1S60A

Aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and n-terminal his(6)-tag (crystal form 2)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
152
Chain Sequence
LVPRGSHMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETERVIFYRKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside 6'-N-acetyltransferase
publication title A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
pubmed doi rcsb
source organism Salmonella enteritidis
molecule tags Transferase
total genus 37
structure length 152
sequence length 152
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s60A00
1I21A 1PUAA 3PZJA 4YFJA 4KOSA 1KUXA 3B8GA 5FVJA 3FYNA 3R9FA 1Z9UA 4M3SA 4CAWA 1YVKA 2Z11A 4AG9A 2G3TA 4GS4A 5E96A 3P2HA 3W6XA 4KOXA 1B6BA 2C27A 4AVBA 4HNYB 3WR7A 3JUWA 1Y7RA 2JDCA 4FD5A 2H5MA 4PV6A 4KOTA 4QUSA 3TOAA 3CXSA 1LRZA 2JLMA 2WPXA 4XPLA 4HNWB 1PU9A 2VI7A 3F0AA 2HV2A 1XMTA 2Z10A 3DSBA 4NF1A 4JLYA 1U6MA 4UWIA 2PSWA 1P0HA 1S7FA 3BLNA 1YGHA 4KZTA 5KTCA 1MK4A 4JXRA 3W6SA 2B3UA 4UA3A 4IF5A 4EVYA 2PR8A 3BJ8A 4KOYA 2CNSA 2HUZA 4YGOA 2OH1A 3CXQA 4XNHC 3V8IA 5J8CA 3D8PA 3TTHA 2JEVA 1S60A 2VBQA 4K30A 1YK3A 4U5YA 5F47A 4HNXB 1Q2YA 1GHEA 2CNTA 4KOWA 2P6FA 3IWGA 2X7BA 3FRMA 1IIDA 3OWCA 4E8OA 2Q0YA 1YLEA 4X5KA 4F6AA 2A4NA 5GCNA 1M4IA 3I3GA 5JPHA 2FL4A 3GKRA 1RXTA 2FSRA 3D2PA 3R95A 2ZW7A 5IX3A 4F0YA 4XPDB 1MJ9A 4B5PA 4MY3A 4FD6A 3UY5A 3EY5A 1S5KA 1UFHA 2KCWA 1QSMA 2GE3A 4KLVA 4L89A 1YVOA 2K5TA 1R57A 3ZJ0A 4MHDA 1P4NA 2O28A 5KTDA 1QSNA 2R8VA 2IL4A 2ZW5A 3EO4A 1TIQA 4I49A 5KTAA 1S7LA 4YRHA 1Z4RA 1M4DA 2I00A 1NSLA 5EC4A 2G0BA 3TCVA 1IYLA 4KORA 1CJWA 1YR0A 5HMNA 1IB1E 3TFYA 2OU2A 3QAHA 4E2AA 2Y0MA 4CRZB 2DXQA 4E0AA 3R96A 3H4QA 3DNSA 1ON0A 2D4OA 4LX9A 2P0WA 5H84A 3F5BA 3F8KA 1XIXA 4ORFA 4FD7A 4CS0B 4NEXA 2FT0A 3N7ZA 2REFA 1S7NA 3P2FA 2FCKA 4JWPA 3W91A 1OZPA 2PR1A 1J4JA 2B4DB 3DR8A 3EXNA 1XF8A 2B5GB 4JJXA 2FE7A 2FIAA 2ZW4A 5F46A 4OLLA 1Z4EA 3CXPA 4QBJA 2BL1A 1I12A 2EVNA 3GY9A 4U9ZA 5HH1A 2FXFA 4RI1A 2PDOA 5I0CA 2BEIA 2PRBA 4CAVA 4AB7A 5C88A 1V0CA 2B4DA 4MBUA 2B5GA 4J3GA 4Y49B 5F48A 4H6ZA 2G3AA 1BO4A 3T90A 1VHSA 3DR6A 2R98A 3TO9A 1KUYA 2B4BA 4B5PB 2QMLA 2HQYA 2FIWA 2JDDA 4H89A 2BUEA 2VQYA 4B5OA 4MJ8A 4QC6A 2P6GA 3TE4A 3R1KA 2ARHA 3FB3A 4AVCA 2VZYA 1M44A 4PK2A 1XEBA 5H86A 3JVNA 3GYAA 4NSQA 4OADA 4PSWA 5IB0A 1Y9WA 2D4PA 3FBUA 3E0KA 4HKFA 2AJ6A 2OZHA 1Q2DA 2PC1A 4JD6A 4U9YA 2BSWA 2GANA 4ONUA 2QIRA 1XE4A 3QB8A 2WPWA 2J8NA 4II9A 1MJAA 3D3SA 2OZUA 4OAEA 3S6GA 1QSRA 3MGDA 1BOBA 4DNCA 4FD4A 4IUSA 4QVTA 3DDDA 4MY0A 2PQ8A 2GIVA 1N71A 3S6HA 2Q7BA 2R7HA 1S7KA 4R57A 3D2MA 4R87A 4XPDC 4KVOE 5ISVA 2P6EA 2R1IA 3IGRA 3PP9A 2OB0A 2AE6A 4R3LA 4NXYA 1SQHA 3LD2A 4KUBA 2ATRA 3S6KA 3S6FA 4CAXA 2QECA 3FXTA 2VXKA 3VWDA 5EBVA 1IYKA 4KUAA 1KUVA 1VKCA 2REEA 4ZBGA 1RO5A 2Q4VA 1FY7A 2B58A 4CRYB 1Q2CA 2F5IA 4LUAA 4UBRA 1L0CA 4AVAA 5C82A 4XPKA 2Q44A 3PGPA 1NE9A 3G8WA 4XNHB 4KLWA 4R9MA 5DWNA 3NE7A 2FS5A 3TT2A 3VWEA 4PK3A 1M4GA 5J8FA 2Q04A 2RC4A 3LODA 4NCZA 3R9EA 4KVXA 1YREA 3FIXA 3RYOA 2Z0ZA 4H6UA 3R9GA 1QSOA 2NMTA 4JXQA 3FNCA 2ZW6A 4L8AA 3TO7A 4M85A 4BMHA 2J8RA 1CM0A 2VEZA 1YX0A 2I79A 2Q4YA 1S3ZA 2CY2A 4KVME 5DWMA 5CNPA 3TO6A 3T9YA 1KZFA 1M1DA 2OZGA 3SXNA 4PSXA 3SXOA 4AG7A 4KOVA 2B3VA 3C26A 3ZZIA 2ZPAA 3SHPA 5JQ4A 4Y49C 1WK4A 2VZZA 3EC4A 1I1DA 3EFAA 1K4JA 1Y9KA 3K9UA 2J8MA 4MI4A 1IICA 4QB9A 3BJ7A 5IV0A 1MJBA 3G3SA 1NMTA 4R3KA 1QSTA 1B87A 3KKWA 4RS2A 2ZXVA 4KOUA 4UWJA 5F49A 1WWZA 2EUIA 3TOBA 3I9SA 2CNMA
chains in the Genus database with same CATH superfamily
2FVGA 1I21A 1PUAA 3PZJA 4YFJA 3D7DA 2CF4A 4KOSA 2BCOA 2Z3OA 1KUXA 4MHZA 4OIDA 4MFLA 4NGTA 3H8GA 3B8GA 5FVJA 3FYNA 1ELLP 3R9FA 3KQZA 4F8ZA 4R6TA 1Z9UA 2Z3PA 3JRUA 1CPSA 4R8FA 4M3SA 4CAWA 4K3NA 1YVKA 3KHXA 4NJRA 2Z11A 4AG9A 2G3TA 2ZEEA 4GS4A 2OR4A 2V8VA 3P2HA 5E96A 5THWA 1ARMA 4KOXA 3W6XA 1B6BA 2C27A 4AVBA 3RBUA 4HNYB 3IWEA 3WR7A 4DJLA 2O4HA 2CIJA 3JUWA 3CPAA 1Y7RA 5LRJA 2JDCA 1IU8A 1QMUA 3CPXA 3B3CA 4FD5A 2H5MA 1EE3P 4P6YA 4WWVA 4CGMA 5A28A 3WC7A 4PV6A 4ZY0A 4KOTA 4QUSA 5AG7A 3TOAA 4GXHA 3CXSA 5G21A 1LRZA 2WYRA 5HVFA 2JLMA 3PB4X 4NGMA 3TC8A 3B3VA 4CGNA 5JGFA 2PJBA 2WPXA 4XPLA 4HNWB 1PU9A 1IY7A 2AFSA 1LCPA 2PJ8A 2VI7A 4NGRA 1XRYA 3F0AA 4LQ6A 5LRGA 4CPAA 2HV2A 1XMTA 2Z10A 5G20A 3DSBA 4NF1A 4P4FA 4JLYA 4F9UA 1U6MA 4UWIA 2PSWA 1P0HA 1Y0RA 1S7FA 3BLNA 2YNCC 1YGHA 2Z3KA 2V8DA 2ZENA 4KZTA 4NGNA 5HVGA 5KTCA 1MK4A 2DPSA 3QNVA 4JXRA 4MXUA 3W6SA 2B3UA 3QAYA 3RNZA 4UA3A 1LOKA 4CYPA 2VL1A 4IF5A 4EVYA 4UEZA 1RTQA 2PR8A 4MHYA 1GYTA 2F8HA 2I3CA 3RO0A 3BJ8A 4KOYA 4MHNA 4P4BA 4C2YA 4CYOA 3VH9A 2ZEGA 2CNSA 3K2KA 4ONWA 1ZO0A 1VHEA 2HUZA 2OH1A 2XEFA 4YGOA 3WABA 4BBHA 4FAIA 3CXQA 1ZG7A 3PB6X 3L2NA 4IHMA 4XNHC 2Q7SA 3D8PA 3V8IA 5J8CA 2G9DA 4HPSA 3TTHA 2JEVA 1S60A 4UCMA 2VBQA 3WC6A 4K30A 1YK3A 1FNOA 2EBJA 4U5YA 3FMCA 3PB9X 5CBMA 3VARA 2PJ6A 5F47A 2PVVA 2ZEHA 4HNXB 3TX8A 4EMEA 4A32A 2HC9A 1Q2YA 2CNTA 1GHEA 1TF8A 4KOWA 5D29A 4BD9A 2CTBA 1R3NA 1Z8TA 2P6FA 3IWGA 1XJOA 3PFOA 3PB8X 5I4MA 5JM6A 3GB0A 2X7BA 3FRMA 1IIDA 3OWCA 1ZG9A 2Z3NA 4E8OA 2XEGA 4MCQA 1JQGA 2Q0YA 4OC4A 1YLEA 4X5KA 5LYDA 3CZXA 1PCAA 3B2YA 1NSAA 4A33A 4F6AA 2A4NA 2PE3A 5GCNA 3S9LA 1M4IA 3I3GA 5JPHA 3FEEA 4KS9A 2FL4A 2GREA 3GKRA 4OC3A 1RXTA 3D66A 2FSRA 2V8GA 2ZEMA 2ZW7A 3D2PA 4NFRA 3R95A 5IX3A 3WT4A 3SJGA 4F0YA 2PJ5A 4PXDA 4OC1A 3B7IA 3N5FA 2JEWA 4XPDB 3S9NA 1MJ9A 2WUUA 1JWQA 4B5PA 1X10A 4MY3A 3CT9A 1VGYA 4FWUA 8CPAA 3SJFA 4FD6A 3UY5A 3EY5A 1ARLA 1S5KA 2JBKA 4MCPA 4UFXA 4ZY1A 3A9LA 6CPAA 1UFHA 4H2KA 2KCWA 1QSMA 2DEAA 4PPZA 2QJ8A 2GE3A 5CPAA 2GLFA 4KLVA 2GU2A 4L89A 1YVOA 4PXBA 2K5TA 3GLJA 3ISZA 1R57A 3ZJ0A 4MHDA 2J9AA 5HXDA 4KSFA 4MHPA 1P4NA 2O28A 5KTDA 4FBEA 2PJ2A 3VATA 1QSNA 2R8VA 1VIXA 2IL4A 2ZW5A 3EO4A 4P10A 1TIQA 1F57A 4I49A 5KTAA 1M4LA 1S7LA 2PIYA 4YRHA 3DLJA 1Z4RA 3FECA 1M4DA 4MFPA 2I00A 3B3SA 2GFQA 1NSLA 5EC4A 2G0BA 3TCVA 2AFXA 2PJ1A 1IYLA 4OMEA 3IO1A 1VHOA 3NH4A 3H8EA 3V38A 4KORA 3S9MA 4E2AA 1XFOA 2PRQA 2Q4ZA 1CJWA 3D7FA 1YSJA 4NGSA 4A37A 1YR0A 3D68A 4CGOA 1IB1E 5HMNA 1TKHA 2XEIA 3SI2A 4A2ZA 3TFYA 3D4UA 7CPAA 2OU2A 2AFWA 2PJ3A 4YU9A 4M6IA 1CP7A 3QAHA 3NH8A 1HDUA 2Y0MA 2CXAA 2DXQA 3FF3A 3FJUA 3FVLA 3PFEA 3PBBA 4CRZB 4E0AA 4EFDA 4F0XA 4TWEA 3R96A 3H4QA 3I1UA 4CAEA 2AFZA 1DE4C 3DNSA 3PRTA 5HVHA 4X2TA 1ON0A 2D4OA 4PQAA 5LYLA 2RB7A 3D67A 4LX9A 2P0WA 4B11A 3IJ3A 2C1CA 5H84A 3F5BA 3F8KA 2F7VA 1XIXA 5JH9A 4ORFA 4R7MA 2C6GA 2EK8A 3MRUA 4FD7A 3JTKA 4CS0B 4NEXA 2C6CA 2FT0A 2PJ0A 3N7ZA 4OC5A 2REFA 5DS0A 1S7NA 3P2FA 4R76A 3PBEA 1YLOA 3LWUA 2FCKA 3B3TA 4JWPA 3W91A 2BOAA 4B14A 3IIBA 1OZPA 1YMEA 4M6HA 2PR1A 1J4JA 5A27A 3H5ZA 1A2ZA 2B4DB 3DR8A 3EXNA 1XF8A 1YQEA 2B5GB 1LANA 4JJXA 2FE7A 4OP4A 2FIAA 2ZW4A 2OOTA 4OLLA 1Z4EA 2ODFA 5F46A 3CXPA 4QBJA 4ZX8A 2BL1A 1I12A 2EVNA 3GY9A 4U9ZA 5HH1A 4MFZA 2PJ7A 2FXFA 4RI1A 2PDOA 5I0CA 2BEIA 2PRBA 2WSAA 3DGVA 5K8MA 4UF4A 4LQGA 5F09A 1AUGA 2AFUA 3IFEA 4MMOA 4CAVA 4AB7A 3BI0A 5C88A 1V0CA 2B4DA 4MBUA 3SI1A 2AFMA 5AG4A 3IU1A 2B5GA 3SI0A 2V8HA 3SJXA 4B12A 4J3GA 3KHZA 4P44A 4Y49B 5F48A 4H6ZA 3RZAA 4YWYA 2G3AA 1BO4A 1TF9A 3T90A 1VHSA 5G1ZA 5K8PA 3DR6A 2R98A 3TO9A 4CGPA 4MFJA 1KUYA 2B4BA 4B5PB 3IWWA 3B35A 3T8WA 2PCUA 3D7HA 2QMLA 2HQYA 4P45A 2FIWA 3ISXA 2JDDA 4H89A 2BUEA 2VQYA 4B5OA 4MJ8A 1CX8A 4QC6A 4A94A 2P6GA 4Q7AA 3HLPA 4GM5A 3NA6A 4UIBA 3R1KA 3TE4A 2ARHA 3FB3A 3RAMA 3IEHA 4AVCA 2NSMA 2VZYA 5AG6A 2QVPA 1M44A 4PK2A 1XEBA 5H86A 3JVNA 3GYAA 4NSQA 4OADA 4PSWA 5IB0A 1LAMA 1Y9WA 2D4PA 3FBUA 3E0KA 4HKFA 2AFOA 2AJ6A 2OZHA 1Q2DA 1KWMA 2PC1A 4JD6A 4RUHA 4U9YA 1AMPA 3KASA 2BSWA 2GANA 2CTCA 2PIZA 4ONUA 4Q36A 4KSIA 2QIRA 1XE4A 5LRKA 1F2PA 3QB8A 4OC0A 3BI1A 1QQ9A 2WPWA 1Z8XA 2J8NA 4II9A 2RFHA 1MJAA 4UCNA 3D3SA 2OZUA 4OAEA 4OKOA 3S6GA 1QSRA 4JZ0A 3MGDA 4UEFA 1BOBA 1X12A 4DNCA 4FD4A 4IUSA 4B10A 4QVTA 3FEDA 5J1QA 3DDDA 1Z8WA 4MY0A 2ZEOA 4UFWA 5AGEA 1CPXA 2PQ8A 2GIVA 1N71A 4G1PA 1Q7LA 3S6HA 4CAFA 2Q7BA 5IB9A 2R7HA 1S7KA 2ZEPA 1Z5RA 3BHXA 4F9VA 4R57A 3D2MA 4IAVA 4R87A 4XPDC 3MN8A 4KVOE 4DUKA 5D8NA 5ISVA 3KZWA 2P6EA 4X8IA 4MRIA 2NYQA 3LMSA 2R1IA 4A95A 2Q51A 1AYEA 3HUVA 4WJBA 3NE8A 3IGRA 3PP9A 2OB0A 2AE6A 5BWAB 1UWYA 3FH4A 1BPMA 4A30A 4R3LA 4B6ZA 1TKFA 5G22A 4NXYA 4NGQA 1SQHA 3LD2A 4KUBA 2ATRA 3S6KA 4DYOA 1Z8LA 3S6FA 4CAXA 3LACA 2QECA 3FXTA 4Z65A 2JBJA 2VXKA 2BO9A 3VWDA 1CG2A 4C2XA 2ZEDA 5EBVA 1IYKA 4PXEA 4UCPA 4KUAA 1HDQA 1IOIA 1KUVA 1VKCA 3IC1A 2REEA 4MCRA 4ZBGA 1RO5A 2GLJA 4O23A 2IQ6A 4P4DA 2Q4VA 4BINA 2YGWA 1FY7A 3PB7X 4ZGYB 1YW6A 4C2ZA 2B58A 1F2OA 2PVWA 5K8NA 4CRYB 4C7IA 1Q2CA 2F5IA 4LUAA 4UBRA 1H8LA 1L0CA 5AG5A 4AVAA 5C82A 2Q43A 1ELMP 3PEIA 4XPKA 2Q44A 3BXMA 1BPNA 3PGPA 2PJCA 1HEEA 3KQXA 1NE9A 3G8WA 1FT7A 2EO8A 4XNHB 4CYQA 4KLWA 4R9MA 5DWNA 1XMBA 2YNCA 4A38A 3NE7A 1Y7EA 2FS5A 1Z2LA 3TT2A 3VWEA 5K8OA 4PK3A 4A31A 1M4GA 5J8FA 4EWTA 3KR5A 4P4IA 2Q04A 1ZLIA 2RC4A 2Z3MA 3LODA 4MFKA 4NCZA 3R9EA 3V7ZA 2ZELA 4KVXA 3SJEA 1OBRA 1YREA 2YNEA 3FIXA 5LYFA 3RYOA 2Z0ZA 2DPTA 4CGLA 4H6UA 3R9GA 4NJQA 4MCSA 1IGBA 1QSOA 3NH5A 1PYTB 2NMTA 1YW4A 4JXQA 3FNCA 5ELYA 2ZW6A 3D7GA 4A39A 3B3WA 1CP6A 3KL9A 4L8AA 4M85A 4PXCA 3TO7A 1XOVA 2ZOFA 1Y0YA 1TKJA 2J8RA 4BMHA 1CM0A 2VEZA 1YX0A 2I79A 2YNDA 4W9YA 2POKA 2Q4YA 1S3ZA 2EK9A 2V77A 2ABZA 2CY2A 2Z3LA 4KVME 4M6GA 5DWMA 5CNPA 3TO6A 4IK2A 3T9YA 1KZFA 1TXRA 4KSAA 1M1DA 4UEEA 4C68A 2OZGA 4JYWA 4ZX9A 2PJAA 3SXNA 4PSXA 4MFQA 3SXOA 3WC5A 1DTDA 4Q38A 1XBUA 4AG7A 4KOVA 3GUXA 2B3VA 2ZEFA 3C26A 4ZY2A 3ZZIA 4P4EA 4NGPA 1ZLHA 3KGQA 2ZPAA 3SHPA 1BLLE 4FUUA 3IU2A 5JQ4A 2C6PA 4CYNA 4TNUA 1IOFA 4Y49C 1WK4A 1LFWA 2VZZA 1I1DA 3EC4A 2IJZA 3H8FA 4OC2A 4B13A 3EFAA 1K4JA 1Y9KA 3K9UA 2IMOA 3CDXA 2ANPA 2J8MA 2XEJA 3K9TA 4MI4A 1IICA 4QB9A 3BJ7A 4OIWA 1ZG8A 3KI9A 2DF5A 5LYIA 5IV0A 1BAVA 1MJBA 2PJ9A 1NMTA 3G3SA 3KR4A 4X3RA 4C7HA 2HB6A 2EWBA 4RN7A 4R3KA 1QSTA 4AXVA 1B87A 2QYVA 1R43A 1LAPA 3KKWA 3NFZA 4RS2A 4ZI6A 2ZXVA 4KOUA 2PJ4A 4UWJA 5F49A 1WWZA 2EUIA 1CBXA 4P4JA 4UFVA 3FX6A 3TOBA 3I9SA 5EMIA 4UIAA 4ZYQA 3GIUA 2CNMA 2ZOGA 2WZNA 2O53A
chains in the Genus database with same CATH topology
1I21A 1PUAA 3PZJA 4YFJA 4KOSA 2Z3OA 1KUXA 4MFLA 3B8GA 5FVJA 3FYNA 3R9FA 1Z9UA 2Z3PA 4M3SA 4CAWA 1YVKA 2Z11A 4AG9A 2G3TA 4GS4A 5E96A 3P2HA 3W6XA 4KOXA 1B6BA 2C27A 4AVBA 4HNYB 3IWEA 3WR7A 3JUWA 1Y7RA 2JDCA 4FD5A 2H5MA 4CGMA 5A28A 4PV6A 4KOTA 4QUSA 5AG7A 3TOAA 3CXSA 5G21A 1LRZA 2JLMA 4CGNA 2WPXA 4XPLA 4HNWB 1PU9A 2VI7A 3F0AA 2HV2A 1XMTA 2Z10A 5G20A 3DSBA 4NF1A 4JLYA 1U6MA 4UWIA 2PSWA 1P0HA 1S7FA 3BLNA 2YNCC 1YGHA 2Z3KA 4KZTA 5KTCA 1MK4A 2DPSA 4JXRA 3W6SA 2B3UA 4UA3A 4CYPA 4IF5A 4EVYA 2PR8A 3BJ8A 4KOYA 4CYOA 4C2YA 2CNSA 1ZO0A 2HUZA 4YGOA 2OH1A 4BBHA 3CXQA 4XNHC 3V8IA 5J8CA 3D8PA 3TTHA 2JEVA 1S60A 4UCMA 2VBQA 4K30A 1YK3A 4U5YA 5F47A 4HNXB 4A32A 1Q2YA 1GHEA 2CNTA 4KOWA 2P6FA 3IWGA 2X7BA 3FRMA 1IIDA 3OWCA 4E8OA 2Z3NA 2Q0YA 1YLEA 4X5KA 4F6AA 4A33A 2A4NA 5GCNA 1M4IA 3I3GA 5JPHA 4KS9A 2FL4A 3GKRA 1RXTA 2FSRA 3D2PA 3R95A 2ZW7A 5IX3A 4F0YA 4XPDB 1MJ9A 2WUUA 4B5PA 4MY3A 4FD6A 3UY5A 3EY5A 1S5KA 4UFXA 3A9LA 1UFHA 2KCWA 1QSMA 2GE3A 4KLVA 4L89A 1YVOA 2K5TA 1R57A 3ZJ0A 4MHDA 4KSFA 1P4NA 2O28A 5KTDA 1QSNA 2R8VA 2IL4A 2ZW5A 3EO4A 1TIQA 4I49A 5KTAA 1S7LA 4YRHA 1Z4RA 1M4DA 4MFPA 2I00A 1NSLA 5EC4A 2G0BA 3TCVA 1IYLA 4KORA 1CJWA 1YR0A 4CGOA 5HMNA 1IB1E 3TFYA 4A2ZA 2OU2A 3QAHA 4E2AA 2Y0MA 2CXAA 2DXQA 4CRZB 4E0AA 4F0XA 3R96A 3H4QA 4CAEA 3DNSA 1ON0A 2D4OA 4LX9A 2P0WA 4B11A 5H84A 3F5BA 3F8KA 1XIXA 4ORFA 4FD7A 3JTKA 4CS0B 4NEXA 2FT0A 3N7ZA 2REFA 1S7NA 3P2FA 2FCKA 4JWPA 3W91A 4B14A 1OZPA 2PR1A 1J4JA 5A27A 3H5ZA 2B4DB 3DR8A 3EXNA 1XF8A 2B5GB 4JJXA 2FE7A 2FIAA 2ZW4A 5F46A 4OLLA 1Z4EA 3CXPA 4QBJA 2BL1A 1I12A 2EVNA 3GY9A 4U9ZA 5HH1A 4MFZA 2FXFA 4RI1A 2PDOA 5I0CA 2BEIA 2PRBA 2WSAA 4CAVA 4AB7A 5C88A 1V0CA 2B4DA 4MBUA 5AG4A 3IU1A 2B5GA 4B12A 4J3GA 4Y49B 5F48A 4H6ZA 2G3AA 1BO4A 3T90A 1VHSA 5G1ZA 3DR6A 2R98A 3TO9A 4CGPA 4MFJA 1KUYA 2B4BA 4B5PB 2QMLA 2HQYA 2FIWA 2JDDA 4H89A 2BUEA 2VQYA 4B5OA 4MJ8A 4QC6A 2P6GA 3TE4A 3R1KA 2ARHA 3FB3A 4AVCA 2VZYA 5AG6A 1M44A 4PK2A 1XEBA 5H86A 3JVNA 3GYAA 4NSQA 4OADA 4PSWA 5IB0A 1Y9WA 2D4PA 3FBUA 3E0KA 4HKFA 2AJ6A 2OZHA 1Q2DA 2PC1A 4JD6A 4U9YA 2BSWA 2GANA 4ONUA 4Q36A 2QIRA 1XE4A 3QB8A 2WPWA 2J8NA 4II9A 1MJAA 4UCNA 3D3SA 2OZUA 4OAEA 3S6GA 1QSRA 3MGDA 1BOBA 4DNCA 4FD4A 4IUSA 4B10A 4QVTA 3DDDA 4MY0A 4UFWA 5AGEA 2PQ8A 2GIVA 1N71A 4CAFA 3S6HA 2Q7BA 2R7HA 1S7KA 4R57A 3D2MA 4R87A 4XPDC 4KVOE 5ISVA 2P6EA 2R1IA 4A95A 3IGRA 3PP9A 2OB0A 2AE6A 5BWAB 4A30A 4R3LA 5G22A 4NXYA 1SQHA 3LD2A 4KUBA 2ATRA 3S6KA 3S6FA 4CAXA 2QECA 3FXTA 2VXKA 3VWDA 4C2XA 5EBVA 1IYKA 4UCPA 4KUAA 1KUVA 1VKCA 2REEA 4ZBGA 1RO5A 2Q4VA 2YGWA 1FY7A 4ZGYB 4C2ZA 2B58A 4CRYB 4C7IA 1Q2CA 2F5IA 4LUAA 4UBRA 1L0CA 5AG5A 4AVAA 5C82A 4XPKA 2Q44A 3PGPA 1NE9A 3G8WA 4CYQA 4XNHB 4KLWA 4R9MA 5DWNA 2YNCA 3NE7A 2FS5A 3TT2A 3VWEA 4PK3A 4A31A 1M4GA 5J8FA 2Q04A 2RC4A 2Z3MA 3LODA 4MFKA 4NCZA 3R9EA 4KVXA 1YREA 2YNEA 3FIXA 3RYOA 2Z0ZA 2DPTA 4CGLA 4H6UA 3R9GA 1QSOA 2NMTA 4JXQA 3FNCA 2ZW6A 4L8AA 3TO7A 4M85A 4BMHA 2J8RA 1CM0A 2VEZA 1YX0A 2I79A 2YNDA 2Q4YA 1S3ZA 2CY2A 2Z3LA 4KVME 5DWMA 5CNPA 3TO6A 3T9YA 1KZFA 4KSAA 4C68A 1M1DA 2OZGA 3SXNA 4PSXA 4MFQA 3SXOA 4Q38A 4AG7A 4KOVA 2B3VA 3C26A 3ZZIA 2ZPAA 3SHPA 3IU2A 5JQ4A 4CYNA 4Y49C 1WK4A 2VZZA 3EC4A 1I1DA 4B13A 3EFAA 1K4JA 1Y9KA 3K9UA 2J8MA 4MI4A 1IICA 4QB9A 3BJ7A 5IV0A 1MJBA 3G3SA 1NMTA 4C7HA 4R3KA 1QSTA 1B87A 3KKWA 4RS2A 2ZXVA 4KOUA 4UWJA 5F49A 1WWZA 2EUIA 4UFVA 3TOBA 3I9SA 2CNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I21 A;  1PUA A;  3PZJ A;  4YFJ A;  4KOS A;  1KUX A;  3B8G A;  5FVJ A;  3FYN A;  3R9F A;  1Z9U A;  4M3S A;  4CAW A;  1YVK A;  2Z11 A;  4AG9 A;  2G3T A;  4GS4 A;  5E96 A;  3P2H A;  3W6X A;  4KOX A;  1B6B A;  2C27 A;  4AVB A;  4HNY B;  3WR7 A;  3JUW A;  1Y7R A;  2JDC A;  4FD5 A;  2H5M A;  4PV6 A;  4KOT A;  4QUS A;  3TOA A;  3CXS A;  1LRZ A;  2JLM A;  2WPX A;  4XPL A;  4HNW B;  1PU9 A;  2VI7 A;  3F0A A;  2HV2 A;  1XMT A;  2Z10 A;  3DSB A;  4NF1 A;  4JLY A;  1U6M A;  4UWI A;  2PSW A;  1P0H A;  1S7F A;  3BLN A;  1YGH A;  4KZT A;  5KTC A;  1MK4 A;  4JXR A;  3W6S A;  2B3U A;  4UA3 A;  4IF5 A;  4EVY A;  2PR8 A;  3BJ8 A;  4KOY A;  2CNS A;  2HUZ A;  4YGO A;  2OH1 A;  3CXQ A;  4XNH C;  3V8I A;  5J8C A;  3D8P A;  3TTH A;  2JEV A;  1S60 A;  2VBQ A;  4K30 A;  1YK3 A;  4U5Y A;  5F47 A;  4HNX B;  1Q2Y A;  1GHE A;  2CNT A;  4KOW A;  2P6F A;  3IWG A;  2X7B A;  3FRM A;  1IID A;  3OWC A;  4E8O A;  2Q0Y A;  1YLE A;  4X5K A;  4F6A A;  2A4N A;  5GCN A;  1M4I A;  3I3G A;  5JPH A;  2FL4 A;  3GKR A;  1RXT A;  2FSR A;  3D2P A;  3R95 A;  2ZW7 A;  5IX3 A;  4F0Y A;  4XPD B;  1MJ9 A;  4B5P A;  4MY3 A;  4FD6 A;  3UY5 A;  3EY5 A;  1S5K A;  1UFH A;  2KCW A;  1QSM A;  2GE3 A;  4KLV A;  4L89 A;  1YVO A;  2K5T A;  1R57 A;  3ZJ0 A;  4MHD A;  1P4N A;  2O28 A;  5KTD A;  1QSN A;  2R8V A;  2IL4 A;  2ZW5 A;  3EO4 A;  1TIQ A;  4I49 A;  5KTA A;  1S7L A;  4YRH A;  1Z4R A;  1M4D A;  2I00 A;  1NSL A;  5EC4 A;  2G0B A;  3TCV A;  1IYL A;  4KOR A;  1CJW A;  1YR0 A;  5HMN A;  1IB1 E;  3TFY A;  2OU2 A;  3QAH A;  4E2A A;  2Y0M A;  4CRZ B;  2DXQ A;  4E0A A;  3R96 A;  3H4Q A;  3DNS A;  1ON0 A;  2D4O A;  4LX9 A;  2P0W A;  5H84 A;  3F5B A;  3F8K A;  1XIX A;  4ORF A;  4FD7 A;  4CS0 B;  4NEX A;  2FT0 A;  3N7Z A;  2REF A;  1S7N A;  3P2F A;  2FCK A;  4JWP A;  3W91 A;  1OZP A;  2PR1 A;  1J4J A;  2B4D B;  3DR8 A;  3EXN A;  1XF8 A;  2B5G B;  4JJX A;  2FE7 A;  2FIA A;  2ZW4 A;  5F46 A;  4OLL A;  1Z4E A;  3CXP A;  4QBJ A;  2BL1 A;  1I12 A;  2EVN A;  3GY9 A;  4U9Z A;  5HH1 A;  2FXF A;  4RI1 A;  2PDO A;  5I0C A;  2BEI A;  2PRB A;  4CAV A;  4AB7 A;  5C88 A;  1V0C A;  2B4D A;  4MBU A;  2B5G A;  4J3G A;  4Y49 B;  5F48 A;  4H6Z A;  2G3A A;  1BO4 A;  3T90 A;  1VHS A;  3DR6 A;  2R98 A;  3TO9 A;  1KUY A;  2B4B A;  4B5P B;  2QML A;  2HQY A;  2FIW A;  2JDD A;  4H89 A;  2BUE A;  2VQY A;  4B5O A;  4MJ8 A;  4QC6 A;  2P6G A;  3TE4 A;  3R1K A;  2ARH A;  3FB3 A;  4AVC A;  2VZY A;  1M44 A;  4PK2 A;  1XEB A;  5H86 A;  3JVN A;  3GYA A;  4NSQ A;  4OAD A;  4PSW A;  5IB0 A;  1Y9W A;  2D4P A;  3FBU A;  3E0K A;  4HKF A;  2AJ6 A;  2OZH A;  1Q2D A;  2PC1 A;  4JD6 A;  4U9Y A;  2BSW A;  2GAN A;  4ONU A;  2QIR A;  1XE4 A;  3QB8 A;  2WPW A;  2J8N A;  4II9 A;  1MJA A;  3D3S A;  2OZU A;  4OAE A;  3S6G A;  1QSR A;  3MGD A;  1BOB A;  4DNC A;  4FD4 A;  4IUS A;  4QVT A;  3DDD A;  4MY0 A;  2PQ8 A;  2GIV A;  1N71 A;  3S6H A;  2Q7B A;  2R7H A;  1S7K A;  4R57 A;  3D2M A;  4R87 A;  4XPD C;  4KVO E;  5ISV A;  2P6E A;  2R1I A;  3IGR A;  3PP9 A;  2OB0 A;  2AE6 A;  4R3L A;  4NXY A;  1SQH A;  3LD2 A;  4KUB A;  2ATR A;  3S6K A;  3S6F A;  4CAX A;  2QEC A;  3FXT A;  2VXK A;  3VWD A;  5EBV A;  1IYK A;  4KUA A;  1KUV A;  1VKC A;  2REE A;  4ZBG A;  1RO5 A;  2Q4V A;  1FY7 A;  2B58 A;  4CRY B;  1Q2C A;  2F5I A;  4LUA A;  4UBR A;  1L0C A;  4AVA A;  5C82 A;  4XPK A;  2Q44 A;  3PGP A;  1NE9 A;  3G8W A;  4XNH B;  4KLW A;  4R9M A;  5DWN A;  3NE7 A;  2FS5 A;  3TT2 A;  3VWE A;  4PK3 A;  1M4G A;  5J8F A;  2Q04 A;  2RC4 A;  3LOD A;  4NCZ A;  3R9E A;  4KVX A;  1YRE A;  3FIX A;  3RYO A;  2Z0Z A;  4H6U A;  3R9G A;  1QSO A;  2NMT A;  4JXQ A;  3FNC A;  2ZW6 A;  4L8A A;  3TO7 A;  4M85 A;  4BMH A;  2J8R A;  1CM0 A;  2VEZ A;  1YX0 A;  2I79 A;  2Q4Y A;  1S3Z A;  2CY2 A;  4KVM E;  5DWM A;  5CNP A;  3TO6 A;  3T9Y A;  1KZF A;  1M1D A;  2OZG A;  3SXN A;  4PSX A;  3SXO A;  4AG7 A;  4KOV A;  2B3V A;  3C26 A;  3ZZI A;  2ZPA A;  3SHP A;  5JQ4 A;  4Y49 C;  1WK4 A;  2VZZ A;  3EC4 A;  1I1D A;  3EFA A;  1K4J A;  1Y9K A;  3K9U A;  2J8M A;  4MI4 A;  1IIC A;  4QB9 A;  3BJ7 A;  5IV0 A;  1MJB A;  3G3S A;  1NMT A;  4R3K A;  1QST A;  1B87 A;  3KKW A;  4RS2 A;  2ZXV A;  4KOU A;  4UWJ A;  5F49 A;  1WWZ A;  2EUI A;  3TOB A;  3I9S A;  2CNM A; 
#chains in the Genus database with same CATH topology
 2FVG A;  1I21 A;  1PUA A;  3PZJ A;  4YFJ A;  3D7D A;  2CF4 A;  4KOS A;  2BCO A;  2Z3O A;  1KUX A;  4MHZ A;  4OID A;  4MFL A;  4NGT A;  3H8G A;  3B8G A;  5FVJ A;  3FYN A;  1ELL P;  3R9F A;  3KQZ A;  4F8Z A;  4R6T A;  1Z9U A;  2Z3P A;  3JRU A;  1CPS A;  4R8F A;  4M3S A;  4CAW A;  4K3N A;  1YVK A;  3KHX A;  4NJR A;  2Z11 A;  4AG9 A;  2G3T A;  2ZEE A;  4GS4 A;  2OR4 A;  2V8V A;  3P2H A;  5E96 A;  5THW A;  1ARM A;  4KOX A;  3W6X A;  1B6B A;  2C27 A;  4AVB A;  3RBU A;  4HNY B;  3IWE A;  3WR7 A;  4DJL A;  2O4H A;  2CIJ A;  3JUW A;  3CPA A;  1Y7R A;  5LRJ A;  2JDC A;  1IU8 A;  1QMU A;  3CPX A;  3B3C A;  4FD5 A;  2H5M A;  1EE3 P;  4P6Y A;  4WWV A;  4CGM A;  5A28 A;  3WC7 A;  4PV6 A;  4ZY0 A;  4KOT A;  4QUS A;  5AG7 A;  3TOA A;  4GXH A;  3CXS A;  5G21 A;  1LRZ A;  2WYR A;  5HVF A;  2JLM A;  3PB4 X;  4NGM A;  3TC8 A;  3B3V A;  4CGN A;  5JGF A;  2PJB A;  2WPX A;  4XPL A;  4HNW B;  1PU9 A;  1IY7 A;  2AFS A;  1LCP A;  2PJ8 A;  2VI7 A;  4NGR A;  1XRY A;  3F0A A;  4LQ6 A;  5LRG A;  4CPA A;  2HV2 A;  1XMT A;  2Z10 A;  5G20 A;  3DSB A;  4NF1 A;  4P4F A;  4JLY A;  4F9U A;  1U6M A;  4UWI A;  2PSW A;  1P0H A;  1Y0R A;  1S7F A;  3BLN A;  2YNC C;  1YGH A;  2Z3K A;  2V8D A;  2ZEN A;  4KZT A;  4NGN A;  5HVG A;  5KTC A;  1MK4 A;  2DPS A;  3QNV A;  4JXR A;  4MXU A;  3W6S A;  2B3U A;  3QAY A;  3RNZ A;  4UA3 A;  1LOK A;  4CYP A;  2VL1 A;  4IF5 A;  4EVY A;  4UEZ A;  1RTQ A;  2PR8 A;  4MHY A;  1GYT A;  2F8H A;  2I3C A;  3RO0 A;  3BJ8 A;  4KOY A;  4MHN A;  4P4B A;  4C2Y A;  4CYO A;  3VH9 A;  2ZEG A;  2CNS A;  3K2K A;  4ONW A;  1ZO0 A;  1VHE A;  2HUZ A;  2OH1 A;  2XEF A;  4YGO A;  3WAB A;  4BBH A;  4FAI A;  3CXQ A;  1ZG7 A;  3PB6 X;  3L2N A;  4IHM A;  4XNH C;  2Q7S A;  3D8P A;  3V8I A;  5J8C A;  2G9D A;  4HPS A;  3TTH A;  2JEV A;  1S60 A;  4UCM A;  2VBQ A;  3WC6 A;  4K30 A;  1YK3 A;  1FNO A;  2EBJ A;  4U5Y A;  3FMC A;  3PB9 X;  5CBM A;  3VAR A;  2PJ6 A;  5F47 A;  2PVV A;  2ZEH A;  4HNX B;  3TX8 A;  4EME A;  4A32 A;  2HC9 A;  1Q2Y A;  2CNT A;  1GHE A;  1TF8 A;  4KOW A;  5D29 A;  4BD9 A;  2CTB A;  1R3N A;  1Z8T A;  2P6F A;  3IWG A;  1XJO A;  3PFO A;  3PB8 X;  5I4M A;  5JM6 A;  3GB0 A;  2X7B A;  3FRM A;  1IID A;  3OWC A;  1ZG9 A;  2Z3N A;  4E8O A;  2XEG A;  4MCQ A;  1JQG A;  2Q0Y A;  4OC4 A;  1YLE A;  4X5K A;  5LYD A;  3CZX A;  1PCA A;  3B2Y A;  1NSA A;  4A33 A;  4F6A A;  2A4N A;  2PE3 A;  5GCN A;  3S9L A;  1M4I A;  3I3G A;  5JPH A;  3FEE A;  4KS9 A;  2FL4 A;  2GRE A;  3GKR A;  4OC3 A;  1RXT A;  3D66 A;  2FSR A;  2V8G A;  2ZEM A;  2ZW7 A;  3D2P A;  4NFR A;  3R95 A;  5IX3 A;  3WT4 A;  3SJG A;  4F0Y A;  2PJ5 A;  4PXD A;  4OC1 A;  3B7I A;  3N5F A;  2JEW A;  4XPD B;  3S9N A;  1MJ9 A;  2WUU A;  1JWQ A;  4B5P A;  1X10 A;  4MY3 A;  3CT9 A;  1VGY A;  4FWU A;  8CPA A;  3SJF A;  4FD6 A;  3UY5 A;  3EY5 A;  1ARL A;  1S5K A;  2JBK A;  4MCP A;  4UFX A;  4ZY1 A;  3A9L A;  6CPA A;  1UFH A;  4H2K A;  2KCW A;  1QSM A;  2DEA A;  4PPZ A;  2QJ8 A;  2GE3 A;  5CPA A;  2GLF A;  4KLV A;  2GU2 A;  4L89 A;  1YVO A;  4PXB A;  2K5T A;  3GLJ A;  3ISZ A;  1R57 A;  3ZJ0 A;  4MHD A;  2J9A A;  5HXD A;  4KSF A;  4MHP A;  1P4N A;  2O28 A;  5KTD A;  4FBE A;  2PJ2 A;  3VAT A;  1QSN A;  2R8V A;  1VIX A;  2IL4 A;  2ZW5 A;  3EO4 A;  4P10 A;  1TIQ A;  1F57 A;  4I49 A;  5KTA A;  1M4L A;  1S7L A;  2PIY A;  4YRH A;  3DLJ A;  1Z4R A;  3FEC A;  1M4D A;  4MFP A;  2I00 A;  3B3S A;  2GFQ A;  1NSL A;  5EC4 A;  2G0B A;  3TCV A;  2AFX A;  2PJ1 A;  1IYL A;  4OME A;  3IO1 A;  1VHO A;  3NH4 A;  3H8E A;  3V38 A;  4KOR A;  3S9M A;  4E2A A;  1XFO A;  2PRQ A;  2Q4Z A;  1CJW A;  3D7F A;  1YSJ A;  4NGS A;  4A37 A;  1YR0 A;  3D68 A;  4CGO A;  1IB1 E;  5HMN A;  1TKH A;  2XEI A;  3SI2 A;  4A2Z A;  3TFY A;  3D4U A;  7CPA A;  2OU2 A;  2AFW A;  2PJ3 A;  4YU9 A;  4M6I A;  1CP7 A;  3QAH A;  3NH8 A;  1HDU A;  2Y0M A;  2CXA A;  2DXQ A;  3FF3 A;  3FJU A;  3FVL A;  3PFE A;  3PBB A;  4CRZ B;  4E0A A;  4EFD A;  4F0X A;  4TWE A;  3R96 A;  3H4Q A;  3I1U A;  4CAE A;  2AFZ A;  1DE4 C;  3DNS A;  3PRT A;  5HVH A;  4X2T A;  1ON0 A;  2D4O A;  4PQA A;  5LYL A;  2RB7 A;  3D67 A;  4LX9 A;  2P0W A;  4B11 A;  3IJ3 A;  2C1C A;  5H84 A;  3F5B A;  3F8K A;  2F7V A;  1XIX A;  5JH9 A;  4ORF A;  4R7M A;  2C6G A;  2EK8 A;  3MRU A;  4FD7 A;  3JTK A;  4CS0 B;  4NEX A;  2C6C A;  2FT0 A;  2PJ0 A;  3N7Z A;  4OC5 A;  2REF A;  5DS0 A;  1S7N A;  3P2F A;  4R76 A;  3PBE A;  1YLO A;  3LWU A;  2FCK A;  3B3T A;  4JWP A;  3W91 A;  2BOA A;  4B14 A;  3IIB A;  1OZP A;  1YME A;  4M6H A;  2PR1 A;  1J4J A;  5A27 A;  3H5Z A;  1A2Z A;  2B4D B;  3DR8 A;  3EXN A;  1XF8 A;  1YQE A;  2B5G B;  1LAN A;  4JJX A;  2FE7 A;  4OP4 A;  2FIA A;  2ZW4 A;  2OOT A;  4OLL A;  1Z4E A;  2ODF A;  5F46 A;  3CXP A;  4QBJ A;  4ZX8 A;  2BL1 A;  1I12 A;  2EVN A;  3GY9 A;  4U9Z A;  5HH1 A;  4MFZ A;  2PJ7 A;  2FXF A;  4RI1 A;  2PDO A;  5I0C A;  2BEI A;  2PRB A;  2WSA A;  3DGV A;  5K8M A;  4UF4 A;  4LQG A;  5F09 A;  1AUG A;  2AFU A;  3IFE A;  4MMO A;  4CAV A;  4AB7 A;  3BI0 A;  5C88 A;  1V0C A;  2B4D A;  4MBU A;  3SI1 A;  2AFM A;  5AG4 A;  3IU1 A;  2B5G A;  3SI0 A;  2V8H A;  3SJX A;  4B12 A;  4J3G A;  3KHZ A;  4P44 A;  4Y49 B;  5F48 A;  4H6Z A;  3RZA A;  4YWY A;  2G3A A;  1BO4 A;  1TF9 A;  3T90 A;  1VHS A;  5G1Z A;  5K8P A;  3DR6 A;  2R98 A;  3TO9 A;  4CGP A;  4MFJ A;  1KUY A;  2B4B A;  4B5P B;  3IWW A;  3B35 A;  3T8W A;  2PCU A;  3D7H A;  2QML A;  2HQY A;  4P45 A;  2FIW A;  3ISX A;  2JDD A;  4H89 A;  2BUE A;  2VQY A;  4B5O A;  4MJ8 A;  1CX8 A;  4QC6 A;  4A94 A;  2P6G A;  4Q7A A;  3HLP A;  4GM5 A;  3NA6 A;  4UIB A;  3R1K A;  3TE4 A;  2ARH A;  3FB3 A;  3RAM A;  3IEH A;  4AVC A;  2NSM A;  2VZY A;  5AG6 A;  2QVP A;  1M44 A;  4PK2 A;  1XEB A;  5H86 A;  3JVN A;  3GYA A;  4NSQ A;  4OAD A;  4PSW A;  5IB0 A;  1LAM A;  1Y9W A;  2D4P A;  3FBU A;  3E0K A;  4HKF A;  2AFO A;  2AJ6 A;  2OZH A;  1Q2D A;  1KWM A;  2PC1 A;  4JD6 A;  4RUH A;  4U9Y A;  1AMP A;  3KAS A;  2BSW A;  2GAN A;  2CTC A;  2PIZ A;  4ONU A;  4Q36 A;  4KSI A;  2QIR A;  1XE4 A;  5LRK A;  1F2P A;  3QB8 A;  4OC0 A;  3BI1 A;  1QQ9 A;  2WPW A;  1Z8X A;  2J8N A;  4II9 A;  2RFH A;  1MJA A;  4UCN A;  3D3S A;  2OZU A;  4OAE A;  4OKO A;  3S6G A;  1QSR A;  4JZ0 A;  3MGD A;  4UEF A;  1BOB A;  1X12 A;  4DNC A;  4FD4 A;  4IUS A;  4B10 A;  4QVT A;  3FED A;  5J1Q A;  3DDD A;  1Z8W A;  4MY0 A;  2ZEO A;  4UFW A;  5AGE A;  1CPX A;  2PQ8 A;  2GIV A;  1N71 A;  4G1P A;  1Q7L A;  3S6H A;  4CAF A;  2Q7B A;  5IB9 A;  2R7H A;  1S7K A;  2ZEP A;  1Z5R A;  3BHX A;  4F9V A;  4R57 A;  3D2M A;  4IAV A;  4R87 A;  4XPD C;  3MN8 A;  4KVO E;  4DUK A;  5D8N A;  5ISV A;  3KZW A;  2P6E A;  4X8I A;  4MRI A;  2NYQ A;  3LMS A;  2R1I A;  4A95 A;  2Q51 A;  1AYE A;  3HUV A;  4WJB A;  3NE8 A;  3IGR A;  3PP9 A;  2OB0 A;  2AE6 A;  5BWA B;  1UWY A;  3FH4 A;  1BPM A;  4A30 A;  4R3L A;  4B6Z A;  1TKF A;  5G22 A;  4NXY A;  4NGQ A;  1SQH A;  3LD2 A;  4KUB A;  2ATR A;  3S6K A;  4DYO A;  1Z8L A;  3S6F A;  4CAX A;  3LAC A;  2QEC A;  3FXT A;  4Z65 A;  2JBJ A;  2VXK A;  2BO9 A;  3VWD A;  1CG2 A;  4C2X A;  2ZED A;  5EBV A;  1IYK A;  4PXE A;  4UCP A;  4KUA A;  1HDQ A;  1IOI A;  1KUV A;  1VKC A;  3IC1 A;  2REE A;  4MCR A;  4ZBG A;  1RO5 A;  2GLJ A;  4O23 A;  2IQ6 A;  4P4D A;  2Q4V A;  4BIN A;  2YGW A;  1FY7 A;  3PB7 X;  4ZGY B;  1YW6 A;  4C2Z A;  2B58 A;  1F2O A;  2PVW A;  5K8N A;  4CRY B;  4C7I A;  1Q2C A;  2F5I A;  4LUA A;  4UBR A;  1H8L A;  1L0C A;  5AG5 A;  4AVA A;  5C82 A;  2Q43 A;  1ELM P;  3PEI A;  4XPK A;  2Q44 A;  3BXM A;  1BPN A;  3PGP A;  2PJC A;  1HEE A;  3KQX A;  1NE9 A;  3G8W A;  1FT7 A;  2EO8 A;  4XNH B;  4CYQ A;  4KLW A;  4R9M A;  5DWN A;  1XMB A;  2YNC A;  4A38 A;  3NE7 A;  1Y7E A;  2FS5 A;  1Z2L A;  3TT2 A;  3VWE A;  5K8O A;  4PK3 A;  4A31 A;  1M4G A;  5J8F A;  4EWT A;  3KR5 A;  4P4I A;  2Q04 A;  1ZLI A;  2RC4 A;  2Z3M A;  3LOD A;  4MFK A;  4NCZ A;  3R9E A;  3V7Z A;  2ZEL A;  4KVX A;  3SJE A;  1OBR A;  1YRE A;  2YNE A;  3FIX A;  5LYF A;  3RYO A;  2Z0Z A;  2DPT A;  4CGL A;  4H6U A;  3R9G A;  4NJQ A;  4MCS A;  1IGB A;  1QSO A;  3NH5 A;  1PYT B;  2NMT A;  1YW4 A;  4JXQ A;  3FNC A;  5ELY A;  2ZW6 A;  3D7G A;  4A39 A;  3B3W A;  1CP6 A;  3KL9 A;  4L8A A;  4M85 A;  4PXC A;  3TO7 A;  1XOV A;  2ZOF A;  1Y0Y A;  1TKJ A;  2J8R A;  4BMH A;  1CM0 A;  2VEZ A;  1YX0 A;  2I79 A;  2YND A;  4W9Y A;  2POK A;  2Q4Y A;  1S3Z A;  2EK9 A;  2V77 A;  2ABZ A;  2CY2 A;  2Z3L A;  4KVM E;  4M6G A;  5DWM A;  5CNP A;  3TO6 A;  4IK2 A;  3T9Y A;  1KZF A;  1TXR A;  4KSA A;  1M1D A;  4UEE A;  4C68 A;  2OZG A;  4JYW A;  4ZX9 A;  2PJA A;  3SXN A;  4PSX A;  4MFQ A;  3SXO A;  3WC5 A;  1DTD A;  4Q38 A;  1XBU A;  4AG7 A;  4KOV A;  3GUX A;  2B3V A;  2ZEF A;  3C26 A;  4ZY2 A;  3ZZI A;  4P4E A;  4NGP A;  1ZLH A;  3KGQ A;  2ZPA A;  3SHP A;  1BLL E;  4FUU A;  3IU2 A;  5JQ4 A;  2C6P A;  4CYN A;  4TNU A;  1IOF A;  4Y49 C;  1WK4 A;  1LFW A;  2VZZ A;  1I1D A;  3EC4 A;  2IJZ A;  3H8F A;  4OC2 A;  4B13 A;  3EFA A;  1K4J A;  1Y9K A;  3K9U A;  2IMO A;  3CDX A;  2ANP A;  2J8M A;  2XEJ A;  3K9T A;  4MI4 A;  1IIC A;  4QB9 A;  3BJ7 A;  4OIW A;  1ZG8 A;  3KI9 A;  2DF5 A;  5LYI A;  5IV0 A;  1BAV A;  1MJB A;  2PJ9 A;  1NMT A;  3G3S A;  3KR4 A;  4X3R A;  4C7H A;  2HB6 A;  2EWB A;  4RN7 A;  4R3K A;  1QST A;  4AXV A;  1B87 A;  2QYV A;  1R43 A;  1LAP A;  3KKW A;  3NFZ A;  4RS2 A;  4ZI6 A;  2ZXV A;  4KOU A;  2PJ4 A;  4UWJ A;  5F49 A;  1WWZ A;  2EUI A;  1CBX A;  4P4J A;  4UFV A;  3FX6 A;  3TOB A;  3I9S A;  5EMI A;  4UIA A;  4ZYQ A;  3GIU A;  2CNM A;  2ZOG A;  2WZN A;  2O53 A; 
#chains in the Genus database with same CATH homology
 1I21 A;  1PUA A;  3PZJ A;  4YFJ A;  4KOS A;  2Z3O A;  1KUX A;  4MFL A;  3B8G A;  5FVJ A;  3FYN A;  3R9F A;  1Z9U A;  2Z3P A;  4M3S A;  4CAW A;  1YVK A;  2Z11 A;  4AG9 A;  2G3T A;  4GS4 A;  5E96 A;  3P2H A;  3W6X A;  4KOX A;  1B6B A;  2C27 A;  4AVB A;  4HNY B;  3IWE A;  3WR7 A;  3JUW A;  1Y7R A;  2JDC A;  4FD5 A;  2H5M A;  4CGM A;  5A28 A;  4PV6 A;  4KOT A;  4QUS A;  5AG7 A;  3TOA A;  3CXS A;  5G21 A;  1LRZ A;  2JLM A;  4CGN A;  2WPX A;  4XPL A;  4HNW B;  1PU9 A;  2VI7 A;  3F0A A;  2HV2 A;  1XMT A;  2Z10 A;  5G20 A;  3DSB A;  4NF1 A;  4JLY A;  1U6M A;  4UWI A;  2PSW A;  1P0H A;  1S7F A;  3BLN A;  2YNC C;  1YGH A;  2Z3K A;  4KZT A;  5KTC A;  1MK4 A;  2DPS A;  4JXR A;  3W6S A;  2B3U A;  4UA3 A;  4CYP A;  4IF5 A;  4EVY A;  2PR8 A;  3BJ8 A;  4KOY A;  4CYO A;  4C2Y A;  2CNS A;  1ZO0 A;  2HUZ A;  4YGO A;  2OH1 A;  4BBH A;  3CXQ A;  4XNH C;  3V8I A;  5J8C A;  3D8P A;  3TTH A;  2JEV A;  1S60 A;  4UCM A;  2VBQ A;  4K30 A;  1YK3 A;  4U5Y A;  5F47 A;  4HNX B;  4A32 A;  1Q2Y A;  1GHE A;  2CNT A;  4KOW A;  2P6F A;  3IWG A;  2X7B A;  3FRM A;  1IID A;  3OWC A;  4E8O A;  2Z3N A;  2Q0Y A;  1YLE A;  4X5K A;  4F6A A;  4A33 A;  2A4N A;  5GCN A;  1M4I A;  3I3G A;  5JPH A;  4KS9 A;  2FL4 A;  3GKR A;  1RXT A;  2FSR A;  3D2P A;  3R95 A;  2ZW7 A;  5IX3 A;  4F0Y A;  4XPD B;  1MJ9 A;  2WUU A;  4B5P A;  4MY3 A;  4FD6 A;  3UY5 A;  3EY5 A;  1S5K A;  4UFX A;  3A9L A;  1UFH A;  2KCW A;  1QSM A;  2GE3 A;  4KLV A;  4L89 A;  1YVO A;  2K5T A;  1R57 A;  3ZJ0 A;  4MHD A;  4KSF A;  1P4N A;  2O28 A;  5KTD A;  1QSN A;  2R8V A;  2IL4 A;  2ZW5 A;  3EO4 A;  1TIQ A;  4I49 A;  5KTA A;  1S7L A;  4YRH A;  1Z4R A;  1M4D A;  4MFP A;  2I00 A;  1NSL A;  5EC4 A;  2G0B A;  3TCV A;  1IYL A;  4KOR A;  1CJW A;  1YR0 A;  4CGO A;  5HMN A;  1IB1 E;  3TFY A;  4A2Z A;  2OU2 A;  3QAH A;  4E2A A;  2Y0M A;  2CXA A;  2DXQ A;  4CRZ B;  4E0A A;  4F0X A;  3R96 A;  3H4Q A;  4CAE A;  3DNS A;  1ON0 A;  2D4O A;  4LX9 A;  2P0W A;  4B11 A;  5H84 A;  3F5B A;  3F8K A;  1XIX A;  4ORF A;  4FD7 A;  3JTK A;  4CS0 B;  4NEX A;  2FT0 A;  3N7Z A;  2REF A;  1S7N A;  3P2F A;  2FCK A;  4JWP A;  3W91 A;  4B14 A;  1OZP A;  2PR1 A;  1J4J A;  5A27 A;  3H5Z A;  2B4D B;  3DR8 A;  3EXN A;  1XF8 A;  2B5G B;  4JJX A;  2FE7 A;  2FIA A;  2ZW4 A;  5F46 A;  4OLL A;  1Z4E A;  3CXP A;  4QBJ A;  2BL1 A;  1I12 A;  2EVN A;  3GY9 A;  4U9Z A;  5HH1 A;  4MFZ A;  2FXF A;  4RI1 A;  2PDO A;  5I0C A;  2BEI A;  2PRB A;  2WSA A;  4CAV A;  4AB7 A;  5C88 A;  1V0C A;  2B4D A;  4MBU A;  5AG4 A;  3IU1 A;  2B5G A;  4B12 A;  4J3G A;  4Y49 B;  5F48 A;  4H6Z A;  2G3A A;  1BO4 A;  3T90 A;  1VHS A;  5G1Z A;  3DR6 A;  2R98 A;  3TO9 A;  4CGP A;  4MFJ A;  1KUY A;  2B4B A;  4B5P B;  2QML A;  2HQY A;  2FIW A;  2JDD A;  4H89 A;  2BUE A;  2VQY A;  4B5O A;  4MJ8 A;  4QC6 A;  2P6G A;  3TE4 A;  3R1K A;  2ARH A;  3FB3 A;  4AVC A;  2VZY A;  5AG6 A;  1M44 A;  4PK2 A;  1XEB A;  5H86 A;  3JVN A;  3GYA A;  4NSQ A;  4OAD A;  4PSW A;  5IB0 A;  1Y9W A;  2D4P A;  3FBU A;  3E0K A;  4HKF A;  2AJ6 A;  2OZH A;  1Q2D A;  2PC1 A;  4JD6 A;  4U9Y A;  2BSW A;  2GAN A;  4ONU A;  4Q36 A;  2QIR A;  1XE4 A;  3QB8 A;  2WPW A;  2J8N A;  4II9 A;  1MJA A;  4UCN A;  3D3S A;  2OZU A;  4OAE A;  3S6G A;  1QSR A;  3MGD A;  1BOB A;  4DNC A;  4FD4 A;  4IUS A;  4B10 A;  4QVT A;  3DDD A;  4MY0 A;  4UFW A;  5AGE A;  2PQ8 A;  2GIV A;  1N71 A;  4CAF A;  3S6H A;  2Q7B A;  2R7H A;  1S7K A;  4R57 A;  3D2M A;  4R87 A;  4XPD C;  4KVO E;  5ISV A;  2P6E A;  2R1I A;  4A95 A;  3IGR A;  3PP9 A;  2OB0 A;  2AE6 A;  5BWA B;  4A30 A;  4R3L A;  5G22 A;  4NXY A;  1SQH A;  3LD2 A;  4KUB A;  2ATR A;  3S6K A;  3S6F A;  4CAX A;  2QEC A;  3FXT A;  2VXK A;  3VWD A;  4C2X A;  5EBV A;  1IYK A;  4UCP A;  4KUA A;  1KUV A;  1VKC A;  2REE A;  4ZBG A;  1RO5 A;  2Q4V A;  2YGW A;  1FY7 A;  4ZGY B;  4C2Z A;  2B58 A;  4CRY B;  4C7I A;  1Q2C A;  2F5I A;  4LUA A;  4UBR A;  1L0C A;  5AG5 A;  4AVA A;  5C82 A;  4XPK A;  2Q44 A;  3PGP A;  1NE9 A;  3G8W A;  4CYQ A;  4XNH B;  4KLW A;  4R9M A;  5DWN A;  2YNC A;  3NE7 A;  2FS5 A;  3TT2 A;  3VWE A;  4PK3 A;  4A31 A;  1M4G A;  5J8F A;  2Q04 A;  2RC4 A;  2Z3M A;  3LOD A;  4MFK A;  4NCZ A;  3R9E A;  4KVX A;  1YRE A;  2YNE A;  3FIX A;  3RYO A;  2Z0Z A;  2DPT A;  4CGL A;  4H6U A;  3R9G A;  1QSO A;  2NMT A;  4JXQ A;  3FNC A;  2ZW6 A;  4L8A A;  3TO7 A;  4M85 A;  4BMH A;  2J8R A;  1CM0 A;  2VEZ A;  1YX0 A;  2I79 A;  2YND A;  2Q4Y A;  1S3Z A;  2CY2 A;  2Z3L A;  4KVM E;  5DWM A;  5CNP A;  3TO6 A;  3T9Y A;  1KZF A;  4KSA A;  4C68 A;  1M1D A;  2OZG A;  3SXN A;  4PSX A;  4MFQ A;  3SXO A;  4Q38 A;  4AG7 A;  4KOV A;  2B3V A;  3C26 A;  3ZZI A;  2ZPA A;  3SHP A;  3IU2 A;  5JQ4 A;  4CYN A;  4Y49 C;  1WK4 A;  2VZZ A;  3EC4 A;  1I1D A;  4B13 A;  3EFA A;  1K4J A;  1Y9K A;  3K9U A;  2J8M A;  4MI4 A;  1IIC A;  4QB9 A;  3BJ7 A;  5IV0 A;  1MJB A;  3G3S A;  1NMT A;  4C7H A;  4R3K A;  1QST A;  1B87 A;  3KKW A;  4RS2 A;  2ZXV A;  4KOU A;  4UWJ A;  5F49 A;  1WWZ A;  2EUI A;  4UFV A;  3TOB A;  3I9S A;  2CNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...