1S70B

Complex between protein ser/thr phosphatase-1 (delta) and the myosin phosphatase targeting subunit 1 (mypt1)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
291
Chain Sequence
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRKKTKVKFDDGAVFLAACSSGDTEEVLRLLERGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEYLISQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQARYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMEAVNKVGQTAFDVADEDILGYLEELQKKQNLLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of protein phosphatase 1 regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine protein phosphatase PP1-beta (or delta) cat
total genus 80
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
B PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1s70B01
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1s70B02
5KWDA 4BERA 5ENPD 4U8YD 5AQBA 4TUMA 1OY3D 3D9HA 3V31A 3NOGD 4G8KA 4LNUD 1N0RA 3TWXA 2ETBA 1SVXA 4HRNA 5BXOA 4JB8P 5HRYA 4HB5A 5AQ9A 1AP7A 1IXVA 2V4HC 3W9FA 4Z68A 2A5EA 5CBOA 4J7WA 3AJIA 3EHQA 4LSZE 1DCQA 3TWVA 1IKND 2F8YA 3ZKJA 5JMND 1A5EA 1K1BA 2V5QC 2BKGA 1IHBA 4BESA 5EIDA 4ZFHA 2F8XK 2RFAA 4DX2A 2ETAA 4C48B 4A63B 3J5PA 5EYPF 1G3NB 3HRAA 1BI8B 3V2OA 5JA4D 4F6RD 1BU9A 4BEPA 4ATZD 1WDYA 4G8LA 4B93B 5CEDB 4F1PA 2VGEA 1N0QA 5EYLA 3NBNB 5KNHD 3IXEA 1NFIE 3KEAA 1MX6A 4GMRA 2JABA 5ENOD 1BD8A 5AARA 5CERB 3DEPA 4DX5D 2Y0BG 1K1AA 4LG6A 5CBNA 2DZOA 3TWTA 4NIKA 4ZHBA 3F6QA 2XENA 5ENRD 4K5BA 4RLYA 3TWQA 4CZ2D 1YYHA 2L6BA 4YDWA 1K3ZD 5EIBE 5AN8A 2KXPC 1BLXB 4HNAD 5KNGA 3JXJA 4CYMD 1S70B 4K5AB 2KBXA 2QYJA 3TWSA 1MX4A 4DRXE 4HI9A 3ZUVB 3W9GA 5CECB 5FIOA 5BXUA 3C5RA 3EU9A 5KBAA 4DX6D 2F37A 4N5QA 1WG0A 1MJ0A 2AJAA 3B95A 2P2CP 3V79K 1UOHA 5EN5D 2MYOA 1N11A 5ENQD 5HS0A 3Q9NC 2XEEA 2NYJA 2XZDG 2PNNA 3Q9UC 4U8VD 5D66A 4HI8A 1TR4A 4HBDA 3TWRA 2DVWA 2DZNA 4HLLA 3UTMA 2ZGGA 4DUIA 2Y1LE 4OAUC 4YDYA 3DEOA 2B0OE 3AAAC 5AQAA 4O1OA 3V2XA 1DC2A 4GPMA 1OT8A 3B7BA 5FINA 3T9KA 1BI7B 5ENTD 4HQDA 2DWZA 3TWUA 3UXGA 3JUEA 3T8KA 3EHRA 3SO8A 1YCSB 4U96D 4O1PA 2XEHA 1SW6A 3J5QB 4J8YA 4QQIA 5AQ7A 2QC9A 4DX1A 3HG0D 4O60A 4DX7D 1D9SA 4HRLA 2ZGDA 3ZU7B 2RFMA 4U95D 4BSZB 1AWCB 1MX2A 3V30A 5ITZF 5HKPA 5EILA 5CEAA 5AAOA 4QFVA 2FO1E 4OAVB 3TWWA 2XZTG 4BETA 5ENSD 3ZNGA 1MYOA 3NOCD 2HE0A 1YMPA 3JXIA 4K5CA 4UUCA 4HRMB 2ETCA 2BKKB 3UI2A 3LJNA 2J8SD 1QYMA
chains in the Genus database with same CATH superfamily
4CT0A 2H6IA 1TNUA 3TWXA 1SVXA 3VLDA 5CMWA 3E4BA 3UM1A 4MS6A 4Z68A 3CSFA 3GYZA 3PE3A 4P29A 5KJKA 1TNZA 4G25A 4KVMA 2AXUA 3CSTA 5BPPA 2BF0X 1N4SA 1NI1A 1NFIE 4FLBA 4XIFA 1OXJA 3UUXA 3KD7A 2AWIA 4YVOA 1TN6A 3TWQA 4RQIA 1MX4A 2XCCA 1V54E 5EN5D 3G2TA 1H0AA 4JHKA 1QQEA 2VSNA 4APFA 4JC8A 1OWMA 4HLLA 3Q78A 4GZDA 1NZNA 2ZISA 2XGMA 3C3RA 3SHFA 3Q47B 3KEZA 3ZEFA 1B89A 1BI7B 4CGWA 5EX3A 4AM9A 4U0SA 1TN7A 4O1PA 4DX1A 4MRUA 3HG0D 2R17C 4GTSA 4IN3B 3LVQE 4L1BA 3O48A 4ATGA 4U8HA 3ZNGA 3PZ4A 3LDZA 4UWLA 4GAAA 2BEDA 4JL0A 2ZU6B 4NQ0A 3ASOE 3GW4A 3NOGD 5FTPA 2ETBA 4HRNA 2I6HA 4JB8P 3CVUA 5AQ9A 1KT0A 3CVXA 4U0UA 4PUCA 5CBOA 1H19A 3P2BA 3DSVA 3ESKA 4GYWA 2OV8A 3DSTA 3QKYA 4A63B 1BI8B 1N94A 4I2ZA 4F6RD 4BEPA 2M63A 1JUQA 5E75A 3MX3A 1TNOA 2A5UA 2DZOA 3L13A 5A7DB 5JJ6A 2LXMA 4UWFA 1N4QA 2MRIA 2KXPC 4HNAD 1HE8A 5LP0A 4TXPA 3W9GA 2RKKA 3RKVA 2X6IA 4XKBA 1HF8A 3PUKA 2J07A 4DLOA 2XHEA 5KJMA 3FTZA 3EHNA 1Y8MA 2R59A 3T8KA 3TXMA 3E32A 2NSZA 3E30A 4L2LA 3CVNA 3CKBA 4C0MA 2WQHA 2YHEA 4TXQA 3UT7A 4G23A 3U64A 4A3VA 3JXIA 3RO3A 5FJYA 2GROB 5AQBA 4JEUA 3EHMA 5IY5E 3U9WA 3ZIMA 2XPZA 1N95A 1H6OA 1LF8A 3DPYA 3ZPJA 4U04A 4KXKB 4EZJA 3EJNA 1H6PA 3B7RL 2ETAA 5LFAA 5BV1A 3PEVB 2LNIA 5FWQA 3V2OA 3I4RB 3PREA 3VLFA 3FH7A 3UT4A 2Q7FA 2WQ7A 2XQ0A 3QWWA 1ELRA 2VGXB 3VTYA 2ZIRA 4HOQA 3ASFA 4YDWA 2VSYA 5EIBE 3RSEG 1BLXB 2HYZA 3EIJA 3FUHA 3TWSA 2OCCE 5T3RA 4GZ3A 1WG0A 2P2CP 1UOHA 3L17A 3ZYQA 2P9IG 2FF4A 3LS8A 3MGBA 2OOEA 2LUHA 2Y1LE 2CFUA 3AAAC 4AJWA 5ANRA 1O1TA 3JYSA 3UQ3A 4HQDA 4GTPA 3CKCA 1N52A 2I2OA 3J5QB 2MHKA 3NZUA 4IULA 5EILA 1LTXA 4U07A 5KCMA 3CVVA 3CVWA 4EBAA 3UI2A 1E7VA 4AVXA 1ZB1A 2EIJE 3Q5MA 4BERA 4CT4A 2VTBA 3TAXA 3FH8A 2KCVA 4F1SA 1KPSB 4G11A 3ASHA 2YHCA 2V4HC 4JEHA 5AENA 2R5SA 2Y69E 1EDUA 4JXTA 4X8QA 2AXZA 4N3BA 3BUAA 3HHMA 3Q73A 5ARGA 1BPOA 3QAQA 1QBQA 4M7CA 3CHOA 4I6EA 3ULEG 5CBNA 3BEEA 4OYSA 2L6BA 3GZ2A 4FHKA 3GZ1A 2E2EA 3AU4A 4FADA 4A55A 3HVEA 5G05C 4N5QA 1EF1C 2AJAA 3FUIA 2I9CA 4B89A 4F7AA 2WXHA 4N3AA 2IJGX 4G2VA 3ZVVA 2R05A 5DBKA 4MLPA 1ELKA 4YDYA 3QWPA 4HXIA 4WNDA 3U4TA 4XI9A 4EECA 5LX8A 4J8YA 5EDSA 1ZBPA 5HKPA 3L22A 3UM2A 4KZCA 2X38A 2EQXA 3HIZA 3PNLB 3MA5A 3ESLA 3V79K 4L7TA 2Y4TA 4GA2A 3Q75A 5ENPD 4TUMA 3L54A 4KMOA 4AY5A 2BUGA 1OCRE 3W9FA 3ASDA 1H2VC 2WXIA 3CVYA 4ILGA 4B0ZA 1DCQA 3L16A 1IKND 1WY6A 1RZ4A 3TG4A 4N5CA 1N4PA 4N39A 5BNWA 3CQCB 5EYPF 1BU9A 1KZPA 3NBNB 3JQ1A 1NP7A 2JABA 4ANWA 1W3BA 3G2WA 3JCKC 4NIKA 4CDMA 2J4DA 4GYOA 4OVUA 4FU3A 3S7FA 3FY4A 4RSYA 3FTUA 2V5FA 1HFAA 3JXJA 3LJ3A 2P9PG 4YDOA 3RIBA 2RD0A 2WXRA 3TGOA 3G2UA 5AJDA 4HI9A 3ZUVB 4TXRA 3ENEA 2XGOA 4WNEA 2XCBA 3LKUA 3APDA 3PZDA 2CFZA 4J8DA 3EU5A 4PS8A 4U63A 3ISMC 1Z3YA 2VQ2A 3VLEA 5LOZA 3ONLA 2DIWA 3T9KA 3CV0A 3RU0A 3B13A 4ACLA 3JUEA 2WXQA 3ZXSA 3LYAA 2R2LA 4HFGA 2WXKA 3FUMA 3NAWA 2XZTG 4GA0A 4J8SA 1MYOA 5LCWC 5J08A 1NA3A 4CCAA 1IHGA 2NXPA 1X81A 4J8FA 1JWFA 4I6GA 3CK7A 4GZ5A 4H7XA 4HB5A 2X6FA 5C1DA 5HQ8A 3LY9A 3FTVA 1HX8A 3FULA 5FQ8A 3PVLA 3QARA 1VDYA 2F8XK 4DX2A 1A17A 1UN8A 3WXXA 4OVVA 1SZ9A 4I6JA 2CHZA 3UX4A 3O4ZA 2L0IA 4EBAG 3BU8A 4MKTA 2J08A 5FZQA 4K5BA 4RLYA 1K3ZD 3SGHA 3UIOC 3SF4A 2XS1A 3S2AA 5FIOA 2HR2A 3B95A 2DYRE 2NYJA 2XZDG 3JQ0A 2UWJG 2P9NG 3TWRA 1TJFA 3FU5A 3Q7AA 5FQ4A 4GTOA 3FFLA 4GPMA 3B7UX 3APCA 4LCTA 5A6CA 2QYUA 3B7SA 3RRUA 3TXNA 1DNPA 3MJWA 5CCMA 2YQ8A 5JHBA 3JUIA 2FO1E 4OAVB 3AG4E 3DWLG 1TNBA 1EYHA 1S0PA 2GRPB 3I5PA 4HRMB 4BX9A 3D9IA 1KLXA 4IRUA 1SZAA 3DXMG 1JCRA 4LNUD 1IQUA 2WXPA 4GTQA 3DXKG 4H7YA 5G04C 2PZIA 4U0ZA 4U7EB 3LPZA 4J7WA 1DCEA 4EZLA 4GU5A 5JMND 2Y4UA 4FJZA 4O6FA 5HI7A 1OWPA 2WXNA 1N0QA 2GRLA 1YA0A 4JW1A 5CHEE 4LG6A 3TWTA 3PZ3A 1RW2A 4GMLA 3CEQA 2X3MA 3SI5A 3L9TA 5C2YA 3FH5A 4A1GA 5T8IA 2MYOA 4UWGA 3Q9NC 5JHAA 1TR4A 4WNGA 1ZU2A 1MHQA 4Y6WA 4DUIA 5BV0A 1MQSA 2OVFA 5E76A 1OCCE 4GMJA 3SO8A 1N4RA 2AVPA 2XPYA 4XKCA 2IOSA 5B1AE 3QC1A 4DI3A 3TL5A 1AWCB 4U95D 3FTYA 3TWWA 2VSOE 4K5CA 3NQPA 3PNTB 2WMOA 3FU0A 2KZTB 3ABKE 2KATA 1N0RA 2KM4A 3HYMB 3PS6A 2IONA 2GRRB 4C0EA 3T8MA 4MBGA 4JPSA 3T5XA 3AG1E 2V5QC 2P9LG 3DSUA 3UKUG 4FA6A 4Q69A 1TN8A 2QY7A 2VGEA 3G2VA 4UI9C 4APOA 1BD8A 1O1SA 3FUJA 3HXCA 4ZHBA 3BQOA 4EQFA 2VGYA 3SZ7A 1S70B 2QYJA 4Y6CA 1H2TC 3PRZA 5B1BE 1OCZE 2ZXWE 2J9QA 5KJLA 1FPPA 3E33A 3KSLA 4J6IA 1LD7A 2XEEA 3FHEA 1X5BA 4PS3A 3DSXA 1TNYA 2WXMA 4BSXA 2ZGGA 4KYOB 4DK5A 3LEWA 3D3MA 3V2XA 1E90A 4BTAA 3TWUA 4A3TA 1YCSB 3FEXA 3D9KA 2EIKE 3V30A 3FUDA 2Y3AA 3Q15A 4B8CB 5KJNA 4ANUA 4I17A 1JCSA 5BUZA 3SFXA 3I3NA 1HG5A 1FT2A 2OEWA 2XGSA 3Q49B 4FHJA 3D9HA 2KCKA 3CHMA 1E8ZA 3NF1A 4JVSA 2A5EA 2VYIA 2J49A 2L6JA 4ILHB 2R03A 3C72A 1OWOA 3UMVA 3ABME 2RFAA 2XEVA 4LERA 5D0OD 3TG5A 5G55A 3IHYA 2DBAA 3J5PA 4BTBA 4Q94A 3D9LA 4B93B 5CEDB 5LCWJ 1E8YA 4AY6A 4DLQA 2J09A 4G24A 2LO6A 2FULA 4R7LA 2VJ8A 4G26A 3PUJA 5FZSA 1NL4A 4RVBA 2YINA 1MJ0A 3U3WA 2DYSE 1QZ2A 4NRHB 3UM0A 2FI7A 3ASGA 3C98A 4LNGA 2DZNA 3UTMA 4JHJA 1DC2A 2LAHA 3UXGA 4ANXA 3S7JA 5A23A 2QC9A 3CQGB 1D9SA 1Z3XA 2WXGA 3D9MA 5AAOA 4GYYA 5CCLA 3FTSA 4TV3A 4PS7A 2QZAA 4EZKA 3FUNA 1OY3D 3DSWA 2VGXA 5ANLA 4I2WA 3VTXA 5BXOA 5HRYA 3MKRA 1HXIA 3LVRE 2WXLA 3EHQA 3TWVA 1TYQG 1A5EA 4UQZA 2E0IA 1IHBA 3RK6A 4BESA 4ZFHA 4HOSA 3ZW3A 3HRAA 2V0PA 3MKQB 4ATZD 2AXVA 3N71A 3LY8A 3ML9A 3OXLA 3C3OA 2CHXA 4GMRA 1S64A 3ZGQA 4F3VA 2C0MA 2UY1A 2NC9A 4URKA 2WXFA 1ELWA 3ZRHA 2C0LA 3U66A 4LRZA 3D9NA 4ME2A 3RRMB 2IF4A 4PDXA 2B6CA 4AEZC 4HBDA 4C9BB 4UWHA 3OTNA 4GPKA 3KS2A 3HXDA 4GCNA 5DIZA 4O1OA 4HOUA 3EUVA 2WVIA 4TRQA 5EX0A 4FP7A 3EHRA 1SW6A 3UKRG 4G1TA 4L23A 2WM9A 3SQVA 2ZGDA 3ZU7B 4FJYA 3CVLA 4RG6A 3B7TA 2H6FA 2OEVA 2ETCA 2BKKB 3Q4AB 3K9IA 4E85A 3UM3A 4WAFA 1Z5SC 3ULQA 1AP7A 1JWGA 3CHPA 3MCXA 4BT8A 2KCLA 4JA9A 1H2UA 4D10C 3ML8A 2J4BA 5EIDA 4GA1A 3SBTB 4J8EA 1G3NB 4V3IA 2IY0C 2PM6A 2C2LA 3KEAA 4WWNA 3PH0C 3DRAA 5CERB 4DX5D 2VTBB 3I4GA 2IO3C 4J0UA 4CZ2D 5BT1A 3QDNA 4I1OB 4WWOA 2X6KA 2LAIA 2PL2A 3TJPA 4B8AA 3CVPA 3KAEA 4ACKA 5CECB 2CG3A 2KZTA 4LUNU 1PC2A 4YVQC 3QB2A 1INZA 5ENQD 3Q7FA 5AQAA 2FEZA 1U3CA 3EIQC 2IO2C 1JCQA 3FU3A 2L0TB 2R02A 4BFRA 4I43A 4GCOA 4FULA 4CDRA 1P5QA 1N9AA 5CRUA 2PQNA 3LJNA 3MV3B 2J8SD 1QYMA 3SFYA 2FO7A 4EPZA 1FT1A 4G8KA 4KT6B 2XRZA 3PZ1A 2LSVA 3RJVA 4Q96A 2V8SE 5H7PA 2QFCA 2VSXE 1E7UA 2F8YA 1FVHA 3MZLB 5FT9A 3FTXA 2BKGA 1HS6A 2YNQA 3CHSA 3E34A 5G05J 4A1SA 4JA7A 2GW1A 2I1JA 1WDYA 5T4YA 5EYLA 5KNHD 4CGVA 5FQ7A 2GRQB 3FWVA 5AARA 3FTWA 4FC8A 1YYHA 3EDTB 1QNFA 4ANVA 3CHQA 4CYMD 2KBXA 1DVPA 2OVBA 3R9MA 2KC7A 3RO2A 5JJ7A 2IOLA 4BY6A 3LY7A 1NA0A 3IBEA 3DEOA 2B0OE 1PY1A 5FINA 3CR3A 4U96D 3CGHA 4DX7D 2WPVA 4HRLA 2RFMA 4BSZB 1HG2A 1MX2A 1O5MA 2WXOA 3PZ2A 2H6HA 3NOCD 4EHMA 1SA4A 1HO8A 5KWDA 1V55E 4KVOA 1KZOA 4PH4B 4XI0A 1S63A 5JJTA 3NB2A 3V31A 5AJLA 4HORA 4UI9J 3OAWA 2P9UG 3D9OA 2A4ZA 4HVBA 4FLHA 4F53A 3MKQA 4I1MA 3QJZA 4L9PA 4GB9A 2PM7A 4LEUA 4G8LA 4F1PA 4UWKA 4AP2A 3HDXA 3IXEA 3S7DA 3AG3E 3QNKA 4E6HA 1XNFA 3BG0B 3UIPC 3CIAA 4IYPA 3L08A 4B94A 2XENA 3CHRA 5ARFA 2ONDA 3CK8A 4M3OA 5G04J 5J90A 3AG2E 2X6JA 4DRXE 3EU9A 1Q2ZA 2WQ6A 5HS0A 1D8EA 3AS4A 2PNNA 3MYVA 3HXFA 3ZYKA 5D66A 4HI8A 3Q79A 3MEKA 2BTDA 4GTMA 4DJAA 3UT8A 4AIFA 1WM5A 2P9SG 3PEUB 4XZ4A 5B3SE 4NACA 5D0QD 4DPRA 1HU3A 5CRVA 4L2YA 2LXLA 4QFVA 3FP3A 1K8KG 4BETA 3R7RA 4HLEA 4UQXA 2IFUA 3QOUA 3GZSA 1UG3A 3KSQA 2JLBA 5AIJA 4WWPA 4LNBA 4JD2G 1E8XA 1E96B 3RAUA 1TJCA 3SBSA 1SQMA 2JEKA 3SD5A 2CG2A 3CVQA 1K1BA 3ZHEA 4UQYA 1JPLA 3UINC 3CLJA 1UW4B 3OXGA 3OXFA 5JA4D 5FZRA 4BWRA 3ZFWA 1FVFA 3DSSA 3FEYA 4ILIA 4TUUA 3WG7E 3QWVA 3DPDA 3P1UA 5ENNA 3FU6A 4I1AA 4RG9A 4K5AB 2FBNA 4XEIG 1O1RA 3E37A 2F37A 1N11A 2WXJA 5FQ6A 3RRNB 3Q9UC 2MOWA 3R7QA 3ONKA 4CEMA 1IQRA 2EINE 1N54A 4NURA 1LD8A 4GZCA 4YNDA 2XS8A 1OT8A 1U3DA 3IEGA 3LCAA 3IHVA 4UI9K 4ABNA 4HS2A 3CK9A 4KZ0A 1OWNA 1WAO1 3PDNA 2UY1B 5ENSD 2HE0A 4UUCA 2GRNB 2WB2A 3HXEA 3NZSA 2PQRA 1SA5A 4AXHA 3AS5A 1IXVA 5D2MC 4LSZE 3ZKJA 4GZ6A 2X6HA 5M72A 1Z6TA 2HO1A 2GRMA 2ILRA 3FDHA 4GTRA 4DI4A 3C3QA 2Y0BG 1UJKA 3F6QA 3ZYLA 4BT9A 3L82A 3FUKA 4JHRA 4AOFA 3SNXA 2CHWA 4WUYA 1UN9A 2EIME 2V4LA 1MZCA 3C5RA 4W9RA 3ZHEB 2F0YA 4HOTA 3SY2A 2DVWA 4WNFA 1U2VG 4GTTA 4XX5A 3AS8A 3FUEA 5CMYA 4I9EA 4AV7A 1OWLA 4GTVA 2XEHA 4QQIA 5AQ7A 3AU5A 3HVEB 4YDEA 3IV0A 3FUFA 3R9AB 1OCOE 5CEAA 3APFA 3DBSA 3PE4A 1YMPA 1KT1A 4I9CA 1Y6IA 3D9JA 3UPVA 1D8DA 3ASNE 4U8YD 3LXUX 3ULYA 5EKQD 2HM8A 3HXBA 1L5JA 1HZ4A 3L6AA 3QK0A 3AJIA 5AYWD 3G2SA 2DCPA 2XRYA 4C48B 4JZYA 2EILE 4XE0A 2WMNA 2RG8A 1MX6A 5ENOD 3DEPA 1K1AA 4K03A 3ZXPA 4CRWA 2AW6A 3ZN3A 4KBQA 5ENRD 2XPIA 5BW8C 2GGFA 4BX8A 5AN8A 1H6KA 5KNGA 1GW6A 4N3CA 5BXUA 5KBAA 4DX6D 1EPUA 4N2SA 3ZYMA 2LSUA 4U8VD 2IEJA 4OAUC 3X2QE 1FCHA 1OUVA 3ABLE 2P9KG 3B7BA 5ENTD 2H6GA 2DWZA 2IQCA 1TEZA 1XGWA 4O60A 3T5VA 5G2NA 3BG1B 3S7BA 3D9PA 1PAQA 3IKOB 4K0RA 5ITZF 2P58C 4N2QA 1HH8A 1E8WA 1UJJA 3URZA 3SFZA 2I1KA 1IYGA 2L9BA 2IU1A 3MV2B 4CDNA
chains in the Genus database with same CATH topology
5KWDA 4BERA 5ENPD 4U8YD 5AQBA 4TUMA 1OY3D 3D9HA 3V31A 3NOGD 4G8KA 4LNUD 1N0RA 3TWXA 2ETBA 1SVXA 4HRNA 5BXOA 4JB8P 5HRYA 4HB5A 5AQ9A 1AP7A 1IXVA 2V4HC 3W9FA 4Z68A 2A5EA 5CBOA 4J7WA 3AJIA 3EHQA 4LSZE 1DCQA 3TWVA 1IKND 2F8YA 3ZKJA 5JMND 1A5EA 1K1BA 2V5QC 2BKGA 1IHBA 4BESA 5EIDA 4ZFHA 2F8XK 2RFAA 4DX2A 2ETAA 4C48B 4A63B 3J5PA 5EYPF 1G3NB 3HRAA 1BI8B 3V2OA 5JA4D 4F6RD 1BU9A 4BEPA 4ATZD 1WDYA 4G8LA 4B93B 5CEDB 4F1PA 2VGEA 1N0QA 5EYLA 3NBNB 5KNHD 3IXEA 1NFIE 3KEAA 1MX6A 4GMRA 2JABA 5ENOD 1BD8A 5AARA 5CERB 3DEPA 4DX5D 2Y0BG 1K1AA 4LG6A 5CBNA 2DZOA 3TWTA 4NIKA 4ZHBA 3F6QA 2XENA 5ENRD 4K5BA 4RLYA 3TWQA 4CZ2D 1YYHA 2L6BA 4YDWA 1K3ZD 5EIBE 5AN8A 2KXPC 1BLXB 4HNAD 5KNGA 3JXJA 4CYMD 1S70B 4K5AB 2KBXA 2QYJA 3TWSA 1MX4A 4DRXE 4HI9A 3ZUVB 3W9GA 5CECB 5FIOA 5BXUA 3C5RA 3EU9A 5KBAA 4DX6D 2F37A 4N5QA 1WG0A 1MJ0A 2AJAA 3B95A 2P2CP 3V79K 1UOHA 5EN5D 2MYOA 1N11A 5ENQD 5HS0A 3Q9NC 2XEEA 2NYJA 2XZDG 2PNNA 3Q9UC 4U8VD 5D66A 4HI8A 1TR4A 4HBDA 3TWRA 2DVWA 2DZNA 4HLLA 3UTMA 2ZGGA 4DUIA 2Y1LE 4OAUC 4YDYA 3DEOA 2B0OE 3AAAC 5AQAA 4O1OA 3V2XA 1DC2A 4GPMA 1OT8A 3B7BA 5FINA 3T9KA 1BI7B 5ENTD 4HQDA 2DWZA 3TWUA 3UXGA 3JUEA 3T8KA 3EHRA 3SO8A 1YCSB 4U96D 4O1PA 2XEHA 1SW6A 3J5QB 4J8YA 4QQIA 5AQ7A 2QC9A 4DX1A 3HG0D 4O60A 4DX7D 1D9SA 4HRLA 2ZGDA 3ZU7B 2RFMA 4U95D 4BSZB 1AWCB 1MX2A 3V30A 5ITZF 5HKPA 5EILA 5CEAA 5AAOA 4QFVA 2FO1E 4OAVB 3TWWA 2XZTG 4BETA 5ENSD 3ZNGA 1MYOA 3NOCD 2HE0A 1YMPA 3JXIA 4K5CA 4UUCA 4HRMB 2ETCA 2BKKB 3UI2A 3LJNA 2J8SD 1QYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KWD A;  4BER A;  5ENP D;  4U8Y D;  5AQB A;  4TUM A;  1OY3 D;  3D9H A;  3V31 A;  3NOG D;  4G8K A;  4LNU D;  1N0R A;  3TWX A;  2ETB A;  1SVX A;  4HRN A;  5BXO A;  4JB8 P;  5HRY A;  4HB5 A;  5AQ9 A;  1AP7 A;  1IXV A;  2V4H C;  3W9F A;  4Z68 A;  2A5E A;  5CBO A;  4J7W A;  3AJI A;  3EHQ A;  4LSZ E;  1DCQ A;  3TWV A;  1IKN D;  2F8Y A;  3ZKJ A;  5JMN D;  1A5E A;  1K1B A;  2V5Q C;  2BKG A;  1IHB A;  4BES A;  5EID A;  4ZFH A;  2F8X K;  2RFA A;  4DX2 A;  2ETA A;  4C48 B;  4A63 B;  3J5P A;  5EYP F;  1G3N B;  3HRA A;  1BI8 B;  3V2O A;  5JA4 D;  4F6R D;  1BU9 A;  4BEP A;  4ATZ D;  1WDY A;  4G8L A;  4B93 B;  5CED B;  4F1P A;  2VGE A;  1N0Q A;  5EYL A;  3NBN B;  5KNH D;  3IXE A;  1NFI E;  3KEA A;  1MX6 A;  4GMR A;  2JAB A;  5ENO D;  1BD8 A;  5AAR A;  5CER B;  3DEP A;  4DX5 D;  2Y0B G;  1K1A A;  4LG6 A;  5CBN A;  2DZO A;  3TWT A;  4NIK A;  4ZHB A;  3F6Q A;  2XEN A;  5ENR D;  4K5B A;  4RLY A;  3TWQ A;  4CZ2 D;  1YYH A;  2L6B A;  4YDW A;  1K3Z D;  5EIB E;  5AN8 A;  2KXP C;  1BLX B;  4HNA D;  5KNG A;  3JXJ A;  4CYM D;  1S70 B;  4K5A B;  2KBX A;  2QYJ A;  3TWS A;  1MX4 A;  4DRX E;  4HI9 A;  3ZUV B;  3W9G A;  5CEC B;  5FIO A;  5BXU A;  3C5R A;  3EU9 A;  5KBA A;  4DX6 D;  2F37 A;  4N5Q A;  1WG0 A;  1MJ0 A;  2AJA A;  3B95 A;  2P2C P;  3V79 K;  1UOH A;  5EN5 D;  2MYO A;  1N11 A;  5ENQ D;  5HS0 A;  3Q9N C;  2XEE A;  2NYJ A;  2XZD G;  2PNN A;  3Q9U C;  4U8V D;  5D66 A;  4HI8 A;  1TR4 A;  4HBD A;  3TWR A;  2DVW A;  2DZN A;  4HLL A;  3UTM A;  2ZGG A;  4DUI A;  2Y1L E;  4OAU C;  4YDY A;  3DEO A;  2B0O E;  3AAA C;  5AQA A;  4O1O A;  3V2X A;  1DC2 A;  4GPM A;  1OT8 A;  3B7B A;  5FIN A;  3T9K A;  1BI7 B;  5ENT D;  4HQD A;  2DWZ A;  3TWU A;  3UXG A;  3JUE A;  3T8K A;  3EHR A;  3SO8 A;  1YCS B;  4U96 D;  4O1P A;  2XEH A;  1SW6 A;  3J5Q B;  4J8Y A;  4QQI A;  5AQ7 A;  2QC9 A;  4DX1 A;  3HG0 D;  4O60 A;  4DX7 D;  1D9S A;  4HRL A;  2ZGD A;  3ZU7 B;  2RFM A;  4U95 D;  4BSZ B;  1AWC B;  1MX2 A;  3V30 A;  5ITZ F;  5HKP A;  5EIL A;  5CEA A;  5AAO A;  4QFV A;  2FO1 E;  4OAV B;  3TWW A;  2XZT G;  4BET A;  5ENS D;  3ZNG A;  1MYO A;  3NOC D;  2HE0 A;  1YMP A;  3JXI A;  4K5C A;  4UUC A;  4HRM B;  2ETC A;  2BKK B;  3UI2 A;  3LJN A;  2J8S D;  1QYM A; 
#chains in the Genus database with same CATH topology
 4CT0 A;  2H6I A;  1TNU A;  3TWX A;  1SVX A;  3VLD A;  5CMW A;  3E4B A;  3UM1 A;  4MS6 A;  4Z68 A;  3CSF A;  3GYZ A;  3PE3 A;  4P29 A;  5KJK A;  1TNZ A;  4G25 A;  4KVM A;  2AXU A;  3CST A;  5BPP A;  2BF0 X;  1N4S A;  1NI1 A;  1NFI E;  4FLB A;  4XIF A;  1OXJ A;  3UUX A;  3KD7 A;  2AWI A;  4YVO A;  1TN6 A;  3TWQ A;  4RQI A;  1MX4 A;  2XCC A;  1V54 E;  5EN5 D;  3G2T A;  1H0A A;  4JHK A;  1QQE A;  2VSN A;  4APF A;  4JC8 A;  1OWM A;  4HLL A;  3Q78 A;  4GZD A;  1NZN A;  2ZIS A;  2XGM A;  3C3R A;  3SHF A;  3Q47 B;  3KEZ A;  3ZEF A;  1B89 A;  1BI7 B;  4CGW A;  5EX3 A;  4AM9 A;  4U0S A;  1TN7 A;  4O1P A;  4DX1 A;  4MRU A;  3HG0 D;  2R17 C;  4GTS A;  4IN3 B;  3LVQ E;  4L1B A;  3O48 A;  4ATG A;  4U8H A;  3ZNG A;  3PZ4 A;  3LDZ A;  4UWL A;  4GAA A;  2BED A;  4JL0 A;  2ZU6 B;  4NQ0 A;  3ASO E;  3GW4 A;  3NOG D;  5FTP A;  2ETB A;  4HRN A;  2I6H A;  4JB8 P;  3CVU A;  5AQ9 A;  1KT0 A;  3CVX A;  4U0U A;  4PUC A;  5CBO A;  1H19 A;  3P2B A;  3DSV A;  3ESK A;  4GYW A;  2OV8 A;  3DST A;  3QKY A;  4A63 B;  1BI8 B;  1N94 A;  4I2Z A;  4F6R D;  4BEP A;  2M63 A;  1JUQ A;  5E75 A;  3MX3 A;  1TNO A;  2A5U A;  2DZO A;  3L13 A;  5A7D B;  5JJ6 A;  2LXM A;  4UWF A;  1N4Q A;  2MRI A;  2KXP C;  4HNA D;  1HE8 A;  5LP0 A;  4TXP A;  3W9G A;  2RKK A;  3RKV A;  2X6I A;  4XKB A;  1HF8 A;  3PUK A;  2J07 A;  4DLO A;  2XHE A;  5KJM A;  3FTZ A;  3EHN A;  1Y8M A;  2R59 A;  3T8K A;  3TXM A;  3E32 A;  2NSZ A;  3E30 A;  4L2L A;  3CVN A;  3CKB A;  4C0M A;  2WQH A;  2YHE A;  4TXQ A;  3UT7 A;  4G23 A;  3U64 A;  4A3V A;  3JXI A;  3RO3 A;  5FJY A;  2GRO B;  5AQB A;  4JEU A;  3EHM A;  5IY5 E;  3U9W A;  3ZIM A;  2XPZ A;  1N95 A;  1H6O A;  1LF8 A;  3DPY A;  3ZPJ A;  4U04 A;  4KXK B;  4EZJ A;  3EJN A;  1H6P A;  3B7R L;  2ETA A;  5LFA A;  5BV1 A;  3PEV B;  2LNI A;  5FWQ A;  3V2O A;  3I4R B;  3PRE A;  3VLF A;  3FH7 A;  3UT4 A;  2Q7F A;  2WQ7 A;  2XQ0 A;  3QWW A;  1ELR A;  2VGX B;  3VTY A;  2ZIR A;  4HOQ A;  3ASF A;  4YDW A;  2VSY A;  5EIB E;  3RSE G;  1BLX B;  2HYZ A;  3EIJ A;  3FUH A;  3TWS A;  2OCC E;  5T3R A;  4GZ3 A;  1WG0 A;  2P2C P;  1UOH A;  3L17 A;  3ZYQ A;  2P9I G;  2FF4 A;  3LS8 A;  3MGB A;  2OOE A;  2LUH A;  2Y1L E;  2CFU A;  3AAA C;  4AJW A;  5ANR A;  1O1T A;  3JYS A;  3UQ3 A;  4HQD A;  4GTP A;  3CKC A;  1N52 A;  2I2O A;  3J5Q B;  2MHK A;  3NZU A;  4IUL A;  5EIL A;  1LTX A;  4U07 A;  5KCM A;  3CVV A;  3CVW A;  4EBA A;  3UI2 A;  1E7V A;  4AVX A;  1ZB1 A;  2EIJ E;  3Q5M A;  4BER A;  4CT4 A;  2VTB A;  3TAX A;  3FH8 A;  2KCV A;  4F1S A;  1KPS B;  4G11 A;  3ASH A;  2YHC A;  2V4H C;  4JEH A;  5AEN A;  2R5S A;  2Y69 E;  1EDU A;  4JXT A;  4X8Q A;  2AXZ A;  4N3B A;  3BUA A;  3HHM A;  3Q73 A;  5ARG A;  1BPO A;  3QAQ A;  1QBQ A;  4M7C A;  3CHO A;  4I6E A;  3ULE G;  5CBN A;  3BEE A;  4OYS A;  2L6B A;  3GZ2 A;  4FHK A;  3GZ1 A;  2E2E A;  3AU4 A;  4FAD A;  4A55 A;  3HVE A;  5G05 C;  4N5Q A;  1EF1 C;  2AJA A;  3FUI A;  2I9C A;  4B89 A;  4F7A A;  2WXH A;  4N3A A;  2IJG X;  4G2V A;  3ZVV A;  2R05 A;  5DBK A;  4MLP A;  1ELK A;  4YDY A;  3QWP A;  4HXI A;  4WND A;  3U4T A;  4XI9 A;  4EEC A;  5LX8 A;  4J8Y A;  5EDS A;  1ZBP A;  5HKP A;  3L22 A;  3UM2 A;  4KZC A;  2X38 A;  2EQX A;  3HIZ A;  3PNL B;  3MA5 A;  3ESL A;  3V79 K;  4L7T A;  2Y4T A;  4GA2 A;  3Q75 A;  5ENP D;  4TUM A;  3L54 A;  4KMO A;  4AY5 A;  2BUG A;  1OCR E;  3W9F A;  3ASD A;  1H2V C;  2WXI A;  3CVY A;  4ILG A;  4B0Z A;  1DCQ A;  3L16 A;  1IKN D;  1WY6 A;  1RZ4 A;  3TG4 A;  4N5C A;  1N4P A;  4N39 A;  5BNW A;  3CQC B;  5EYP F;  1BU9 A;  1KZP A;  3NBN B;  3JQ1 A;  1NP7 A;  2JAB A;  4ANW A;  1W3B A;  3G2W A;  3JCK C;  4NIK A;  4CDM A;  2J4D A;  4GYO A;  4OVU A;  4FU3 A;  3S7F A;  3FY4 A;  4RSY A;  3FTU A;  2V5F A;  1HFA A;  3JXJ A;  3LJ3 A;  2P9P G;  4YDO A;  3RIB A;  2RD0 A;  2WXR A;  3TGO A;  3G2U A;  5AJD A;  4HI9 A;  3ZUV B;  4TXR A;  3ENE A;  2XGO A;  4WNE A;  2XCB A;  3LKU A;  3APD A;  3PZD A;  2CFZ A;  4J8D A;  3EU5 A;  4PS8 A;  4U63 A;  3ISM C;  1Z3Y A;  2VQ2 A;  3VLE A;  5LOZ A;  3ONL A;  2DIW A;  3T9K A;  3CV0 A;  3RU0 A;  3B13 A;  4ACL A;  3JUE A;  2WXQ A;  3ZXS A;  3LYA A;  2R2L A;  4HFG A;  2WXK A;  3FUM A;  3NAW A;  2XZT G;  4GA0 A;  4J8S A;  1MYO A;  5LCW C;  5J08 A;  1NA3 A;  4CCA A;  1IHG A;  2NXP A;  1X81 A;  4J8F A;  1JWF A;  4I6G A;  3CK7 A;  4GZ5 A;  4H7X A;  4HB5 A;  2X6F A;  5C1D A;  5HQ8 A;  3LY9 A;  3FTV A;  1HX8 A;  3FUL A;  5FQ8 A;  3PVL A;  3QAR A;  1VDY A;  2F8X K;  4DX2 A;  1A17 A;  1UN8 A;  3WXX A;  4OVV A;  1SZ9 A;  4I6J A;  2CHZ A;  3UX4 A;  3O4Z A;  2L0I A;  4EBA G;  3BU8 A;  4MKT A;  2J08 A;  5FZQ A;  4K5B A;  4RLY A;  1K3Z D;  3SGH A;  3UIO C;  3SF4 A;  2XS1 A;  3S2A A;  5FIO A;  2HR2 A;  3B95 A;  2DYR E;  2NYJ A;  2XZD G;  3JQ0 A;  2UWJ G;  2P9N G;  3TWR A;  1TJF A;  3FU5 A;  3Q7A A;  5FQ4 A;  4GTO A;  3FFL A;  4GPM A;  3B7U X;  3APC A;  4LCT A;  5A6C A;  2QYU A;  3B7S A;  3RRU A;  3TXN A;  1DNP A;  3MJW A;  5CCM A;  2YQ8 A;  5JHB A;  3JUI A;  2FO1 E;  4OAV B;  3AG4 E;  3DWL G;  1TNB A;  1EYH A;  1S0P A;  2GRP B;  3I5P A;  4HRM B;  4BX9 A;  3D9I A;  1KLX A;  4IRU A;  1SZA A;  3DXM G;  1JCR A;  4LNU D;  1IQU A;  2WXP A;  4GTQ A;  3DXK G;  4H7Y A;  5G04 C;  2PZI A;  4U0Z A;  4U7E B;  3LPZ A;  4J7W A;  1DCE A;  4EZL A;  4GU5 A;  5JMN D;  2Y4U A;  4FJZ A;  4O6F A;  5HI7 A;  1OWP A;  2WXN A;  1N0Q A;  2GRL A;  1YA0 A;  4JW1 A;  5CHE E;  4LG6 A;  3TWT A;  3PZ3 A;  1RW2 A;  4GML A;  3CEQ A;  2X3M A;  3SI5 A;  3L9T A;  5C2Y A;  3FH5 A;  4A1G A;  5T8I A;  2MYO A;  4UWG A;  3Q9N C;  5JHA A;  1TR4 A;  4WNG A;  1ZU2 A;  1MHQ A;  4Y6W A;  4DUI A;  5BV0 A;  1MQS A;  2OVF A;  5E76 A;  1OCC E;  4GMJ A;  3SO8 A;  1N4R A;  2AVP A;  2XPY A;  4XKC A;  2IOS A;  5B1A E;  3QC1 A;  4DI3 A;  3TL5 A;  1AWC B;  4U95 D;  3FTY A;  3TWW A;  2VSO E;  4K5C A;  3NQP A;  3PNT B;  2WMO A;  3FU0 A;  2KZT B;  3ABK E;  2KAT A;  1N0R A;  2KM4 A;  3HYM B;  3PS6 A;  2ION A;  2GRR B;  4C0E A;  3T8M A;  4MBG A;  4JPS A;  3T5X A;  3AG1 E;  2V5Q C;  2P9L G;  3DSU A;  3UKU G;  4FA6 A;  4Q69 A;  1TN8 A;  2QY7 A;  2VGE A;  3G2V A;  4UI9 C;  4APO A;  1BD8 A;  1O1S A;  3FUJ A;  3HXC A;  4ZHB A;  3BQO A;  4EQF A;  2VGY A;  3SZ7 A;  1S70 B;  2QYJ A;  4Y6C A;  1H2T C;  3PRZ A;  5B1B E;  1OCZ E;  2ZXW E;  2J9Q A;  5KJL A;  1FPP A;  3E33 A;  3KSL A;  4J6I A;  1LD7 A;  2XEE A;  3FHE A;  1X5B A;  4PS3 A;  3DSX A;  1TNY A;  2WXM A;  4BSX A;  2ZGG A;  4KYO B;  4DK5 A;  3LEW A;  3D3M A;  3V2X A;  1E90 A;  4BTA A;  3TWU A;  4A3T A;  1YCS B;  3FEX A;  3D9K A;  2EIK E;  3V30 A;  3FUD A;  2Y3A A;  3Q15 A;  4B8C B;  5KJN A;  4ANU A;  4I17 A;  1JCS A;  5BUZ A;  3SFX A;  3I3N A;  1HG5 A;  1FT2 A;  2OEW A;  2XGS A;  3Q49 B;  4FHJ A;  3D9H A;  2KCK A;  3CHM A;  1E8Z A;  3NF1 A;  4JVS A;  2A5E A;  2VYI A;  2J49 A;  2L6J A;  4ILH B;  2R03 A;  3C72 A;  1OWO A;  3UMV A;  3ABM E;  2RFA A;  2XEV A;  4LER A;  5D0O D;  3TG5 A;  5G55 A;  3IHY A;  2DBA A;  3J5P A;  4BTB A;  4Q94 A;  3D9L A;  4B93 B;  5CED B;  5LCW J;  1E8Y A;  4AY6 A;  4DLQ A;  2J09 A;  4G24 A;  2LO6 A;  2FUL A;  4R7L A;  2VJ8 A;  4G26 A;  3PUJ A;  5FZS A;  1NL4 A;  4RVB A;  2YIN A;  1MJ0 A;  3U3W A;  2DYS E;  1QZ2 A;  4NRH B;  3UM0 A;  2FI7 A;  3ASG A;  3C98 A;  4LNG A;  2DZN A;  3UTM A;  4JHJ A;  1DC2 A;  2LAH A;  3UXG A;  4ANX A;  3S7J A;  5A23 A;  2QC9 A;  3CQG B;  1D9S A;  1Z3X A;  2WXG A;  3D9M A;  5AAO A;  4GYY A;  5CCL A;  3FTS A;  4TV3 A;  4PS7 A;  2QZA A;  4EZK A;  3FUN A;  1OY3 D;  3DSW A;  2VGX A;  5ANL A;  4I2W A;  3VTX A;  5BXO A;  5HRY A;  3MKR A;  1HXI A;  3LVR E;  2WXL A;  3EHQ A;  3TWV A;  1TYQ G;  1A5E A;  4UQZ A;  2E0I A;  1IHB A;  3RK6 A;  4BES A;  4ZFH A;  4HOS A;  3ZW3 A;  3HRA A;  2V0P A;  3MKQ B;  4ATZ D;  2AXV A;  3N71 A;  3LY8 A;  3ML9 A;  3OXL A;  3C3O A;  2CHX A;  4GMR A;  1S64 A;  3ZGQ A;  4F3V A;  2C0M A;  2UY1 A;  2NC9 A;  4URK A;  2WXF A;  1ELW A;  3ZRH A;  2C0L A;  3U66 A;  4LRZ A;  3D9N A;  4ME2 A;  3RRM B;  2IF4 A;  4PDX A;  2B6C A;  4AEZ C;  4HBD A;  4C9B B;  4UWH A;  3OTN A;  4GPK A;  3KS2 A;  3HXD A;  4GCN A;  5DIZ A;  4O1O A;  4HOU A;  3EUV A;  2WVI A;  4TRQ A;  5EX0 A;  4FP7 A;  3EHR A;  1SW6 A;  3UKR G;  4G1T A;  4L23 A;  2WM9 A;  3SQV A;  2ZGD A;  3ZU7 B;  4FJY A;  3CVL A;  4RG6 A;  3B7T A;  2H6F A;  2OEV A;  2ETC A;  2BKK B;  3Q4A B;  3K9I A;  4E85 A;  3UM3 A;  4WAF A;  1Z5S C;  3ULQ A;  1AP7 A;  1JWG A;  3CHP A;  3MCX A;  4BT8 A;  2KCL A;  4JA9 A;  1H2U A;  4D10 C;  3ML8 A;  2J4B A;  5EID A;  4GA1 A;  3SBT B;  4J8E A;  1G3N B;  4V3I A;  2IY0 C;  2PM6 A;  2C2L A;  3KEA A;  4WWN A;  3PH0 C;  3DRA A;  5CER B;  4DX5 D;  2VTB B;  3I4G A;  2IO3 C;  4J0U A;  4CZ2 D;  5BT1 A;  3QDN A;  4I1O B;  4WWO A;  2X6K A;  2LAI A;  2PL2 A;  3TJP A;  4B8A A;  3CVP A;  3KAE A;  4ACK A;  5CEC B;  2CG3 A;  2KZT A;  4LUN U;  1PC2 A;  4YVQ C;  3QB2 A;  1INZ A;  5ENQ D;  3Q7F A;  5AQA A;  2FEZ A;  1U3C A;  3EIQ C;  2IO2 C;  1JCQ A;  3FU3 A;  2L0T B;  2R02 A;  4BFR A;  4I43 A;  4GCO A;  4FUL A;  4CDR A;  1P5Q A;  1N9A A;  5CRU A;  2PQN A;  3LJN A;  3MV3 B;  2J8S D;  1QYM A;  3SFY A;  2FO7 A;  4EPZ A;  1FT1 A;  4G8K A;  4KT6 B;  2XRZ A;  3PZ1 A;  2LSV A;  3RJV A;  4Q96 A;  2V8S E;  5H7P A;  2QFC A;  2VSX E;  1E7U A;  2F8Y A;  1FVH A;  3MZL B;  5FT9 A;  3FTX A;  2BKG A;  1HS6 A;  2YNQ A;  3CHS A;  3E34 A;  5G05 J;  4A1S A;  4JA7 A;  2GW1 A;  2I1J A;  1WDY A;  5T4Y A;  5EYL A;  5KNH D;  4CGV A;  5FQ7 A;  2GRQ B;  3FWV A;  5AAR A;  3FTW A;  4FC8 A;  1YYH A;  3EDT B;  1QNF A;  4ANV A;  3CHQ A;  4CYM D;  2KBX A;  1DVP A;  2OVB A;  3R9M A;  2KC7 A;  3RO2 A;  5JJ7 A;  2IOL A;  4BY6 A;  3LY7 A;  1NA0 A;  3IBE A;  3DEO A;  2B0O E;  1PY1 A;  5FIN A;  3CR3 A;  4U96 D;  3CGH A;  4DX7 D;  2WPV A;  4HRL A;  2RFM A;  4BSZ B;  1HG2 A;  1MX2 A;  1O5M A;  2WXO A;  3PZ2 A;  2H6H A;  3NOC D;  4EHM A;  1SA4 A;  1HO8 A;  5KWD A;  1V55 E;  4KVO A;  1KZO A;  4PH4 B;  4XI0 A;  1S63 A;  5JJT A;  3NB2 A;  3V31 A;  5AJL A;  4HOR A;  4UI9 J;  3OAW A;  2P9U G;  3D9O A;  2A4Z A;  4HVB A;  4FLH A;  4F53 A;  3MKQ A;  4I1M A;  3QJZ A;  4L9P A;  4GB9 A;  2PM7 A;  4LEU A;  4G8L A;  4F1P A;  4UWK A;  4AP2 A;  3HDX A;  3IXE A;  3S7D A;  3AG3 E;  3QNK A;  4E6H A;  1XNF A;  3BG0 B;  3UIP C;  3CIA A;  4IYP A;  3L08 A;  4B94 A;  2XEN A;  3CHR A;  5ARF A;  2OND A;  3CK8 A;  4M3O A;  5G04 J;  5J90 A;  3AG2 E;  2X6J A;  4DRX E;  3EU9 A;  1Q2Z A;  2WQ6 A;  5HS0 A;  1D8E A;  3AS4 A;  2PNN A;  3MYV A;  3HXF A;  3ZYK A;  5D66 A;  4HI8 A;  3Q79 A;  3MEK A;  2BTD A;  4GTM A;  4DJA A;  3UT8 A;  4AIF A;  1WM5 A;  2P9S G;  3PEU B;  4XZ4 A;  5B3S E;  4NAC A;  5D0Q D;  4DPR A;  1HU3 A;  5CRV A;  4L2Y A;  2LXL A;  4QFV A;  3FP3 A;  1K8K G;  4BET A;  3R7R A;  4HLE A;  4UQX A;  2IFU A;  3QOU A;  3GZS A;  1UG3 A;  3KSQ A;  2JLB A;  5AIJ A;  4WWP A;  4LNB A;  4JD2 G;  1E8X A;  1E96 B;  3RAU A;  1TJC A;  3SBS A;  1SQM A;  2JEK A;  3SD5 A;  2CG2 A;  3CVQ A;  1K1B A;  3ZHE A;  4UQY A;  1JPL A;  3UIN C;  3CLJ A;  1UW4 B;  3OXG A;  3OXF A;  5JA4 D;  5FZR A;  4BWR A;  3ZFW A;  1FVF A;  3DSS A;  3FEY A;  4ILI A;  4TUU A;  3WG7 E;  3QWV A;  3DPD A;  3P1U A;  5ENN A;  3FU6 A;  4I1A A;  4RG9 A;  4K5A B;  2FBN A;  4XEI G;  1O1R A;  3E37 A;  2F37 A;  1N11 A;  2WXJ A;  5FQ6 A;  3RRN B;  3Q9U C;  2MOW A;  3R7Q A;  3ONK A;  4CEM A;  1IQR A;  2EIN E;  1N54 A;  4NUR A;  1LD8 A;  4GZC A;  4YND A;  2XS8 A;  1OT8 A;  1U3D A;  3IEG A;  3LCA A;  3IHV A;  4UI9 K;  4ABN A;  4HS2 A;  3CK9 A;  4KZ0 A;  1OWN A;  1WAO 1;  3PDN A;  2UY1 B;  5ENS D;  2HE0 A;  4UUC A;  2GRN B;  2WB2 A;  3HXE A;  3NZS A;  2PQR A;  1SA5 A;  4AXH A;  3AS5 A;  1IXV A;  5D2M C;  4LSZ E;  3ZKJ A;  4GZ6 A;  2X6H A;  5M72 A;  1Z6T A;  2HO1 A;  2GRM A;  2ILR A;  3FDH A;  4GTR A;  4DI4 A;  3C3Q A;  2Y0B G;  1UJK A;  3F6Q A;  3ZYL A;  4BT9 A;  3L82 A;  3FUK A;  4JHR A;  4AOF A;  3SNX A;  2CHW A;  4WUY A;  1UN9 A;  2EIM E;  2V4L A;  1MZC A;  3C5R A;  4W9R A;  3ZHE B;  2F0Y A;  4HOT A;  3SY2 A;  2DVW A;  4WNF A;  1U2V G;  4GTT A;  4XX5 A;  3AS8 A;  3FUE A;  5CMY A;  4I9E A;  4AV7 A;  1OWL A;  4GTV A;  2XEH A;  4QQI A;  5AQ7 A;  3AU5 A;  3HVE B;  4YDE A;  3IV0 A;  3FUF A;  3R9A B;  1OCO E;  5CEA A;  3APF A;  3DBS A;  3PE4 A;  1YMP A;  1KT1 A;  4I9C A;  1Y6I A;  3D9J A;  3UPV A;  1D8D A;  3ASN E;  4U8Y D;  3LXU X;  3ULY A;  5EKQ D;  2HM8 A;  3HXB A;  1L5J A;  1HZ4 A;  3L6A A;  3QK0 A;  3AJI A;  5AYW D;  3G2S A;  2DCP A;  2XRY A;  4C48 B;  4JZY A;  2EIL E;  4XE0 A;  2WMN A;  2RG8 A;  1MX6 A;  5ENO D;  3DEP A;  1K1A A;  4K03 A;  3ZXP A;  4CRW A;  2AW6 A;  3ZN3 A;  4KBQ A;  5ENR D;  2XPI A;  5BW8 C;  2GGF A;  4BX8 A;  5AN8 A;  1H6K A;  5KNG A;  1GW6 A;  4N3C A;  5BXU A;  5KBA A;  4DX6 D;  1EPU A;  4N2S A;  3ZYM A;  2LSU A;  4U8V D;  2IEJ A;  4OAU C;  3X2Q E;  1FCH A;  1OUV A;  3ABL E;  2P9K G;  3B7B A;  5ENT D;  2H6G A;  2DWZ A;  2IQC A;  1TEZ A;  1XGW A;  4O60 A;  3T5V A;  5G2N A;  3BG1 B;  3S7B A;  3D9P A;  1PAQ A;  3IKO B;  4K0R A;  5ITZ F;  2P58 C;  4N2Q A;  1HH8 A;  1E8W A;  1UJJ A;  3URZ A;  3SFZ A;  2I1K A;  1IYG A;  2L9B A;  2IU1 A;  3MV2 B;  4CDN A; 
#chains in the Genus database with same CATH homology
 5KWD A;  4BER A;  5ENP D;  4U8Y D;  5AQB A;  4TUM A;  1OY3 D;  3D9H A;  3V31 A;  3NOG D;  4G8K A;  4LNU D;  1N0R A;  3TWX A;  2ETB A;  1SVX A;  4HRN A;  5BXO A;  4JB8 P;  5HRY A;  4HB5 A;  5AQ9 A;  1AP7 A;  1IXV A;  2V4H C;  3W9F A;  4Z68 A;  2A5E A;  5CBO A;  4J7W A;  3AJI A;  3EHQ A;  4LSZ E;  1DCQ A;  3TWV A;  1IKN D;  2F8Y A;  3ZKJ A;  5JMN D;  1A5E A;  1K1B A;  2V5Q C;  2BKG A;  1IHB A;  4BES A;  5EID A;  4ZFH A;  2F8X K;  2RFA A;  4DX2 A;  2ETA A;  4C48 B;  4A63 B;  3J5P A;  5EYP F;  1G3N B;  3HRA A;  1BI8 B;  3V2O A;  5JA4 D;  4F6R D;  1BU9 A;  4BEP A;  4ATZ D;  1WDY A;  4G8L A;  4B93 B;  5CED B;  4F1P A;  2VGE A;  1N0Q A;  5EYL A;  3NBN B;  5KNH D;  3IXE A;  1NFI E;  3KEA A;  1MX6 A;  4GMR A;  2JAB A;  5ENO D;  1BD8 A;  5AAR A;  5CER B;  3DEP A;  4DX5 D;  2Y0B G;  1K1A A;  4LG6 A;  5CBN A;  2DZO A;  3TWT A;  4NIK A;  4ZHB A;  3F6Q A;  2XEN A;  5ENR D;  4K5B A;  4RLY A;  3TWQ A;  4CZ2 D;  1YYH A;  2L6B A;  4YDW A;  1K3Z D;  5EIB E;  5AN8 A;  2KXP C;  1BLX B;  4HNA D;  5KNG A;  3JXJ A;  4CYM D;  1S70 B;  4K5A B;  2KBX A;  2QYJ A;  3TWS A;  1MX4 A;  4DRX E;  4HI9 A;  3ZUV B;  3W9G A;  5CEC B;  5FIO A;  5BXU A;  3C5R A;  3EU9 A;  5KBA A;  4DX6 D;  2F37 A;  4N5Q A;  1WG0 A;  1MJ0 A;  2AJA A;  3B95 A;  2P2C P;  3V79 K;  1UOH A;  5EN5 D;  2MYO A;  1N11 A;  5ENQ D;  5HS0 A;  3Q9N C;  2XEE A;  2NYJ A;  2XZD G;  2PNN A;  3Q9U C;  4U8V D;  5D66 A;  4HI8 A;  1TR4 A;  4HBD A;  3TWR A;  2DVW A;  2DZN A;  4HLL A;  3UTM A;  2ZGG A;  4DUI A;  2Y1L E;  4OAU C;  4YDY A;  3DEO A;  2B0O E;  3AAA C;  5AQA A;  4O1O A;  3V2X A;  1DC2 A;  4GPM A;  1OT8 A;  3B7B A;  5FIN A;  3T9K A;  1BI7 B;  5ENT D;  4HQD A;  2DWZ A;  3TWU A;  3UXG A;  3JUE A;  3T8K A;  3EHR A;  3SO8 A;  1YCS B;  4U96 D;  4O1P A;  2XEH A;  1SW6 A;  3J5Q B;  4J8Y A;  4QQI A;  5AQ7 A;  2QC9 A;  4DX1 A;  3HG0 D;  4O60 A;  4DX7 D;  1D9S A;  4HRL A;  2ZGD A;  3ZU7 B;  2RFM A;  4U95 D;  4BSZ B;  1AWC B;  1MX2 A;  3V30 A;  5ITZ F;  5HKP A;  5EIL A;  5CEA A;  5AAO A;  4QFV A;  2FO1 E;  4OAV B;  3TWW A;  2XZT G;  4BET A;  5ENS D;  3ZNG A;  1MYO A;  3NOC D;  2HE0 A;  1YMP A;  3JXI A;  4K5C A;  4UUC A;  4HRM B;  2ETC A;  2BKK B;  3UI2 A;  3LJN A;  2J8S D;  1QYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...