1HJPA 1BPYA 4RNMA 2K4PA 1IIPA 1U48A 5DGAA 4RQ0A 1BPEA 5KFMA 3GV8B 2VANA 1L7PA 4RQNA 2JGAA 3G6YA 1UT5A 2F44A 5G5HA 1LKYB 4UAZA 3T5JA 4J9OA 3VC8A 3LWMA 5ALNA 3B0YA 1DGSA 1Z4NA 5DQIA 4C8KA 4KLIA 4BUGA 3RRHA 5ALDA 5ALXA 4Q44A 2FLLA 5AKLA 2W8LA 3LWLA 3RJHA 2YMMA 2LBOA 3ZD8A 4J9LA 4I2CA 3CW2C 2VA3A 7ICOA 5KFUA 4KLMA 3RR8A 3QUCA 4FFDA 4CNQA 2QARA 4UB5A 3MC1A 4XRHA 1SZHA 3AQFA 3M8SA 3PX4A 1JN3A 1JMSA 3TFRA 3RJGA 1NKBA 4I29A 3WK8A 2KSOA 4RNNA 3RR7A 4X5VA 4QZAA 5D49A 3LVVA 3MR6A 4RPYA 4PHPA 4C4TA 3QE9Y 3QEBZ 1QCKA 1KFDA 2EDUA 4B6JA 5DBCA 4ECUA 8ICSA 4FBTA 1ZOLA 3Q8MA 2PFQA 2Q4TA 3EUB2 4DL2A 4QJFB 4DL6A 4ELUA 1ZQKA 2ZG6A 4Y2PA 3KHGA 2H3IA 5J0QA 1YT3A 2BCSA 2P66A 5AKGA 1OW5A 1PK3A 3V6JA 8ICMA 2WAQC 4DL4A 1BPXA 1N63A 5ALPA 2RHFA 2E3TA 3NVVA 4NLCA 5J2BA 2HBMA 1L7NA 3RJKA 7ICRA 1RXVA 1RDFA 1SB3C 1L3UA 2ISPA 1BVSA 2NO5A 2C2EA 3F2DA 2UVWA 4PGXA 1B43A 4CDGA 4QWDA 1MSWD 1A0PA 1RG6A 3BQ0A 3CNHA 2HCFA 3WK6A 2RQ5A 4O5CA 4IQWA 2W8KA 3J81j 9ICJA 4OJPA 4YR2A 3IHQB 8ICQA 2JRZA 1XNSA 2W54A 3QU7A 5KFTA 2KTQA 3K1ZA 2YB4A 4JK1A 1XSNA 5KTQA 2JMGA 1Z1VA 4DSLA 2IBKA 3ICXA 3RJEA 2FPLA 4ECWA 4F50A 2C28A 4OJLA 1CI4A 2Y9UA 1ZQAA 4O5EA 4QZGA 1ZQFA 3LDAA 3PW7A 2PFOA 3PW0A 2JH7A 5AM5A 2H3FA 5ALHA 3MR5A 3TADC 3DEEA 1WCLA 4TURA 2XY6A 1L8OA 3HX0A 7ICKA 1FIQA 1ZQDA 1TK5A 4ECZA 1IXRA 3PMLA 3GIKA 3TAPA 4FZLA 3OPXA 4C7YA 5AM1A 4Y2SA 2ASLA 2NRTA 1V97A 2G5IB 2HOIA 2ZIXA 4YG2A 4F5PA 2D6FC 2YX8A 4IL6U 3RH5A 3SAGA 1HUOA 5KFPA 4QWEA 4M04A 4O5KA 3WKCA 4O3RA 2LYHA 3AL0B 3RJFA 4ECYA 1B22A 8ICYA 1DGJA 4BGDA 3H40A 4GXJA 1XWLA 5ALSA 1XSLA 1COKA 2KOBA 2GWSA 4EYHB 4DL3A 1FO4A 1RZTA 4DLEA 3MGIA 3C5FA 5KAFU 7ICFA 1WYGA 1CUKA 2NRVA 3Q8RB 2DWQA 4YD1A 1KEJA 1UQVA 4ED0A 4F5RA 5AKYA 2HMXA 5HR6A 5KFDA 4YR3A 4NL9A 3OJUA 3QU9A 4I2JA 5J29A 3UPQA 4QZHA 3BJYA 1PZNA 2KICA 5KL1B 5AICA 1SGGA 3PSFA 5KFQA 3GDXA 1WWUA 1ZQXA 2AGOA 1U9LA 1T94A 2FE9A 4PPXA 3AU2A 4P0QA 2HW3A 1X9SA 9ICWA 3GZFA 2BQ3A 1ED1A 4C4SA 3MGVA 3AM9A 1SZPA 5IINA 3AMZA 9ICSA 1XC9A 3UM9A 2QARB 2Y1JA 2EAPA 4PGQA 3RBEA 2LYBA 5F9NA 1N60A 4TQRA 3IV6A 4C0ZA 2KSOB 4NLKA 1A76A 4NLBA 2VKQA 4B9VA 4KLLA 3BZKA 1GO3F 2V4RA 5ALLA 1RXWA 4RUAA 5J0SA 5KT7A 4LJXA 2E8MA 5KG5A 8ICRA 4O3NA 2H3QA 3SR6A 4C4RA 1NJWA 1ZQTA 3QUTA 4JB3A 2IOHA 3LYSA 2W9MA 2XGQA 3T5LA 5J0UA 5JRTA 4LVSA 2KV2A 4UB8U 2A1JA 4QW8A 3BDPA 4CF4A 4R8UB 3ZDDA 3T5KA 1J2NA 2HBJA 5KFCA 1ZQSA 2KG5A 4F8RA 1S76D 1SIJA 1S97A 4RU9A 4RNOA 4ECVA 1PK1A 4F91B 1Q46A 1DRGA 3EYZA 2JR5A 2C2DA 4EX6A 3JPNA 2R8GA 2JHDA 4EBDA 3C5GA 4EZ6A 2UVRA 3MDCA 1JRPA 4RQ6A 5ALRA 5AKJA 1S5LU 2OWOA 1PVRA 1NJXA 1VDVA 2JH1A 8ICEA 7ICPA 4F5QA 2QLTA 4O3SA 1DK2A 4RQ5A 1QH9A 1AROP 3PMNA 2VIXA 3H8JA 2G06A 2K4EA 4F5OA 4DL5A 1KL9A 9ICMA 1ZQBA 2OHFA 4Y2RA 1ZQHA 4I27A 3WKDA 1ZXIA 4YMNA 4HYKA 5D46A
chains in the Genus database with same CATH topology
4UB6U 4PJ0U 5GTHU 5H2FU 5GTIU 3A0HU 4UB8U 5B5EU 5B66U 5TISU 5KAIU 3A0BU 3KZIU 4IL6U 2DUYA 5KAFU 1S5LU 2AXTU 5E79U 3WU2U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 U;  4PJ0 U;  5GTH U;  5H2F U;  5GTI U;  3A0H U;  4UB8 U;  5B5E U;  5B66 U;  5TIS U;  5KAI U;  3A0B U;  3KZI U;  4IL6 U;  2DUY A;  5KAF U;  1S5L U;  2AXT U;  5E79 U;  3WU2 U; 
#chains in the Genus database with same CATH topology
 1UT8 A;  4CF5 A;  8ICP A;  2YY6 A;  2W9C A;  4F93 B;  4MF2 A;  2W3S A;  1F5S A;  4C8O A;  3SD7 A;  5DBA A;  2OXO A;  4CF3 A;  1ZQG A;  3BQ1 A;  4U6P A;  4O3Q A;  5J2D A;  1FFV A;  2DUY A;  8ICI A;  5J2J A;  2B6G A;  1JX4 A;  4UAV A;  4Q8F A;  3GU3 A;  2BCU A;  3BS7 A;  4R64 A;  1NI3 A;  2DPI A;  1JAL A;  1ZQN A;  4CE6 A;  3QU2 A;  3ED5 A;  3H0M B;  2KHQ A;  2KE7 A;  1DOQ A;  4PHA A;  2VJ5 A;  5HHI A;  4UAY A;  3NRZ A;  5AM2 A;  3FYH A;  1ZQQ A;  5DQG A;  4PL2 A;  5HNK A;  3JPR A;  3I28 A;  5EWF A;  1S0M A;  2FLP A;  3KKA A;  4XQ8 A;  2Y9T A;  5J0T A;  2ZUB A;  1NJZ A;  5AI4 A;  3ZDB A;  2R8H A;  1QSS A;  4TUP A;  3BS5 A;  2WHE A;  2H3V A;  2XGP A;  5HMM A;  3ZDA A;  5AKI A;  2BCV A;  2ZIV A;  4Y2J A;  1ZD4 A;  1SKW A;  4YMM A;  1D8L A;  1T3Q A;  2AHO B;  4M0A A;  4CRX A;  5ALM A;  1YZ6 A;  4J9S A;  4C8N A;  2KFZ A;  2P6R A;  9ICN A;  1TAQ A;  3C2L A;  5ALF A;  2KJ5 A;  3SEN A;  2F3N A;  4PH5 A;  3TAN A;  2ZUC A;  2DL0 A;  4R65 A;  7ICS A;  3ISD A;  1V38 A;  5KG2 A;  2WB1 F;  1MC8 A;  3WKA A;  5KFX A;  3CYM A;  3NAS A;  1DXS A;  4FS1 A;  3UMG A;  3GIM A;  4KX5 A;  4P0Q B;  5DDM A;  4UAW A;  2ZIW A;  1XO0 A;  5DB8 A;  4I2I A;  5AIA A;  2FMP A;  5CEH A;  3WU2 U;  4UB2 A;  2K8A A;  1SKR A;  4F2S A;  9ICR A;  4C7Z A;  1DK3 A;  5DKW A;  2ASJ A;  4KTQ A;  4NJ8 A;  1ZD2 P;  2R8J A;  5B66 U;  5DG8 A;  2KIW A;  4DFP A;  5AI9 A;  5AKX A;  3SV4 A;  3RB3 A;  5KFF A;  3CRX A;  1BGX T;  4LZG A;  3JPS A;  4O9M A;  5ALZ A;  2JZB A;  2B21 A;  2ES6 A;  4AP9 A;  2JEG A;  3PX0 A;  3M6Z A;  3IRU A;  4P0P A;  4GFJ A;  2HHQ A;  4KIT B;  5AK4 A;  4BJQ A;  5CA7 A;  3RF9 A;  2AGP A;  1XO1 A;  4B9T A;  2PXI A;  3B0X A;  2PMZ C;  1NK5 A;  1ZET A;  3PW5 A;  3GIL A;  2KD1 A;  3PO4 A;  2KZZ A;  1D8B A;  1PK1 B;  3A0H U;  1X6I A;  3C1Z A;  4AYB F;  1U49 A;  4M9L A;  1K5O A;  4IR1 A;  2QKQ A;  2PFN A;  2BGW A;  4DS4 A;  2BQU A;  4ED2 A;  1XU4 A;  2KN7 A;  2FPM A;  5BOM A;  4F2R A;  7ICT A;  1KBU A;  1U45 A;  2HOQ A;  3T79 A;  1H38 A;  4O0I A;  1RYR A;  3RRG A;  3WKB A;  1JIH A;  4K4I A;  3D2S A;  1KSP A;  4DSJ A;  4DQR A;  4KLD A;  2JXJ A;  2HHT A;  1F0M A;  1K1Q A;  4MFC A;  3QX7 A;  5AI0 A;  3Q8S B;  3TAR A;  1OXJ A;  1SXD A;  8ICG A;  3HJE A;  2DGZ A;  1BPZ A;  1QQ7 A;  4DSK A;  4O3M A;  5EE9 A;  4M6W B;  1LVH A;  4PJ0 U;  3ZDC A;  1ZQI A;  3OSP A;  2W04 A;  5GTI U;  1WG8 A;  4RQ7 A;  1ZYQ A;  2VA2 A;  2LI6 A;  4QIW F;  3UXN A;  1NK4 A;  2WF5 A;  2NRW A;  3SAF A;  5KNI A;  2M0N A;  1UHU A;  3TAC B;  2YMQ A;  1N56 A;  4EBC A;  2D8C A;  4UAS A;  2I5H A;  2UVV A;  4ED8 A;  8ICT A;  2FPK A;  4UAT A;  1X9X A;  3PR4 A;  5KFS A;  4HAI A;  4QZF A;  1Z19 A;  1ZD5 A;  4F92 B;  2ZJ8 A;  2W7O A;  3HIL A;  3RAX A;  2HOF A;  5KT6 A;  3C2M A;  1JXE A;  4EEK A;  4BWJ A;  3IG8 A;  3QUQ A;  4F4X A;  1NNL A;  1UCV A;  1WUD A;  5DB9 A;  5L1L A;  1N48 A;  3QU4 A;  2XCP A;  4DF8 A;  1A6S A;  2LKY A;  1TVA A;  1ZQE A;  5J2K A;  3THV A;  4GXK A;  1FFU A;  4I2E A;  1ZRM A;  4ELT A;  2DBY A;  1N5W A;  2ODG A;  2BPG A;  3R9K A;  4RQ3 A;  3M9N B;  3U26 A;  2CPR A;  1ZQJ A;  4NXZ A;  2BPF A;  3FC4 A;  3H8S A;  4BDP A;  3GII A;  3BS5 B;  3OHA A;  3KKA C;  5KT5 A;  4QNL A;  4IRC A;  4FE3 A;  3KHL A;  3DV9 A;  4U7C A;  1TV9 A;  5BOL A;  5CHG A;  4OJ6 A;  1QQ6 A;  4M9J A;  5B5E U;  2ZTE A;  1S0V A;  2W9A A;  4J9M A;  2R8I A;  2BKE A;  4JWM A;  4KX3 A;  4OO1 J;  2DKX A;  3IDW A;  2K4H A;  1LV5 A;  4J9R A;  1RYU A;  3RH6 A;  4I2D A;  2J6U A;  4DO9 A;  5GTH U;  4C8L A;  3TFS A;  2JV3 A;  1HIW A;  3OJS A;  1ZJM A;  3N28 A;  5DQH A;  2GLE A;  3PSI A;  4YR0 A;  1T3N A;  2AQ0 A;  3V7K A;  5DB6 A;  4DQI A;  3H8W A;  3QU5 A;  5KFJ A;  7ICE A;  2YB1 A;  9ICQ A;  3EZ5 A;  1VJ5 A;  5KFV A;  4F3O A;  4DF4 A;  4EYI B;  4PZO A;  3PST A;  4DFJ A;  3SZ2 A;  3S6J A;  3RTV A;  4QWB A;  4NWI A;  1L3T A;  3MDA A;  2NO4 A;  5TZV A;  5L1K A;  8ICH A;  1S9F A;  1ZQL A;  1O03 A;  2IHN A;  1JI7 A;  3AEV A;  1L5U A;  3NVZ A;  5KT3 A;  2DF4 B;  3SAH A;  4Q43 A;  5ALJ A;  2RP5 A;  4Y2X A;  4RUC A;  5L1M A;  1SKS A;  1S0N A;  4KLS A;  5HP4 A;  1X42 A;  4Y2T A;  4YCX A;  4OCZ A;  1QQ5 A;  5KFW A;  4DOB A;  3UQ0 A;  3LVW A;  2K4I A;  4ECX A;  3ORY A;  4DS5 A;  5BPC A;  1ZQZ A;  3N7R C;  7ICU A;  4P0P B;  1ZD3 A;  5KFN A;  5KFA A;  4ED7 A;  3PNC A;  2ZUD A;  4P2H A;  5J0O A;  4EX7 A;  3RJJ A;  3MAB A;  3RBD A;  9ICU A;  4Z6E A;  3TI0 A;  4KLF A;  3ISB A;  3L5K A;  4QW9 A;  4JWN A;  5CR0 A;  4IQV A;  2RDJ A;  2KIV A;  5AI5 A;  5J2F A;  5J0P A;  2HHV A;  1NK9 A;  4KLG A;  4KLU A;  2LYA A;  4Q8E A;  2E1F A;  2C2R A;  3JPT A;  3IM1 A;  8ICB A;  2EH9 A;  4XA5 A;  2XY7 A;  4MEY A;  4US8 A;  5AKK A;  2KMD A;  4Y2V A;  5F9L A;  8ICU A;  1A77 A;  2YN4 A;  3QYP A;  5IIM A;  3IP4 B;  8ICA A;  5DLG A;  2LHT A;  2Z7J A;  1UA1 A;  2F2A B;  2YTU A;  5KG4 A;  2G07 A;  5ALT A;  5DG9 A;  1Y88 A;  2IOF K;  5KAI U;  2L5Y A;  4DQP A;  1TK0 A;  2RDI A;  4QZ8 A;  4QZI A;  2LPE A;  2LM4 A;  3NUQ A;  5III A;  5FP0 A;  5ALQ A;  3ZD9 A;  5JUM A;  5J8Y A;  2Y0S F;  2MSN A;  3F53 A;  2ISO A;  5EE1 A;  4KLQ A;  2IMW P;  4YQW A;  5AM4 A;  1SL0 A;  1KKX A;  1KN5 A;  1ZQR A;  3HKZ F;  5JU5 A;  2UVU A;  4Z6D A;  2HHU A;  2KJ8 A;  3HPO A;  1YZ7 A;  3F5A A;  4FS2 A;  3NS1 A;  2BCQ A;  1X9W A;  2ATL A;  3HWT A;  4M2Y A;  2VJ4 A;  2W11 A;  1U47 A;  3DDH A;  4XUS A;  9ICF A;  3M9O B;  4PL1 A;  4EEY A;  1KDH A;  3ZI4 A;  3K4G A;  5J0R A;  3BQ7 A;  2B0C A;  5AK3 A;  5DLF A;  2BCR A;  1NK8 A;  2HHW A;  5KFE A;  1SV4 A;  1SV0 A;  4KLO A;  2BR0 A;  1QTM A;  4B9S A;  3MFI A;  4FZM A;  3V7J A;  2QB1 A;  5KFL A;  4JV0 A;  2PMZ F;  9ICP A;  3Q8Q B;  3L4P A;  5AM3 A;  3GV7 B;  3WKE A;  4P4P A;  2FMQ A;  4RPZ A;  1EXN A;  3Q8K A;  1NK7 A;  2W43 A;  4ECR A;  1HEK A;  1T8E A;  3I76 A;  4B9L A;  5KFY A;  2EAM A;  4CGZ A;  5KG7 A;  2KHV A;  3D6J A;  4IQU A;  9ICV A;  4G3I A;  4YXJ A;  3ISC A;  3T3F A;  1NKE A;  3ETR A;  4B9U A;  2G0A A;  5IIK A;  4DSI A;  2GO7 A;  2RLT A;  9ICK A;  2ZIX B;  5CRX A;  2AXT U;  4JMU A;  4P4O A;  4DFK A;  1C20 A;  2G09 A;  5HHH A;  1MA7 A;  1B0X A;  2A3V A;  2BDP A;  4UB4 A;  9ICT A;  3KHH A;  1RM6 C;  4MFA A;  3C28 A;  4DLG A;  3WK9 A;  1SXE A;  2JEI A;  5KT4 A;  4J9K A;  4RQ4 A;  2AJQ A;  4GLX A;  4NLZ A;  7ICM A;  1ZQO A;  2W9B A;  5KFR A;  3KFU F;  1J2M A;  2ZIU A;  4OJ5 A;  2H5X A;  4QZD A;  5ALK A;  3IG5 A;  5AIB A;  9ICA A;  3RAQ A;  2WAQ F;  9ICL A;  2YML A;  3EPI A;  4DSE A;  4QZ9 A;  3PO5 A;  1BNP A;  5KFK A;  3HW8 A;  3EPG A;  3G6X A;  2GOL A;  1L7O A;  1URJ A;  1Q3V A;  4EZ9 A;  2RRD A;  1N62 A;  4NM1 A;  2WTF A;  4UBC A;  2BHN A;  3FM9 A;  5IIL A;  3Q8L A;  4DEZ A;  4PZN A;  4FBU A;  4RPX A;  4R66 A;  5AI6 A;  8ICL A;  5AK5 A;  8ICO A;  4I2G A;  4MFF A;  3ZDE A;  5ALW A;  4RQM A;  2AU0 A;  2LM1 A;  4DCC A;  1TKD A;  4M47 A;  2K8C B;  2F8K A;  2F8L A;  4I28 A;  7ICI A;  4I2A A;  1PUZ A;  5ALE A;  1Q8K A;  1QLN A;  1L6N A;  1Z4O A;  2F77 X;  3WK5 A;  2I9G A;  3H4B A;  5E79 U;  2Y1I A;  2BQR A;  4JV1 A;  5ALG A;  5KG6 A;  5CJ7 A;  3N7S C;  1SL2 A;  3C1Y A;  5ALO A;  2HBL A;  2KKV A;  4GC7 A;  1BPB A;  3D2N A;  5TIS U;  4UW9 A;  1ZQM A;  1KFS A;  2A1J B;  2FJ6 A;  1NK6 A;  4NLG A;  4QZE A;  3L3F X;  4QWA A;  1NZP A;  2FI1 A;  1FEZ A;  4PHD A;  1X66 A;  1X2I A;  4UB6 U;  2E8N A;  2PKE A;  2ESE A;  1JUD A;  1Z00 A;  3HP6 A;  2HVH A;  3B9J A;  5IIO A;  1KTQ A;  3SQI A;  1N2X A;  4RT3 A;  1NOM A;  3PW4 A;  5J8Y C;  5EWG A;  3GFK B;  3PY8 A;  4K4H A;  5ALU A;  4F4Z A;  5A0L A;  2YQE A;  1QSL A;  3T5H A;  4UAU A;  1S8O A;  1B4F A;  4I2F A;  4KN4 A;  3AU6 A;  3C2K A;  3GV5 B;  4QZC A;  3V72 A;  1JXL A;  4DWI A;  2XCA A;  1F44 A;  4O3P A;  1KLN A;  4YP3 A;  2H3Z A;  5DG7 A;  2MUT A;  4PGY A;  2KK0 A;  4IR9 A;  5H2F U;  2FMS A;  2DKZ A;  2M9N A;  1XSP A;  2F1I A;  1TAM A;  2G08 A;  5AHX A;  2IA6 A;  4BXO A;  4GIB A;  3UXP A;  2R8K A;  3UXO A;  2V4Q A;  2W9C B;  3PVX A;  3PW2 A;  1L8L A;  1SV0 C;  4Y2Y A;  2XVT A;  3N4M B;  7ICL A;  5J2H A;  4MEX A;  4WJ3 B;  5ALI A;  4ECT A;  7ICJ A;  1Z1B A;  5KFO A;  3EW9 A;  3H7I A;  1ZQV A;  2KFN A;  2EAO A;  3M1Y A;  5DB7 A;  1KW4 A;  3H0L B;  4R8U A;  2OCE A;  4B9N A;  3ONN A;  3C21 A;  1ZQC A;  2J6S A;  2N1R A;  1OUQ A;  1L3S A;  1N5X A;  3GQC A;  7ICG A;  1Z3E B;  2WF6 A;  9ICE A;  2FDR A;  3FAH A;  2PI4 A;  2FLN A;  2BDU A;  2F1J A;  2KNJ A;  9ICH A;  4K4G A;  1ZQY A;  3V6K A;  4I2H A;  1Q3U A;  4BX9 C;  4M9N A;  2EZY A;  5AK6 A;  3H0R B;  4TUQ A;  2WB1 C;  3TAQ A;  1MQ3 A;  4DFM A;  4PHE A;  2PFP A;  4YVZ A;  2D3D A;  3GIJ A;  4M9H A;  1RYS A;  4GC6 A;  2W9B B;  2E8P A;  2ZIV B;  3SMV A;  4RT2 A;  2ZIU B;  5JTI A;  5EE0 A;  1KRP A;  2JEF A;  4F4K A;  4YN4 A;  2PI5 A;  4I2B A;  4OD0 A;  1LB2 B;  5AKZ A;  2NRX A;  2AQ4 A;  1L7M A;  2YMP A;  3HT3 A;  3NTU A;  2OEH A;  5J2E A;  4ICA A;  4ZOH C;  2KP7 A;  2KVS A;  4Z6F A;  2MAX A;  8ICZ A;  1BNO A;  4IRD A;  2NRZ A;  1IV8 A;  1N61 A;  3JPP A;  1RQN A;  4G9B A;  9ICX A;  2QB0 A;  1NZB A;  3PSP A;  4Z6C A;  4RZR A;  1X40 A;  2K8B B;  4DOC A;  2HVI A;  4EBE A;  4J9Q A;  1SL1 A;  3MR3 A;  4J03 A;  1SWW A;  2ZIW B;  5J0W A;  4E0D A;  4ECS A;  2XC9 A;  5AKE A;  5EWE A;  2XO7 A;  4IS7 A;  4USA A;  5IIJ A;  1IG6 A;  3C29 A;  3QNM A;  1BPD A;  2CN1 A;  1COO A;  2IHM A;  4EEL A;  2OM6 A;  3BQ2 A;  3A0B U;  4NY8 A;  1ZQW A;  2P35 A;  1T4G A;  5L1I A;  3JPO A;  5J0X A;  5C0Y A;  1RQL A;  1X9M A;  2A1A A;  3SYZ A;  4KLT A;  4ZH4 A;  3V7L A;  2OYY A;  3UMC A;  4AYB C;  3MFH A;  2G5H B;  2JZB B;  3KTQ A;  4ED6 A;  4ACO A;  5J2C A;  4DQQ A;  4LZD A;  8ICN A;  1JRO A;  2P6U A;  3N7P D;  4F4Y A;  4J9P A;  5KG0 A;  4YMO A;  1V85 A;  1IM4 A;  3QZ8 A;  2XI9 A;  4NM2 A;  2E1E A;  3BQT A;  3ETL A;  2CRX A;  1Z00 B;  3M9M B;  9ICI A;  1RPL A;  3SI8 A;  2LMR A;  3NVY A;  4RQ1 A;  3RJI A;  5EOZ A;  3F2C A;  2V9W A;  4IRK A;  3HRD D;  1V9P A;  4TUS A;  1T7P A;  4A8E A;  2HHX A;  2HSZ A;  3NGD A;  2ZJA A;  5DBB A;  2MRL A;  1X6J A;  2EZX A;  2WF8 A;  2GH1 A;  3MR2 A;  4YXM A;  4QIW C;  1D9D A;  2NV3 A;  3FDS A;  3KBB A;  3H8M A;  2XIC A;  4ED1 A;  1O08 A;  3OHB A;  2CXY A;  1XS9 D;  3RB4 A;  5KG3 A;  1NKC A;  3I1Y A;  4QWC A;  4YD2 A;  3AN1 A;  1D9F A;  3KOO A;  5KFZ A;  3UMB A;  4YFK A;  2WF9 A;  4O3O A;  4RQ2 A;  2MUT B;  4KLE A;  2VA8 A;  5KL8 B;  2F76 X;  5C5J A;  5KFB A;  2KZ3 A;  2Q0Z X;  1TAU A;  3WK7 A;  2BPC A;  2W55 A;  2K60 A;  2J6T A;  4F72 A;  1S77 D;  4BXO B;  3UQ2 A;  2I1Q A;  2ZXI A;  2EAN A;  3KD3 A;  3H4D A;  2K89 A;  5ALY A;  3JPQ A;  3QEA Z;  4MHV A;  1ZQ1 C;  4ECQ A;  3D2Q A;  1WCN A;  3TKA A;  4DFD A;  2W7P A;  5G5G A;  3CP8 A;  4UB1 A;  3RB0 A;  3TQ1 A;  2DPJ A;  3O0F A;  4F71 A;  2KEY A;  2KZM A;  4FO6 A;  3OGU A;  1KQQ A;  2AH5 A;  1LKY A;  1UA0 A;  8ICJ A;  1U4B A;  5J0Y A;  4KMO B;  3NRW A;  4QZB A;  1L3V A;  4UAR A;  2XY5 A;  4B9M A;  5ALV A;  1NJY A;  4DSF A;  1NK0 A;  7ICV A;  5L1J A;  4NLN A;  8ICF A;  2I6X A;  4US9 A;  3PX6 A;  9ICC A;  1TE2 A;  5CB1 A;  5KFG A;  4KLH A;  4DQS A;  3K75 D;  1ZRN A;  2EQY A;  9ICO A;  9ICB A;  4CCH A;  1ZQU A;  3F5E A;  1J97 A;  4F5N A;  1PVP A;  2XID A;  3M6K A;  3N97 B;  2AGQ A;  2OH2 A;  3QZ7 A;  2HDO A;  4M6W A;  5KT2 A;  5KFH A;  3K1R B;  5CWR A;  1S0O A;  4IC9 A;  4UBB A;  5HR7 A;  2JEJ A;  5J2A A;  5T14 A;  7ICQ A;  3KZX A;  3VCB A;  2C22 A;  1S10 A;  5L9X A;  4DL7 A;  2QB0 B;  3AUO A;  1WWV A;  1QSY A;  5AM0 A;  2HHS A;  2EZZ A;  3BZC A;  4RQ8 A;  4IQT A;  4EEN A;  2E8O A;  1SWV A;  4FZN A;  5AI8 A;  4KMU A;  3M7D A;  4R63 A;  3E0F A;  3MBY A;  4KN7 A;  1K1S A;  2KJ9 A;  4ED3 A;  4DOA A;  3KZI U;  1ZQP A;  2HI0 A;  3C23 A;  9ICG A;  8ICC A;  5K4L A;  3OSN A;  2IOF A;  3RFA A;  1ZJN A;  2DFL A;  5CP2 A;  1AQ6 A;  1CRX A;  2KKP A;  7ICH A;  8ICX A;  5F3X B;  3G6V A;  5DDY A;  4JUZ A;  4UB3 A;  8ICV A;  2KVC A;  3PR5 B;  3M8R A;  3RH4 A;  8ICK A;  2ASD A;  2WFA A;  2R18 A;  2WF7 A;  7ICN A;  3AQE A;  4Y2U A;  3E58 A;  2ZJ5 A;  2HBK A;  3OTQ A;  2E5S A;  2ALZ A;  3TAD A;  4MF8 A;  3LK9 A;  4OJO A;  5HML A;  3KHR A;  3V6H A;  5J2I A;  1UPH A;  3ALR A;  5AKH A;  4P4M A;  3IN5 A;  1PVQ A;  3QXG A;  3Q8P B;  1KFT A;  1MQ2 A;  3E2E A;  5KG1 A;  3WK4 A;  3SEI A;  3F2B A;  2ZTC A;  2BZF A;  2NYV A;  3RB6 A;  1M6Y A;  4Q45 A;  4NL9 C;  1CEZ A;  3EWA A;  5KFI A;  1ECW A;  1D8Y A;  3NVW A;  2W03 A;  4KLJ A;  5DGB A;  2ZTD A;  4F4W A;  3PV8 A;  3PZP A;  2ZXH A;  8ICW A;  4C80 A;  4UQG A;  2Y0S C;  2W3R A;  4M9G A;  2DQN B;  4C8M A;  2MA1 A;  2F1H A;  2MU2 A;  1TK8 A;  1VLB A;  1C7Y A;  4ELV A;  4NV0 A;  4Y2Q A;  4J9N A;  1TFR A;  3HKZ C;  1MN8 A;  3MGH A;  1HUZ A;  4BWM A;  3QUB A;  5EE3 A;  4JV2 A;  2O6K A;  5J2G A;  5D4B A;  3SV3 A;  2A19 A;  4TQS A;  4GXI A;  1P7D A;  1HJP A;  1BPY A;  4RNM A;  2K4P A;  1IIP A;  1U48 A;  5DGA A;  4RQ0 A;  1BPE A;  5KFM A;  3GV8 B;  2VAN A;  1L7P A;  4RQN A;  2JGA A;  3G6Y A;  1UT5 A;  2F44 A;  5G5H A;  1LKY B;  4UAZ A;  3T5J A;  4J9O A;  3VC8 A;  3LWM A;  5ALN A;  3B0Y A;  1DGS A;  1Z4N A;  5DQI A;  4C8K A;  4KLI A;  4BUG A;  3RRH A;  5ALD A;  5ALX A;  4Q44 A;  2FLL A;  5AKL A;  2W8L A;  3LWL A;  3RJH A;  2YMM A;  2LBO A;  3ZD8 A;  4J9L A;  4I2C A;  3CW2 C;  2VA3 A;  7ICO A;  5KFU A;  4KLM A;  3RR8 A;  3QUC A;  4FFD A;  4CNQ A;  2QAR A;  4UB5 A;  3MC1 A;  4XRH A;  1SZH A;  3AQF A;  3M8S A;  3PX4 A;  1JN3 A;  1JMS A;  3TFR A;  3RJG A;  1NKB A;  4I29 A;  3WK8 A;  2KSO A;  4RNN A;  3RR7 A;  4X5V A;  4QZA A;  5D49 A;  3LVV A;  3MR6 A;  4RPY A;  4PHP A;  4C4T A;  3QE9 Y;  3QEB Z;  1QCK A;  1KFD A;  2EDU A;  4B6J A;  5DBC A;  4ECU A;  8ICS A;  4FBT A;  1ZOL A;  3Q8M A;  2PFQ A;  2Q4T A;  3EUB 2;  4DL2 A;  4QJF B;  4DL6 A;  4ELU A;  1ZQK A;  2ZG6 A;  4Y2P A;  3KHG A;  2H3I A;  5J0Q A;  1YT3 A;  2BCS A;  2P66 A;  5AKG A;  1OW5 A;  1PK3 A;  3V6J A;  8ICM A;  2WAQ C;  4DL4 A;  1BPX A;  1N63 A;  5ALP A;  2RHF A;  2E3T A;  3NVV A;  4NLC A;  5J2B A;  2HBM A;  1L7N A;  3RJK A;  7ICR A;  1RXV A;  1RDF A;  1SB3 C;  1L3U A;  2ISP A;  1BVS A;  2NO5 A;  2C2E A;  3F2D A;  2UVW A;  4PGX A;  1B43 A;  4CDG A;  4QWD A;  1MSW D;  1A0P A;  1RG6 A;  3BQ0 A;  3CNH A;  2HCF A;  3WK6 A;  2RQ5 A;  4O5C A;  4IQW A;  2W8K A;  3J81 j;  9ICJ A;  4OJP A;  4YR2 A;  3IHQ B;  8ICQ A;  2JRZ A;  1XNS A;  2W54 A;  3QU7 A;  5KFT A;  2KTQ A;  3K1Z A;  2YB4 A;  4JK1 A;  1XSN A;  5KTQ A;  2JMG A;  1Z1V A;  4DSL A;  2IBK A;  3ICX A;  3RJE A;  2FPL A;  4ECW A;  4F50 A;  2C28 A;  4OJL A;  1CI4 A;  2Y9U A;  1ZQA A;  4O5E A;  4QZG A;  1ZQF A;  3LDA A;  3PW7 A;  2PFO A;  3PW0 A;  2JH7 A;  5AM5 A;  2H3F A;  5ALH A;  3MR5 A;  3TAD C;  3DEE A;  1WCL A;  4TUR A;  2XY6 A;  1L8O A;  3HX0 A;  7ICK A;  1FIQ A;  1ZQD A;  1TK5 A;  4ECZ A;  1IXR A;  3PML A;  3GIK A;  3TAP A;  4FZL A;  3OPX A;  4C7Y A;  5AM1 A;  4Y2S A;  2ASL A;  2NRT A;  1V97 A;  2G5I B;  2HOI A;  2ZIX A;  4YG2 A;  4F5P A;  2D6F C;  2YX8 A;  4IL6 U;  3RH5 A;  3SAG A;  1HUO A;  5KFP A;  4QWE A;  4M04 A;  4O5K A;  3WKC A;  4O3R A;  2LYH A;  3AL0 B;  3RJF A;  4ECY A;  1B22 A;  8ICY A;  1DGJ A;  4BGD A;  3H40 A;  4GXJ A;  1XWL A;  5ALS A;  1XSL A;  1COK A;  2KOB A;  2GWS A;  4EYH B;  4DL3 A;  1FO4 A;  1RZT A;  4DLE A;  3MGI A;  3C5F A;  5KAF U;  7ICF A;  1WYG A;  1CUK A;  2NRV A;  3Q8R B;  2DWQ A;  4YD1 A;  1KEJ A;  1UQV A;  4ED0 A;  4F5R A;  5AKY A;  2HMX A;  5HR6 A;  5KFD A;  4YR3 A;  4NL9 A;  3OJU A;  3QU9 A;  4I2J A;  5J29 A;  3UPQ A;  4QZH A;  3BJY A;  1PZN A;  2KIC A;  5KL1 B;  5AIC A;  1SGG A;  3PSF A;  5KFQ A;  3GDX A;  1WWU A;  1ZQX A;  2AGO A;  1U9L A;  1T94 A;  2FE9 A;  4PPX A;  3AU2 A;  4P0Q A;  2HW3 A;  1X9S A;  9ICW A;  3GZF A;  2BQ3 A;  1ED1 A;  4C4S A;  3MGV A;  3AM9 A;  1SZP A;  5IIN A;  3AMZ A;  9ICS A;  1XC9 A;  3UM9 A;  2QAR B;  2Y1J A;  2EAP A;  4PGQ A;  3RBE A;  2LYB A;  5F9N A;  1N60 A;  4TQR A;  3IV6 A;  4C0Z A;  2KSO B;  4NLK A;  1A76 A;  4NLB A;  2VKQ A;  4B9V A;  4KLL A;  3BZK A;  1GO3 F;  2V4R A;  5ALL A;  1RXW A;  4RUA A;  5J0S A;  5KT7 A;  4LJX A;  2E8M A;  5KG5 A;  8ICR A;  4O3N A;  2H3Q A;  3SR6 A;  4C4R A;  1NJW A;  1ZQT A;  3QUT A;  4JB3 A;  2IOH A;  3LYS A;  2W9M A;  2XGQ A;  3T5L A;  5J0U A;  5JRT A;  4LVS A;  2KV2 A;  4UB8 U;  2A1J A;  4QW8 A;  3BDP A;  4CF4 A;  4R8U B;  3ZDD A;  3T5K A;  1J2N A;  2HBJ A;  5KFC A;  1ZQS A;  2KG5 A;  4F8R A;  1S76 D;  1SIJ A;  1S97 A;  4RU9 A;  4RNO A;  4ECV A;  1PK1 A;  4F91 B;  1Q46 A;  1DRG A;  3EYZ A;  2JR5 A;  2C2D A;  4EX6 A;  3JPN A;  2R8G A;  2JHD A;  4EBD A;  3C5G A;  4EZ6 A;  2UVR A;  3MDC A;  1JRP A;  4RQ6 A;  5ALR A;  5AKJ A;  1S5L U;  2OWO A;  1PVR A;  1NJX A;  1VDV A;  2JH1 A;  8ICE A;  7ICP A;  4F5Q A;  2QLT A;  4O3S A;  1DK2 A;  4RQ5 A;  1QH9 A;  1ARO P;  3PMN A;  2VIX A;  3H8J A;  2G06 A;  2K4E A;  4F5O A;  4DL5 A;  1KL9 A;  9ICM A;  1ZQB A;  2OHF A;  4Y2R A;  1ZQH A;  4I27 A;  3WKD A;  1ZXI A;  4YMN A;  4HYK A;  5D46 A; 
#chains in the Genus database with same CATH homology
 4UB6 U;  4PJ0 U;  5GTH U;  5H2F U;  5GTI U;  3A0H U;  4UB8 U;  5B5E U;  5B66 U;  5TIS U;  5KAI U;  3A0B U;  3KZI U;  4IL6 U;  2DUY A;  5KAF U;  1S5L U;  2AXT U;  5E79 U;  3WU2 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...