1S70B

Complex between protein ser/thr phosphatase-1 (delta) and the myosin phosphatase targeting subunit 1 (mypt1)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
291
Chain Sequence
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRKKTKVKFDDGAVFLAACSSGDTEEVLRLLERGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEYLISQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQARYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMEAVNKVGQTAFDVADEDILGYLEELQKKQNLLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of protein phosphatase 1 regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine protein phosphatase PP1-beta (or delta) cat
total genus 80
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
B PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1s70B01
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1s70B02
5EIBE 5AQ9A 2ZGDA 1MYOA 1N0QA 4J7WA 4A63B 3DEPA 3UTMA 3Q9NC 2KXPC 2XZTG 3TWQA 1SW6A 4LSZE 3JUEA 4HRLA 3ZKJA 4HI9A 4GPMA 3EHRA 1IKND 1WG0A 4YDYA 1TR4A 5ENQD 3JXJA 2J8SD 5FINA 2L6BA 3JXIA 3UXGA 5CERB 3UI2A 1N11A 4HNAD 2Y1LE 1DC2A 5ENSD 4OAUC 4DX6D 4UUCA 3TWUA 1BD8A 4HQDA 1BI8B 4ZFHA 4HRMB 4NIKA 4DRXE 4OAVB 1AP7A 1UOHA 3SO8A 3J5QB 4U8VD 2B0OE 2MYOA 3Q9UC 5FIOA 5ENOD 2PNNA 4BEPA 5BXOA 1OT8A 4HB5A 4RLYA 1YYHA 4U8YD 4BETA 2XEEA 5HRYA 2F8XK 3D9HA 3HG0D 3B95A 3ZNGA 1BLXB 1S70B 4O60A 5ENTD 5CBOA 5D66A 3DEOA 1MJ0A 2F8YA 3B7BA 4GMRA 4HI8A 3TWXA 3TWVA 5EYPF 3V2OA 5CECB 4HRNA 1BU9A 1IXVA 1MX2A 4CZ2D 1K1BA 2V4HC 3TWSA 5CEDB 2XZDG 5ENPD 4ATZD 2DVWA 3V30A 4LNUD 1N0RA 3NOCD 4LG6A 3V2XA 2ZGGA 2AJAA 2RFMA 2ETBA 5HKPA 4BESA 1OY3D 2F37A 4U95D 2ETAA 5BXUA 5KBAA 3W9FA 3F6QA 1SVXA 2KBXA 2RFAA 3LJNA 5JMND 4DUIA 2BKKB 4F1PA 2BKGA 5AARA 5KWDA 4TUMA 5EN5D 2DWZA 4ZHBA 5EIDA 4CYMD 2DZOA 4J8YA 1D9SA 5AN8A 2ETCA 1NFIE 4O1PA 4G8KA 3V31A 4HLLA 2JABA 4B93B 2HE0A 2VGEA 2XENA 3KEAA 4HBDA 4YDWA 5JA4D 3HRAA 3TWWA 5KNGA 3T8KA 5AAOA 3V79K 2V5QC 2QC9A 5KNHD 4N5QA 1AWCB 4K5AB 4BERA 3AJIA 2Y0BG 1BI7B 3ZUVB 1QYMA 3EHQA 1DCQA 3C5RA 5AQAA 2XEHA 5ITZF 4K5CA 4DX5D 1YMPA 3TWRA 5ENRD 1WDYA 2A5EA 3T9KA 3ZU7B 4Z68A 4G8LA 5AQBA 5HS0A 1K1AA 2FO1E 3NBNB 3J5PA 4QFVA 4DX7D 5CBNA 5EILA 4JB8P 4DX2A 1MX4A 1A5EA 2P2CP 5AQ7A 4K5BA 2DZNA 3EU9A 3W9GA 3IXEA 5CEAA 1IHBA 1G3NB 5EYLA 3TWTA 4BSZB 2NYJA 1MX6A 4U96D 4O1OA 4C48B 4DX1A 1YCSB 4F6RD 3AAAC 1K3ZD 2QYJA 4QQIA 3NOGD
chains in the Genus database with same CATH superfamily
3FTXA 4J7WA 4D10C 3Q5MA 3ZKJA 3G2VA 4ACKA 1H2TC 3FUKA 3ASFA 2UY1B 3KAEA 1NP7A 3QWVA 5G04C 4HLEA 3OXFA 5D0QD 5G05J 3L82A 2X6KA 2JLBA 3HG0D 4KVOA 4UQZA 3ESLA 4XE0A 5CECB 4M7CA 4GZCA 4UI9K 3TWSA 5EX3A 1MZCA 1Y8MA 2AJAA 3TJPA 4CRWA 4PDXA 5LCWC 3W9FA 3RRMB 3TGOA 3EHMA 4G1TA 3Q4AB 1UJKA 3BG0B 5KWDA 3FEYA 3VTYA 2Y69E 3CK8A 4ANXA 3VLFA 3UKRG 2VJ8A 4AJWA 2FI7A 3FDHA 3JQ0A 4U8HA 4TXPA 3IEGA 3U9WA 1NA0A 4UWKA 3D9PA 2OCCE 1K8KG 3NBNB 4DX7D 5CBNA 4ILGA 4CGVA 2RG8A 3SHFA 4DLOA 3KD7A 2L0TB 5EYLA 1E8ZA 4MS6A 1MX6A 4DX1A 1O1TA 3AAAC 4YVQC 4KT6B 5BV0A 3AU5A 2XZTG 2BEDA 3FULA 4OVVA 1IKND 3VLDA 3JXIA 2LXLA 2Y4TA 4J8SA 3FHEA 2RKKA 5FT9A 3TXMA 4EZLA 2J09A 4AY6A 2LO6A 2GRQB 4EZKA 4HOSA 3MGBA 4OYSA 5ENNA 1TN7A 1JCSA 3QC1A 3NOCD 4GZ3A 2V5FA 2XRYA 2P9SG 3APFA 3LJNA 5B3SE 3E33A 4TUMA 3DSVA 4FLBA 3I4GA 4DK5A 2C0LA 5C2YA 4B93B 3CIAA 3RRNB 1N95A 3EDTB 4NURA 3LPZA 2WB2A 1OWMA 1H0AA 4GMJA 3MKQB 4K5CA 3BUAA 3D9MA 4Z68A 3J5PA 3ML9A 4JB8P 3D9NA 2OOEA 4K5BA 3FH8A 4KYOB 1HF8A 1Z3YA 2XS1A 2WQ6A 4BSZB 3UM0A 4N2QA 4LNBA 3L08A 4XEIG 4KVMA 3B7TA 4FA6A 2WQHA 2R5SA 3PE4A 1QBQA 2VTBB 2IO3C 1WG0A 3UPVA 3CGHA 5FINA 1UG3A 3K9IA 1EPUA 3HXBA 2QZAA 4GYOA 1IHGA 4I43A 2MYOA 4AV7A 5ANLA 5A23A 3IBEA 4JA7A 1H6OA 1U3DA 3CV0A 1NA3A 2OEVA 1OWNA 2XZDG 3ABKE 4FHJA 3Q79A 1HE8A 2ILRA 1YA0A 2KBXA 2CG3A 4JEUA 2IONA 2Y4UA 5LP0A 3B7UX 3PEVB 3QDNA 3ZYMA 4X8QA 4GTSA 4J8YA 2ETCA 3V31A 4HBDA 1Q2ZA 4J6IA 4F7AA 3I4RB 3ZUVB 1QYMA 3HHMA 4GTPA 1SQMA 3FTZA 3UM1A 3PZ2A 4GTVA 5B1BE 3MV2B 5BW8C 5CEAA 3ZHEA 4LNGA 4GPKA 4DI3A 5LOZA 4U96D 1LF8A 1ELRA 3PUKA 4JHKA 3UUXA 3RKVA 4B0ZA 3CHSA 1UN8A 3FU0A 3Q9NC 4G23A 3X2QE 3E34A 5AIJA 4LRZA 1IYGA 3GYZA 4GA2A 2Y1LE 2KCLA 2H6GA 2BTDA 4J8DA 1H2VC 2H6IA 3FWVA 2PL2A 4XI0A 3ZYQA 4BX9A 4B8CB 4EHMA 2VQ2A 2VGXA 4U04A 5CEDB 4ATZD 2LSVA 1U3CA 3SNXA 3O4ZA 3FUIA 1JWFA 4GTOA 3S7FA 2F37A 5BXUA 1Z3XA 5G2NA 2RFAA 4DUIA 3ZYLA 3UT7A 4XIFA 1OXJA 2XPYA 4I6JA 5AN8A 5DIZA 2E0IA 5E75A 3MEKA 1Y6IA 2AXZA 1JPLA 3S7JA 1JCRA 3HRAA 5G55A 5D0OD 4BT9A 4K5AB 3HYMB 2P9KG 2NSZA 4C0MA 4JD2G 1E8XA 1VDYA 1HS6A 4JVSA 2H6FA 4FU3A 2P2CP 2DZNA 3W9GA 2M63A 4TXQA 2YNQA 3ZPJA 3L9TA 1KT0A 3DRAA 5EKQD 3GZ1A 2XGMA 3ASNE 5CMWA 4QQIA 3UM2A 2CFZA 4APOA 4JC8A 2EIJE 1FT2A 3OTNA 3CHPA 4TUUA 4HI9A 4GPMA 3ZFWA 4AP2A 1PY1A 3PE3A 2VSYA 3QARA 4KZ0A 3UI2A 5KJKA 1DC2A 4CDMA 2LNIA 5FQ4A 4DPRA 4DRXE 1AP7A 4PS3A 3R7RA 5BXOA 4URKA 3UIPC 3EIJA 4LEUA 3D9HA 1WY6A 2GRRB 3ULYA 4U63A 3CVVA 3C3QA 3CSFA 3FUFA 2WXPA 2FO7A 3ASGA 4JW1A 3QB2A 4LERA 2WXGA 4LCTA 3PS6A 4FC8A 1JWGA 3R9AB 4F1PA 3G2WA 3PRZA 3AG2E 3ONKA 4V3IA 4GCNA 4ABNA 2IEJA 3ZYKA 4HOUA 3FY4A 2IFUA 2VSXE 2IOSA 4LUNU 3TWWA 2QYUA 4RVBA 5JHAA 4Y6WA 1D8DA 4N5QA 4N5CA 4I1OB 3C5RA 3CSTA 5ITZF 2AW6A 4E6HA 4G8LA 3FEXA 1TNBA 3G2TA 2A4ZA 1OWOA 3FUJA 1S0PA 3U3WA 5ARFA 3DXKG 1HXIA 3UIOC 1KZOA 1U2VG 2EINE 4HVBA 3Q7FA 2EILE 2IF4A 5AQ9A 1N0QA 3DEPA 4NRHB 1V55E 2WXFA 4HS2A 4LSZE 4P29A 3FTYA 3GW4A 3FTSA 1TR4A 5ENQD 2CHZA 4BSXA 5J90A 3D9KA 1E8YA 4G11A 2FEZA 1BD8A 1BI8B 5FQ6A 5LFAA 4B8AA 2XEEA 2YHCA 4WUYA 4G24A 5D66A 4GMRA 2F0YA 3U66A 3D9JA 4LNUD 2I6HA 2LAHA 4UQXA 2KCVA 4A1SA 4YDOA 5KJLA 3C3OA 2HM8A 1BPOA 3DSTA 3Q78A 1FPPA 1X81A 1EDUA 5EIDA 3UT8A 1UJJA 4WNFA 4O1PA 3PH0C 3I3NA 3CHRA 3MKQA 1LTXA 4UWFA 4TV3A 3ZN3A 3N71A 3TWRA 3T9KA 2GRMA 3LEWA 3SBTB 2R02A 3Q15A 4ME2A 5A7DB 2P9PG 5CRUA 1INZA 4C0EA 5BNWA 1OCCE 2ZGDA 5KCMA 3TWQA 4RSYA 4A55A 2VYIA 3L17A 2WXRA 2DIWA 4BWRA 2X3MA 4YDYA 3CKCA 4GAAA 4I9EA 3CVUA 3E4BA 1N11A 3QK0A 4ANUA 1H6KA 4MRUA 3LXUX 3G2SA 4RG9A 4HRMB 3URZA 3CEQA 3KSQA 3EU5A 4U8VD 2CFUA 2IO2C 2VGYA 3U64A 1YYHA 2H6HA 3CVNA 4WNEA 3RO3A 3UT4A 2ONDA 3B95A 3ZNGA 3MX3A 1O1RA 5G05C 2EQXA 4UI9C 4ANWA 3SI5A 2GGFA 3TG4A 1HO8A 2DZOA 3AS4A 5JJTA 2AWIA 1XNFA 3FTVA 3B13A 3FU6A 4Q69A 4IULA 5JA4D 4KZCA 3EIQC 5KNGA 4GYWA 2V5QC 5KNHD 3CVQA 2P9IG 4FLHA 1AWCB 5CHEE 4CEMA 2OV8A 4DX5D 1N4QA 3NB2A 2WMOA 1JUQA 2XEVA 3APDA 1Z5SC 1S63A 2V8SE 5C1DA 4U07A 3S7DA 1ZBPA 2ZXWE 3EJNA 1IQUA 3AG3E 5IY5E 5AENA 1EF1C 4RQIA 4GZ5A 3SZ7A 1TNZA 5A6CA 3JUEA 3RIBA 3LY8A 4CDNA 2KM4A 3DSXA 5T8IA 2LAIA 3UXGA 3MCXA 2WQ7A 3TWUA 1NZNA 4BEPA 1OT8A 4N39A 3GZ2A 4GA0A 4JZYA 2UWJG 4EPZA 1TNOA 3NAWA 4PUCA 3VTXA 2DCPA 4E85A 2C2LA 1N0RA 1HZ4A 4L7TA 2KZTB 4U95D 1PAQA 1IQRA 3CK9A 3NZUA 5J08A 3FUMA 2JEKA 3ABME 3PVLA 4EBAA 5ARGA 5B1AE 4UWLA 4NACA 4MLPA 4KXKB 1Z6TA 3ZRHA 3KEAA 3ESKA 3ASDA 1BI7B 1YMPA 5ENRD 2A5EA 1FVHA 5AQBA 2XPZA 1DNPA 1OCZE 3S7BA 5HQ8A 1HG5A 2QFCA 2X6IA 1MHQA 2XCBA 3PZ1A 4ILIA 4AVXA 4C48B 4DI4A 4UI9J 1LD7A 1LD8A 2IQCA 2V0PA 3NOGD 3HXFA 1S64A 3FH7A 1SW6A 3RK6A 4KMOA 1H19A 3JXJA 3RAUA 1N52A 1HX8A 3T5VA 2LXMA 4YNDA 1UOHA 3HVEB 2AVPA 2PNNA 4BETA 1OUVA 5CMYA 1MJ0A 3EUVA 5EYPF 3ABLE 4KBQA 4WWPA 2RFMA 4BESA 3WG7E 3T8MA 4W9RA 3E32A 5EN5D 3L6AA 2EIKE 2GRPB 3FUEA 3MZLB 1KLXA 3D9LA 2CHXA 4GCOA 3RJVA 4BT8A 3AJIA 1RW2A 2Y0BG 2ZIRA 3EHQA 3JCKC 1DCQA 1WDYA 4N3AA 4PS8A 1WAO1 3IHYA 4CT4A 4BTBA 4EECA 4NQ0A 4JPSA 3ULEG 1MX4A 3CHQA 3FFLA 3IKOB 3T5XA 4GZ6A 3TG5A 1TNUA 3Q75A 2AXVA 2P9UG 4HOQA 4J8FA 2Y3AA 5T3RA 3SY2A 2FULA 2PQRA 4AY5A 4L2YA 2LUHA 3CKBA 2KATA 4EZJA 2WPVA 3LY9A 2DYSE 3DSSA 5BPPA 3J5QB 2C0MA 4HB5A 5EDSA 1OCRE 3QKYA 3ENEA 3HXEA 3L22A 1BU9A 1NL4A 4XX5A 2DVWA 3FH5A 3GZSA 2GROB 4JL0A 2YINA 2ETBA 1O5MA 4TXRA 3F6QA 2WXIA 2BKKB 2CHWA 4DLQA 4FULA 4I1MA 2I1KA 1D8EA 5DBKA 4HLLA 3D9IA 4GA1A 3NQPA 3CVYA 3C72A 3BEEA 5T4YA 4I2ZA 1WM5A 2XEHA 1SA4A 3PDNA 4GMLA 3ZXSA 2VTBA 3MKRA 5BUZA 2FO1E 3SFZA 2MHKA 2MRIA 4JXTA 5AQ7A 5ANRA 1IHBA 3FP3A 2GW1A 3CHOA 5KJNA 3OXGA 4F6RD 5EX0A 2XRZA 1K3ZD 2VSNA 2J9QA 2OVBA 4WWOA 3SF4A 1TN6A 2WMNA 3JQ1A 4CDRA 4HRLA 2J07A 3KEZA 3O48A 5FZRA 1KPSB 2R17C 2L6BA 4I2WA 3DBSA 4HQDA 4JA9A 4BFRA 4OAVB 3ZGQA 4U8YD 4GZDA 3ULQA 4DJAA 2WM9A 1P5QA 5H7PA 4HRNA 1IXVA 2OVFA 2YQ8A 3LY7A 1OCOE 3LS8A 2J49A 2BUGA 4FJYA 2KC7A 1N4PA 5KBAA 3DWLG 1SA5A 1TNYA 1EYHA 2HYZA 4F3VA 3PUJA 4ZHBA 4YVOA 1X5BA 2ZISA 3DSWA 3IHVA 2XPIA 3I5PA 5AAOA 4BERA 1N94A 1SZ9A 2XGSA 2KCKA 3FUHA 4G2VA 3HXCA 3APCA 1ELWA 4AM9A 3MA5A 3LJ3A 1HU3A 4O1OA 2LSUA 3CK7A 3E37A 1MYOA 1V54E 4YDEA 3RU0A 3R7QA 4L23A 3CLJA 3AS5A 2J8SD 5CERB 4UWGA 4HFGA 3S2AA 4C9BB 4N2SA 1UW4B 3CR3A 4RLYA 3L54A 3QNKA 4GTTA 1BLXB 3QWPA 4O60A 5FWQA 2XHEA 3V2OA 3QAQA 3BG1B 1MX2A 2VSOE 3CQGB 2V4HC 4Y6CA 1TYQG 3QJZA 4H7XA 4H7YA 2WXOA 5HKPA 2ETAA 2P58C 1DVPA 3ZEFA 3C3RA 2IY0C 4GYYA 2CG2A 2I9CA 2L9BA 4G8KA 5FJYA 2XQ0A 2QY7A 4YDWA 3HIZA 4Q96A 2WXKA 3T8KA 2EIME 4RG6A 4F53A 2ZU6B 1QQEA 1N4RA 5CRVA 4HORA 4F1SA 4G26A 4UQYA 3CVLA 3CVWA 3E30A 4CCAA 4WNGA 1JCQA 3EU9A 4O6FA 4FADA 1KT1A 3DXMG 1G3NB 3TWTA 3CVXA 3UKUG 4EBAG 3LVRE 1H2UA 2PZIA 3B7SA 2P9NG 4I6EA 1E8WA 1FT1A 5AJDA 1N9AA 3OXLA 2WVIA 3DSUA 3MV3B 4UWHA 5FTPA 1A17A 1TN8A 4HNAD 2NXPA 4AXHA 4U0SA 5FIOA 3MYVA 3PZ3A 4GB9A 2DYRE 1S70B 4HI8A 3TWXA 5HI7A 4CZ2D 1NI1A 3RSEG 4WWNA 3LCAA 3ZVVA 1SVXA 3CHMA 1RZ4A 3AG4E 3C98A 2DWZA 3FTWA 3NF1A 4M3OA 1HH8A 4BY6A 1D9SA 4I9CA 3UMVA 2GRNB 2IJGX 4BTAA 2HE0A 2VGEA 3LDZA 2R03A 3Q49B 1XGWA 4I1AA 2DBAA 3ASHA 4AOFA 4GU5A 3AG1E 1OWPA 4L1BA 3UX4A 3PNLB 4HOTA 2B6CA 5EILA 4DX2A 3SD5A 4JEHA 2GRLA 5M72A 3IV0A 1W3BA 3BU8A 2QYJA 2X6JA 1OWLA 4I6GA 4WAFA 5FQ7A 1H6PA 2KXPC 4GTQA 3SQVA 5JHBA 5FZSA 5JJ6A 4GTMA 3WXXA 4ANVA 5ENSD 4BX8A 4JHJA 4OAUC 4WNDA 2B0OE 3VLEA 5D2MC 5E76A 5HRYA 2F8XK 1TJCA 4FP7A 3TXNA 5CBOA 3DEOA 1GW6A 4EQFA 5ENPD 1N4SA 3R9MA 3HVEA 1OY3D 4XZ4A 1KZPA 4JHRA 2E2EA 2BKGA 3FUDA 1NFIE 2JABA 5AJLA 4B89A 3QWWA 2XENA 3JYSA 3RO2A 5BT1A 3ZIMA 4XKCA 3L13A 2XCCA 4HXIA 1K1AA 3SFYA 3FU3A 1QZ2A 5AYWD 3HDXA 2Q7FA 1N54A 4L2LA 3HXDA 1E7VA 3QOUA 1SZAA 2HO1A 3ASOE 5FZQA 3MJWA 2A5UA 3Q47B 1ZU2A 2X6FA 3LKUA 5EIBE 2PQNA 2X6HA 3CVPA 3UTMA 5CCMA 1UN9A 1E7UA 3KSLA 3PREA 4J8EA 2WXJA 3JUIA 3EHNA 3OAWA 3LVQE 4DX6D 2WXHA 4ZFHA 4NIKA 3SO8A 3ZW3A 5ENOD 4ACLA 3SBSA 5LCWJ 4ATGA 2FBNA 4PS7A 2F8YA 2WXMA 3TWVA 2L6JA 4OVUA 3UQ3A 4K0RA 4B94A 1FCHA 4LG6A 3UINC 3V2XA 2WXNA 3FUNA 3B7RL 4K03A 4AEZC 4J0UA 5LX8A 1ELKA 2WXLA 1QNFA 2NC9A 5AARA 3Q73A 3NZSA 5CCLA 2AXUA 3KS2A 3CQCB 3AU4A 4AIFA 3ONLA 2R59A 4GTRA 1ZB1A 2RD0A 3P1UA 4ILHB 2J4DA 4U0UA 4APFA 4MKTA 4I17A 1O1SA 3PNTB 4XI9A 2V4LA 4IN3B 4FHKA 3D3MA 2YHEA 3FTUA 1TJFA 4PH4B 2NYJA 1YCSB 1HFAA 1DCEA 5BV1A 4A63B 2IU1A 4R7LA 1E96B 3PZ4A 3FU5A 2XS8A 3EHRA 2IOLA 2P9LG 3PEUB 3ISMC 2BF0X 3AS8A 3DPDA 4N3BA 4IRUA 4A1GA 3U4TA 4UUCA 4TRQA 4CGWA 2VGXB 1TEZA 4L9PA 3Q9UC 2UY1A 4N3CA 3ML8A 3ZXPA 2OEWA 1PC2A 2HR2A 2MOWA 2FF4A 4A3VA 3TL5A 2XGOA 5ENTD 2PM6A 3B7BA 1E90A 4Q94A 2L0IA 1K1BA 3ZHEB 3V30A 5JJ7A 2ZGGA 3LYAA 4U7EB 4G25A 5FQ8A 3SFXA 4XKBA 1B89A 3L16A 2R2LA 2PM7A 5JMND 2I1JA 3P2BA 3SGHA 1MQSA 4CYMD 1L5JA 3D9OA 4IYPA 3RRUA 2X38A 4U0ZA 4A3TA 3DPYA 3TAXA 5G04J 3Q7AA 1FVFA 2J08A 3V79K 2QC9A 3BQOA 4MBGA 3PZDA 1HG2A 2KZTA 5AQAA 3G2UA 3ZU7B 5HS0A 4QFVA 2I2OA 3UM3A 1A5EA 2WXQA 5KJMA 3IXEA 2J4BA 2R05A 4CT0A 4FJZA
chains in the Genus database with same CATH topology
5EIBE 5AQ9A 2ZGDA 1MYOA 1N0QA 4J7WA 4A63B 3DEPA 3UTMA 3Q9NC 2KXPC 2XZTG 3TWQA 1SW6A 4LSZE 3JUEA 4HRLA 3ZKJA 4HI9A 4GPMA 3EHRA 1IKND 1WG0A 4YDYA 1TR4A 5ENQD 3JXJA 2J8SD 5FINA 2L6BA 3JXIA 3UXGA 5CERB 3UI2A 1N11A 4HNAD 2Y1LE 1DC2A 5ENSD 4OAUC 4DX6D 4UUCA 3TWUA 1BD8A 4HQDA 1BI8B 4ZFHA 4HRMB 4NIKA 4DRXE 4OAVB 1AP7A 1UOHA 3SO8A 3J5QB 4U8VD 2B0OE 2MYOA 3Q9UC 5FIOA 5ENOD 2PNNA 4BEPA 5BXOA 1OT8A 4HB5A 4RLYA 1YYHA 4U8YD 4BETA 2XEEA 5HRYA 2F8XK 3D9HA 3HG0D 3B95A 3ZNGA 1BLXB 1S70B 4O60A 5ENTD 5CBOA 5D66A 3DEOA 1MJ0A 2F8YA 3B7BA 4GMRA 4HI8A 3TWXA 3TWVA 5EYPF 3V2OA 5CECB 4HRNA 1BU9A 1IXVA 1MX2A 4CZ2D 1K1BA 2V4HC 3TWSA 5CEDB 2XZDG 5ENPD 4ATZD 2DVWA 3V30A 4LNUD 1N0RA 3NOCD 4LG6A 3V2XA 2ZGGA 2AJAA 2RFMA 2ETBA 5HKPA 4BESA 1OY3D 2F37A 4U95D 2ETAA 5BXUA 5KBAA 3W9FA 3F6QA 1SVXA 2KBXA 2RFAA 3LJNA 5JMND 4DUIA 2BKKB 4F1PA 2BKGA 5AARA 5KWDA 4TUMA 5EN5D 2DWZA 4ZHBA 5EIDA 4CYMD 2DZOA 4J8YA 1D9SA 5AN8A 2ETCA 1NFIE 4O1PA 4G8KA 3V31A 4HLLA 2JABA 4B93B 2HE0A 2VGEA 2XENA 3KEAA 4HBDA 4YDWA 5JA4D 3HRAA 3TWWA 5KNGA 3T8KA 5AAOA 3V79K 2V5QC 2QC9A 5KNHD 4N5QA 1AWCB 4K5AB 4BERA 3AJIA 2Y0BG 1BI7B 3ZUVB 1QYMA 3EHQA 1DCQA 3C5RA 5AQAA 2XEHA 5ITZF 4K5CA 4DX5D 1YMPA 3TWRA 5ENRD 1WDYA 2A5EA 3T9KA 3ZU7B 4Z68A 4G8LA 5AQBA 5HS0A 1K1AA 2FO1E 3NBNB 3J5PA 4QFVA 4DX7D 5CBNA 5EILA 4JB8P 4DX2A 1MX4A 1A5EA 2P2CP 5AQ7A 4K5BA 2DZNA 3EU9A 3W9GA 3IXEA 5CEAA 1IHBA 1G3NB 5EYLA 3TWTA 4BSZB 2NYJA 1MX6A 4U96D 4O1OA 4C48B 4DX1A 1YCSB 4F6RD 3AAAC 1K3ZD 2QYJA 4QQIA 3NOGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EIB E;  5AQ9 A;  2ZGD A;  1MYO A;  1N0Q A;  4J7W A;  4A63 B;  3DEP A;  3UTM A;  3Q9N C;  2KXP C;  2XZT G;  3TWQ A;  1SW6 A;  4LSZ E;  3JUE A;  4HRL A;  3ZKJ A;  4HI9 A;  4GPM A;  3EHR A;  1IKN D;  1WG0 A;  4YDY A;  1TR4 A;  5ENQ D;  3JXJ A;  2J8S D;  5FIN A;  2L6B A;  3JXI A;  3UXG A;  5CER B;  3UI2 A;  1N11 A;  4HNA D;  2Y1L E;  1DC2 A;  5ENS D;  4OAU C;  4DX6 D;  4UUC A;  3TWU A;  1BD8 A;  4HQD A;  1BI8 B;  4ZFH A;  4HRM B;  4NIK A;  4DRX E;  4OAV B;  1AP7 A;  1UOH A;  3SO8 A;  3J5Q B;  4U8V D;  2B0O E;  2MYO A;  3Q9U C;  5FIO A;  5ENO D;  2PNN A;  4BEP A;  5BXO A;  1OT8 A;  4HB5 A;  4RLY A;  1YYH A;  4U8Y D;  4BET A;  2XEE A;  5HRY A;  2F8X K;  3D9H A;  3HG0 D;  3B95 A;  3ZNG A;  1BLX B;  1S70 B;  4O60 A;  5ENT D;  5CBO A;  5D66 A;  3DEO A;  1MJ0 A;  2F8Y A;  3B7B A;  4GMR A;  4HI8 A;  3TWX A;  3TWV A;  5EYP F;  3V2O A;  5CEC B;  4HRN A;  1BU9 A;  1IXV A;  1MX2 A;  4CZ2 D;  1K1B A;  2V4H C;  3TWS A;  5CED B;  2XZD G;  5ENP D;  4ATZ D;  2DVW A;  3V30 A;  4LNU D;  1N0R A;  3NOC D;  4LG6 A;  3V2X A;  2ZGG A;  2AJA A;  2RFM A;  2ETB A;  5HKP A;  4BES A;  1OY3 D;  2F37 A;  4U95 D;  2ETA A;  5BXU A;  5KBA A;  3W9F A;  3F6Q A;  1SVX A;  2KBX A;  2RFA A;  3LJN A;  5JMN D;  4DUI A;  2BKK B;  4F1P A;  2BKG A;  5AAR A;  5KWD A;  4TUM A;  5EN5 D;  2DWZ A;  4ZHB A;  5EID A;  4CYM D;  2DZO A;  4J8Y A;  1D9S A;  5AN8 A;  2ETC A;  1NFI E;  4O1P A;  4G8K A;  3V31 A;  4HLL A;  2JAB A;  4B93 B;  2HE0 A;  2VGE A;  2XEN A;  3KEA A;  4HBD A;  4YDW A;  5JA4 D;  3HRA A;  3TWW A;  5KNG A;  3T8K A;  5AAO A;  3V79 K;  2V5Q C;  2QC9 A;  5KNH D;  4N5Q A;  1AWC B;  4K5A B;  4BER A;  3AJI A;  2Y0B G;  1BI7 B;  3ZUV B;  1QYM A;  3EHQ A;  1DCQ A;  3C5R A;  5AQA A;  2XEH A;  5ITZ F;  4K5C A;  4DX5 D;  1YMP A;  3TWR A;  5ENR D;  1WDY A;  2A5E A;  3T9K A;  3ZU7 B;  4Z68 A;  4G8L A;  5AQB A;  5HS0 A;  1K1A A;  2FO1 E;  3NBN B;  3J5P A;  4QFV A;  4DX7 D;  5CBN A;  5EIL A;  4JB8 P;  4DX2 A;  1MX4 A;  1A5E A;  2P2C P;  5AQ7 A;  4K5B A;  2DZN A;  3EU9 A;  3W9G A;  3IXE A;  5CEA A;  1IHB A;  1G3N B;  5EYL A;  3TWT A;  4BSZ B;  2NYJ A;  1MX6 A;  4U96 D;  4O1O A;  4C48 B;  4DX1 A;  1YCS B;  4F6R D;  3AAA C;  1K3Z D;  2QYJ A;  4QQI A;  3NOG D; 
#chains in the Genus database with same CATH topology
 3FTX A;  4J7W A;  4D10 C;  3Q5M A;  3ZKJ A;  3G2V A;  4ACK A;  1H2T C;  3FUK A;  3ASF A;  2UY1 B;  3KAE A;  1NP7 A;  3QWV A;  5G04 C;  4HLE A;  3OXF A;  5D0Q D;  5G05 J;  3L82 A;  2X6K A;  2JLB A;  3HG0 D;  4KVO A;  4UQZ A;  3ESL A;  4XE0 A;  5CEC B;  4M7C A;  4GZC A;  4UI9 K;  3TWS A;  5EX3 A;  1MZC A;  1Y8M A;  2AJA A;  3TJP A;  4CRW A;  4PDX A;  5LCW C;  3W9F A;  3RRM B;  3TGO A;  3EHM A;  4G1T A;  3Q4A B;  1UJK A;  3BG0 B;  5KWD A;  3FEY A;  3VTY A;  2Y69 E;  3CK8 A;  4ANX A;  3VLF A;  3UKR G;  2VJ8 A;  4AJW A;  2FI7 A;  3FDH A;  3JQ0 A;  4U8H A;  4TXP A;  3IEG A;  3U9W A;  1NA0 A;  4UWK A;  3D9P A;  2OCC E;  1K8K G;  3NBN B;  4DX7 D;  5CBN A;  4ILG A;  4CGV A;  2RG8 A;  3SHF A;  4DLO A;  3KD7 A;  2L0T B;  5EYL A;  1E8Z A;  4MS6 A;  1MX6 A;  4DX1 A;  1O1T A;  3AAA C;  4YVQ C;  4KT6 B;  5BV0 A;  3AU5 A;  2XZT G;  2BED A;  3FUL A;  4OVV A;  1IKN D;  3VLD A;  3JXI A;  2LXL A;  2Y4T A;  4J8S A;  3FHE A;  2RKK A;  5FT9 A;  3TXM A;  4EZL A;  2J09 A;  4AY6 A;  2LO6 A;  2GRQ B;  4EZK A;  4HOS A;  3MGB A;  4OYS A;  5ENN A;  1TN7 A;  1JCS A;  3QC1 A;  3NOC D;  4GZ3 A;  2V5F A;  2XRY A;  2P9S G;  3APF A;  3LJN A;  5B3S E;  3E33 A;  4TUM A;  3DSV A;  4FLB A;  3I4G A;  4DK5 A;  2C0L A;  5C2Y A;  4B93 B;  3CIA A;  3RRN B;  1N95 A;  3EDT B;  4NUR A;  3LPZ A;  2WB2 A;  1OWM A;  1H0A A;  4GMJ A;  3MKQ B;  4K5C A;  3BUA A;  3D9M A;  4Z68 A;  3J5P A;  3ML9 A;  4JB8 P;  3D9N A;  2OOE A;  4K5B A;  3FH8 A;  4KYO B;  1HF8 A;  1Z3Y A;  2XS1 A;  2WQ6 A;  4BSZ B;  3UM0 A;  4N2Q A;  4LNB A;  3L08 A;  4XEI G;  4KVM A;  3B7T A;  4FA6 A;  2WQH A;  2R5S A;  3PE4 A;  1QBQ A;  2VTB B;  2IO3 C;  1WG0 A;  3UPV A;  3CGH A;  5FIN A;  1UG3 A;  3K9I A;  1EPU A;  3HXB A;  2QZA A;  4GYO A;  1IHG A;  4I43 A;  2MYO A;  4AV7 A;  5ANL A;  5A23 A;  3IBE A;  4JA7 A;  1H6O A;  1U3D A;  3CV0 A;  1NA3 A;  2OEV A;  1OWN A;  2XZD G;  3ABK E;  4FHJ A;  3Q79 A;  1HE8 A;  2ILR A;  1YA0 A;  2KBX A;  2CG3 A;  4JEU A;  2ION A;  2Y4U A;  5LP0 A;  3B7U X;  3PEV B;  3QDN A;  3ZYM A;  4X8Q A;  4GTS A;  4J8Y A;  2ETC A;  3V31 A;  4HBD A;  1Q2Z A;  4J6I A;  4F7A A;  3I4R B;  3ZUV B;  1QYM A;  3HHM A;  4GTP A;  1SQM A;  3FTZ A;  3UM1 A;  3PZ2 A;  4GTV A;  5B1B E;  3MV2 B;  5BW8 C;  5CEA A;  3ZHE A;  4LNG A;  4GPK A;  4DI3 A;  5LOZ A;  4U96 D;  1LF8 A;  1ELR A;  3PUK A;  4JHK A;  3UUX A;  3RKV A;  4B0Z A;  3CHS A;  1UN8 A;  3FU0 A;  3Q9N C;  4G23 A;  3X2Q E;  3E34 A;  5AIJ A;  4LRZ A;  1IYG A;  3GYZ A;  4GA2 A;  2Y1L E;  2KCL A;  2H6G A;  2BTD A;  4J8D A;  1H2V C;  2H6I A;  3FWV A;  2PL2 A;  4XI0 A;  3ZYQ A;  4BX9 A;  4B8C B;  4EHM A;  2VQ2 A;  2VGX A;  4U04 A;  5CED B;  4ATZ D;  2LSV A;  1U3C A;  3SNX A;  3O4Z A;  3FUI A;  1JWF A;  4GTO A;  3S7F A;  2F37 A;  5BXU A;  1Z3X A;  5G2N A;  2RFA A;  4DUI A;  3ZYL A;  3UT7 A;  4XIF A;  1OXJ A;  2XPY A;  4I6J A;  5AN8 A;  5DIZ A;  2E0I A;  5E75 A;  3MEK A;  1Y6I A;  2AXZ A;  1JPL A;  3S7J A;  1JCR A;  3HRA A;  5G55 A;  5D0O D;  4BT9 A;  4K5A B;  3HYM B;  2P9K G;  2NSZ A;  4C0M A;  4JD2 G;  1E8X A;  1VDY A;  1HS6 A;  4JVS A;  2H6F A;  4FU3 A;  2P2C P;  2DZN A;  3W9G A;  2M63 A;  4TXQ A;  2YNQ A;  3ZPJ A;  3L9T A;  1KT0 A;  3DRA A;  5EKQ D;  3GZ1 A;  2XGM A;  3ASN E;  5CMW A;  4QQI A;  3UM2 A;  2CFZ A;  4APO A;  4JC8 A;  2EIJ E;  1FT2 A;  3OTN A;  3CHP A;  4TUU A;  4HI9 A;  4GPM A;  3ZFW A;  4AP2 A;  1PY1 A;  3PE3 A;  2VSY A;  3QAR A;  4KZ0 A;  3UI2 A;  5KJK A;  1DC2 A;  4CDM A;  2LNI A;  5FQ4 A;  4DPR A;  4DRX E;  1AP7 A;  4PS3 A;  3R7R A;  5BXO A;  4URK A;  3UIP C;  3EIJ A;  4LEU A;  3D9H A;  1WY6 A;  2GRR B;  3ULY A;  4U63 A;  3CVV A;  3C3Q A;  3CSF A;  3FUF A;  2WXP A;  2FO7 A;  3ASG A;  4JW1 A;  3QB2 A;  4LER A;  2WXG A;  4LCT A;  3PS6 A;  4FC8 A;  1JWG A;  3R9A B;  4F1P A;  3G2W A;  3PRZ A;  3AG2 E;  3ONK A;  4V3I A;  4GCN A;  4ABN A;  2IEJ A;  3ZYK A;  4HOU A;  3FY4 A;  2IFU A;  2VSX E;  2IOS A;  4LUN U;  3TWW A;  2QYU A;  4RVB A;  5JHA A;  4Y6W A;  1D8D A;  4N5Q A;  4N5C A;  4I1O B;  3C5R A;  3CST A;  5ITZ F;  2AW6 A;  4E6H A;  4G8L A;  3FEX A;  1TNB A;  3G2T A;  2A4Z A;  1OWO A;  3FUJ A;  1S0P A;  3U3W A;  5ARF A;  3DXK G;  1HXI A;  3UIO C;  1KZO A;  1U2V G;  2EIN E;  4HVB A;  3Q7F A;  2EIL E;  2IF4 A;  5AQ9 A;  1N0Q A;  3DEP A;  4NRH B;  1V55 E;  2WXF A;  4HS2 A;  4LSZ E;  4P29 A;  3FTY A;  3GW4 A;  3FTS A;  1TR4 A;  5ENQ D;  2CHZ A;  4BSX A;  5J90 A;  3D9K A;  1E8Y A;  4G11 A;  2FEZ A;  1BD8 A;  1BI8 B;  5FQ6 A;  5LFA A;  4B8A A;  2XEE A;  2YHC A;  4WUY A;  4G24 A;  5D66 A;  4GMR A;  2F0Y A;  3U66 A;  3D9J A;  4LNU D;  2I6H A;  2LAH A;  4UQX A;  2KCV A;  4A1S A;  4YDO A;  5KJL A;  3C3O A;  2HM8 A;  1BPO A;  3DST A;  3Q78 A;  1FPP A;  1X81 A;  1EDU A;  5EID A;  3UT8 A;  1UJJ A;  4WNF A;  4O1P A;  3PH0 C;  3I3N A;  3CHR A;  3MKQ A;  1LTX A;  4UWF A;  4TV3 A;  3ZN3 A;  3N71 A;  3TWR A;  3T9K A;  2GRM A;  3LEW A;  3SBT B;  2R02 A;  3Q15 A;  4ME2 A;  5A7D B;  2P9P G;  5CRU A;  1INZ A;  4C0E A;  5BNW A;  1OCC E;  2ZGD A;  5KCM A;  3TWQ A;  4RSY A;  4A55 A;  2VYI A;  3L17 A;  2WXR A;  2DIW A;  4BWR A;  2X3M A;  4YDY A;  3CKC A;  4GAA A;  4I9E A;  3CVU A;  3E4B A;  1N11 A;  3QK0 A;  4ANU A;  1H6K A;  4MRU A;  3LXU X;  3G2S A;  4RG9 A;  4HRM B;  3URZ A;  3CEQ A;  3KSQ A;  3EU5 A;  4U8V D;  2CFU A;  2IO2 C;  2VGY A;  3U64 A;  1YYH A;  2H6H A;  3CVN A;  4WNE A;  3RO3 A;  3UT4 A;  2OND A;  3B95 A;  3ZNG A;  3MX3 A;  1O1R A;  5G05 C;  2EQX A;  4UI9 C;  4ANW A;  3SI5 A;  2GGF A;  3TG4 A;  1HO8 A;  2DZO A;  3AS4 A;  5JJT A;  2AWI A;  1XNF A;  3FTV A;  3B13 A;  3FU6 A;  4Q69 A;  4IUL A;  5JA4 D;  4KZC A;  3EIQ C;  5KNG A;  4GYW A;  2V5Q C;  5KNH D;  3CVQ A;  2P9I G;  4FLH A;  1AWC B;  5CHE E;  4CEM A;  2OV8 A;  4DX5 D;  1N4Q A;  3NB2 A;  2WMO A;  1JUQ A;  2XEV A;  3APD A;  1Z5S C;  1S63 A;  2V8S E;  5C1D A;  4U07 A;  3S7D A;  1ZBP A;  2ZXW E;  3EJN A;  1IQU A;  3AG3 E;  5IY5 E;  5AEN A;  1EF1 C;  4RQI A;  4GZ5 A;  3SZ7 A;  1TNZ A;  5A6C A;  3JUE A;  3RIB A;  3LY8 A;  4CDN A;  2KM4 A;  3DSX A;  5T8I A;  2LAI A;  3UXG A;  3MCX A;  2WQ7 A;  3TWU A;  1NZN A;  4BEP A;  1OT8 A;  4N39 A;  3GZ2 A;  4GA0 A;  4JZY A;  2UWJ G;  4EPZ A;  1TNO A;  3NAW A;  4PUC A;  3VTX A;  2DCP A;  4E85 A;  2C2L A;  1N0R A;  1HZ4 A;  4L7T A;  2KZT B;  4U95 D;  1PAQ A;  1IQR A;  3CK9 A;  3NZU A;  5J08 A;  3FUM A;  2JEK A;  3ABM E;  3PVL A;  4EBA A;  5ARG A;  5B1A E;  4UWL A;  4NAC A;  4MLP A;  4KXK B;  1Z6T A;  3ZRH A;  3KEA A;  3ESK A;  3ASD A;  1BI7 B;  1YMP A;  5ENR D;  2A5E A;  1FVH A;  5AQB A;  2XPZ A;  1DNP A;  1OCZ E;  3S7B A;  5HQ8 A;  1HG5 A;  2QFC A;  2X6I A;  1MHQ A;  2XCB A;  3PZ1 A;  4ILI A;  4AVX A;  4C48 B;  4DI4 A;  4UI9 J;  1LD7 A;  1LD8 A;  2IQC A;  2V0P A;  3NOG D;  3HXF A;  1S64 A;  3FH7 A;  1SW6 A;  3RK6 A;  4KMO A;  1H19 A;  3JXJ A;  3RAU A;  1N52 A;  1HX8 A;  3T5V A;  2LXM A;  4YND A;  1UOH A;  3HVE B;  2AVP A;  2PNN A;  4BET A;  1OUV A;  5CMY A;  1MJ0 A;  3EUV A;  5EYP F;  3ABL E;  4KBQ A;  4WWP A;  2RFM A;  4BES A;  3WG7 E;  3T8M A;  4W9R A;  3E32 A;  5EN5 D;  3L6A A;  2EIK E;  2GRP B;  3FUE A;  3MZL B;  1KLX A;  3D9L A;  2CHX A;  4GCO A;  3RJV A;  4BT8 A;  3AJI A;  1RW2 A;  2Y0B G;  2ZIR A;  3EHQ A;  3JCK C;  1DCQ A;  1WDY A;  4N3A A;  4PS8 A;  1WAO 1;  3IHY A;  4CT4 A;  4BTB A;  4EEC A;  4NQ0 A;  4JPS A;  3ULE G;  1MX4 A;  3CHQ A;  3FFL A;  3IKO B;  3T5X A;  4GZ6 A;  3TG5 A;  1TNU A;  3Q75 A;  2AXV A;  2P9U G;  4HOQ A;  4J8F A;  2Y3A A;  5T3R A;  3SY2 A;  2FUL A;  2PQR A;  4AY5 A;  4L2Y A;  2LUH A;  3CKB A;  2KAT A;  4EZJ A;  2WPV A;  3LY9 A;  2DYS E;  3DSS A;  5BPP A;  3J5Q B;  2C0M A;  4HB5 A;  5EDS A;  1OCR E;  3QKY A;  3ENE A;  3HXE A;  3L22 A;  1BU9 A;  1NL4 A;  4XX5 A;  2DVW A;  3FH5 A;  3GZS A;  2GRO B;  4JL0 A;  2YIN A;  2ETB A;  1O5M A;  4TXR A;  3F6Q A;  2WXI A;  2BKK B;  2CHW A;  4DLQ A;  4FUL A;  4I1M A;  2I1K A;  1D8E A;  5DBK A;  4HLL A;  3D9I A;  4GA1 A;  3NQP A;  3CVY A;  3C72 A;  3BEE A;  5T4Y A;  4I2Z A;  1WM5 A;  2XEH A;  1SA4 A;  3PDN A;  4GML A;  3ZXS A;  2VTB A;  3MKR A;  5BUZ A;  2FO1 E;  3SFZ A;  2MHK A;  2MRI A;  4JXT A;  5AQ7 A;  5ANR A;  1IHB A;  3FP3 A;  2GW1 A;  3CHO A;  5KJN A;  3OXG A;  4F6R D;  5EX0 A;  2XRZ A;  1K3Z D;  2VSN A;  2J9Q A;  2OVB A;  4WWO A;  3SF4 A;  1TN6 A;  2WMN A;  3JQ1 A;  4CDR A;  4HRL A;  2J07 A;  3KEZ A;  3O48 A;  5FZR A;  1KPS B;  2R17 C;  2L6B A;  4I2W A;  3DBS A;  4HQD A;  4JA9 A;  4BFR A;  4OAV B;  3ZGQ A;  4U8Y D;  4GZD A;  3ULQ A;  4DJA A;  2WM9 A;  1P5Q A;  5H7P A;  4HRN A;  1IXV A;  2OVF A;  2YQ8 A;  3LY7 A;  1OCO E;  3LS8 A;  2J49 A;  2BUG A;  4FJY A;  2KC7 A;  1N4P A;  5KBA A;  3DWL G;  1SA5 A;  1TNY A;  1EYH A;  2HYZ A;  4F3V A;  3PUJ A;  4ZHB A;  4YVO A;  1X5B A;  2ZIS A;  3DSW A;  3IHV A;  2XPI A;  3I5P A;  5AAO A;  4BER A;  1N94 A;  1SZ9 A;  2XGS A;  2KCK A;  3FUH A;  4G2V A;  3HXC A;  3APC A;  1ELW A;  4AM9 A;  3MA5 A;  3LJ3 A;  1HU3 A;  4O1O A;  2LSU A;  3CK7 A;  3E37 A;  1MYO A;  1V54 E;  4YDE A;  3RU0 A;  3R7Q A;  4L23 A;  3CLJ A;  3AS5 A;  2J8S D;  5CER B;  4UWG A;  4HFG A;  3S2A A;  4C9B B;  4N2S A;  1UW4 B;  3CR3 A;  4RLY A;  3L54 A;  3QNK A;  4GTT A;  1BLX B;  3QWP A;  4O60 A;  5FWQ A;  2XHE A;  3V2O A;  3QAQ A;  3BG1 B;  1MX2 A;  2VSO E;  3CQG B;  2V4H C;  4Y6C A;  1TYQ G;  3QJZ A;  4H7X A;  4H7Y A;  2WXO A;  5HKP A;  2ETA A;  2P58 C;  1DVP A;  3ZEF A;  3C3R A;  2IY0 C;  4GYY A;  2CG2 A;  2I9C A;  2L9B A;  4G8K A;  5FJY A;  2XQ0 A;  2QY7 A;  4YDW A;  3HIZ A;  4Q96 A;  2WXK A;  3T8K A;  2EIM E;  4RG6 A;  4F53 A;  2ZU6 B;  1QQE A;  1N4R A;  5CRV A;  4HOR A;  4F1S A;  4G26 A;  4UQY A;  3CVL A;  3CVW A;  3E30 A;  4CCA A;  4WNG A;  1JCQ A;  3EU9 A;  4O6F A;  4FAD A;  1KT1 A;  3DXM G;  1G3N B;  3TWT A;  3CVX A;  3UKU G;  4EBA G;  3LVR E;  1H2U A;  2PZI A;  3B7S A;  2P9N G;  4I6E A;  1E8W A;  1FT1 A;  5AJD A;  1N9A A;  3OXL A;  2WVI A;  3DSU A;  3MV3 B;  4UWH A;  5FTP A;  1A17 A;  1TN8 A;  4HNA D;  2NXP A;  4AXH A;  4U0S A;  5FIO A;  3MYV A;  3PZ3 A;  4GB9 A;  2DYR E;  1S70 B;  4HI8 A;  3TWX A;  5HI7 A;  4CZ2 D;  1NI1 A;  3RSE G;  4WWN A;  3LCA A;  3ZVV A;  1SVX A;  3CHM A;  1RZ4 A;  3AG4 E;  3C98 A;  2DWZ A;  3FTW A;  3NF1 A;  4M3O A;  1HH8 A;  4BY6 A;  1D9S A;  4I9C A;  3UMV A;  2GRN B;  2IJG X;  4BTA A;  2HE0 A;  2VGE A;  3LDZ A;  2R03 A;  3Q49 B;  1XGW A;  4I1A A;  2DBA A;  3ASH A;  4AOF A;  4GU5 A;  3AG1 E;  1OWP A;  4L1B A;  3UX4 A;  3PNL B;  4HOT A;  2B6C A;  5EIL A;  4DX2 A;  3SD5 A;  4JEH A;  2GRL A;  5M72 A;  3IV0 A;  1W3B A;  3BU8 A;  2QYJ A;  2X6J A;  1OWL A;  4I6G A;  4WAF A;  5FQ7 A;  1H6P A;  2KXP C;  4GTQ A;  3SQV A;  5JHB A;  5FZS A;  5JJ6 A;  4GTM A;  3WXX A;  4ANV A;  5ENS D;  4BX8 A;  4JHJ A;  4OAU C;  4WND A;  2B0O E;  3VLE A;  5D2M C;  5E76 A;  5HRY A;  2F8X K;  1TJC A;  4FP7 A;  3TXN A;  5CBO A;  3DEO A;  1GW6 A;  4EQF A;  5ENP D;  1N4S A;  3R9M A;  3HVE A;  1OY3 D;  4XZ4 A;  1KZP A;  4JHR A;  2E2E A;  2BKG A;  3FUD A;  1NFI E;  2JAB A;  5AJL A;  4B89 A;  3QWW A;  2XEN A;  3JYS A;  3RO2 A;  5BT1 A;  3ZIM A;  4XKC A;  3L13 A;  2XCC A;  4HXI A;  1K1A A;  3SFY A;  3FU3 A;  1QZ2 A;  5AYW D;  3HDX A;  2Q7F A;  1N54 A;  4L2L A;  3HXD A;  1E7V A;  3QOU A;  1SZA A;  2HO1 A;  3ASO E;  5FZQ A;  3MJW A;  2A5U A;  3Q47 B;  1ZU2 A;  2X6F A;  3LKU A;  5EIB E;  2PQN A;  2X6H A;  3CVP A;  3UTM A;  5CCM A;  1UN9 A;  1E7U A;  3KSL A;  3PRE A;  4J8E A;  2WXJ A;  3JUI A;  3EHN A;  3OAW A;  3LVQ E;  4DX6 D;  2WXH A;  4ZFH A;  4NIK A;  3SO8 A;  3ZW3 A;  5ENO D;  4ACL A;  3SBS A;  5LCW J;  4ATG A;  2FBN A;  4PS7 A;  2F8Y A;  2WXM A;  3TWV A;  2L6J A;  4OVU A;  3UQ3 A;  4K0R A;  4B94 A;  1FCH A;  4LG6 A;  3UIN C;  3V2X A;  2WXN A;  3FUN A;  3B7R L;  4K03 A;  4AEZ C;  4J0U A;  5LX8 A;  1ELK A;  2WXL A;  1QNF A;  2NC9 A;  5AAR A;  3Q73 A;  3NZS A;  5CCL A;  2AXU A;  3KS2 A;  3CQC B;  3AU4 A;  4AIF A;  3ONL A;  2R59 A;  4GTR A;  1ZB1 A;  2RD0 A;  3P1U A;  4ILH B;  2J4D A;  4U0U A;  4APF A;  4MKT A;  4I17 A;  1O1S A;  3PNT B;  4XI9 A;  2V4L A;  4IN3 B;  4FHK A;  3D3M A;  2YHE A;  3FTU A;  1TJF A;  4PH4 B;  2NYJ A;  1YCS B;  1HFA A;  1DCE A;  5BV1 A;  4A63 B;  2IU1 A;  4R7L A;  1E96 B;  3PZ4 A;  3FU5 A;  2XS8 A;  3EHR A;  2IOL A;  2P9L G;  3PEU B;  3ISM C;  2BF0 X;  3AS8 A;  3DPD A;  4N3B A;  4IRU A;  4A1G A;  3U4T A;  4UUC A;  4TRQ A;  4CGW A;  2VGX B;  1TEZ A;  4L9P A;  3Q9U C;  2UY1 A;  4N3C A;  3ML8 A;  3ZXP A;  2OEW A;  1PC2 A;  2HR2 A;  2MOW A;  2FF4 A;  4A3V A;  3TL5 A;  2XGO A;  5ENT D;  2PM6 A;  3B7B A;  1E90 A;  4Q94 A;  2L0I A;  1K1B A;  3ZHE B;  3V30 A;  5JJ7 A;  2ZGG A;  3LYA A;  4U7E B;  4G25 A;  5FQ8 A;  3SFX A;  4XKB A;  1B89 A;  3L16 A;  2R2L A;  2PM7 A;  5JMN D;  2I1J A;  3P2B A;  3SGH A;  1MQS A;  4CYM D;  1L5J A;  3D9O A;  4IYP A;  3RRU A;  2X38 A;  4U0Z A;  4A3T A;  3DPY A;  3TAX A;  5G04 J;  3Q7A A;  1FVF A;  2J08 A;  3V79 K;  2QC9 A;  3BQO A;  4MBG A;  3PZD A;  1HG2 A;  2KZT A;  5AQA A;  3G2U A;  3ZU7 B;  5HS0 A;  4QFV A;  2I2O A;  3UM3 A;  1A5E A;  2WXQ A;  5KJM A;  3IXE A;  2J4B A;  2R05 A;  4CT0 A;  4FJZ A; 
#chains in the Genus database with same CATH homology
 5EIB E;  5AQ9 A;  2ZGD A;  1MYO A;  1N0Q A;  4J7W A;  4A63 B;  3DEP A;  3UTM A;  3Q9N C;  2KXP C;  2XZT G;  3TWQ A;  1SW6 A;  4LSZ E;  3JUE A;  4HRL A;  3ZKJ A;  4HI9 A;  4GPM A;  3EHR A;  1IKN D;  1WG0 A;  4YDY A;  1TR4 A;  5ENQ D;  3JXJ A;  2J8S D;  5FIN A;  2L6B A;  3JXI A;  3UXG A;  5CER B;  3UI2 A;  1N11 A;  4HNA D;  2Y1L E;  1DC2 A;  5ENS D;  4OAU C;  4DX6 D;  4UUC A;  3TWU A;  1BD8 A;  4HQD A;  1BI8 B;  4ZFH A;  4HRM B;  4NIK A;  4DRX E;  4OAV B;  1AP7 A;  1UOH A;  3SO8 A;  3J5Q B;  4U8V D;  2B0O E;  2MYO A;  3Q9U C;  5FIO A;  5ENO D;  2PNN A;  4BEP A;  5BXO A;  1OT8 A;  4HB5 A;  4RLY A;  1YYH A;  4U8Y D;  4BET A;  2XEE A;  5HRY A;  2F8X K;  3D9H A;  3HG0 D;  3B95 A;  3ZNG A;  1BLX B;  1S70 B;  4O60 A;  5ENT D;  5CBO A;  5D66 A;  3DEO A;  1MJ0 A;  2F8Y A;  3B7B A;  4GMR A;  4HI8 A;  3TWX A;  3TWV A;  5EYP F;  3V2O A;  5CEC B;  4HRN A;  1BU9 A;  1IXV A;  1MX2 A;  4CZ2 D;  1K1B A;  2V4H C;  3TWS A;  5CED B;  2XZD G;  5ENP D;  4ATZ D;  2DVW A;  3V30 A;  4LNU D;  1N0R A;  3NOC D;  4LG6 A;  3V2X A;  2ZGG A;  2AJA A;  2RFM A;  2ETB A;  5HKP A;  4BES A;  1OY3 D;  2F37 A;  4U95 D;  2ETA A;  5BXU A;  5KBA A;  3W9F A;  3F6Q A;  1SVX A;  2KBX A;  2RFA A;  3LJN A;  5JMN D;  4DUI A;  2BKK B;  4F1P A;  2BKG A;  5AAR A;  5KWD A;  4TUM A;  5EN5 D;  2DWZ A;  4ZHB A;  5EID A;  4CYM D;  2DZO A;  4J8Y A;  1D9S A;  5AN8 A;  2ETC A;  1NFI E;  4O1P A;  4G8K A;  3V31 A;  4HLL A;  2JAB A;  4B93 B;  2HE0 A;  2VGE A;  2XEN A;  3KEA A;  4HBD A;  4YDW A;  5JA4 D;  3HRA A;  3TWW A;  5KNG A;  3T8K A;  5AAO A;  3V79 K;  2V5Q C;  2QC9 A;  5KNH D;  4N5Q A;  1AWC B;  4K5A B;  4BER A;  3AJI A;  2Y0B G;  1BI7 B;  3ZUV B;  1QYM A;  3EHQ A;  1DCQ A;  3C5R A;  5AQA A;  2XEH A;  5ITZ F;  4K5C A;  4DX5 D;  1YMP A;  3TWR A;  5ENR D;  1WDY A;  2A5E A;  3T9K A;  3ZU7 B;  4Z68 A;  4G8L A;  5AQB A;  5HS0 A;  1K1A A;  2FO1 E;  3NBN B;  3J5P A;  4QFV A;  4DX7 D;  5CBN A;  5EIL A;  4JB8 P;  4DX2 A;  1MX4 A;  1A5E A;  2P2C P;  5AQ7 A;  4K5B A;  2DZN A;  3EU9 A;  3W9G A;  3IXE A;  5CEA A;  1IHB A;  1G3N B;  5EYL A;  3TWT A;  4BSZ B;  2NYJ A;  1MX6 A;  4U96 D;  4O1O A;  4C48 B;  4DX1 A;  1YCS B;  4F6R D;  3AAA C;  1K3Z D;  2QYJ A;  4QQI A;  3NOG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...