1S70A

Complex between protein ser/thr phosphatase-1 (delta) and the myosin phosphatase targeting subunit 1 (mypt1)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
HMADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of protein phosphatase 1 regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine protein phosphatase PP1-beta (or delta) cat
total genus 101
structure length 309
sequence length 309
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1s70A00
1T70A 1SU1A 1FJMA 1HPUA 3DSCA 4J6OA 4I5NC 3RQZA 2GJUA 2WDCA 4FBKA 3ZTVA 2KKNA 2ZBMA 2CV9A 2WDEA 4H2FA 1OIEA 2Z1AA 4IL1A 1S3LA 2Z06A 4NZVA 3AV0A 2QJCA 4UT2A 2QFPA 1MF8A 5DNYA 3V4YA 3H67A 3HVQA 3T1IA 4OR9A 1V73A 3RL4A 1S95A 3TGHA 2BCDA 2QFRA 1S3MA 1QHWA 2NYLC 3N5UA 3DW8C 5EQVA 3E7AA 2JOGA 1XZWA 2HYPA 5JJTA 4TUGA 4V0XA 2A22A 3H62B 2NYMC 2WDDA 2NPPC 2XMOA 1Z2WA 4FCXA 1UTEA 4LU9A 3RL3A 1Z2XA 1IT6A 4UT3A 3RL5A 1HP1A 4ZX2A 4DT2A 3IVEA 4O4KA 3THNA 1KBPA 2AHDA 3K7WC 3QFKA 4WWLA 5JPEA 3IB8A 1M63A 1UF3A 4FBWA 1AUIA 3P71C 4FBQA 3E7BA 4O5GA 3FGAC 4B2OA 1HO5A 4G9JA 4V0WA 4I5LC 3AUZA 4LACC 2O8GA 3LL8A 5B8IA 4Q7FA 2DFJA 3DSDA 3CK2A 2HYOA 4UWQA 2USHA 2IE3C 2O8AA 5F3WA 1S8EA 2Q8UA 3EGGA 3GVEA 1W24A 4ORAA 3KBPA 3THOB 4JA7A 2BQ8X 4H2GA 2IE4C 1OIDA 1WARA 4H2IA 1U32A 3H66A 4UT3B 3ZU0A 3C5WC 4MP0A 1JK7A 3QG5C 3QFOA 4H1SA 5JPFA 4TUIA 3EGHA 4HD0A 4O24A 3K7VC 3PSOA 5IOHA 4LTYA 1USHA 1G5BA 4O43A 3H64A 3H68A 3H60A 3IB7A 4ZVZA 1NNWA 2Z72A 3C9FA 3H61A 4H2BA 3QFNA 1II7A 4XPNA 4KKZA 4KBPA 4JA9A 4MOVA 1WAO1 4ORCA 2WDFA 3PSNA 5C1VA 2R17A 5J28A 1XM7A 2IAEC 4MOYA 4DHLA 1S70A 3QFMA 1QFCA 3H69A 3H63A 3IVDA 2BDXA 5INBA 3JYFA 1S3NA 2YVTA 5HPEA 2NXFA 1T71A 4YKEA 3ICFA 4H1YP 4IYPC 4M0VA 2P6BA 1TCOA 4ORBA 4F0ZA 4DSYA 2HY1A 5GTUA 1OI8A 4V0VA
chains in the Genus database with same CATH superfamily
3D03A 1T70A 1SU1A 1FJMA 1HPUA 3DSCA 4J6OA 4I5NC 3RQZA 2GJUA 2WDCA 4FBKA 3ZTVA 2KKNA 2ZBMA 2CV9A 2WDEA 4H2FA 1OIEA 2Z1AA 4IL1A 1S3LA 2Z06A 4NZVA 3AV0A 2QJCA 4UT2A 2QFPA 1MF8A 5DNYA 2ZO9B 3V4YA 3H67A 3HVQA 3T1IA 4OR9A 1V73A 3RL4A 1S95A 3TGHA 2BCDA 2QFRA 3E0JA 1S3MA 1QHWA 2NYLC 3N5UA 3DW8C 5EQVA 3E7AA 2JOGA 1XZWA 2HYPA 5JJTA 4TUGA 4V0XA 2A22A 3H62B 2NYMC 2WDDA 2NPPC 2XMOA 1Z2WA 4FCXA 1UTEA 4LU9A 3RL3A 1Z2XA 1IT6A 4UT3A 3RL5A 1HP1A 4ZX2A 4DT2A 2YEQA 3IVEA 4O4KA 1KBPA 2AHDA 3K7WC 3QFKA 4WWLA 3THNA 5JPEA 3IB8A 1M63A 1UF3A 4FBWA 1AUIA 3P71C 4FBQA 3E7BA 4O5GA 3FGAC 4B2OA 1HO5A 4G9JA 2ZOAA 4V0WA 4I5LC 3AUZA 4LACC 2O8GA 3LL8A 5B8IA 4Q7FA 2DFJA 3DSDA 3CK2A 2HYOA 4UWQA 2USHA 2IE3C 2O8AA 2DXNA 5F3WA 1S8EA 2Q8UA 3EGGA 3GVEA 1W24A 4ORAA 3KBPA 3THOB 4JA7A 2BQ8X 4H2GA 2IE4C 1OIDA 1WARA 4H2IA 1U32A 3H66A 4UT3B 3ZU0A 3C5WC 4MP0A 1JK7A 3QG5C 3QFOA 4H1SA 5JPFA 4TUIA 3EGHA 4HD0A 4O24A 3K7VC 3PSOA 5IOHA 4LTYA 1USHA 1G5BA 4O43A 3H64A 3H68A 3H60A 3IB7A 4ZVZA 1NNWA 2DXLA 2Z72A 3C9FA 3H61A 4H2BA 3QFNA 1II7A 4XPNA 4KKZA 4KBPA 4JA9A 4MOVA 1WAO1 4ORCA 2WDFA 3PSNA 5C1VA 2R17A 5J28A 1XM7A 2IAEC 4MOYA 4DHLA 1S70A 3QFMA 1QFCA 3H69A 3H63A 3IVDA 2BDXA 5INBA 3JYFA 1S3NA 2YVTA 5HPEA 2NXFA 1T71A 4YKEA 3ICFA 4H1YP 4IYPC 4M0VA 2P6BA 1TCOA 3FLOA 4ORBA 4F0ZA 4DSYA 2HY1A 5GTUA 1OI8A 4V0VA
chains in the Genus database with same CATH topology
3D03A 1T70A 1SU1A 1FJMA 1HPUA 3DSCA 4J6OA 4I5NC 3RQZA 2GJUA 2WDCA 4FBKA 3ZTVA 2KKNA 2ZBMA 2CV9A 2WDEA 4H2FA 1OIEA 2Z1AA 4IL1A 1S3LA 2Z06A 4NZVA 3AV0A 2QJCA 4UT2A 2QFPA 1MF8A 5DNYA 2ZO9B 3V4YA 3H67A 3HVQA 3T1IA 4OR9A 1V73A 3RL4A 1S95A 3TGHA 2BCDA 2QFRA 3E0JA 1S3MA 1QHWA 2NYLC 3N5UA 3DW8C 5EQVA 3E7AA 2JOGA 1XZWA 2HYPA 5JJTA 4TUGA 4V0XA 2A22A 3H62B 2NYMC 2WDDA 2NPPC 2XMOA 1Z2WA 4FCXA 1UTEA 4LU9A 3RL3A 1Z2XA 1IT6A 4UT3A 3RL5A 1HP1A 4ZX2A 4DT2A 2YEQA 3IVEA 4O4KA 1KBPA 2AHDA 3K7WC 3QFKA 4WWLA 3THNA 5JPEA 3IB8A 1M63A 1UF3A 4FBWA 1AUIA 3P71C 4FBQA 3E7BA 4O5GA 3FGAC 4B2OA 1HO5A 4G9JA 2ZOAA 4V0WA 4I5LC 3AUZA 4LACC 2O8GA 3LL8A 5B8IA 4Q7FA 2DFJA 3DSDA 3CK2A 2HYOA 4UWQA 2USHA 2IE3C 2O8AA 2DXNA 5F3WA 1S8EA 2Q8UA 3EGGA 3GVEA 1W24A 4ORAA 3KBPA 3THOB 4JA7A 2BQ8X 4H2GA 2IE4C 1OIDA 1WARA 4H2IA 1U32A 3H66A 4UT3B 3ZU0A 3C5WC 4MP0A 1JK7A 3QG5C 3QFOA 4H1SA 5JPFA 4TUIA 3EGHA 4HD0A 4O24A 3K7VC 3PSOA 5IOHA 4LTYA 1USHA 1G5BA 4O43A 3H64A 3H68A 3H60A 3IB7A 4ZVZA 1NNWA 2DXLA 2Z72A 3C9FA 3H61A 4H2BA 3QFNA 1II7A 4XPNA 4KKZA 4KBPA 4JA9A 4MOVA 1WAO1 4ORCA 2WDFA 3PSNA 5C1VA 2R17A 5J28A 1XM7A 2IAEC 4MOYA 4DHLA 1S70A 3QFMA 1QFCA 3H69A 3H63A 3IVDA 2BDXA 5INBA 3JYFA 1S3NA 2YVTA 5HPEA 2NXFA 1T71A 4YKEA 3ICFA 4H1YP 4IYPC 4M0VA 2P6BA 1TCOA 3FLOA 4ORBA 4F0ZA 4DSYA 2HY1A 5GTUA 1OI8A 4V0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T70 A;  1SU1 A;  1FJM A;  1HPU A;  3DSC A;  4J6O A;  4I5N C;  3RQZ A;  2GJU A;  2WDC A;  4FBK A;  3ZTV A;  2KKN A;  2ZBM A;  2CV9 A;  2WDE A;  4H2F A;  1OIE A;  2Z1A A;  4IL1 A;  1S3L A;  2Z06 A;  4NZV A;  3AV0 A;  2QJC A;  4UT2 A;  2QFP A;  1MF8 A;  5DNY A;  3V4Y A;  3H67 A;  3HVQ A;  3T1I A;  4OR9 A;  1V73 A;  3RL4 A;  1S95 A;  3TGH A;  2BCD A;  2QFR A;  1S3M A;  1QHW A;  2NYL C;  3N5U A;  3DW8 C;  5EQV A;  3E7A A;  2JOG A;  1XZW A;  2HYP A;  5JJT A;  4TUG A;  4V0X A;  2A22 A;  3H62 B;  2NYM C;  2WDD A;  2NPP C;  2XMO A;  1Z2W A;  4FCX A;  1UTE A;  4LU9 A;  3RL3 A;  1Z2X A;  1IT6 A;  4UT3 A;  3RL5 A;  1HP1 A;  4ZX2 A;  4DT2 A;  3IVE A;  4O4K A;  3THN A;  1KBP A;  2AHD A;  3K7W C;  3QFK A;  4WWL A;  5JPE A;  3IB8 A;  1M63 A;  1UF3 A;  4FBW A;  1AUI A;  3P71 C;  4FBQ A;  3E7B A;  4O5G A;  3FGA C;  4B2O A;  1HO5 A;  4G9J A;  4V0W A;  4I5L C;  3AUZ A;  4LAC C;  2O8G A;  3LL8 A;  5B8I A;  4Q7F A;  2DFJ A;  3DSD A;  3CK2 A;  2HYO A;  4UWQ A;  2USH A;  2IE3 C;  2O8A A;  5F3W A;  1S8E A;  2Q8U A;  3EGG A;  3GVE A;  1W24 A;  4ORA A;  3KBP A;  3THO B;  4JA7 A;  2BQ8 X;  4H2G A;  2IE4 C;  1OID A;  1WAR A;  4H2I A;  1U32 A;  3H66 A;  4UT3 B;  3ZU0 A;  3C5W C;  4MP0 A;  1JK7 A;  3QG5 C;  3QFO A;  4H1S A;  5JPF A;  4TUI A;  3EGH A;  4HD0 A;  4O24 A;  3K7V C;  3PSO A;  5IOH A;  4LTY A;  1USH A;  1G5B A;  4O43 A;  3H64 A;  3H68 A;  3H60 A;  3IB7 A;  4ZVZ A;  1NNW A;  2Z72 A;  3C9F A;  3H61 A;  4H2B A;  3QFN A;  1II7 A;  4XPN A;  4KKZ A;  4KBP A;  4JA9 A;  4MOV A;  1WAO 1;  4ORC A;  2WDF A;  3PSN A;  5C1V A;  2R17 A;  5J28 A;  1XM7 A;  2IAE C;  4MOY A;  4DHL A;  1S70 A;  3QFM A;  1QFC A;  3H69 A;  3H63 A;  3IVD A;  2BDX A;  5INB A;  3JYF A;  1S3N A;  2YVT A;  5HPE A;  2NXF A;  1T71 A;  4YKE A;  3ICF A;  4H1Y P;  4IYP C;  4M0V A;  2P6B A;  1TCO A;  4ORB A;  4F0Z A;  4DSY A;  2HY1 A;  5GTU A;  1OI8 A;  4V0V A; 
#chains in the Genus database with same CATH topology
 3D03 A;  1T70 A;  1SU1 A;  1FJM A;  1HPU A;  3DSC A;  4J6O A;  4I5N C;  3RQZ A;  2GJU A;  2WDC A;  4FBK A;  3ZTV A;  2KKN A;  2ZBM A;  2CV9 A;  2WDE A;  4H2F A;  1OIE A;  2Z1A A;  4IL1 A;  1S3L A;  2Z06 A;  4NZV A;  3AV0 A;  2QJC A;  4UT2 A;  2QFP A;  1MF8 A;  5DNY A;  2ZO9 B;  3V4Y A;  3H67 A;  3HVQ A;  3T1I A;  4OR9 A;  1V73 A;  3RL4 A;  1S95 A;  3TGH A;  2BCD A;  2QFR A;  3E0J A;  1S3M A;  1QHW A;  2NYL C;  3N5U A;  3DW8 C;  5EQV A;  3E7A A;  2JOG A;  1XZW A;  2HYP A;  5JJT A;  4TUG A;  4V0X A;  2A22 A;  3H62 B;  2NYM C;  2WDD A;  2NPP C;  2XMO A;  1Z2W A;  4FCX A;  1UTE A;  4LU9 A;  3RL3 A;  1Z2X A;  1IT6 A;  4UT3 A;  3RL5 A;  1HP1 A;  4ZX2 A;  4DT2 A;  2YEQ A;  3IVE A;  4O4K A;  1KBP A;  2AHD A;  3K7W C;  3QFK A;  4WWL A;  3THN A;  5JPE A;  3IB8 A;  1M63 A;  1UF3 A;  4FBW A;  1AUI A;  3P71 C;  4FBQ A;  3E7B A;  4O5G A;  3FGA C;  4B2O A;  1HO5 A;  4G9J A;  2ZOA A;  4V0W A;  4I5L C;  3AUZ A;  4LAC C;  2O8G A;  3LL8 A;  5B8I A;  4Q7F A;  2DFJ A;  3DSD A;  3CK2 A;  2HYO A;  4UWQ A;  2USH A;  2IE3 C;  2O8A A;  2DXN A;  5F3W A;  1S8E A;  2Q8U A;  3EGG A;  3GVE A;  1W24 A;  4ORA A;  3KBP A;  3THO B;  4JA7 A;  2BQ8 X;  4H2G A;  2IE4 C;  1OID A;  1WAR A;  4H2I A;  1U32 A;  3H66 A;  4UT3 B;  3ZU0 A;  3C5W C;  4MP0 A;  1JK7 A;  3QG5 C;  3QFO A;  4H1S A;  5JPF A;  4TUI A;  3EGH A;  4HD0 A;  4O24 A;  3K7V C;  3PSO A;  5IOH A;  4LTY A;  1USH A;  1G5B A;  4O43 A;  3H64 A;  3H68 A;  3H60 A;  3IB7 A;  4ZVZ A;  1NNW A;  2DXL A;  2Z72 A;  3C9F A;  3H61 A;  4H2B A;  3QFN A;  1II7 A;  4XPN A;  4KKZ A;  4KBP A;  4JA9 A;  4MOV A;  1WAO 1;  4ORC A;  2WDF A;  3PSN A;  5C1V A;  2R17 A;  5J28 A;  1XM7 A;  2IAE C;  4MOY A;  4DHL A;  1S70 A;  3QFM A;  1QFC A;  3H69 A;  3H63 A;  3IVD A;  2BDX A;  5INB A;  3JYF A;  1S3N A;  2YVT A;  5HPE A;  2NXF A;  1T71 A;  4YKE A;  3ICF A;  4H1Y P;  4IYP C;  4M0V A;  2P6B A;  1TCO A;  3FLO A;  4ORB A;  4F0Z A;  4DSY A;  2HY1 A;  5GTU A;  1OI8 A;  4V0V A; 
#chains in the Genus database with same CATH homology
 3D03 A;  1T70 A;  1SU1 A;  1FJM A;  1HPU A;  3DSC A;  4J6O A;  4I5N C;  3RQZ A;  2GJU A;  2WDC A;  4FBK A;  3ZTV A;  2KKN A;  2ZBM A;  2CV9 A;  2WDE A;  4H2F A;  1OIE A;  2Z1A A;  4IL1 A;  1S3L A;  2Z06 A;  4NZV A;  3AV0 A;  2QJC A;  4UT2 A;  2QFP A;  1MF8 A;  5DNY A;  2ZO9 B;  3V4Y A;  3H67 A;  3HVQ A;  3T1I A;  4OR9 A;  1V73 A;  3RL4 A;  1S95 A;  3TGH A;  2BCD A;  2QFR A;  3E0J A;  1S3M A;  1QHW A;  2NYL C;  3N5U A;  3DW8 C;  5EQV A;  3E7A A;  2JOG A;  1XZW A;  2HYP A;  5JJT A;  4TUG A;  4V0X A;  2A22 A;  3H62 B;  2NYM C;  2WDD A;  2NPP C;  2XMO A;  1Z2W A;  4FCX A;  1UTE A;  4LU9 A;  3RL3 A;  1Z2X A;  1IT6 A;  4UT3 A;  3RL5 A;  1HP1 A;  4ZX2 A;  4DT2 A;  2YEQ A;  3IVE A;  4O4K A;  1KBP A;  2AHD A;  3K7W C;  3QFK A;  4WWL A;  3THN A;  5JPE A;  3IB8 A;  1M63 A;  1UF3 A;  4FBW A;  1AUI A;  3P71 C;  4FBQ A;  3E7B A;  4O5G A;  3FGA C;  4B2O A;  1HO5 A;  4G9J A;  2ZOA A;  4V0W A;  4I5L C;  3AUZ A;  4LAC C;  2O8G A;  3LL8 A;  5B8I A;  4Q7F A;  2DFJ A;  3DSD A;  3CK2 A;  2HYO A;  4UWQ A;  2USH A;  2IE3 C;  2O8A A;  2DXN A;  5F3W A;  1S8E A;  2Q8U A;  3EGG A;  3GVE A;  1W24 A;  4ORA A;  3KBP A;  3THO B;  4JA7 A;  2BQ8 X;  4H2G A;  2IE4 C;  1OID A;  1WAR A;  4H2I A;  1U32 A;  3H66 A;  4UT3 B;  3ZU0 A;  3C5W C;  4MP0 A;  1JK7 A;  3QG5 C;  3QFO A;  4H1S A;  5JPF A;  4TUI A;  3EGH A;  4HD0 A;  4O24 A;  3K7V C;  3PSO A;  5IOH A;  4LTY A;  1USH A;  1G5B A;  4O43 A;  3H64 A;  3H68 A;  3H60 A;  3IB7 A;  4ZVZ A;  1NNW A;  2DXL A;  2Z72 A;  3C9F A;  3H61 A;  4H2B A;  3QFN A;  1II7 A;  4XPN A;  4KKZ A;  4KBP A;  4JA9 A;  4MOV A;  1WAO 1;  4ORC A;  2WDF A;  3PSN A;  5C1V A;  2R17 A;  5J28 A;  1XM7 A;  2IAE C;  4MOY A;  4DHL A;  1S70 A;  3QFM A;  1QFC A;  3H69 A;  3H63 A;  3IVD A;  2BDX A;  5INB A;  3JYF A;  1S3N A;  2YVT A;  5HPE A;  2NXF A;  1T71 A;  4YKE A;  3ICF A;  4H1Y P;  4IYP C;  4M0V A;  2P6B A;  1TCO A;  3FLO A;  4ORB A;  4F0Z A;  4DSY A;  2HY1 A;  5GTU A;  1OI8 A;  4V0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...