1S60A

Aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and n-terminal his(6)-tag (crystal form 2)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
152
Chain Sequence
b'LVPRGSHMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETERVIFYRKRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside 6'-N-acetyltransferase
publication title A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
pubmed doi rcsb
source organism Salmonella enteritidis
molecule tags Transferase
total genus 37
structure length 152
sequence length 152
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s60A00
4JJXA 2D4PA 3R96A 4KUAA 2AJ6A 4QBJA 4R3KA 4BMHA 4L89A 5EBVA 4OLLA 2G0BA 5ISVA 4YRHA 1M4GA 3SXNA 4E0AA 3IGRA 2B5GB 3QB8A 4ZBGA 4Y49C 2FXFA 3FNCA 1S7KA 3TOAA 2FL4A 3PGPA 1VKCA 2Q4YA 2X7BA 2CY2A 4CRYB 3FRMA 4R87A 4KOYA 3F0AA 1FY7A 4QB9A 3EFAA 4IF5A 4L8AA 3EO4A 4AG7A 1I12A 3ZJ0A 4CAWA 2F5IA 3B8GA 4H6ZA 1OZPA 2WPXA 4HNWB 4RI1A 1YREA 2QECA 3R9GA 5IB0A 2GE3A 2DXQA 2REEA 2BEIA 2BL1A 3GY9A 1Q2DA 1IYKA 3TT2A 3TO9A 4B5PB 4HNYB 2JDCA 4KOXA 4U9YA 2PDOA 4XNHB 3KKWA 2BSWA 2R98A 4NXYA 3I3GA 4JD6A 4MHDA 2A4NA 3H4QA 4PK3A 2OZUA 1CM0A 4CAVA 1XF8A 4F0YA 3TO6A 2OB0A 5C88A 4I49A 4OADA 5IX3A 2HQYA 3JUWA 1N71A 2OH1A 4KOVA 4KORA 4KOUA 1XIXA 5CNPA 2PR8A 4UWJA 4IUSA 2JEVA 2Q4VA 1R57A 3BLNA 2JDDA 3NE7A 2IL4A 4CS0B 1Y9WA 3F5BA 5E96A 4II9A 1MJAA 2CNTA 2J8RA 4J3GA 4JWPA 3DR6A 4X5KA 4R9MA 5KTAA 4KZTA 1RXTA 4KOSA 4OAEA 4UBRA 3P2FA 3SHPA 2GANA 4XNHC 4HNXB 2VBQA 1NMTA 1YR0A 1M44A 1YK3A 4KUBA 2Q44A 3W91A 2FSRA 4LX9A 1Z9UA 2RC4A 2Q0YA 4NEXA 1LRZA 4R57A 2Q04A 4B5OA 1S3ZA 5H84A 3T90A 3P2HA 2ATRA 5KTCA 4UA3A 3LD2A 3ZZIA 3PZJA 4QUSA 4E2AA 2R1IA 4M3SA 3VWDA 2PSWA 4KOTA 2FIAA 3V8IA 2VXKA 2Q7BA 2OU2A 2HV2A 3T9YA 4AG9A 5JQ4A 5J8FA 3DR8A 1KUXA 4AB7A 4XPDB 2B4DB 2B5GA 1P0HA 1I21A 4NF1A 1XMTA 1U6MA 4FD6A 3R9FA 2OZGA 2JLMA 1Q2YA 4H89A 2GIVA 3TOBA 3BJ8A 4KLVA 3I9SA 3TO7A 2CNSA 1CJWA 3S6HA 1Z4EA 2PQ8A 1V0CA 1MJBA 4U5YA 4XPKA 2QIRA 1K4JA 3FYNA 4UWIA 1S5KA 3RYOA 3TCVA 4CRZB 1YVOA 1GHEA 1WWZA 1Q2CA 2B4DA 1B87A 3JVNA 1QSOA 2I00A 1TIQA 4LUAA 1KUYA 1NSLA 2FE7A 4NSQA 5I0CA 3LODA 2B3VA 1MK4A 4RS2A 5HMNA 1IB1E 1Y7RA 5F48A 2Z0ZA 2EVNA 3EC4A 5F49A 2B3UA 4XPDC 1IIDA 2K5TA 5F47A 3WR7A 1M4DA 4B5PA 2FS5A 1PUAA 2PRBA 4MI4A 4Y49B 3EXNA 1UFHA 3FBUA 3D8PA 3N7ZA 1NE9A 2ZW7A 4H6UA 3R95A 3W6XA 4JXRA 1IYLA 2P6FA 2WPWA 4AVAA 4MBUA 3DNSA 3C26A 3E0KA 3G8WA 4PK2A 3EY5A 2VZZA 4ORFA 5DWMA 4KOWA 2HUZA 1IICA 2ZW5A 4YGOA 2QMLA 5H86A 2J8NA 2BUEA 2VI7A 3CXSA 2J8MA 1QSTA 5GCNA 1QSMA 4GS4A 4F6AA 1VHSA 1YVKA 5DWNA 3CXPA 1M4IA 3S6FA 3FIXA 2Z10A 1ON0A 3IWGA 4MY3A 3K9UA 2AE6A 2VZYA 3FB3A 1MJ9A 2CNMA 4KVME 5C82A 4AVCA 4PSWA 3TTHA 5EC4A 4KVOE 2PC1A 2ARHA 2FIWA 3FXTA 2B4BA 3D2MA 2R8VA 2P6GA 3MGDA 1RO5A 3DSBA 3R1KA 1S60A 1J4JA 1QSRA 2ZW4A 4FD4A 4AVBA 2REFA 4JLYA 5KTDA 1WK4A 2B58A 4K30A 4U9ZA 4MJ8A 4XPLA 3D2PA 2ZPAA 3CXQA 2C27A 1SQHA 1YGHA 3TE4A 1L0CA 1I1DA 2I79A 4EVYA 4FD7A 2G3TA 3DDDA 2Y0MA 5IV0A 5JPHA 4R3LA 5J8CA 3GYAA 1KUVA 2PR1A 1XE4A 3TFYA 1B6BA 3S6KA 4CAXA 3D3SA 1BO4A 2NMTA 5HH1A 1Z4RA 1YX0A 2OZHA 1Y9KA 4ONUA 3VWEA 4KLWA 5F46A 4KVXA 4MY0A 4NCZA 2ZW6A 2EUIA 2FT0A 1M1DA 2H5MA 5FVJA 1PU9A 1KZFA 2P0WA 4JXQA 2Z11A 2KCWA 3W6SA 4PV6A 2ZXVA 3R9EA 3PP9A 1S7NA 3F8KA 3SXOA 1S7FA 2R7HA 2FCKA 1BOBA 4PSXA 2G3AA 4E8OA 3GKRA 4FD5A 3S6GA 2VEZA 1XEBA 3OWCA 3QAHA 4YFJA 3G3SA 4QC6A 2VQYA 3BJ7A 2D4OA 4QVTA 1P4NA 4M85A 3UY5A 2O28A 4HKFA 1QSNA 1YLEA 2P6EA 4DNCA 1S7LA
chains in the Genus database with same CATH superfamily
4NGRA 3S9NA 4JJXA 2D4PA 4LQ6A 3PEIA 3R96A 4KUAA 4CAFA 3CZXA 2AJ6A 2PVWA 4QBJA 4M6HA 4R3KA 4BMHA 2EBJA 2V8HA 4NGPA 4B10A 2ZEPA 3GB0A 4L89A 2PJCA 5EBVA 4OLLA 3HUVA 4P4DA 3IU2A 1Z5RA 4ZX8A 7CPAA 1Y0RA 2G0BA 5ISVA 4YRHA 1Z8TA 2ZEFA 1OBRA 2CXAA 1M4GA 2ZEHA 3B3WA 4UCMA 2WUUA 1IGBA 4NJRA 5HXDA 3SXNA 1AUGA 1EE3P 3CPXA 5G21A 4A30A 4BBHA 5G22A 2RB7A 4E0AA 3FEEA 3IGRA 2B5GB 2HB6A 3D7HA 3QB8A 4ZBGA 4Y49C 2FXFA 3FNCA 1S7KA 3IC1A 3TOAA 2FL4A 3PGPA 4OMEA 4A38A 1VKCA 1X12A 2Q4YA 2X7BA 4FAIA 1TKJA 2CY2A 4OC5A 3NA6A 3PBEA 4FUUA 4Q38A 5D29A 3FRMA 4R87A 4CRYB 4KOYA 5LYLA 3F0AA 1FY7A 4MHPA 4QB9A 3EFAA 4IF5A 4L8AA 3EO4A 3H5ZA 4AG7A 3T8WA 1ZG9A 4P4IA 1I12A 5LYIA 3ZJ0A 4FBEA 1Z2LA 4P4FA 4UFWA 4CAWA 2GFQA 3KL9A 2F5IA 3B8GA 2ZOFA 4H6ZA 3V38A 1OZPA 2WPXA 1VHEA 3TE4A 5D8NA 2Z3MA 4HNWB 4OC3A 3I1UA 3D66A 4RI1A 4P4JA 1YREA 4MHYA 1F57A 2AFZA 2QECA 4UIAA 3R9GA 4CYNA 1TF9A 5IB0A 1F2PA 2GE3A 2WSAA 2DXQA 5K8OA 2QJ8A 2REEA 2BEIA 4BD9A 2BL1A 1TF8A 3GY9A 4EWTA 1BPMA 3FVLA 1H8LA 3MRUA 2PRQA 1ARLA 1AMPA 2JEWA 1FT7A 3JTKA 5HVGA 4NFRA 1HDUA 2YNDA 4CYPA 4BINA 2C6CA 1YLOA 1Q2DA 1IYKA 2QYVA 1R43A 3KQZA 4MFKA 5AGEA 1NSAA 3TT2A 2Z3OA 4MCSA 4TWEA 3TO9A 4B5PB 4HNYB 3K2KA 2JDCA 3KR5A 2GLFA 3SJFA 4KOXA 4U9YA 3IEHA 2PJ5A 5K8NA 4OC4A 2PDOA 4XNHB 3KKWA 2DPTA 4PXCA 2BSWA 3FECA 2R98A 5HVFA 1Z8LA 1QQ9A 4NXYA 3I3GA 4JD6A 4MHDA 4ZI6A 1ZO0A 2GU2A 2A4NA 3H4QA 4PK3A 2OZUA 2JBKA 1CM0A 4UFXA 4CAVA 1XF8A 4F0YA 4H2KA 1LCPA 3TO6A 3MN8A 2OB0A 3KR4A 4I49A 4MRIA 4UFVA 4OADA 4Q7AA 1CPSA 5C88A 5IX3A 2HQYA 1CP7A 2XEGA 3D67A 3JUWA 1N71A 2OH1A 3FJUA 4PXBA 3GIUA 2Z3LA 4OKOA 4KOVA 4PQAA 4KORA 4UIBA 3WC7A 6CPAA 4KSAA 2Q43A 4KOUA 1XIXA 1A2ZA 5CNPA 1ZLIA 2PR8A 1ZG8A 3HLPA 2F8HA 3H8EA 4MCPA 4OIDA 4UWJA 4IUSA 4MFZA 2JEVA 2PJBA 2Q4VA 1R57A 3BLNA 3FEDA 2EWBA 2JDDA 3NE7A 2IL4A 4CS0B 5AG7A 1Y9WA 3KGQA 3F5BA 5E96A 4II9A 2QVPA 4KSFA 4C2ZA 1MJAA 2CNTA 5HVHA 5IB9A 2J8RA 4J3GA 3B3TA 2C1CA 3DGVA 4JWPA 3DR6A 4X5KA 3NH4A 5CPAA 4R9MA 5F09A 3B3VA 5KTAA 4KZTA 3IFEA 1RXTA 4KOSA 4OAEA 4UBRA 3BXMA 3P2FA 3SHPA 4CPAA 2PJ0A 2GANA 4XNHC 3A9LA 1VIXA 4HNXB 3D4UA 2VBQA 1NMTA 1YR0A 1M44A 2IQ6A 3PBBA 5EMIA 3VARA 4YU9A 1RTQA 1YK3A 4KUBA 3S9MA 2Q44A 3W91A 2FSRA 4LX9A 4C7IA 1Z9UA 2RC4A 4CGNA 2Q0YA 4NEXA 1LRZA 4R57A 5AG6A 4UEFA 3RZAA 2Q04A 2O53A 1S3ZA 2VL1A 5H84A 4B5OA 4A2ZA 1BPNA 3T90A 3PFEA 4MFPA 1XFOA 1IOFA 3WC6A 3P2HA 1CX8A 2PIZA 3H8GA 2ATRA 5KTCA 4UA3A 3BHXA 3PFOA 3LD2A 2Z3NA 2WYRA 2EO8A 2YNCA 2CIJA 4NGTA 3TC8A 3ZZIA 3PZJA 1TXRA 2PJ4A 2Q4ZA 4KS9A 4QUSA 1Q7LA 1CPXA 1IY7A 1PCAA 2PJAA 3ISXA 3PB9X 4P4EA 3B35A 5LYDA 4E2AA 2R1IA 4M3SA 2V8VA 2YNEA 4ZYQA 2PJ7A 3VWDA 4MMOA 4CGMA 1DE4C 2PSWA 4KOTA 3IWWA 2FIAA 3V8IA 4A39A 2ZEEA 1XRYA 2VXKA 2Q7BA 2OU2A 2HV2A 3T9YA 1JWQA 3D68A 1ZG7A 3SI1A 2ANPA 2EK9A 3VATA 1YW4A 4AG9A 2YNCC 3H8FA 1Y0YA 5J8FA 4ZY2A 5JQ4A 3DR8A 1KUXA 5LRKA 4AB7A 4XPDB 2B4DB 2B5GA 4JZ0A 1P0HA 4PXDA 3RNZA 1I21A 4NF1A 1XMTA 3PRTA 3QNVA 1U6MA 2G9DA 5LRJA 5A28A 5J1QA 3PB6X 4FD6A 3R9FA 2OZGA 3PB8X 2XEJA 2JLMA 1Q2YA 4H89A 2GIVA 2BOAA 2JBJA 2PJ8A 3NE8A 2YGWA 3TOBA 3BJ8A 1Z8WA 4KLVA 3I9SA 3RBUA 3TO7A 2CNSA 1CJWA 4OC0A 4P45A 3S6HA 1ELLP 1Z4EA 2AFOA 2PQ8A 2V8GA 1V0CA 1MJBA 4U5YA 4XPKA 1HEEA 2QIRA 1K4JA 4B11A 3FYNA 4P6YA 1S5KA 4UWIA 3RYOA 3TCVA 4CRZB 4DJLA 4M6GA 1YVOA 4UF4A 1GHEA 4X2TA 1WWZA 4R76A 3SJEA 2OOTA 1Q2CA 2AFXA 2C6PA 2FVGA 4M6IA 1VGYA 4OP4A 1ZLHA 3B7IA 2B4DA 1B87A 1HDQA 3JVNA 1QSOA 3NH5A 2I00A 2ZOGA 1TIQA 4LUAA 1KUYA 4P4BA 1NSLA 2OR4A 4MHNA 1IOIA 2FE7A 4NSQA 4CGLA 4NGNA 5I0CA 4A37A 4R6TA 2PE3A 3LODA 2B3VA 4OC1A 1MK4A 1FNOA 4RS2A 4A33A 5HMNA 1IB1E 1Y7RA 5F48A 1KWMA 2Z0ZA 2AFUA 4F9UA 2EVNA 3EC4A 3BI0A 1TKFA 4B13A 2O4HA 2AFWA 4LQGA 5F49A 2B3UA 4XPDC 2PIYA 4B6ZA 1IIDA 2C6GA 2K5TA 4RN7A 5F47A 3WR7A 1M4DA 4B5PA 2FS5A 1PUAA 2V8DA 2PJ3A 2PRBA 5JM6A 3PB4X 2DPSA 2ODFA 3IWEA 3IO1A 4MI4A 1YW6A 3IJ3A 4Y49B 1LAMA 3EXNA 1UFHA 3FBUA 5G1ZA 5JGFA 3CT9A 3D8PA 4P10A 3N7ZA 1NE9A 1CG2A 2ZW7A 5A27A 4H6UA 3R95A 1AYEA 3W6XA 1LAPA 4JXRA 1IYLA 2P6FA 2WPWA 4AVAA 4MBUA 3KQXA 3DNSA 3C26A 3E0KA 3G8WA 4PK2A 3WC5A 3EY5A 2NYQA 2VZZA 3D7DA 4KSIA 1BLLE 4O23A 1TKHA 3CPAA 4ORFA 4UEZA 4C2YA 4DYOA 5K8MA 4EFDA 1JQGA 4PPZA 5DWMA 4KOWA 4R8FA 2HUZA 4UCPA 4DUKA 3RAMA 3VH9A 3KHZA 2PCUA 5ELYA 3V7ZA 3KZWA 1IICA 4MHZA 2ZW5A 4YGOA 4AXVA 2QMLA 3D7FA 2J8NA 5H86A 2PVVA 3S9LA 2BUEA 2VI7A 3CXSA 2J8MA 1QSTA 5GCNA 1QSMA 4C68A 4GS4A 1QMUA 1VHOA 1R3NA 1VHSA 4F6AA 4A95A 1YVKA 2AFSA 5K8PA 5DWNA 3CXPA 3FMCA 1M4IA 1Z8XA 3S6FA 3FIXA 4IK2A 3LMSA 3LWUA 5AG4A 2POKA 2Z10A 8CPAA 1ON0A 1XOVA 3IWGA 4MY3A 3K9UA 4WJBA 2AE6A 2VZYA 3FB3A 1MJ9A 1ELMP 2CNMA 1IU8A 4KVME 3SJGA 2DEAA 2EK8A 5C82A 3FF3A 2ZEGA 1PYTB 2PJ1A 4AVCA 4PSWA 4X8IA 3TTHA 4UEEA 4B12A 5EC4A 4KVOE 2PJ6A 2RFHA 4ZY0A 4NGMA 2PC1A 2ARHA 2FIWA 3FXTA 4PXEA 5CBMA 1YQEA 2B4BA 3D2MA 3KASA 3PB7X 1M4LA 2R8VA 3N5FA 2P6GA 3GUXA 3MGDA 1RO5A 3DSBA 3R1KA 1S60A 3SI2A 1J4JA 1QSRA 3ISZA 2PJ9A 2ZW4A 4FD4A 3FX6A 2V77A 4AVBA 4CYQA 2BCOA 4F9VA 4CYOA 4F8ZA 2REFA 4X3RA 4JLYA 3SJXA 2J9AA 2HC9A 5KTDA 4Z65A 1WK4A 2B58A 1YSJA 1XBUA 1Y7EA 2CF4A 3CDXA 4K30A 4U9ZA 4MJ8A 4XPLA 3D2PA 4ZY1A 4TNUA 2ZPAA 4MCRA 3WABA 2IJZA 3CXQA 2C27A 4IHMA 1GYTA 1SQHA 1YGHA 4C2XA 4NGSA 4G1PA 2Q51A 4A31A 1L0CA 5DS0A 5BWAB 1I1DA 4OIWA 2WZNA 2AFMA 2I79A 4FWUA 4W9YA 4CAEA 4EVYA 4MFQA 4ZGYB 2CTBA 4FD7A 2G3TA 4ZX9A 4CGPA 1BAVA 1XMBA 1UWYA 2GLJA 3DDDA 2Y0MA 4Q36A 1CP6A 2ZEDA 5IV0A 5JPHA 3KI9A 4K3NA 4R3LA 5J8CA 3GYAA 1KUVA 2NSMA 2Q7SA 3TX8A 4B14A 2CTCA 1LOKA 2PR1A 4ONWA 1XE4A 4YWYA 3TFYA 3B2YA 1B6BA 3S6KA 4CAXA 3D3SA 1BO4A 1DTDA 2NMTA 3BI1A 3DLJA 3QAYA 1Z4RA 2XEIA 1LANA 5HH1A 1YX0A 4WWVA 5LRGA 2OZHA 1Y9KA 2ABZA 2XEFA 4HPSA 4ONUA 3VWEA 3LACA 1X10A 4KLWA 5F46A 4UCNA 2IMOA 2Z3PA 4R7MA 4KVXA 4RUHA 4A32A 2BO9A 3JRUA 4MY0A 4NCZA 2ZW6A 1LFWA 3K9TA 2EUIA 3RO0A 2FT0A 1M1DA 2H5MA 5FVJA 1PU9A 5THWA 1KZFA 3FH4A 2P0WA 4GM5A 3D7GA 4JXQA 2Z11A 5LYFA 2KCWA 4GXHA 4PV6A 3W6SA 2ZXVA 3R9EA 3PP9A 2ZEOA 4MCQA 4NJQA 1F2OA 3NFZA 1S7NA 3B3SA 3F8KA 1ARMA 3SXOA 1S7FA 5JH9A 4OC2A 3NH8A 5AG5A 4C7HA 3GLJA 2F7VA 2R7HA 4P44A 2FCKA 1BOBA 3B3CA 2I3CA 4PSXA 3WT4A 2G3AA 4E8OA 2ZENA 2ZELA 3GKRA 3KHXA 4FD5A 5G20A 3S6GA 2VEZA 4EMEA 1XEBA 3OWCA 3QAHA 1YMEA 3L2NA 4YFJA 2GREA 1CBXA 2ZEMA 3G3SA 4QC6A 4JYWA 4F0XA 2VQYA 2Z3KA 1XJOA 4MXUA 3BJ7A 2DF5A 2D4OA 4QVTA 1P4NA 4M85A 3UY5A 4MFJA 2O28A 4HKFA 1QSNA 1YLEA 4MFLA 4CGOA 5I4MA 2P6EA 3IU1A 4DNCA 2PJ2A 1S7LA 4NGQA 3SI0A 3IIBA 4A94A 4IAVA
chains in the Genus database with same CATH topology
4JJXA 2D4PA 3R96A 4KUAA 4CAFA 2AJ6A 4QBJA 4R3KA 4BMHA 4B10A 4L89A 5EBVA 4OLLA 3IU2A 2G0BA 5ISVA 4YRHA 4UCMA 2CXAA 1M4GA 2WUUA 3SXNA 5G21A 4A30A 4BBHA 5G22A 4E0AA 3IGRA 2B5GB 3QB8A 4ZBGA 4Y49C 2FXFA 3FNCA 1S7KA 3TOAA 2FL4A 3PGPA 1VKCA 2Q4YA 2X7BA 2CY2A 4Q38A 4CRYB 3FRMA 4R87A 4KOYA 3F0AA 1FY7A 4QB9A 3EFAA 4IF5A 4L8AA 3EO4A 3H5ZA 4AG7A 1I12A 3ZJ0A 4UFWA 4CAWA 2F5IA 3B8GA 4H6ZA 1OZPA 2WPXA 2Z3MA 4HNWB 4RI1A 1YREA 2QECA 3R9GA 4CYNA 5IB0A 2GE3A 2WSAA 2DXQA 2REEA 2BEIA 2BL1A 3GY9A 3JTKA 2YNDA 4CYPA 1Q2DA 1IYKA 4MFKA 5AGEA 3TT2A 2Z3OA 3TO9A 4B5PB 4HNYB 2JDCA 4KOXA 4U9YA 2PDOA 4XNHB 3KKWA 2DPTA 2BSWA 2R98A 4NXYA 3I3GA 4JD6A 4MHDA 1ZO0A 2A4NA 3H4QA 4PK3A 2OZUA 1CM0A 4UFXA 4CAVA 1XF8A 4F0YA 3TO6A 2OB0A 4UFVA 4I49A 5C88A 4OADA 5IX3A 2HQYA 3JUWA 1N71A 2OH1A 2Z3LA 4KOVA 4KORA 4KSAA 4KOUA 1XIXA 5CNPA 2PR8A 4UWJA 4IUSA 4MFZA 2JEVA 2Q4VA 1R57A 3BLNA 2JDDA 3NE7A 2IL4A 4CS0B 5AG7A 1Y9WA 3F5BA 5E96A 4II9A 4KSFA 4C2ZA 1MJAA 2CNTA 2J8RA 4J3GA 4JWPA 3DR6A 4X5KA 4R9MA 5KTAA 4KZTA 1RXTA 4KOSA 4OAEA 4UBRA 3P2FA 3SHPA 2GANA 4XNHC 3A9LA 4HNXB 2VBQA 1NMTA 1YR0A 1M44A 1YK3A 4KUBA 2Q44A 3W91A 2FSRA 4LX9A 4C7IA 1Z9UA 2RC4A 4CGNA 2Q0YA 4NEXA 1LRZA 4R57A 5AG6A 2Q04A 4B5OA 1S3ZA 5H84A 4A2ZA 3T90A 4MFPA 3P2HA 2ATRA 5KTCA 4UA3A 3LD2A 2Z3NA 2YNCA 3ZZIA 3PZJA 4KS9A 4QUSA 4E2AA 2R1IA 4M3SA 2YNEA 3VWDA 4CGMA 2PSWA 4KOTA 2FIAA 3V8IA 2VXKA 2Q7BA 2OU2A 2HV2A 3T9YA 4AG9A 2YNCC 5JQ4A 5J8FA 3DR8A 1KUXA 4AB7A 4XPDB 2B4DB 2B5GA 1P0HA 1I21A 4NF1A 1XMTA 1U6MA 5A28A 4FD6A 3R9FA 2OZGA 2JLMA 1Q2YA 4H89A 2GIVA 2YGWA 3TOBA 3BJ8A 4KLVA 3I9SA 3TO7A 2CNSA 1CJWA 3S6HA 1Z4EA 2PQ8A 1V0CA 1MJBA 4U5YA 4XPKA 2QIRA 1K4JA 4B11A 3FYNA 4UWIA 1S5KA 3RYOA 3TCVA 4CRZB 1YVOA 1GHEA 1WWZA 1Q2CA 2B4DA 1B87A 3JVNA 1QSOA 2I00A 1TIQA 4LUAA 1KUYA 1NSLA 2FE7A 4NSQA 4CGLA 5I0CA 3LODA 2B3VA 1MK4A 4RS2A 4A33A 5HMNA 1IB1E 1Y7RA 5F48A 2Z0ZA 2EVNA 3EC4A 4B13A 5F49A 2B3UA 4XPDC 1IIDA 2K5TA 5F47A 3WR7A 1M4DA 4B5PA 2FS5A 1PUAA 2PRBA 2DPSA 3IWEA 4MI4A 4Y49B 3EXNA 1UFHA 3FBUA 5G1ZA 3D8PA 3N7ZA 1NE9A 2ZW7A 5A27A 4H6UA 3R95A 3W6XA 4JXRA 1IYLA 2P6FA 2WPWA 4AVAA 4MBUA 3DNSA 3C26A 3E0KA 3G8WA 4PK2A 3EY5A 2VZZA 4ORFA 4C2YA 5DWMA 4KOWA 2HUZA 4UCPA 1IICA 2ZW5A 4YGOA 2QMLA 5H86A 2J8NA 2BUEA 2VI7A 3CXSA 2J8MA 1QSTA 5GCNA 1QSMA 4C68A 4GS4A 4F6AA 1VHSA 4A95A 1YVKA 5DWNA 3CXPA 1M4IA 3S6FA 3FIXA 5AG4A 2Z10A 1ON0A 3IWGA 4MY3A 3K9UA 2AE6A 2VZYA 3FB3A 1MJ9A 2CNMA 4KVME 5C82A 4AVCA 4PSWA 3TTHA 4B12A 5EC4A 4KVOE 2PC1A 2ARHA 2FIWA 3FXTA 2B4BA 3D2MA 2R8VA 2P6GA 3MGDA 1RO5A 3DSBA 3R1KA 1S60A 1J4JA 1QSRA 2ZW4A 4FD4A 4AVBA 4CYQA 4CYOA 2REFA 4JLYA 5KTDA 1WK4A 2B58A 4K30A 4U9ZA 4MJ8A 4XPLA 3D2PA 2ZPAA 3CXQA 2C27A 4C2XA 1SQHA 1YGHA 4A31A 1L0CA 5BWAB 3TE4A 1I1DA 2I79A 4EVYA 4CAEA 4MFQA 4ZGYB 4FD7A 2G3TA 4CGPA 3DDDA 2Y0MA 4Q36A 5IV0A 5JPHA 4R3LA 5J8CA 3GYAA 1KUVA 4B14A 2PR1A 1XE4A 3TFYA 1B6BA 3S6KA 4CAXA 3D3SA 1BO4A 2NMTA 5HH1A 1Z4RA 1YX0A 2OZHA 1Y9KA 4ONUA 3VWEA 4KLWA 5F46A 4UCNA 2Z3PA 4KVXA 4A32A 4MY0A 4NCZA 2ZW6A 2EUIA 2FT0A 1M1DA 2H5MA 5FVJA 1PU9A 1KZFA 2P0WA 4JXQA 2Z11A 2KCWA 3W6SA 4PV6A 2ZXVA 3R9EA 3PP9A 1S7NA 3F8KA 3SXOA 1S7FA 5AG5A 4C7HA 2R7HA 2FCKA 1BOBA 4PSXA 2G3AA 4E8OA 3GKRA 4FD5A 5G20A 3S6GA 2VEZA 1XEBA 3OWCA 3QAHA 4YFJA 3G3SA 4QC6A 4F0XA 2VQYA 2Z3KA 3BJ7A 2D4OA 4QVTA 1P4NA 4M85A 3UY5A 4MFJA 2O28A 4HKFA 1QSNA 1YLEA 4MFLA 4CGOA 2P6EA 3IU1A 4DNCA 1S7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJX A;  2D4P A;  3R96 A;  4KUA A;  2AJ6 A;  4QBJ A;  4R3K A;  4BMH A;  4L89 A;  5EBV A;  4OLL A;  2G0B A;  5ISV A;  4YRH A;  1M4G A;  3SXN A;  4E0A A;  3IGR A;  2B5G B;  3QB8 A;  4ZBG A;  4Y49 C;  2FXF A;  3FNC A;  1S7K A;  3TOA A;  2FL4 A;  3PGP A;  1VKC A;  2Q4Y A;  2X7B A;  2CY2 A;  4CRY B;  3FRM A;  4R87 A;  4KOY A;  3F0A A;  1FY7 A;  4QB9 A;  3EFA A;  4IF5 A;  4L8A A;  3EO4 A;  4AG7 A;  1I12 A;  3ZJ0 A;  4CAW A;  2F5I A;  3B8G A;  4H6Z A;  1OZP A;  2WPX A;  4HNW B;  4RI1 A;  1YRE A;  2QEC A;  3R9G A;  5IB0 A;  2GE3 A;  2DXQ A;  2REE A;  2BEI A;  2BL1 A;  3GY9 A;  1Q2D A;  1IYK A;  3TT2 A;  3TO9 A;  4B5P B;  4HNY B;  2JDC A;  4KOX A;  4U9Y A;  2PDO A;  4XNH B;  3KKW A;  2BSW A;  2R98 A;  4NXY A;  3I3G A;  4JD6 A;  4MHD A;  2A4N A;  3H4Q A;  4PK3 A;  2OZU A;  1CM0 A;  4CAV A;  1XF8 A;  4F0Y A;  3TO6 A;  2OB0 A;  5C88 A;  4I49 A;  4OAD A;  5IX3 A;  2HQY A;  3JUW A;  1N71 A;  2OH1 A;  4KOV A;  4KOR A;  4KOU A;  1XIX A;  5CNP A;  2PR8 A;  4UWJ A;  4IUS A;  2JEV A;  2Q4V A;  1R57 A;  3BLN A;  2JDD A;  3NE7 A;  2IL4 A;  4CS0 B;  1Y9W A;  3F5B A;  5E96 A;  4II9 A;  1MJA A;  2CNT A;  2J8R A;  4J3G A;  4JWP A;  3DR6 A;  4X5K A;  4R9M A;  5KTA A;  4KZT A;  1RXT A;  4KOS A;  4OAE A;  4UBR A;  3P2F A;  3SHP A;  2GAN A;  4XNH C;  4HNX B;  2VBQ A;  1NMT A;  1YR0 A;  1M44 A;  1YK3 A;  4KUB A;  2Q44 A;  3W91 A;  2FSR A;  4LX9 A;  1Z9U A;  2RC4 A;  2Q0Y A;  4NEX A;  1LRZ A;  4R57 A;  2Q04 A;  4B5O A;  1S3Z A;  5H84 A;  3T90 A;  3P2H A;  2ATR A;  5KTC A;  4UA3 A;  3LD2 A;  3ZZI A;  3PZJ A;  4QUS A;  4E2A A;  2R1I A;  4M3S A;  3VWD A;  2PSW A;  4KOT A;  2FIA A;  3V8I A;  2VXK A;  2Q7B A;  2OU2 A;  2HV2 A;  3T9Y A;  4AG9 A;  5JQ4 A;  5J8F A;  3DR8 A;  1KUX A;  4AB7 A;  4XPD B;  2B4D B;  2B5G A;  1P0H A;  1I21 A;  4NF1 A;  1XMT A;  1U6M A;  4FD6 A;  3R9F A;  2OZG A;  2JLM A;  1Q2Y A;  4H89 A;  2GIV A;  3TOB A;  3BJ8 A;  4KLV A;  3I9S A;  3TO7 A;  2CNS A;  1CJW A;  3S6H A;  1Z4E A;  2PQ8 A;  1V0C A;  1MJB A;  4U5Y A;  4XPK A;  2QIR A;  1K4J A;  3FYN A;  4UWI A;  1S5K A;  3RYO A;  3TCV A;  4CRZ B;  1YVO A;  1GHE A;  1WWZ A;  1Q2C A;  2B4D A;  1B87 A;  3JVN A;  1QSO A;  2I00 A;  1TIQ A;  4LUA A;  1KUY A;  1NSL A;  2FE7 A;  4NSQ A;  5I0C A;  3LOD A;  2B3V A;  1MK4 A;  4RS2 A;  5HMN A;  1IB1 E;  1Y7R A;  5F48 A;  2Z0Z A;  2EVN A;  3EC4 A;  5F49 A;  2B3U A;  4XPD C;  1IID A;  2K5T A;  5F47 A;  3WR7 A;  1M4D A;  4B5P A;  2FS5 A;  1PUA A;  2PRB A;  4MI4 A;  4Y49 B;  3EXN A;  1UFH A;  3FBU A;  3D8P A;  3N7Z A;  1NE9 A;  2ZW7 A;  4H6U A;  3R95 A;  3W6X A;  4JXR A;  1IYL A;  2P6F A;  2WPW A;  4AVA A;  4MBU A;  3DNS A;  3C26 A;  3E0K A;  3G8W A;  4PK2 A;  3EY5 A;  2VZZ A;  4ORF A;  5DWM A;  4KOW A;  2HUZ A;  1IIC A;  2ZW5 A;  4YGO A;  2QML A;  5H86 A;  2J8N A;  2BUE A;  2VI7 A;  3CXS A;  2J8M A;  1QST A;  5GCN A;  1QSM A;  4GS4 A;  4F6A A;  1VHS A;  1YVK A;  5DWN A;  3CXP A;  1M4I A;  3S6F A;  3FIX A;  2Z10 A;  1ON0 A;  3IWG A;  4MY3 A;  3K9U A;  2AE6 A;  2VZY A;  3FB3 A;  1MJ9 A;  2CNM A;  4KVM E;  5C82 A;  4AVC A;  4PSW A;  3TTH A;  5EC4 A;  4KVO E;  2PC1 A;  2ARH A;  2FIW A;  3FXT A;  2B4B A;  3D2M A;  2R8V A;  2P6G A;  3MGD A;  1RO5 A;  3DSB A;  3R1K A;  1S60 A;  1J4J A;  1QSR A;  2ZW4 A;  4FD4 A;  4AVB A;  2REF A;  4JLY A;  5KTD A;  1WK4 A;  2B58 A;  4K30 A;  4U9Z A;  4MJ8 A;  4XPL A;  3D2P A;  2ZPA A;  3CXQ A;  2C27 A;  1SQH A;  1YGH A;  3TE4 A;  1L0C A;  1I1D A;  2I79 A;  4EVY A;  4FD7 A;  2G3T A;  3DDD A;  2Y0M A;  5IV0 A;  5JPH A;  4R3L A;  5J8C A;  3GYA A;  1KUV A;  2PR1 A;  1XE4 A;  3TFY A;  1B6B A;  3S6K A;  4CAX A;  3D3S A;  1BO4 A;  2NMT A;  5HH1 A;  1Z4R A;  1YX0 A;  2OZH A;  1Y9K A;  4ONU A;  3VWE A;  4KLW A;  5F46 A;  4KVX A;  4MY0 A;  4NCZ A;  2ZW6 A;  2EUI A;  2FT0 A;  1M1D A;  2H5M A;  5FVJ A;  1PU9 A;  1KZF A;  2P0W A;  4JXQ A;  2Z11 A;  2KCW A;  3W6S A;  4PV6 A;  2ZXV A;  3R9E A;  3PP9 A;  1S7N A;  3F8K A;  3SXO A;  1S7F A;  2R7H A;  2FCK A;  1BOB A;  4PSX A;  2G3A A;  4E8O A;  3GKR A;  4FD5 A;  3S6G A;  2VEZ A;  1XEB A;  3OWC A;  3QAH A;  4YFJ A;  3G3S A;  4QC6 A;  2VQY A;  3BJ7 A;  2D4O A;  4QVT A;  1P4N A;  4M85 A;  3UY5 A;  2O28 A;  4HKF A;  1QSN A;  1YLE A;  2P6E A;  4DNC A;  1S7L A; 
#chains in the Genus database with same CATH topology
 4NGR A;  3S9N A;  4JJX A;  2D4P A;  4LQ6 A;  3PEI A;  3R96 A;  4KUA A;  4CAF A;  3CZX A;  2AJ6 A;  2PVW A;  4QBJ A;  4M6H A;  4R3K A;  4BMH A;  2EBJ A;  2V8H A;  4NGP A;  4B10 A;  2ZEP A;  3GB0 A;  4L89 A;  2PJC A;  5EBV A;  4OLL A;  3HUV A;  4P4D A;  3IU2 A;  1Z5R A;  4ZX8 A;  7CPA A;  1Y0R A;  2G0B A;  5ISV A;  4YRH A;  1Z8T A;  2ZEF A;  1OBR A;  2CXA A;  1M4G A;  2ZEH A;  3B3W A;  4UCM A;  2WUU A;  1IGB A;  4NJR A;  5HXD A;  3SXN A;  1AUG A;  1EE3 P;  3CPX A;  5G21 A;  4A30 A;  4BBH A;  5G22 A;  2RB7 A;  4E0A A;  3FEE A;  3IGR A;  2B5G B;  2HB6 A;  3D7H A;  3QB8 A;  4ZBG A;  4Y49 C;  2FXF A;  3FNC A;  1S7K A;  3IC1 A;  3TOA A;  2FL4 A;  3PGP A;  4OME A;  4A38 A;  1VKC A;  1X12 A;  2Q4Y A;  2X7B A;  4FAI A;  1TKJ A;  2CY2 A;  4OC5 A;  3NA6 A;  3PBE A;  4FUU A;  4Q38 A;  5D29 A;  3FRM A;  4R87 A;  4CRY B;  4KOY A;  5LYL A;  3F0A A;  1FY7 A;  4MHP A;  4QB9 A;  3EFA A;  4IF5 A;  4L8A A;  3EO4 A;  3H5Z A;  4AG7 A;  3T8W A;  1ZG9 A;  4P4I A;  1I12 A;  5LYI A;  3ZJ0 A;  4FBE A;  1Z2L A;  4P4F A;  4UFW A;  4CAW A;  2GFQ A;  3KL9 A;  2F5I A;  3B8G A;  2ZOF A;  4H6Z A;  3V38 A;  1OZP A;  2WPX A;  1VHE A;  3TE4 A;  5D8N A;  2Z3M A;  4HNW B;  4OC3 A;  3I1U A;  3D66 A;  4RI1 A;  4P4J A;  1YRE A;  4MHY A;  1F57 A;  2AFZ A;  2QEC A;  4UIA A;  3R9G A;  4CYN A;  1TF9 A;  5IB0 A;  1F2P A;  2GE3 A;  2WSA A;  2DXQ A;  5K8O A;  2QJ8 A;  2REE A;  2BEI A;  4BD9 A;  2BL1 A;  1TF8 A;  3GY9 A;  4EWT A;  1BPM A;  3FVL A;  1H8L A;  3MRU A;  2PRQ A;  1ARL A;  1AMP A;  2JEW A;  1FT7 A;  3JTK A;  5HVG A;  4NFR A;  1HDU A;  2YND A;  4CYP A;  4BIN A;  2C6C A;  1YLO A;  1Q2D A;  1IYK A;  2QYV A;  1R43 A;  3KQZ A;  4MFK A;  5AGE A;  1NSA A;  3TT2 A;  2Z3O A;  4MCS A;  4TWE A;  3TO9 A;  4B5P B;  4HNY B;  3K2K A;  2JDC A;  3KR5 A;  2GLF A;  3SJF A;  4KOX A;  4U9Y A;  3IEH A;  2PJ5 A;  5K8N A;  4OC4 A;  2PDO A;  4XNH B;  3KKW A;  2DPT A;  4PXC A;  2BSW A;  3FEC A;  2R98 A;  5HVF A;  1Z8L A;  1QQ9 A;  4NXY A;  3I3G A;  4JD6 A;  4MHD A;  4ZI6 A;  1ZO0 A;  2GU2 A;  2A4N A;  3H4Q A;  4PK3 A;  2OZU A;  2JBK A;  1CM0 A;  4UFX A;  4CAV A;  1XF8 A;  4F0Y A;  4H2K A;  1LCP A;  3TO6 A;  3MN8 A;  2OB0 A;  3KR4 A;  4I49 A;  4MRI A;  4UFV A;  4OAD A;  4Q7A A;  1CPS A;  5C88 A;  5IX3 A;  2HQY A;  1CP7 A;  2XEG A;  3D67 A;  3JUW A;  1N71 A;  2OH1 A;  3FJU A;  4PXB A;  3GIU A;  2Z3L A;  4OKO A;  4KOV A;  4PQA A;  4KOR A;  4UIB A;  3WC7 A;  6CPA A;  4KSA A;  2Q43 A;  4KOU A;  1XIX A;  1A2Z A;  5CNP A;  1ZLI A;  2PR8 A;  1ZG8 A;  3HLP A;  2F8H A;  3H8E A;  4MCP A;  4OID A;  4UWJ A;  4IUS A;  4MFZ A;  2JEV A;  2PJB A;  2Q4V A;  1R57 A;  3BLN A;  3FED A;  2EWB A;  2JDD A;  3NE7 A;  2IL4 A;  4CS0 B;  5AG7 A;  1Y9W A;  3KGQ A;  3F5B A;  5E96 A;  4II9 A;  2QVP A;  4KSF A;  4C2Z A;  1MJA A;  2CNT A;  5HVH A;  5IB9 A;  2J8R A;  4J3G A;  3B3T A;  2C1C A;  3DGV A;  4JWP A;  3DR6 A;  4X5K A;  3NH4 A;  5CPA A;  4R9M A;  5F09 A;  3B3V A;  5KTA A;  4KZT A;  3IFE A;  1RXT A;  4KOS A;  4OAE A;  4UBR A;  3BXM A;  3P2F A;  3SHP A;  4CPA A;  2PJ0 A;  2GAN A;  4XNH C;  3A9L A;  1VIX A;  4HNX B;  3D4U A;  2VBQ A;  1NMT A;  1YR0 A;  1M44 A;  2IQ6 A;  3PBB A;  5EMI A;  3VAR A;  4YU9 A;  1RTQ A;  1YK3 A;  4KUB A;  3S9M A;  2Q44 A;  3W91 A;  2FSR A;  4LX9 A;  4C7I A;  1Z9U A;  2RC4 A;  4CGN A;  2Q0Y A;  4NEX A;  1LRZ A;  4R57 A;  5AG6 A;  4UEF A;  3RZA A;  2Q04 A;  2O53 A;  1S3Z A;  2VL1 A;  5H84 A;  4B5O A;  4A2Z A;  1BPN A;  3T90 A;  3PFE A;  4MFP A;  1XFO A;  1IOF A;  3WC6 A;  3P2H A;  1CX8 A;  2PIZ A;  3H8G A;  2ATR A;  5KTC A;  4UA3 A;  3BHX A;  3PFO A;  3LD2 A;  2Z3N A;  2WYR A;  2EO8 A;  2YNC A;  2CIJ A;  4NGT A;  3TC8 A;  3ZZI A;  3PZJ A;  1TXR A;  2PJ4 A;  2Q4Z A;  4KS9 A;  4QUS A;  1Q7L A;  1CPX A;  1IY7 A;  1PCA A;  2PJA A;  3ISX A;  3PB9 X;  4P4E A;  3B35 A;  5LYD A;  4E2A A;  2R1I A;  4M3S A;  2V8V A;  2YNE A;  4ZYQ A;  2PJ7 A;  3VWD A;  4MMO A;  4CGM A;  1DE4 C;  2PSW A;  4KOT A;  3IWW A;  2FIA A;  3V8I A;  4A39 A;  2ZEE A;  1XRY A;  2VXK A;  2Q7B A;  2OU2 A;  2HV2 A;  3T9Y A;  1JWQ A;  3D68 A;  1ZG7 A;  3SI1 A;  2ANP A;  2EK9 A;  3VAT A;  1YW4 A;  4AG9 A;  2YNC C;  3H8F A;  1Y0Y A;  5J8F A;  4ZY2 A;  5JQ4 A;  3DR8 A;  1KUX A;  5LRK A;  4AB7 A;  4XPD B;  2B4D B;  2B5G A;  4JZ0 A;  1P0H A;  4PXD A;  3RNZ A;  1I21 A;  4NF1 A;  1XMT A;  3PRT A;  3QNV A;  1U6M A;  2G9D A;  5LRJ A;  5A28 A;  5J1Q A;  3PB6 X;  4FD6 A;  3R9F A;  2OZG A;  3PB8 X;  2XEJ A;  2JLM A;  1Q2Y A;  4H89 A;  2GIV A;  2BOA A;  2JBJ A;  2PJ8 A;  3NE8 A;  2YGW A;  3TOB A;  3BJ8 A;  1Z8W A;  4KLV A;  3I9S A;  3RBU A;  3TO7 A;  2CNS A;  1CJW A;  4OC0 A;  4P45 A;  3S6H A;  1ELL P;  1Z4E A;  2AFO A;  2PQ8 A;  2V8G A;  1V0C A;  1MJB A;  4U5Y A;  4XPK A;  1HEE A;  2QIR A;  1K4J A;  4B11 A;  3FYN A;  4P6Y A;  1S5K A;  4UWI A;  3RYO A;  3TCV A;  4CRZ B;  4DJL A;  4M6G A;  1YVO A;  4UF4 A;  1GHE A;  4X2T A;  1WWZ A;  4R76 A;  3SJE A;  2OOT A;  1Q2C A;  2AFX A;  2C6P A;  2FVG A;  4M6I A;  1VGY A;  4OP4 A;  1ZLH A;  3B7I A;  2B4D A;  1B87 A;  1HDQ A;  3JVN A;  1QSO A;  3NH5 A;  2I00 A;  2ZOG A;  1TIQ A;  4LUA A;  1KUY A;  4P4B A;  1NSL A;  2OR4 A;  4MHN A;  1IOI A;  2FE7 A;  4NSQ A;  4CGL A;  4NGN A;  5I0C A;  4A37 A;  4R6T A;  2PE3 A;  3LOD A;  2B3V A;  4OC1 A;  1MK4 A;  1FNO A;  4RS2 A;  4A33 A;  5HMN A;  1IB1 E;  1Y7R A;  5F48 A;  1KWM A;  2Z0Z A;  2AFU A;  4F9U A;  2EVN A;  3EC4 A;  3BI0 A;  1TKF A;  4B13 A;  2O4H A;  2AFW A;  4LQG A;  5F49 A;  2B3U A;  4XPD C;  2PIY A;  4B6Z A;  1IID A;  2C6G A;  2K5T A;  4RN7 A;  5F47 A;  3WR7 A;  1M4D A;  4B5P A;  2FS5 A;  1PUA A;  2V8D A;  2PJ3 A;  2PRB A;  5JM6 A;  3PB4 X;  2DPS A;  2ODF A;  3IWE A;  3IO1 A;  4MI4 A;  1YW6 A;  3IJ3 A;  4Y49 B;  1LAM A;  3EXN A;  1UFH A;  3FBU A;  5G1Z A;  5JGF A;  3CT9 A;  3D8P A;  4P10 A;  3N7Z A;  1NE9 A;  1CG2 A;  2ZW7 A;  5A27 A;  4H6U A;  3R95 A;  1AYE A;  3W6X A;  1LAP A;  4JXR A;  1IYL A;  2P6F A;  2WPW A;  4AVA A;  4MBU A;  3KQX A;  3DNS A;  3C26 A;  3E0K A;  3G8W A;  4PK2 A;  3WC5 A;  3EY5 A;  2NYQ A;  2VZZ A;  3D7D A;  4KSI A;  1BLL E;  4O23 A;  1TKH A;  3CPA A;  4ORF A;  4UEZ A;  4C2Y A;  4DYO A;  5K8M A;  4EFD A;  1JQG A;  4PPZ A;  5DWM A;  4KOW A;  4R8F A;  2HUZ A;  4UCP A;  4DUK A;  3RAM A;  3VH9 A;  3KHZ A;  2PCU A;  5ELY A;  3V7Z A;  3KZW A;  1IIC A;  4MHZ A;  2ZW5 A;  4YGO A;  4AXV A;  2QML A;  3D7F A;  2J8N A;  5H86 A;  2PVV A;  3S9L A;  2BUE A;  2VI7 A;  3CXS A;  2J8M A;  1QST A;  5GCN A;  1QSM A;  4C68 A;  4GS4 A;  1QMU A;  1VHO A;  1R3N A;  1VHS A;  4F6A A;  4A95 A;  1YVK A;  2AFS A;  5K8P A;  5DWN A;  3CXP A;  3FMC A;  1M4I A;  1Z8X A;  3S6F A;  3FIX A;  4IK2 A;  3LMS A;  3LWU A;  5AG4 A;  2POK A;  2Z10 A;  8CPA A;  1ON0 A;  1XOV A;  3IWG A;  4MY3 A;  3K9U A;  4WJB A;  2AE6 A;  2VZY A;  3FB3 A;  1MJ9 A;  1ELM P;  2CNM A;  1IU8 A;  4KVM E;  3SJG A;  2DEA A;  2EK8 A;  5C82 A;  3FF3 A;  2ZEG A;  1PYT B;  2PJ1 A;  4AVC A;  4PSW A;  4X8I A;  3TTH A;  4UEE A;  4B12 A;  5EC4 A;  4KVO E;  2PJ6 A;  2RFH A;  4ZY0 A;  4NGM A;  2PC1 A;  2ARH A;  2FIW A;  3FXT A;  4PXE A;  5CBM A;  1YQE A;  2B4B A;  3D2M A;  3KAS A;  3PB7 X;  1M4L A;  2R8V A;  3N5F A;  2P6G A;  3GUX A;  3MGD A;  1RO5 A;  3DSB A;  3R1K A;  1S60 A;  3SI2 A;  1J4J A;  1QSR A;  3ISZ A;  2PJ9 A;  2ZW4 A;  4FD4 A;  3FX6 A;  2V77 A;  4AVB A;  4CYQ A;  2BCO A;  4F9V A;  4CYO A;  4F8Z A;  2REF A;  4X3R A;  4JLY A;  3SJX A;  2J9A A;  2HC9 A;  5KTD A;  4Z65 A;  1WK4 A;  2B58 A;  1YSJ A;  1XBU A;  1Y7E A;  2CF4 A;  3CDX A;  4K30 A;  4U9Z A;  4MJ8 A;  4XPL A;  3D2P A;  4ZY1 A;  4TNU A;  2ZPA A;  4MCR A;  3WAB A;  2IJZ A;  3CXQ A;  2C27 A;  4IHM A;  1GYT A;  1SQH A;  1YGH A;  4C2X A;  4NGS A;  4G1P A;  2Q51 A;  4A31 A;  1L0C A;  5DS0 A;  5BWA B;  1I1D A;  4OIW A;  2WZN A;  2AFM A;  2I79 A;  4FWU A;  4W9Y A;  4CAE A;  4EVY A;  4MFQ A;  4ZGY B;  2CTB A;  4FD7 A;  2G3T A;  4ZX9 A;  4CGP A;  1BAV A;  1XMB A;  1UWY A;  2GLJ A;  3DDD A;  2Y0M A;  4Q36 A;  1CP6 A;  2ZED A;  5IV0 A;  5JPH A;  3KI9 A;  4K3N A;  4R3L A;  5J8C A;  3GYA A;  1KUV A;  2NSM A;  2Q7S A;  3TX8 A;  4B14 A;  2CTC A;  1LOK A;  2PR1 A;  4ONW A;  1XE4 A;  4YWY A;  3TFY A;  3B2Y A;  1B6B A;  3S6K A;  4CAX A;  3D3S A;  1BO4 A;  1DTD A;  2NMT A;  3BI1 A;  3DLJ A;  3QAY A;  1Z4R A;  2XEI A;  1LAN A;  5HH1 A;  1YX0 A;  4WWV A;  5LRG A;  2OZH A;  1Y9K A;  2ABZ A;  2XEF A;  4HPS A;  4ONU A;  3VWE A;  3LAC A;  1X10 A;  4KLW A;  5F46 A;  4UCN A;  2IMO A;  2Z3P A;  4R7M A;  4KVX A;  4RUH A;  4A32 A;  2BO9 A;  3JRU A;  4MY0 A;  4NCZ A;  2ZW6 A;  1LFW A;  3K9T A;  2EUI A;  3RO0 A;  2FT0 A;  1M1D A;  2H5M A;  5FVJ A;  1PU9 A;  5THW A;  1KZF A;  3FH4 A;  2P0W A;  4GM5 A;  3D7G A;  4JXQ A;  2Z11 A;  5LYF A;  2KCW A;  4GXH A;  4PV6 A;  3W6S A;  2ZXV A;  3R9E A;  3PP9 A;  2ZEO A;  4MCQ A;  4NJQ A;  1F2O A;  3NFZ A;  1S7N A;  3B3S A;  3F8K A;  1ARM A;  3SXO A;  1S7F A;  5JH9 A;  4OC2 A;  3NH8 A;  5AG5 A;  4C7H A;  3GLJ A;  2F7V A;  2R7H A;  4P44 A;  2FCK A;  1BOB A;  3B3C A;  2I3C A;  4PSX A;  3WT4 A;  2G3A A;  4E8O A;  2ZEN A;  2ZEL A;  3GKR A;  3KHX A;  4FD5 A;  5G20 A;  3S6G A;  2VEZ A;  4EME A;  1XEB A;  3OWC A;  3QAH A;  1YME A;  3L2N A;  4YFJ A;  2GRE A;  1CBX A;  2ZEM A;  3G3S A;  4QC6 A;  4JYW A;  4F0X A;  2VQY A;  2Z3K A;  1XJO A;  4MXU A;  3BJ7 A;  2DF5 A;  2D4O A;  4QVT A;  1P4N A;  4M85 A;  3UY5 A;  4MFJ A;  2O28 A;  4HKF A;  1QSN A;  1YLE A;  4MFL A;  4CGO A;  5I4M A;  2P6E A;  3IU1 A;  4DNC A;  2PJ2 A;  1S7L A;  4NGQ A;  3SI0 A;  3IIB A;  4A94 A;  4IAV A; 
#chains in the Genus database with same CATH homology
 4JJX A;  2D4P A;  3R96 A;  4KUA A;  4CAF A;  2AJ6 A;  4QBJ A;  4R3K A;  4BMH A;  4B10 A;  4L89 A;  5EBV A;  4OLL A;  3IU2 A;  2G0B A;  5ISV A;  4YRH A;  4UCM A;  2CXA A;  1M4G A;  2WUU A;  3SXN A;  5G21 A;  4A30 A;  4BBH A;  5G22 A;  4E0A A;  3IGR A;  2B5G B;  3QB8 A;  4ZBG A;  4Y49 C;  2FXF A;  3FNC A;  1S7K A;  3TOA A;  2FL4 A;  3PGP A;  1VKC A;  2Q4Y A;  2X7B A;  2CY2 A;  4Q38 A;  4CRY B;  3FRM A;  4R87 A;  4KOY A;  3F0A A;  1FY7 A;  4QB9 A;  3EFA A;  4IF5 A;  4L8A A;  3EO4 A;  3H5Z A;  4AG7 A;  1I12 A;  3ZJ0 A;  4UFW A;  4CAW A;  2F5I A;  3B8G A;  4H6Z A;  1OZP A;  2WPX A;  2Z3M A;  4HNW B;  4RI1 A;  1YRE A;  2QEC A;  3R9G A;  4CYN A;  5IB0 A;  2GE3 A;  2WSA A;  2DXQ A;  2REE A;  2BEI A;  2BL1 A;  3GY9 A;  3JTK A;  2YND A;  4CYP A;  1Q2D A;  1IYK A;  4MFK A;  5AGE A;  3TT2 A;  2Z3O A;  3TO9 A;  4B5P B;  4HNY B;  2JDC A;  4KOX A;  4U9Y A;  2PDO A;  4XNH B;  3KKW A;  2DPT A;  2BSW A;  2R98 A;  4NXY A;  3I3G A;  4JD6 A;  4MHD A;  1ZO0 A;  2A4N A;  3H4Q A;  4PK3 A;  2OZU A;  1CM0 A;  4UFX A;  4CAV A;  1XF8 A;  4F0Y A;  3TO6 A;  2OB0 A;  4UFV A;  4I49 A;  5C88 A;  4OAD A;  5IX3 A;  2HQY A;  3JUW A;  1N71 A;  2OH1 A;  2Z3L A;  4KOV A;  4KOR A;  4KSA A;  4KOU A;  1XIX A;  5CNP A;  2PR8 A;  4UWJ A;  4IUS A;  4MFZ A;  2JEV A;  2Q4V A;  1R57 A;  3BLN A;  2JDD A;  3NE7 A;  2IL4 A;  4CS0 B;  5AG7 A;  1Y9W A;  3F5B A;  5E96 A;  4II9 A;  4KSF A;  4C2Z A;  1MJA A;  2CNT A;  2J8R A;  4J3G A;  4JWP A;  3DR6 A;  4X5K A;  4R9M A;  5KTA A;  4KZT A;  1RXT A;  4KOS A;  4OAE A;  4UBR A;  3P2F A;  3SHP A;  2GAN A;  4XNH C;  3A9L A;  4HNX B;  2VBQ A;  1NMT A;  1YR0 A;  1M44 A;  1YK3 A;  4KUB A;  2Q44 A;  3W91 A;  2FSR A;  4LX9 A;  4C7I A;  1Z9U A;  2RC4 A;  4CGN A;  2Q0Y A;  4NEX A;  1LRZ A;  4R57 A;  5AG6 A;  2Q04 A;  4B5O A;  1S3Z A;  5H84 A;  4A2Z A;  3T90 A;  4MFP A;  3P2H A;  2ATR A;  5KTC A;  4UA3 A;  3LD2 A;  2Z3N A;  2YNC A;  3ZZI A;  3PZJ A;  4KS9 A;  4QUS A;  4E2A A;  2R1I A;  4M3S A;  2YNE A;  3VWD A;  4CGM A;  2PSW A;  4KOT A;  2FIA A;  3V8I A;  2VXK A;  2Q7B A;  2OU2 A;  2HV2 A;  3T9Y A;  4AG9 A;  2YNC C;  5JQ4 A;  5J8F A;  3DR8 A;  1KUX A;  4AB7 A;  4XPD B;  2B4D B;  2B5G A;  1P0H A;  1I21 A;  4NF1 A;  1XMT A;  1U6M A;  5A28 A;  4FD6 A;  3R9F A;  2OZG A;  2JLM A;  1Q2Y A;  4H89 A;  2GIV A;  2YGW A;  3TOB A;  3BJ8 A;  4KLV A;  3I9S A;  3TO7 A;  2CNS A;  1CJW A;  3S6H A;  1Z4E A;  2PQ8 A;  1V0C A;  1MJB A;  4U5Y A;  4XPK A;  2QIR A;  1K4J A;  4B11 A;  3FYN A;  4UWI A;  1S5K A;  3RYO A;  3TCV A;  4CRZ B;  1YVO A;  1GHE A;  1WWZ A;  1Q2C A;  2B4D A;  1B87 A;  3JVN A;  1QSO A;  2I00 A;  1TIQ A;  4LUA A;  1KUY A;  1NSL A;  2FE7 A;  4NSQ A;  4CGL A;  5I0C A;  3LOD A;  2B3V A;  1MK4 A;  4RS2 A;  4A33 A;  5HMN A;  1IB1 E;  1Y7R A;  5F48 A;  2Z0Z A;  2EVN A;  3EC4 A;  4B13 A;  5F49 A;  2B3U A;  4XPD C;  1IID A;  2K5T A;  5F47 A;  3WR7 A;  1M4D A;  4B5P A;  2FS5 A;  1PUA A;  2PRB A;  2DPS A;  3IWE A;  4MI4 A;  4Y49 B;  3EXN A;  1UFH A;  3FBU A;  5G1Z A;  3D8P A;  3N7Z A;  1NE9 A;  2ZW7 A;  5A27 A;  4H6U A;  3R95 A;  3W6X A;  4JXR A;  1IYL A;  2P6F A;  2WPW A;  4AVA A;  4MBU A;  3DNS A;  3C26 A;  3E0K A;  3G8W A;  4PK2 A;  3EY5 A;  2VZZ A;  4ORF A;  4C2Y A;  5DWM A;  4KOW A;  2HUZ A;  4UCP A;  1IIC A;  2ZW5 A;  4YGO A;  2QML A;  5H86 A;  2J8N A;  2BUE A;  2VI7 A;  3CXS A;  2J8M A;  1QST A;  5GCN A;  1QSM A;  4C68 A;  4GS4 A;  4F6A A;  1VHS A;  4A95 A;  1YVK A;  5DWN A;  3CXP A;  1M4I A;  3S6F A;  3FIX A;  5AG4 A;  2Z10 A;  1ON0 A;  3IWG A;  4MY3 A;  3K9U A;  2AE6 A;  2VZY A;  3FB3 A;  1MJ9 A;  2CNM A;  4KVM E;  5C82 A;  4AVC A;  4PSW A;  3TTH A;  4B12 A;  5EC4 A;  4KVO E;  2PC1 A;  2ARH A;  2FIW A;  3FXT A;  2B4B A;  3D2M A;  2R8V A;  2P6G A;  3MGD A;  1RO5 A;  3DSB A;  3R1K A;  1S60 A;  1J4J A;  1QSR A;  2ZW4 A;  4FD4 A;  4AVB A;  4CYQ A;  4CYO A;  2REF A;  4JLY A;  5KTD A;  1WK4 A;  2B58 A;  4K30 A;  4U9Z A;  4MJ8 A;  4XPL A;  3D2P A;  2ZPA A;  3CXQ A;  2C27 A;  4C2X A;  1SQH A;  1YGH A;  4A31 A;  1L0C A;  5BWA B;  3TE4 A;  1I1D A;  2I79 A;  4EVY A;  4CAE A;  4MFQ A;  4ZGY B;  4FD7 A;  2G3T A;  4CGP A;  3DDD A;  2Y0M A;  4Q36 A;  5IV0 A;  5JPH A;  4R3L A;  5J8C A;  3GYA A;  1KUV A;  4B14 A;  2PR1 A;  1XE4 A;  3TFY A;  1B6B A;  3S6K A;  4CAX A;  3D3S A;  1BO4 A;  2NMT A;  5HH1 A;  1Z4R A;  1YX0 A;  2OZH A;  1Y9K A;  4ONU A;  3VWE A;  4KLW A;  5F46 A;  4UCN A;  2Z3P A;  4KVX A;  4A32 A;  4MY0 A;  4NCZ A;  2ZW6 A;  2EUI A;  2FT0 A;  1M1D A;  2H5M A;  5FVJ A;  1PU9 A;  1KZF A;  2P0W A;  4JXQ A;  2Z11 A;  2KCW A;  3W6S A;  4PV6 A;  2ZXV A;  3R9E A;  3PP9 A;  1S7N A;  3F8K A;  3SXO A;  1S7F A;  5AG5 A;  4C7H A;  2R7H A;  2FCK A;  1BOB A;  4PSX A;  2G3A A;  4E8O A;  3GKR A;  4FD5 A;  5G20 A;  3S6G A;  2VEZ A;  1XEB A;  3OWC A;  3QAH A;  4YFJ A;  3G3S A;  4QC6 A;  4F0X A;  2VQY A;  2Z3K A;  3BJ7 A;  2D4O A;  4QVT A;  1P4N A;  4M85 A;  3UY5 A;  4MFJ A;  2O28 A;  4HKF A;  1QSN A;  1YLE A;  4MFL A;  4CGO A;  2P6E A;  3IU1 A;  4DNC A;  1S7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...