1S63A

Human protein farnesyltransferase complexed with l-778,123 and fpp
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Analysis Reveals that Anticancer Clinical Candidate L-778,123 Inhibits Protein Farnesyltransferase and Geranylgeranyltransferase-I by Different Binding Modes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 128
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1s63A00
4GTTA 1TNZA 3DSSA 3PZ1A 1O1SA 1TN6A 3KSLA 3E33A 1D8EA 3Q7FA 3DSXA 4YDEA 2H6GA 1S64A 1O5MA 1O1RA 1O1TA 4GTVA 1FT1A 1JCRA 4GTMA 1S63A 1TNUA 1SA4A 3DSWA 2ZISA 1TNBA 1MZCA 3DSUA 3KSQA 2F0YA 1N4QA 1N95A 3HXDA 1D8DA 1SA5A 2H6HA 3EU5A 3E32A 3E30A 3Q7AA 3Q78A 1N4SA 1TN7A 1NL4A 3PZ2A 3HXBA 2H6FA 1LD7A 3C72A 3HXFA 3E34A 4EHMA 4LNBA 1NI1A 1DCEA 1LTXA 3DPYA 1N9AA 3Q75A 3DSTA 3HXEA 1KZPA 2R2LA 4GTRA 1FPPA 3HXCA 4GTQA 1TNYA 4GTOA 3Q73A 4YDOA 4GTSA 3PZ4A 4LNGA 2H6IA 2ZIRA 3EUVA 1LD8A 1X81A 1KZOA 3DSVA 1JCSA 1QBQA 1N4RA 3E37A 3Q79A 2BEDA 3DRAA 3SFYA 2IEJA 1FT2A 1N4PA 4L9PA 1JCQA 4GTPA 1TNOA 3PZ3A 3SFXA 4MBGA 1N94A 1TN8A
chains in the Genus database with same CATH superfamily
3IHYA 3FTUA 2XGSA 2V4HC 4K0RA 3FFLA 5ENTD 1E90A 2UWJG 2RG8A 2JABA 4FHKA 4UWGA 1O1TA 3BG1B 4U8YD 4BFRA 5KCMA 4FJZA 1UN9A 5EIBE 5EYPF 1MZCA 3EIQC 4UI9J 4GYYA 5KJKA 4XX5A 3ASDA 1A17A 2ETCA 3ZGQA 3BUAA 3E30A 3FU3A 1QZ2A 5E75A 5FQ4A 2DWZA 3S2AA 5LP0A 3HXFA 4TXQA 4EZKA 3ISMC 1IXVA 3BG0B 1YA0A 1PY1A 1HE8A 2WXMA 3JQ0A 3AU5A 2MRIA 2NSZA 3LY9A 3Q73A 4ACKA 3TXMA 4L1BA 2WXIA 3J5PA 2GRPB 4WWOA 2IFUA 3MZLB 4FLHA 3MV3B 3Q79A 5CEDB 4B8AA 4XKCA 3TWWA 2CFZA 1QYMA 3SF4A 3SFXA 4AV7A 2F8YA 2X6IA 2X6KA 4GTTA 3TWQA 1O1SA 3VLFA 1ZBPA 3FEXA 1E8WA 3HDXA 3PNLB 1KLXA 4IULA 1ELRA 2CFUA 1ELKA 3UT8A 5AJDA 5ENPD 2KCKA 1N11A 3Q15A 2Y3AA 2WXJA 5D66A 3EHQA 5A6CA 3Q9UC 4X8QA 5AQ9A 4EECA 1MQSA 2FF4A 3AS4A 4HNAD 2FO7A 3X2QE 4FLBA 2QC9A 2AJAA 2FI7A 5G05J 2XPIA 1GW6A 1OCRE 4G8LA 1N4QA 1N95A 2XGOA 2DYSE 3LY7A 1WM5A 3D9OA 4Q96A 3NZSA 1AP7A 3CK7A 1H6PA 4UQZA 4G25A 4UQYA 4JHRA 4DX2A 2XGMA 2HE0A 2P58C 2XCBA 2BTDA 3LXUX 1ZB1A 3W9FA 3HXEA 3TWTA 3T5VA 2IU1A 2RKKA 3FH5A 3FTVA 4U8HA 4I6GA 2I2OA 1X81A 3D9KA 4U96D 1SQMA 4LERA 3QNKA 3KD7A 1D9SA 4FC8A 3DXKG 5E76A 2X38A 2E0IA 4MBGA 1N94A 2DCPA 1X5BA 3NQPA 5G04C 3CKCA 3NOCD 1MYOA 3UIPC 3Q7FA 4DLOA 1RZ4A 3IEGA 4ZHBA 1V54E 1INZA 3MKQA 2XZTG 2AVPA 5C1DA 4CYMD 2FBNA 5BXOA 4KBQA 4UWLA 1IHGA 4GU5A 4APFA 3U3WA 2KZTB 3RJVA 1EPUA 2XENA 5A7DB 3OXGA 4JL0A 1S0PA 5DIZA 1DVPA 3OXLA 3AG1E 2BKKB 5KWDA 4U95D 3UKRG 4BT8A 4F53A 3HYMB 2PQNA 4AXHA 4WAFA 1SW6A 4O1PA 2XS8A 1V55E 1UG3A 4JXTA 3AG4E 4TXRA 3OAWA 2EILE 4U0UA 2I6HA 4J8DA 3CVXA 4NURA 4HFGA 3CKBA 2H6IA 5A23A 5EX3A 3O48A 3TWSA 2P9SG 2OOEA 1KZOA 3G2VA 3D9HA 4J0UA 3LYAA 2KCLA 1K3ZD 4AOFA 4BWRA 1OCCE 1FCHA 3KEZA 4ILIA 4GA1A 1HFAA 1MHQA 2BKGA 3B95A 1TN6A 2GRLA 3CVPA 4K5BA 4F6RD 4RSYA 2RD0A 4GMJA 3ABME 2VSNA 3V2OA 4CEMA 5IY5E 2VGXB 1MJ0A 1S63A 4ANUA 3ZYMA 4KZCA 4UI9C 2VGEA 3GZSA 2Y0BG 4XZ4A 3G2UA 4GYOA 2I1JA 1XNFA 3ENEA 5EN5D 3JUEA 4KVOA 5EIDA 4DPRA 3MV2B 4RVBA 4NACA 4B94A 2M63A 4L2YA 1LD7A 3C72A 4EHMA 2OV8A 1DCEA 4DK5A 1TJCA 2AXZA 3FUDA 3D9LA 3FUJA 3TWRA 4J8YA 1OWOA 3MX3A 3WXXA 2R2LA 3D9JA 1YCSB 3ULYA 1E8ZA 3TWVA 3NAWA 2ZIRA 2V4LA 3V2XA 3PEVB 4G26A 4NRHB 3RRNB 2FO1E 2AXUA 1VDYA 3UT7A 2C2LA 3DRAA 4KXKB 3SFYA 4HORA 1UN8A 4Q69A 3RO2A 4PS3A 5JHAA 3UXGA 2DBAA 3SHFA 2WXOA 4EPZA 5FZQA 4BT9A 4MKTA 3SO8A 4IYPA 3KSLA 2UY1A 5BV0A 4G8KA 2QZAA 3KAEA 4HQDA 2X6FA 5LFAA 1FT1A 2VQ2A 3RKVA 3ZXSA 3R9MA 3L6AA 3B7TA 4KYOB 5G05C 3C3OA 2KXPC 4PUCA 5CRVA 3AG2E 1BD8A 5CERB 4PDXA 1TR4A 2GRRB 3DBSA 3ZYQA 2WB2A 4ZFHA 3L54A 3JYSA 3L08A 4IN3B 2FEZA 2Y4UA 4BETA 1N9AA 2KM4A 4HS2A 3CVVA 1HZ4A 4Y6WA 2ZGDA 4TXPA 4BX8A 1TNYA 2VYIA 4KT6B 3VTXA 3ML9A 3HVEA 4W9RA 3UKUG 2KATA 4BSZB 5FQ7A 4I9CA 3DEPA 1HG5A 2MYOA 3JCKC 1XGWA 4CGVA 3CK8A 1NA3A 5JJ7A 3V31A 4H7XA 4WNDA 3FH7A 3UT4A 4FP7A 2FULA 4YDYA 4RQIA 3Q4AB 3UMVA 4E6HA 4IRUA 4U0SA 4XE0A 3ULQA 3S7FA 3T8KA 1TNUA 1H2TC 4AJWA 3QARA 4N5CA 4A63B 1JPLA 2VSOE 2Y4TA 3PEUB 1TNBA 2PM6A 1KT1A 3G2WA 4AVXA 4G23A 4AIFA 1UW4B 3D9PA 2ZU6B 4B89A 4GCOA 4F1SA 4HLLA 4XEIG 1YMPA 3AAAC 3FH8A 3W9GA 1TJFA 3LS8A 3O4ZA 3P1UA 5ANRA 4LNBA 1LTXA 3JUIA 4BX9A 4MRUA 5D0QD 4UUCA 2P9PG 3S7BA 1SZ9A 4BTAA 2LAHA 3T8MA 2J4DA 3DSVA 1H19A 4RG6A 3ZPJA 4N3AA 2WXFA 5KJNA 2P2CP 4K5CA 1RW2A 1TNOA 5BUZA 3U64A 2HYZA 2B0OE 3L17A 5J08A 4CT0A 3TGOA 1B89A 4CDNA 3FTSA 3MGBA 2F37A 3UINC 2YINA 2P9NG 4KVMA 3I4RB 4TRQA 3EJNA 1OXJA 2LXLA 2WXLA 4XKBA 2F0YA 1IQRA 3IBEA 5ARGA 3HXDA 4GB9A 2I1KA 5JJTA 4EBAA 2WXNA 4GZCA 4DRXE 4B0ZA 3U9WA 1U2VG 3CK9A 3CSFA 4AP2A 3ONKA 2IQCA 2XS1A 5FQ6A 1Z5SC 1KZPA 1FPPA 4AEZC 3HXCA 2J09A 2XEVA 5JA4D 2L0TB 3ZN3A 4GTSA 2GRMA 3EUVA 2IOLA 5ENSD 2XPZA 4ANXA 1QBQA 2P9UG 2IY0C 5H7PA 2WQ6A 4L9PA 4CRWA 3CVNA 4CCAA 3FUNA 3ESLA 5EKQD 5CCLA 2R05A 4E85A 5ITZF 3B13A 5ENNA 4LRZA 4N3BA 3E33A 4U07A 2UY1B 2GRNB 2PQRA 1MX2A 5FINA 4GZ5A 2HR2A 4I6JA 5EX0A 3SBSA 5G55A 5AAOA 2VGYA 3PDNA 4XI0A 5ENQD 1ELWA 4V3IA 2AWIA 3S7JA 5AIJA 1NZNA 2OEWA 3ASNE 5CRUA 3EU5A 3SGHA 2Y1LE 5FTPA 3Q78A 3TWUA 4CDRA 2VSXE 1WY6A 1HS6A 1OWPA 3FTWA 4J7WA 4RLYA 4OYSA 4Y6CA 2H6FA 1G3NB 3CVYA 1UJKA 1A5EA 2GROB 3CSTA 3ZUVB 4F1PA 4U7EB 5EDSA 4K03A 4HOTA 2KC7A 3OXFA 1BU9A 2A5UA 3MYVA 4ILHB 3JXJA 4ATGA 3ZEFA 3FU0A 4ACLA 4LEUA 3PZ4A 2WVIA 4JHJA 5B1AE 2L6JA 3ASOE 4Z68A 1OCOE 3UPVA 3ONLA 3KS2A 1BI8B 3U4TA 5LOZA 2XPYA 3ASHA 1JCQA 4CZ2D 3FUMA 3IXEA 3NOGD 3DSSA 1DCQA 3ASGA 5BPPA 3PZDA 3LKUA 4TV3A 4GZDA 3QWWA 4YDEA 3JXIA 4FJYA 2ETAA 2EIJE 3CR3A 2CG3A 3ZYKA 4DX5D 3MA5A 5G2NA 2DVWA 3AS8A 3Q47B 1HXIA 2GRQB 4APOA 4TUUA 3FDHA 4OVVA 3CGHA 4UI9K 2H6HA 3FTZA 3SNXA 1ZU2A 4I2ZA 3SZ7A 3RIBA 1H6KA 3NZUA 3FU6A 2MOWA 2HM8A 2WXGA 4U63A 3B7SA 5LX8A 5ENRD 4PS8A 3MKQB 1NI1A 3HHMA 5M72A 3QAQA 5FQ8A 4H7YA 3CEQA 3I3NA 2PNNA 3U66A 3CHMA 1H6OA 4YDOA 2LO6A 4ATZD 3QWPA 1EDUA 3QKYA 5CMWA 3MCXA 3ABKE 2AW6A 1LD8A 2R02A 3D9IA 2CHZA 2BEDA 1TYQG 4J8FA 2DZOA 4A55A 2ILRA 3TXNA 3PVLA 5HQ8A 3QC1A 3RRUA 3L9TA 3ULEG 2XZDG 2L0IA 3PZ1A 1P5QA 2NXPA 3UM1A 4CT4A 3CHQA 2IOSA 5CCMA 1KT0A 1KPSB 4ILGA 4OAVB 2H6GA 1OWNA 3CV0A 4YVOA 1O1RA 2KCVA 2RFMA 4BY6A 3ML8A 4GTMA 3OTNA 1WG0A 3FTXA 4C9BB 4O60A 3APFA 2JLBA 2ZGGA 3VLDA 4BSXA 3DSUA 5LCWC 1SA5A 2QFCA 3PE4A 5J90A 3ZHEB 4UQXA 4GYWA 3PNTB 4DLQA 3C3QA 3L82A 3T9KA 4DI4A 2C0LA 3ZFWA 5G04J 3I5PA 2R03A 3SFZA 3C5RA 4QFVA 4BEPA 4BESA 2IONA 4Q94A 1OY3D 4DX6D 1H0AA 2OVBA 3BEEA 4HOSA 4JVSA 1N52A 2E2EA 3B7UX 3EHMA 4I1MA 2V5QC 3R7QA 3FULA 5T8IA 1N4RA 1N0RA 3T5XA 1Z3XA 4LG6A 3PZ3A 3SD5A 1FVHA 3Q5MA 4N3CA 1TN8A 5BXUA 3SY2A 1L5JA 4JA9A 3VTYA 4U0ZA 1WAO1 2X6JA 5CBNA 1LF8A 1N54A 2OEVA 4F3VA 4R7LA 3APCA 4DI3A 4HXIA 4I1OB 5KJMA 3C98A 2J49A 3MJWA 4HI8A 1JUQA 2R59A 3MEKA 3PUKA 3B7RL 3PE3A 4B8CB 2PZIA 3FUEA 3RK6A 4A3TA 4OVUA 4LSZE 2EINE 3GW4A 3QJZA 4KZ0A 3CVQA 3E32A 2PL2A 4LNUD 3UUXA 4G1TA 3CQCB 4U04A 4WNEA 1UOHA 4N2QA 1PC2A 5DBKA 4DJAA 5T3RA 4WNGA 3DSTA 3HIZA 4GA0A 3RSEG 4GTQA 3CVUA 4JD2G 3L13A 3DWLG 2R17C 4AM9A 3FHEA 3L16A 3RO3A 4BERA 5CECB 2P9KG 2P9IG 3EDTB 3LJNA 2ONDA 5LCWJ 3FWVA 2EQXA 4UWFA 2L6BA 4CGWA 5JMND 4PH4B 1TNZA 1OCZE 1HF8A 2BUGA 4ME2A 4WWPA 1Y6IA 3D9NA 3CQGB 3TG5A 5HI7A 2NYJA 5D0OD 3P2BA 1SA4A 3AU4A 4JB8P 2PM7A 3TJPA 2ZISA 2WXKA 3RU0A 4WUYA 4FA6A 1EYHA 3D9MA 4JHKA 3TWXA 5KJLA 5HS0A 2WXPA 2LXMA 4CDMA 3G2SA 1N4SA 3MKRA 3LDZA 1NL4A 3S7DA 5FJYA 2XEEA 4I2WA 3ZW3A 4FHJA 2WMOA 2WMNA 5FIOA 1E7UA 3DEOA 4JPSA 3UI2A 4I9EA 4JEUA 2B6CA 2VSYA 4LNGA 2XEHA 5AYWD 3CLJA 4K5AB 4I1AA 4URKA 4F7AA 4PS7A 2QYJA 1OWLA 1FT2A 2XRYA 5T4YA 3SBTB 4J6IA 2Y69E 1E7VA 4D10C 2DYRE 3CHRA 4JA7A 4GA2A 1FVFA 1YYHA 3EHNA 1Z3YA 2A4ZA 4HRMB 1D8EA 4O6FA 4N5QA 2ZXWE 1O5MA 4OAUC 4GCNA 2A5EA 3Q49B 3AJIA 2Q7FA 4HOQA 4MLPA 3AG3E 1E96B 3DSWA 5ANLA 4G24A 1S70B 4QQIA 2WXRA 3PS6A 5BV1A 4L2LA 3KSQA 4GZ3A 3ZU7B 3EIJA 2X6HA 4LUNU 3ZHEA 4DX1A 4A3VA 4HVBA 4HRNA 5HRYA 3UQ3A 3FP3A 3HXBA 2CHXA 2XRZA 2EIKE 1SVXA 3VLEA 4YNDA 5B3SE 3E34A 2YQ8A 2VJ8A 3R9AB 1N0QA 2XHEA 2V5FA 3Q75A 5BW8C 4GTRA 3IHVA 2J4BA 4HB5A 4GTOA 4I43A 2VTBB 1K1BA 3N71A 4EZJA 1MX4A 5AENA 1BI7B 4XI9A 4UWKA 3ESKA 3EU9A 3I4GA 4GAAA 4JZYA 4G2VA 3RAUA 5KNHD 4N2SA 4GTPA 2J9QA 3IV0A 5B1BE 4I6EA 2IO2C 3PRZA 2LSVA 1HU3A 5C2YA 3QOUA 3ZKJA 3BQOA 2QY7A 5KNGA 2CHWA 3EHRA 5FZRA 3RRMB 3Q9NC 4L7TA 1S64A 2AXVA 4HBDA 4I17A 3ZYLA 3GZ2A 3CVLA 1IYGA 2V8SE 5ENOD 4YVQC 1Y8MA 3APDA 2RFAA 4KMOA 2WQ7A 3CVWA 2OVFA 5CBOA 2YHCA 4C0MA 3Q7AA 3C3RA 3SQVA 2HO1A 1K1AA 1TN7A 4L23A 4GPMA 3HRAA 1HO8A 3FUFA 5KBAA 3G2TA 1QNFA 3J5QB 3PREA 3V30A 4FADA 3L22A 2DZNA 2VGXA 2YHEA 3GYZA 4LCTA 1NA0A 3QWVA 3FUKA 3IKOB 1EF1C 4J8SA 1JWFA 2DIWA 3UX4A 3FUIA 3HVEB 3FU5A 2CG2A 4J8EA 2XQ0A 5AQBA 2GW1A 3FTYA 2L9BA 4WNFA 3FY4A 4MS6A 1QQEA 3E37A 2R5SA 2IEJA 2IO3C 3UIOC 5AQAA 2J8SD 3TAXA 2WQHA 5FWQA 4HRLA 4FU3A 2P9LG 1H2VC 4EZLA 5D2MC 3ABLE 3LCAA 3LVRE 3URZA 3DSXA 2LAIA 2NC9A 4O1OA 4A1SA 4JC8A 4B93B 4FULA 4GTVA 2ETBA 5AN8A 1JCRA 2J08A 2X3MA 1Z6TA 4EBAG 1UJJA 3D3MA 4GPKA 2C0MA 5AQ7A 1OUVA 1PAQA 4HOUA 1E8XA 4M7CA 2IJGX 1BLXB 2IF4A 4EQFA 3QDNA 4YDWA 1BPOA 4AY6A 4GZ6A 1HG2A 1HH8A 3NF1A 2BF0X 3LPZA 5JHBA 3UTMA 1OWMA 2GGFA 1IHBA 3E4BA 4JW1A 3CIAA 3K9IA 3QB2A 3NBNB 3DPYA 4ABNA 1TEZA 3BU8A 1NFIE 1WDYA 5EILA 3SI5A 3PUJA 3NB2A 4ANWA 1JWGA 1SZAA 1U3DA 5FT9A 2JEKA 3JQ1A 2WM9A 2I9CA 3DPDA 4WWNA 1DC2A 2XCCA 3TG4A 2KBXA 3B7BA 3F6QA 1IKND 1N4PA 3FEYA 4ANVA 4U8VD 4HLEA 3QK0A 2J07A 4UWHA 4HI9A 1K8KG 1MX6A 5CEAA 2V0PA 3WG7E 3ZVVA 4C0EA 1AWCB 3HG0D 4JEHA 2LSUA 2WXHA 4BTBA 2YNQA 2MHKA 4DUIA 3FUHA 3AS5A 4NQ0A 3ZIMA 2KZTA 4XIFA 2OCCE 4P29A 1OT8A 3GZ1A 1DNPA 1E8YA 5BNWA 3ZNGA 3ZRHA 5AARA 3KEAA 4GMRA 4AY5A 3ZXPA 1HX8A 1D8DA 2WXQA 3DXMG 1NP7A 3V79K 4M3OA 2WPVA 5AJLA 4DX7D 2QYUA 3PZ2A 5HKPA 3UM0A 5CMYA 5FZSA 5CHEE 4TUMA 4RG9A 4GMLA 3UM2A 1Q2ZA 1U3CA 3LJ3A 3PH0C 2LNIA 2EIME 3UM3A 2VTBA 1W3BA 1H2UA 5BT1A 1IQUA 3ASFA 4N39A 1JCSA 3TL5A 3CHPA 2LUHA 2F8XK 4NIKA 3R7RA 3LEWA 4C48B 5EYLA 3CHOA 4A1GA 3LVQE 5ARFA 3LY8A 5JJ6A 4G11A 3CHSA
chains in the Genus database with same CATH topology
4GTTA 1TNZA 3DSSA 3PZ1A 1O1SA 1TN6A 3KSLA 3E33A 1D8EA 3Q7FA 3DSXA 4YDEA 2H6GA 1S64A 1O5MA 1O1RA 1O1TA 4GTVA 1FT1A 1JCRA 4GTMA 1S63A 1TNUA 1SA4A 3DSWA 2ZISA 1TNBA 1MZCA 3DSUA 3KSQA 2F0YA 1N4QA 1N95A 3HXDA 1D8DA 1SA5A 2H6HA 3EU5A 3E32A 3E30A 3Q7AA 3Q78A 1N4SA 1TN7A 1NL4A 3PZ2A 3HXBA 2H6FA 1LD7A 3C72A 3HXFA 3E34A 4EHMA 4LNBA 1NI1A 1DCEA 1LTXA 3DPYA 1N9AA 3Q75A 3DSTA 3HXEA 1KZPA 2R2LA 4GTRA 1FPPA 3HXCA 4GTQA 1TNYA 4GTOA 3Q73A 4YDOA 4GTSA 3PZ4A 4LNGA 2H6IA 2ZIRA 3EUVA 1LD8A 1X81A 1KZOA 3DSVA 1JCSA 1QBQA 1N4RA 3E37A 3Q79A 2BEDA 3DRAA 3SFYA 2IEJA 1FT2A 1N4PA 4L9PA 1JCQA 4GTPA 1TNOA 3PZ3A 3SFXA 4MBGA 1N94A 1TN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTT A;  1TNZ A;  3DSS A;  3PZ1 A;  1O1S A;  1TN6 A;  3KSL A;  3E33 A;  1D8E A;  3Q7F A;  3DSX A;  4YDE A;  2H6G A;  1S64 A;  1O5M A;  1O1R A;  1O1T A;  4GTV A;  1FT1 A;  1JCR A;  4GTM A;  1S63 A;  1TNU A;  1SA4 A;  3DSW A;  2ZIS A;  1TNB A;  1MZC A;  3DSU A;  3KSQ A;  2F0Y A;  1N4Q A;  1N95 A;  3HXD A;  1D8D A;  1SA5 A;  2H6H A;  3EU5 A;  3E32 A;  3E30 A;  3Q7A A;  3Q78 A;  1N4S A;  1TN7 A;  1NL4 A;  3PZ2 A;  3HXB A;  2H6F A;  1LD7 A;  3C72 A;  3HXF A;  3E34 A;  4EHM A;  4LNB A;  1NI1 A;  1DCE A;  1LTX A;  3DPY A;  1N9A A;  3Q75 A;  3DST A;  3HXE A;  1KZP A;  2R2L A;  4GTR A;  1FPP A;  3HXC A;  4GTQ A;  1TNY A;  4GTO A;  3Q73 A;  4YDO A;  4GTS A;  3PZ4 A;  4LNG A;  2H6I A;  2ZIR A;  3EUV A;  1LD8 A;  1X81 A;  1KZO A;  3DSV A;  1JCS A;  1QBQ A;  1N4R A;  3E37 A;  3Q79 A;  2BED A;  3DRA A;  3SFY A;  2IEJ A;  1FT2 A;  1N4P A;  4L9P A;  1JCQ A;  4GTP A;  1TNO A;  3PZ3 A;  3SFX A;  4MBG A;  1N94 A;  1TN8 A; 
#chains in the Genus database with same CATH topology
 3IHY A;  3FTU A;  2XGS A;  2V4H C;  4K0R A;  3FFL A;  5ENT D;  1E90 A;  2UWJ G;  2RG8 A;  2JAB A;  4FHK A;  4UWG A;  1O1T A;  3BG1 B;  4U8Y D;  4BFR A;  5KCM A;  4FJZ A;  1UN9 A;  5EIB E;  5EYP F;  1MZC A;  3EIQ C;  4UI9 J;  4GYY A;  5KJK A;  4XX5 A;  3ASD A;  1A17 A;  2ETC A;  3ZGQ A;  3BUA A;  3E30 A;  3FU3 A;  1QZ2 A;  5E75 A;  5FQ4 A;  2DWZ A;  3S2A A;  5LP0 A;  3HXF A;  4TXQ A;  4EZK A;  3ISM C;  1IXV A;  3BG0 B;  1YA0 A;  1PY1 A;  1HE8 A;  2WXM A;  3JQ0 A;  3AU5 A;  2MRI A;  2NSZ A;  3LY9 A;  3Q73 A;  4ACK A;  3TXM A;  4L1B A;  2WXI A;  3J5P A;  2GRP B;  4WWO A;  2IFU A;  3MZL B;  4FLH A;  3MV3 B;  3Q79 A;  5CED B;  4B8A A;  4XKC A;  3TWW A;  2CFZ A;  1QYM A;  3SF4 A;  3SFX A;  4AV7 A;  2F8Y A;  2X6I A;  2X6K A;  4GTT A;  3TWQ A;  1O1S A;  3VLF A;  1ZBP A;  3FEX A;  1E8W A;  3HDX A;  3PNL B;  1KLX A;  4IUL A;  1ELR A;  2CFU A;  1ELK A;  3UT8 A;  5AJD A;  5ENP D;  2KCK A;  1N11 A;  3Q15 A;  2Y3A A;  2WXJ A;  5D66 A;  3EHQ A;  5A6C A;  3Q9U C;  4X8Q A;  5AQ9 A;  4EEC A;  1MQS A;  2FF4 A;  3AS4 A;  4HNA D;  2FO7 A;  3X2Q E;  4FLB A;  2QC9 A;  2AJA A;  2FI7 A;  5G05 J;  2XPI A;  1GW6 A;  1OCR E;  4G8L A;  1N4Q A;  1N95 A;  2XGO A;  2DYS E;  3LY7 A;  1WM5 A;  3D9O A;  4Q96 A;  3NZS A;  1AP7 A;  3CK7 A;  1H6P A;  4UQZ A;  4G25 A;  4UQY A;  4JHR A;  4DX2 A;  2XGM A;  2HE0 A;  2P58 C;  2XCB A;  2BTD A;  3LXU X;  1ZB1 A;  3W9F A;  3HXE A;  3TWT A;  3T5V A;  2IU1 A;  2RKK A;  3FH5 A;  3FTV A;  4U8H A;  4I6G A;  2I2O A;  1X81 A;  3D9K A;  4U96 D;  1SQM A;  4LER A;  3QNK A;  3KD7 A;  1D9S A;  4FC8 A;  3DXK G;  5E76 A;  2X38 A;  2E0I A;  4MBG A;  1N94 A;  2DCP A;  1X5B A;  3NQP A;  5G04 C;  3CKC A;  3NOC D;  1MYO A;  3UIP C;  3Q7F A;  4DLO A;  1RZ4 A;  3IEG A;  4ZHB A;  1V54 E;  1INZ A;  3MKQ A;  2XZT G;  2AVP A;  5C1D A;  4CYM D;  2FBN A;  5BXO A;  4KBQ A;  4UWL A;  1IHG A;  4GU5 A;  4APF A;  3U3W A;  2KZT B;  3RJV A;  1EPU A;  2XEN A;  5A7D B;  3OXG A;  4JL0 A;  1S0P A;  5DIZ A;  1DVP A;  3OXL A;  3AG1 E;  2BKK B;  5KWD A;  4U95 D;  3UKR G;  4BT8 A;  4F53 A;  3HYM B;  2PQN A;  4AXH A;  4WAF A;  1SW6 A;  4O1P A;  2XS8 A;  1V55 E;  1UG3 A;  4JXT A;  3AG4 E;  4TXR A;  3OAW A;  2EIL E;  4U0U A;  2I6H A;  4J8D A;  3CVX A;  4NUR A;  4HFG A;  3CKB A;  2H6I A;  5A23 A;  5EX3 A;  3O48 A;  3TWS A;  2P9S G;  2OOE A;  1KZO A;  3G2V A;  3D9H A;  4J0U A;  3LYA A;  2KCL A;  1K3Z D;  4AOF A;  4BWR A;  1OCC E;  1FCH A;  3KEZ A;  4ILI A;  4GA1 A;  1HFA A;  1MHQ A;  2BKG A;  3B95 A;  1TN6 A;  2GRL A;  3CVP A;  4K5B A;  4F6R D;  4RSY A;  2RD0 A;  4GMJ A;  3ABM E;  2VSN A;  3V2O A;  4CEM A;  5IY5 E;  2VGX B;  1MJ0 A;  1S63 A;  4ANU A;  3ZYM A;  4KZC A;  4UI9 C;  2VGE A;  3GZS A;  2Y0B G;  4XZ4 A;  3G2U A;  4GYO A;  2I1J A;  1XNF A;  3ENE A;  5EN5 D;  3JUE A;  4KVO A;  5EID A;  4DPR A;  3MV2 B;  4RVB A;  4NAC A;  4B94 A;  2M63 A;  4L2Y A;  1LD7 A;  3C72 A;  4EHM A;  2OV8 A;  1DCE A;  4DK5 A;  1TJC A;  2AXZ A;  3FUD A;  3D9L A;  3FUJ A;  3TWR A;  4J8Y A;  1OWO A;  3MX3 A;  3WXX A;  2R2L A;  3D9J A;  1YCS B;  3ULY A;  1E8Z A;  3TWV A;  3NAW A;  2ZIR A;  2V4L A;  3V2X A;  3PEV B;  4G26 A;  4NRH B;  3RRN B;  2FO1 E;  2AXU A;  1VDY A;  3UT7 A;  2C2L A;  3DRA A;  4KXK B;  3SFY A;  4HOR A;  1UN8 A;  4Q69 A;  3RO2 A;  4PS3 A;  5JHA A;  3UXG A;  2DBA A;  3SHF A;  2WXO A;  4EPZ A;  5FZQ A;  4BT9 A;  4MKT A;  3SO8 A;  4IYP A;  3KSL A;  2UY1 A;  5BV0 A;  4G8K A;  2QZA A;  3KAE A;  4HQD A;  2X6F A;  5LFA A;  1FT1 A;  2VQ2 A;  3RKV A;  3ZXS A;  3R9M A;  3L6A A;  3B7T A;  4KYO B;  5G05 C;  3C3O A;  2KXP C;  4PUC A;  5CRV A;  3AG2 E;  1BD8 A;  5CER B;  4PDX A;  1TR4 A;  2GRR B;  3DBS A;  3ZYQ A;  2WB2 A;  4ZFH A;  3L54 A;  3JYS A;  3L08 A;  4IN3 B;  2FEZ A;  2Y4U A;  4BET A;  1N9A A;  2KM4 A;  4HS2 A;  3CVV A;  1HZ4 A;  4Y6W A;  2ZGD A;  4TXP A;  4BX8 A;  1TNY A;  2VYI A;  4KT6 B;  3VTX A;  3ML9 A;  3HVE A;  4W9R A;  3UKU G;  2KAT A;  4BSZ B;  5FQ7 A;  4I9C A;  3DEP A;  1HG5 A;  2MYO A;  3JCK C;  1XGW A;  4CGV A;  3CK8 A;  1NA3 A;  5JJ7 A;  3V31 A;  4H7X A;  4WND A;  3FH7 A;  3UT4 A;  4FP7 A;  2FUL A;  4YDY A;  4RQI A;  3Q4A B;  3UMV A;  4E6H A;  4IRU A;  4U0S A;  4XE0 A;  3ULQ A;  3S7F A;  3T8K A;  1TNU A;  1H2T C;  4AJW A;  3QAR A;  4N5C A;  4A63 B;  1JPL A;  2VSO E;  2Y4T A;  3PEU B;  1TNB A;  2PM6 A;  1KT1 A;  3G2W A;  4AVX A;  4G23 A;  4AIF A;  1UW4 B;  3D9P A;  2ZU6 B;  4B89 A;  4GCO A;  4F1S A;  4HLL A;  4XEI G;  1YMP A;  3AAA C;  3FH8 A;  3W9G A;  1TJF A;  3LS8 A;  3O4Z A;  3P1U A;  5ANR A;  4LNB A;  1LTX A;  3JUI A;  4BX9 A;  4MRU A;  5D0Q D;  4UUC A;  2P9P G;  3S7B A;  1SZ9 A;  4BTA A;  2LAH A;  3T8M A;  2J4D A;  3DSV A;  1H19 A;  4RG6 A;  3ZPJ A;  4N3A A;  2WXF A;  5KJN A;  2P2C P;  4K5C A;  1RW2 A;  1TNO A;  5BUZ A;  3U64 A;  2HYZ A;  2B0O E;  3L17 A;  5J08 A;  4CT0 A;  3TGO A;  1B89 A;  4CDN A;  3FTS A;  3MGB A;  2F37 A;  3UIN C;  2YIN A;  2P9N G;  4KVM A;  3I4R B;  4TRQ A;  3EJN A;  1OXJ A;  2LXL A;  2WXL A;  4XKB A;  2F0Y A;  1IQR A;  3IBE A;  5ARG A;  3HXD A;  4GB9 A;  2I1K A;  5JJT A;  4EBA A;  2WXN A;  4GZC A;  4DRX E;  4B0Z A;  3U9W A;  1U2V G;  3CK9 A;  3CSF A;  4AP2 A;  3ONK A;  2IQC A;  2XS1 A;  5FQ6 A;  1Z5S C;  1KZP A;  1FPP A;  4AEZ C;  3HXC A;  2J09 A;  2XEV A;  5JA4 D;  2L0T B;  3ZN3 A;  4GTS A;  2GRM A;  3EUV A;  2IOL A;  5ENS D;  2XPZ A;  4ANX A;  1QBQ A;  2P9U G;  2IY0 C;  5H7P A;  2WQ6 A;  4L9P A;  4CRW A;  3CVN A;  4CCA A;  3FUN A;  3ESL A;  5EKQ D;  5CCL A;  2R05 A;  4E85 A;  5ITZ F;  3B13 A;  5ENN A;  4LRZ A;  4N3B A;  3E33 A;  4U07 A;  2UY1 B;  2GRN B;  2PQR A;  1MX2 A;  5FIN A;  4GZ5 A;  2HR2 A;  4I6J A;  5EX0 A;  3SBS A;  5G55 A;  5AAO A;  2VGY A;  3PDN A;  4XI0 A;  5ENQ D;  1ELW A;  4V3I A;  2AWI A;  3S7J A;  5AIJ A;  1NZN A;  2OEW A;  3ASN E;  5CRU A;  3EU5 A;  3SGH A;  2Y1L E;  5FTP A;  3Q78 A;  3TWU A;  4CDR A;  2VSX E;  1WY6 A;  1HS6 A;  1OWP A;  3FTW A;  4J7W A;  4RLY A;  4OYS A;  4Y6C A;  2H6F A;  1G3N B;  3CVY A;  1UJK A;  1A5E A;  2GRO B;  3CST A;  3ZUV B;  4F1P A;  4U7E B;  5EDS A;  4K03 A;  4HOT A;  2KC7 A;  3OXF A;  1BU9 A;  2A5U A;  3MYV A;  4ILH B;  3JXJ A;  4ATG A;  3ZEF A;  3FU0 A;  4ACL A;  4LEU A;  3PZ4 A;  2WVI A;  4JHJ A;  5B1A E;  2L6J A;  3ASO E;  4Z68 A;  1OCO E;  3UPV A;  3ONL A;  3KS2 A;  1BI8 B;  3U4T A;  5LOZ A;  2XPY A;  3ASH A;  1JCQ A;  4CZ2 D;  3FUM A;  3IXE A;  3NOG D;  3DSS A;  1DCQ A;  3ASG A;  5BPP A;  3PZD A;  3LKU A;  4TV3 A;  4GZD A;  3QWW A;  4YDE A;  3JXI A;  4FJY A;  2ETA A;  2EIJ E;  3CR3 A;  2CG3 A;  3ZYK A;  4DX5 D;  3MA5 A;  5G2N A;  2DVW A;  3AS8 A;  3Q47 B;  1HXI A;  2GRQ B;  4APO A;  4TUU A;  3FDH A;  4OVV A;  3CGH A;  4UI9 K;  2H6H A;  3FTZ A;  3SNX A;  1ZU2 A;  4I2Z A;  3SZ7 A;  3RIB A;  1H6K A;  3NZU A;  3FU6 A;  2MOW A;  2HM8 A;  2WXG A;  4U63 A;  3B7S A;  5LX8 A;  5ENR D;  4PS8 A;  3MKQ B;  1NI1 A;  3HHM A;  5M72 A;  3QAQ A;  5FQ8 A;  4H7Y A;  3CEQ A;  3I3N A;  2PNN A;  3U66 A;  3CHM A;  1H6O A;  4YDO A;  2LO6 A;  4ATZ D;  3QWP A;  1EDU A;  3QKY A;  5CMW A;  3MCX A;  3ABK E;  2AW6 A;  1LD8 A;  2R02 A;  3D9I A;  2CHZ A;  2BED A;  1TYQ G;  4J8F A;  2DZO A;  4A55 A;  2ILR A;  3TXN A;  3PVL A;  5HQ8 A;  3QC1 A;  3RRU A;  3L9T A;  3ULE G;  2XZD G;  2L0I A;  3PZ1 A;  1P5Q A;  2NXP A;  3UM1 A;  4CT4 A;  3CHQ A;  2IOS A;  5CCM A;  1KT0 A;  1KPS B;  4ILG A;  4OAV B;  2H6G A;  1OWN A;  3CV0 A;  4YVO A;  1O1R A;  2KCV A;  2RFM A;  4BY6 A;  3ML8 A;  4GTM A;  3OTN A;  1WG0 A;  3FTX A;  4C9B B;  4O60 A;  3APF A;  2JLB A;  2ZGG A;  3VLD A;  4BSX A;  3DSU A;  5LCW C;  1SA5 A;  2QFC A;  3PE4 A;  5J90 A;  3ZHE B;  4UQX A;  4GYW A;  3PNT B;  4DLQ A;  3C3Q A;  3L82 A;  3T9K A;  4DI4 A;  2C0L A;  3ZFW A;  5G04 J;  3I5P A;  2R03 A;  3SFZ A;  3C5R A;  4QFV A;  4BEP A;  4BES A;  2ION A;  4Q94 A;  1OY3 D;  4DX6 D;  1H0A A;  2OVB A;  3BEE A;  4HOS A;  4JVS A;  1N52 A;  2E2E A;  3B7U X;  3EHM A;  4I1M A;  2V5Q C;  3R7Q A;  3FUL A;  5T8I A;  1N4R A;  1N0R A;  3T5X A;  1Z3X A;  4LG6 A;  3PZ3 A;  3SD5 A;  1FVH A;  3Q5M A;  4N3C A;  1TN8 A;  5BXU A;  3SY2 A;  1L5J A;  4JA9 A;  3VTY A;  4U0Z A;  1WAO 1;  2X6J A;  5CBN A;  1LF8 A;  1N54 A;  2OEV A;  4F3V A;  4R7L A;  3APC A;  4DI3 A;  4HXI A;  4I1O B;  5KJM A;  3C98 A;  2J49 A;  3MJW A;  4HI8 A;  1JUQ A;  2R59 A;  3MEK A;  3PUK A;  3B7R L;  3PE3 A;  4B8C B;  2PZI A;  3FUE A;  3RK6 A;  4A3T A;  4OVU A;  4LSZ E;  2EIN E;  3GW4 A;  3QJZ A;  4KZ0 A;  3CVQ A;  3E32 A;  2PL2 A;  4LNU D;  3UUX A;  4G1T A;  3CQC B;  4U04 A;  4WNE A;  1UOH A;  4N2Q A;  1PC2 A;  5DBK A;  4DJA A;  5T3R A;  4WNG A;  3DST A;  3HIZ A;  4GA0 A;  3RSE G;  4GTQ A;  3CVU A;  4JD2 G;  3L13 A;  3DWL G;  2R17 C;  4AM9 A;  3FHE A;  3L16 A;  3RO3 A;  4BER A;  5CEC B;  2P9K G;  2P9I G;  3EDT B;  3LJN A;  2OND A;  5LCW J;  3FWV A;  2EQX A;  4UWF A;  2L6B A;  4CGW A;  5JMN D;  4PH4 B;  1TNZ A;  1OCZ E;  1HF8 A;  2BUG A;  4ME2 A;  4WWP A;  1Y6I A;  3D9N A;  3CQG B;  3TG5 A;  5HI7 A;  2NYJ A;  5D0O D;  3P2B A;  1SA4 A;  3AU4 A;  4JB8 P;  2PM7 A;  3TJP A;  2ZIS A;  2WXK A;  3RU0 A;  4WUY A;  4FA6 A;  1EYH A;  3D9M A;  4JHK A;  3TWX A;  5KJL A;  5HS0 A;  2WXP A;  2LXM A;  4CDM A;  3G2S A;  1N4S A;  3MKR A;  3LDZ A;  1NL4 A;  3S7D A;  5FJY A;  2XEE A;  4I2W A;  3ZW3 A;  4FHJ A;  2WMO A;  2WMN A;  5FIO A;  1E7U A;  3DEO A;  4JPS A;  3UI2 A;  4I9E A;  4JEU A;  2B6C A;  2VSY A;  4LNG A;  2XEH A;  5AYW D;  3CLJ A;  4K5A B;  4I1A A;  4URK A;  4F7A A;  4PS7 A;  2QYJ A;  1OWL A;  1FT2 A;  2XRY A;  5T4Y A;  3SBT B;  4J6I A;  2Y69 E;  1E7V A;  4D10 C;  2DYR E;  3CHR A;  4JA7 A;  4GA2 A;  1FVF A;  1YYH A;  3EHN A;  1Z3Y A;  2A4Z A;  4HRM B;  1D8E A;  4O6F A;  4N5Q A;  2ZXW E;  1O5M A;  4OAU C;  4GCN A;  2A5E A;  3Q49 B;  3AJI A;  2Q7F A;  4HOQ A;  4MLP A;  3AG3 E;  1E96 B;  3DSW A;  5ANL A;  4G24 A;  1S70 B;  4QQI A;  2WXR A;  3PS6 A;  5BV1 A;  4L2L A;  3KSQ A;  4GZ3 A;  3ZU7 B;  3EIJ A;  2X6H A;  4LUN U;  3ZHE A;  4DX1 A;  4A3V A;  4HVB A;  4HRN A;  5HRY A;  3UQ3 A;  3FP3 A;  3HXB A;  2CHX A;  2XRZ A;  2EIK E;  1SVX A;  3VLE A;  4YND A;  5B3S E;  3E34 A;  2YQ8 A;  2VJ8 A;  3R9A B;  1N0Q A;  2XHE A;  2V5F A;  3Q75 A;  5BW8 C;  4GTR A;  3IHV A;  2J4B A;  4HB5 A;  4GTO A;  4I43 A;  2VTB B;  1K1B A;  3N71 A;  4EZJ A;  1MX4 A;  5AEN A;  1BI7 B;  4XI9 A;  4UWK A;  3ESK A;  3EU9 A;  3I4G A;  4GAA A;  4JZY A;  4G2V A;  3RAU A;  5KNH D;  4N2S A;  4GTP A;  2J9Q A;  3IV0 A;  5B1B E;  4I6E A;  2IO2 C;  3PRZ A;  2LSV A;  1HU3 A;  5C2Y A;  3QOU A;  3ZKJ A;  3BQO A;  2QY7 A;  5KNG A;  2CHW A;  3EHR A;  5FZR A;  3RRM B;  3Q9N C;  4L7T A;  1S64 A;  2AXV A;  4HBD A;  4I17 A;  3ZYL A;  3GZ2 A;  3CVL A;  1IYG A;  2V8S E;  5ENO D;  4YVQ C;  1Y8M A;  3APD A;  2RFA A;  4KMO A;  2WQ7 A;  3CVW A;  2OVF A;  5CBO A;  2YHC A;  4C0M A;  3Q7A A;  3C3R A;  3SQV A;  2HO1 A;  1K1A A;  1TN7 A;  4L23 A;  4GPM A;  3HRA A;  1HO8 A;  3FUF A;  5KBA A;  3G2T A;  1QNF A;  3J5Q B;  3PRE A;  3V30 A;  4FAD A;  3L22 A;  2DZN A;  2VGX A;  2YHE A;  3GYZ A;  4LCT A;  1NA0 A;  3QWV A;  3FUK A;  3IKO B;  1EF1 C;  4J8S A;  1JWF A;  2DIW A;  3UX4 A;  3FUI A;  3HVE B;  3FU5 A;  2CG2 A;  4J8E A;  2XQ0 A;  5AQB A;  2GW1 A;  3FTY A;  2L9B A;  4WNF A;  3FY4 A;  4MS6 A;  1QQE A;  3E37 A;  2R5S A;  2IEJ A;  2IO3 C;  3UIO C;  5AQA A;  2J8S D;  3TAX A;  2WQH A;  5FWQ A;  4HRL A;  4FU3 A;  2P9L G;  1H2V C;  4EZL A;  5D2M C;  3ABL E;  3LCA A;  3LVR E;  3URZ A;  3DSX A;  2LAI A;  2NC9 A;  4O1O A;  4A1S A;  4JC8 A;  4B93 B;  4FUL A;  4GTV A;  2ETB A;  5AN8 A;  1JCR A;  2J08 A;  2X3M A;  1Z6T A;  4EBA G;  1UJJ A;  3D3M A;  4GPK A;  2C0M A;  5AQ7 A;  1OUV A;  1PAQ A;  4HOU A;  1E8X A;  4M7C A;  2IJG X;  1BLX B;  2IF4 A;  4EQF A;  3QDN A;  4YDW A;  1BPO A;  4AY6 A;  4GZ6 A;  1HG2 A;  1HH8 A;  3NF1 A;  2BF0 X;  3LPZ A;  5JHB A;  3UTM A;  1OWM A;  2GGF A;  1IHB A;  3E4B A;  4JW1 A;  3CIA A;  3K9I A;  3QB2 A;  3NBN B;  3DPY A;  4ABN A;  1TEZ A;  3BU8 A;  1NFI E;  1WDY A;  5EIL A;  3SI5 A;  3PUJ A;  3NB2 A;  4ANW A;  1JWG A;  1SZA A;  1U3D A;  5FT9 A;  2JEK A;  3JQ1 A;  2WM9 A;  2I9C A;  3DPD A;  4WWN A;  1DC2 A;  2XCC A;  3TG4 A;  2KBX A;  3B7B A;  3F6Q A;  1IKN D;  1N4P A;  3FEY A;  4ANV A;  4U8V D;  4HLE A;  3QK0 A;  2J07 A;  4UWH A;  4HI9 A;  1K8K G;  1MX6 A;  5CEA A;  2V0P A;  3WG7 E;  3ZVV A;  4C0E A;  1AWC B;  3HG0 D;  4JEH A;  2LSU A;  2WXH A;  4BTB A;  2YNQ A;  2MHK A;  4DUI A;  3FUH A;  3AS5 A;  4NQ0 A;  3ZIM A;  2KZT A;  4XIF A;  2OCC E;  4P29 A;  1OT8 A;  3GZ1 A;  1DNP A;  1E8Y A;  5BNW A;  3ZNG A;  3ZRH A;  5AAR A;  3KEA A;  4GMR A;  4AY5 A;  3ZXP A;  1HX8 A;  1D8D A;  2WXQ A;  3DXM G;  1NP7 A;  3V79 K;  4M3O A;  2WPV A;  5AJL A;  4DX7 D;  2QYU A;  3PZ2 A;  5HKP A;  3UM0 A;  5CMY A;  5FZS A;  5CHE E;  4TUM A;  4RG9 A;  4GML A;  3UM2 A;  1Q2Z A;  1U3C A;  3LJ3 A;  3PH0 C;  2LNI A;  2EIM E;  3UM3 A;  2VTB A;  1W3B A;  1H2U A;  5BT1 A;  1IQU A;  3ASF A;  4N39 A;  1JCS A;  3TL5 A;  3CHP A;  2LUH A;  2F8X K;  4NIK A;  3R7R A;  3LEW A;  4C48 B;  5EYL A;  3CHO A;  4A1G A;  3LVQ E;  5ARF A;  3LY8 A;  5JJ6 A;  4G11 A;  3CHS A; 
#chains in the Genus database with same CATH homology
 4GTT A;  1TNZ A;  3DSS A;  3PZ1 A;  1O1S A;  1TN6 A;  3KSL A;  3E33 A;  1D8E A;  3Q7F A;  3DSX A;  4YDE A;  2H6G A;  1S64 A;  1O5M A;  1O1R A;  1O1T A;  4GTV A;  1FT1 A;  1JCR A;  4GTM A;  1S63 A;  1TNU A;  1SA4 A;  3DSW A;  2ZIS A;  1TNB A;  1MZC A;  3DSU A;  3KSQ A;  2F0Y A;  1N4Q A;  1N95 A;  3HXD A;  1D8D A;  1SA5 A;  2H6H A;  3EU5 A;  3E32 A;  3E30 A;  3Q7A A;  3Q78 A;  1N4S A;  1TN7 A;  1NL4 A;  3PZ2 A;  3HXB A;  2H6F A;  1LD7 A;  3C72 A;  3HXF A;  3E34 A;  4EHM A;  4LNB A;  1NI1 A;  1DCE A;  1LTX A;  3DPY A;  1N9A A;  3Q75 A;  3DST A;  3HXE A;  1KZP A;  2R2L A;  4GTR A;  1FPP A;  3HXC A;  4GTQ A;  1TNY A;  4GTO A;  3Q73 A;  4YDO A;  4GTS A;  3PZ4 A;  4LNG A;  2H6I A;  2ZIR A;  3EUV A;  1LD8 A;  1X81 A;  1KZO A;  3DSV A;  1JCS A;  1QBQ A;  1N4R A;  3E37 A;  3Q79 A;  2BED A;  3DRA A;  3SFY A;  2IEJ A;  1FT2 A;  1N4P A;  4L9P A;  1JCQ A;  4GTP A;  1TNO A;  3PZ3 A;  3SFX A;  4MBG A;  1N94 A;  1TN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...