1S70B

Complex between protein ser/thr phosphatase-1 (delta) and the myosin phosphatase targeting subunit 1 (mypt1)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
291
Chain Sequence
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRKKTKVKFDDGAVFLAACSSGDTEEVLRLLERGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEYLISQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQARYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMEAVNKVGQTAFDVADEDILGYLEELQKKQNLLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine protein phosphatase PP1-beta (or delta) cat
publication title Structural basis of protein phosphatase 1 regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 80
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
B PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1s70B01
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1s70B02
5EIDA 3UI2A 1MJ0A 1MYOA 1QYMA 2Y1LE 4HLLA 5AARA 5CEAA 2NYJA 4DX5D 1N0RA 4HI8A 5EYPF 5KNHD 1YYHA 2ZGGA 1MX2A 2P2CP 3EU9A 1BLXB 3W9FA 3W9GA 1A5EA 1N0QA 5HS0A 4ZFHA 3HG0D 4YDWA 3DEOA 2F8YA 5EILA 2HE0A 1IKND 3LJNA 4U8VD 4K5CA 3NOGD 4U95D 5ENQD 5CERB 1K1AA 2DZOA 1K1BA 3V2XA 3NBNB 3ZNGA 5KBAA 4ZHBA 1UOHA 1BI8B 3V31A 4C48B 3Q9NC 1SVXA 4JB8P 3Q9UC 3SO8A 4K5BA 4CZ2D 3TWXA 2BKGA 2V4HC 3D9HA 1BI7B 2J8SD 3AAAC 3JUEA 5AN8A 4TUMA 4DRXE 4DX6D 1D9SA 4LG6A 2ZGDA 5ENSD 3TWRA 2F37A 1G3NB 5ENTD 5JMND 4F6RD 2DVWA 3UTMA 5ENRD 4HI9A 4DUIA 1TR4A 1WDYA 4ATZD 3TWQA 4F1PA 3TWUA 4DX7D 2RFAA 5CECB 4J7WA 2BKKB 2ETBA 5BXUA 1AP7A 5EYLA 1N11A 1OT8A 2PNNA 3B7BA 3J5PA 3V79K 2F8XK 2KBXA 4QFVA 4O60A 5HKPA 3HRAA 2XZTG 4G8KA 4RLYA 4A63B 1MX4A 2FO1E 2AJAA 3ZU7B 5ITZF 4DX1A 4G8LA 3IXEA 2ETCA 3B95A 1WG0A 3KEAA 2DWZA 5ENPD 2A5EA 4GPMA 5CEDB 4HBDA 4OAUC 4HB5A 3T8KA 2DZNA 5FIOA 4NIKA 5HRYA 5FINA 4J8YA 2V5QC 1YMPA 2L6BA 2RFMA 2VGEA 5JA4D 5D66A 4QQIA 4BEPA 4YDYA 4N5QA 3TWSA 3TWVA 1NFIE 4O1PA 4GMRA 5AQ7A 5AQAA 4U8YD 4O1OA 4Z68A 5CBNA 4BETA 1K3ZD 2B0OE 4HRNA 4BERA 2KXPC 4HQDA 3JXIA 5KWDA 4OAVB 3J5QB 4UUCA 3TWTA 1OY3D 1YCSB 3AJIA 5EIBE 1MX6A 4HRLA 1IXVA 2QC9A 4K5AB 3T9KA 3EHRA 4DX2A 1AWCB 5EN5D 4U96D 3V30A 1S70B 2Y0BG 3ZKJA 4B93B 4BSZB 4CYMD 4HNAD 5KNGA 3F6QA 1SW6A 3NOCD 1DCQA 4HRMB 2XZDG 2MYOA 3JXJA 3ZUVB 3C5RA 5BXOA 1BU9A 5AQBA 3EHQA 4LSZE 5ENOD 2ETAA 2JABA 5AAOA 5AQ9A 2XEEA 3DEPA 4LNUD 3TWWA 4BESA 2XENA 1BD8A 1DC2A 3V2OA 2QYJA 3UXGA 5CBOA 2XEHA 1IHBA
chains in the Genus database with same CATH superfamily
3KD7A 4IYPA 1MX2A 1UG3A 3TXNA 1N0QA 1E7UA 4YDWA 3GYZA 4U07A 4CGVA 4G2VA 4BWRA 3LVRE 2P9IG 3D9PA 2BUGA 2OEVA 1NP7A 3FH5A 4PS8A 3IEGA 3ZEFA 3E30A 3UM0A 4HLEA 4KVMA 4E85A 2ZISA 5AYWD 3SZ7A 4FP7A 1GW6A 3IHYA 3EHMA 4RG9A 2J09A 2EIKE 3APDA 3KEAA 3ZIMA 3FFLA 2KCVA 1KZPA 4UQZA 4WAFA 4GTRA 4GTPA 3PREA 2JEKA 3B7UX 1QQEA 4GMRA 5CHEE 3RO3A 3BQOA 3RRUA 3LPZA 1S70B 1HF8A 3BUAA 3FUNA 1FT2A 1FVHA 5AQBA 3T5XA 4LSZE 2ETAA 4O6FA 5AAOA 1DC2A 3MGBA 1QBQA 3UT4A 5CBOA 2Y3AA 5LOZA 3PRZA 3FTUA 2HM8A 1LD8A 2E0IA 3UIOC 2IOLA 2LNIA 3Q4AB 1K1AA 3UMVA 5FJYA 3NBNB 2IJGX 2CG3A 3EIQC 4AP2A 1WY6A 4U04A 1O5MA 4CZ2D 4U0UA 1Y6IA 1TJCA 2CHXA 2MHKA 3JUEA 4HOUA 4Y6WA 3CHOA 4GZ6A 3ABME 4EZKA 2EILE 4DJAA 5EYLA 2X6HA 3EUVA 3UKUG 3MKQB 2Q7FA 4H7XA 3Q7FA 2DWZA 4XE0A 4GPMA 2VSNA 3HXCA 4BY6A 2LSVA 2WXJA 4BX8A 3FTXA 1E90A 3D9JA 2L6BA 3ZYLA 1OCZE 1RZ4A 3SBTB 3NZUA 3QARA 4G24A 3J5QB 3UT7A 1IQUA 2WXGA 5KCMA 2L6JA 3CSFA 3FWVA 3QDNA 4NURA 5ENOD 1X5BA 2DIWA 2C2LA 3FU0A 5KNHD 1P5QA 3TGOA 5FZSA 4DX5D 4JA9A 3SF4A 2H6GA 5FQ4A 3KS2A 1FCHA 3FHEA 3B7TA 1NL4A 3U9WA 3ML9A 3D9IA 3E33A 4A1SA 2KCKA 2WXHA 1XNFA 5AN8A 2ZGDA 4UQXA 3CQGB 3TWRA 3Q5MA 3UX4A 2I1JA 3C72A 3DXMG 4LEUA 2CFZA 2VTBB 4KYOB 1JPLA 1BPOA 1OT8A 3J5PA 2X6IA 2WXFA 3CHQA 3FEYA 5EKQD 3HRAA 5A6CA 3DSTA 2KZTB 3MKQA 5CEDB 5HQ8A 3FU5A 4Y6CA 4C0MA 4HOSA 2WXIA 3URZA 4JEHA 2LXMA 4J8YA 4O1PA 1IQRA 4IULA 4B0ZA 4B8CB 1OWLA 4FC8A 4EZLA 3AJIA 3EHRA 3OXFA 1SW6A 2C0LA 4HRMB 3JXJA 4P29A 1Z5SC 3RIBA 5AJLA 1N4RA 3R9MA 4Q96A 2QYJA 2EINE 4TRQA 5EIDA 1QZ2A 4PUCA 2LAIA 3ZPJA 4Q69A 4YNDA 4N2QA 1JUQA 5M72A 5G55A 1L5JA 4JHRA 5ENQD 3V2XA 2WM9A 4WNDA 5J08A 5ANRA 2IY0C 3MKRA 4B8AA 2MOWA 3Q49B 3SO8A 1HE8A 3CLJA 1HH8A 2M63A 1OCRE 4I6GA 4GZDA 3TJPA 2VYIA 3E34A 3CK8A 4KZ0A 2NSZA 4F1SA 4BFRA 3T5VA 3ZXPA 2ETBA 1TN6A 1N11A 2P58C 1D8DA 2XEVA 2VSXE 4KVOA 2WXOA 2E2EA 4RG6A 2VGEA 4BEPA 2VGXB 3RK6A 4U0ZA 2XQ0A 3Q47B 3KEZA 2KCLA 4FULA 2A5UA 5A23A 3SFYA 5EIBE 5A7DB 1N4QA 3CVLA 3OTNA 4NRHB 2YNQA 5FTPA 4AXHA 3ABKE 4HNAD 1H2UA 1DCQA 3CHPA 3O48A 2GROB 2CHZA 3SY2A 3CSTA 5C1DA 1H2TC 3RJVA 4FHJA 4CCAA 2WXLA 3JQ1A 1IHBA 1QYMA 3CK9A 5CEAA 3UUXA 3S2AA 5AIJA 4JA7A 4WNEA 3QWVA 2XCBA 5BNWA 5CERB 3CGHA 2CHWA 4CT0A 3HXDA 3I4GA 3FDHA 3SD5A 2P9LG 4ILIA 5E75A 4A3TA 1EF1C 4HS2A 3Q7AA 2WPVA 4GTMA 4DX6D 1D8EA 1Y8MA 3UM1A 4LG6A 1N4SA 3EU5A 5CMYA 5ENSD 2GRLA 4TXRA 4L9PA 4DUIA 4Q94A 2I2OA 4D10C 4KZCA 3B7BA 5FZQA 4FU3A 1H19A 4I1AA 5BV0A 4G8LA 3ZYQA 2WMOA 2X38A 4UWLA 3CQCB 3LVQE 1ELWA 4XKCA 4HB5A 4M7CA 3AG1E 3EHNA 4NIKA 1KZOA 2J4BA 2YINA 3ASOE 4ATGA 5D0OD 5AQAA 1NA3A 2XGOA 3PS6A 4O1OA 4BETA 4PH4B 4OAVB 2OEWA 3JXIA 3R9AB 1IXVA 3ULEG 4J0UA 2ZIRA 4BT8A 2QZAA 3RKVA 1OCOE 3BU8A 1ZBPA 3LXUX 4GAAA 3BG0B 4GA2A 3S7FA 2B6CA 3MJWA 2QYUA 3V2OA 3VTXA 1UN9A 2P9KG 3PZ2A 3CVXA 5EYPF 1YYHA 4M3OA 1BLXB 3FUHA 3NB2A 3ABLE 3FTYA 2DZOA 5AJDA 1E8WA 5ARGA 2Y4UA 4AY6A 3L17A 2V4HC 4APFA 1D9SA 4RVBA 4UWGA 2F37A 5JMND 4EPZA 4FA6A 3ZN3A 5JHAA 4I43A 5D2MC 3FY4A 1WDYA 4JVSA 3D3MA 4DX7D 2JLBA 2LSUA 4J7WA 2IO3C 3GZ2A 3UIPC 5HKPA 1MX4A 3PUKA 2J07A 2V4LA 2H6FA 3QK0A 5D0QD 4HFGA 3GZSA 1HZ4A 5BUZA 5D66A 3MZLB 3TL5A 3MV2B 3C98A 4GCOA 1TNYA 5KWDA 2IFUA 3TWTA 3QAQA 2R5SA 4ANUA 3RO2A 1Z3XA 3MX3A 3QB2A 4B93B 3SQVA 3E37A 2X3MA 3NAWA 1BU9A 2J4DA 3U64A 2ZU6B 3ESKA 3TWWA 1U3CA 1ELKA 5DBKA 5KJKA 4AJWA 3DXKG 4K0RA 3ASHA 4PDXA 2P2CP 5LFAA 4L23A 3DEOA 5EILA 2R2LA 2KM4A 2EQXA 3C3RA 1VDYA 4WWNA 4GA1A 3V31A 5HI7A 3IKOB 1S63A 4YVOA 2WMNA 1SA4A 4GYWA 3O4ZA 2J9QA 2UY1B 3L08A 3V79K 1Z6TA 1H6KA 2GRNB 3DSSA 3AU4A 1ZU2A 2FO1E 1IYGA 1S0PA 2PM6A 4C9BB 3AU5A 3DPDA 3RRMB 3TWVA 1LTXA 3NQPA 1O1RA 2XGMA 3GZ1A 4UUCA 1UJKA 3E32A 5EX0A 1E7VA 3ONKA 4JL0A 4JPSA 4U96D 4PS7A 4BSZB 4BSXA 3ONLA 2WB2A 4JHKA 3G2UA 2V0PA 4WNFA 3AS8A 3Q78A 1DCEA 3UXGA 1OUVA 3TXMA 1E8YA 4UWHA 3L13A 3FEXA 4CEMA 3NOGD 4U95D 1OWNA 2RKKA 3BEEA 3LY7A 3U66A 2I9CA 2WQ7A 2QFCA 2WVIA 4GCNA 4X8QA 3KSQA 5FQ7A 1BI7B 3DBSA 2OV8A 2PQRA 4E6HA 4NACA 3ASDA 2R03A 3G2TA 4ATZD 5BXUA 4LERA 3LKUA 3BG1B 3OAWA 4XZ4A 4AM9A 1UJJA 4B94A 2ETCA 5ENPD 4N3AA 4CRWA 3PUJA 3FUJA 3LCAA 1TNUA 3FU6A 2GRRB 1KT0A 3LYAA 3NF1A 3L6AA 5CBNA 2J08A 5FT9A 4B89A 3FTZA 2H6HA 2GRMA 2L0IA 3AG4E 2QC9A 4YDOA 2J49A 3S7JA 4I17A 3SI5A 5G04C 4AOFA 4GMJA 4EBAA 1O1TA 4GA0A 3L22A 1HO8A 3ZW3A 5HS0A 3MV3B 3PDNA 5T4YA 4GYYA 3DWLG 1PC2A 3ZHEB 3B7SA 3L16A 3RU0A 4NQ0A 2VSOE 3SNXA 4K5BA 4DPRA 3QKYA 1N54A 2J8SD 2X6FA 2WXMA 3HXFA 4LNBA 2IF4A 1K8KG 3AS4A 3UTMA 1NZNA 1FVFA 1QNFA 4DLQA 3KAEA 1MHQA 4N5CA 2BKKB 4GTSA 3N71A 4I2ZA 3UKRG 4XI9A 3SBSA 2IQCA 4EECA 4FJYA 1S64A 2HYZA 4GTVA 3E4BA 2PZIA 4WNGA 3T8KA 4TXPA 3CIAA 3T8MA 2L9BA 5AENA 5G05C 3G2WA 3ASGA 1MZCA 3CVYA 4LRZA 1JCRA 3C3QA 1N95A 2DCPA 4ACLA 2MRIA 4HRNA 4HQDA 3GW4A 3ZRHA 3HXEA 2VTBA 1HFAA 1HU3A 3LY9A 2WXRA 3VTYA 3FP3A 2GRQB 2Y0BG 2ZXWE 2KZTA 3P1UA 1JCSA 3VLFA 2OCCE 3HXBA 4ILHB 5AQ9A 4KMOA 3FU3A 1ZB1A 3QOUA 2Y1LE 4KXKB 1TN8A 3LY8A 2KC7A 4G25A 2F8YA 5ENNA 1K1BA 4GMLA 1KPSB 4A1GA 4GU5A 5BW8C 1E8ZA 2XGSA 3EIJA 1SVXA 4I1OB 3X2QE 3TWXA 2XHEA 3QWPA 2DVWA 3S7DA 4HI9A 1JCQA 4H7YA 3ASFA 4XKBA 1A17A 2WQ6A 3AG3E 3CVQA 4MS6A 2BEDA 2KBXA 3U4TA 4F7AA 2FEZA 4RLYA 1PY1A 4YDEA 2NC9A 2OVBA 5C2YA 5EDSA 2A5EA 4K03A 1FT1A 5JJTA 4IRUA 2RG8A 3DSXA 3I5PA 4A3VA 3ZXSA 5BT1A 3HIZA 2IO2C 4AEZC 2OVFA 3PNLB 3PH0C 4U8YD 2YHCA 3ZYMA 2KXPC 4N39A 2FF4A 2VSYA 1OWMA 4GPKA 3ESLA 2Y69E 4DX2A 5EN5D 5EX3A 4AVXA 2XZDG 3CVPA 3C5RA 4I1MA 3ZGQA 4W9RA 2KATA 1OCCE 2XENA 2VGXA 4MKTA 2RD0A 1TNBA 1X81A 4GTOA 2NYJA 1N0RA 3CVVA 1DVPA 4WWOA 3D9KA 4OVVA 3HG0D 4JHJA 3FUEA 1O1SA 5JJ6A 5ARFA 3LEWA 3ML8A 2VQ2A 4JD2G 2AXUA 1H0AA 4JB8P 3ASNE 3R7QA 4UWKA 1FPPA 4EZJA 3D9HA 1TN7A 4TXQA 4G26A 5T8IA 1W3BA 4UWFA 4ACKA 3PZ3A 1TR4A 4FHKA 4F1PA 3TWUA 4MLPA 2ONDA 3ZYKA 1EDUA 5CECB 2AXZA 1AP7A 4OYSA 4CDMA 4CDRA 2A4ZA 2XZTG 4A63B 5LCWJ 5ITZF 4KT6B 1WG0A 4RQIA 2XPIA 4HBDA 4ILGA 4BX9A 4DI3A 1WM5A 4FJZA 1LF8A 2ILRA 5HRYA 3KSLA 3HHMA 3TWSA 5AQ7A 1DNPA 2X6KA 4U0SA 1K3ZD 3CV0A 2DYSE 4BERA 1TNZA 4G1TA 4HRLA 1TEZA 4K5AB 3V30A 1SA5A 5KNGA 1H6PA 3VLDA 3ZVVA 5G04J 2MYOA 2FO7A 2XCCA 5BXOA 1EYHA 4EHMA 2HR2A 2WXPA 4WWPA 4FLBA 1INZA 2WXNA 2IOSA 3FUKA 3AG2E 4C0EA 1HS6A 3ENEA 3QJZA 3TG4A 4IN3B 4BT9A 2AW6A 3U3WA 2NXPA 1UOHA 3PZ4A 2XPZA 2FULA 4L2LA 3CKBA 2I6HA 2C0MA 4L1BA 1N94A 3MYVA 5ENTD 1SQMA 2PL2A 3DPYA 2EIME 3MCXA 2R02A 3L82A 2I1KA 2RFAA 2Y4TA 3JCKC 2EIJE 4J8DA 4HORA 3Q75A 4QFVA 4O60A 5BPPA 3MEKA 3P2BA 1UN8A 3Q15A 3UM3A 3B7RL 1E8XA 4CDNA 3CK7A 5G05J 5FINA 4BTBA 3LDZA 4G23A 3LJ3A 3PEUB 3PVLA 4WUYA 2OOEA 3ZFWA 4ANXA 1Q2ZA 3ZKJA 4GTQA 5B3SE 3WG7E 1HX8A 3FUMA 4F53A 1HG2A 1TNOA 4J6IA 1OXJA 5B1BE 3DEPA 5FWQA 1ELRA 1MJ0A 5AARA 4HVBA 3SFZA 1NA0A 4N2SA 4EBAG 3W9GA 3TAXA 1V55E 3L9TA 5G2NA 5KBAA 3DSWA 4ZHBA 3L54A 5DIZA 4ME2A 2XS8A 3K9IA 2F0YA 2P9PG 5H7PA 4DRXE 4PS3A 4TUMA 3JQ0A 3UPVA 3PEVB 3FUDA 3C3OA 4GZ3A 4LUNU 3TWQA 3FUFA 2PQNA 3B13A 4L2YA 3QWWA 1KLXA 4CT4A 1YA0A 3CHSA 4I2WA 3PZDA 5KJNA 2R05A 4EQFA 2HO1A 4DI4A 3CKCA 1LD7A 2AJAA 3ZU7B 3B95A 4JZYA 4JXTA 2DZNA 3S7BA 5KJMA 4F3VA 5JA4D 4N5QA 2UY1A 2B0OE 3RAUA 4XI0A 3EJNA 3OXLA 5CRUA 3QC1A 3HVEB 4GYOA 5LCWC 1Z3YA 1AWCB 5JHBA 3F6QA 2IU1A 3DSVA 3DSUA 2CFUA 2XEEA 4LNUD 3LS8A 4ANVA 2GGFA 3Q73A 2XEHA 3ISMC 3UI2A 4HLLA 4HI8A 2GRPB 3D9OA 3D9MA 3PNTB 2V8SE 1XGWA 4I9EA 1N52A 3FUIA 4HOTA 2HE0A 1IKND 3LJNA 4U8VD 5B1AE 2LAHA 3ZNGA 2BF0X 3FULA 1NI1A 3CEQA 1BI8B 4APOA 3PE3A 3Q9NC 2WXQA 2XRZA 1OWOA 4XEIG 3AAAC 3I4RB 4YVQC 1MQSA 3HYMB 1U2VG 4UI9J 4JW1A 1U3DA 3RSEG 2F8XK 3I3NA 5T3RA 3SHFA 4XIFA 1OWPA 4URKA 3SGHA 2FBNA 5JJ7A 3NZSA 4MRUA 4FADA 3APFA 5J90A 4XX5A 4JEUA 5CCLA 1H6OA 2V5QC 2RFMA 5FZRA 4QQIA 2P9SG 3VLEA 2IEJA 4Z68A 4U63A 4G11A 1H2VC 1YCSB 4J8FA 3T9KA 3FTVA 1N9AA 3HVEA 3CVNA 4LNGA 4GZCA 4N3BA 1HXIA 1JWGA 1UW4B 4GB9A 4I6JA 3W9FA 4K5CA 5E76A 2YHEA 2V5FA 4L7TA 1B89A 3R7RA 4I6EA 2YQ8A 3FTSA 4HOQA 5CRVA 3CVUA 3IV0A 3AS5A 4UI9K 5CCMA 3JYSA 4FLHA 3PZ1A 3EDTB 3UQ3A 2PNNA 3G2VA 4GZ5A 4AV7A 3ZHEA 1TJFA 2GW1A 3RRNB 3FH7A 4DX1A 4U8HA 2H6IA 4TV3A 2DBAA 2WQHA 2WXKA 2QY7A 4TUUA 3DRAA 1YMPA 3ULQA 3UINC 3PE4A 2DYRE 1E96B 3UM2A 4A55A 1SZ9A 3D9LA 3SFXA 2VGYA 2LUHA 4HXIA 3CR3A 4KBQA 4CYMD 3JUIA 3NOCD 4N3CA 4OVUA 3EHQA 3OXGA 2P9NG 2R59A 4ABNA 2UWJG 5KJLA 3IHVA 1IHGA 1MYOA 1TYQG 2PM7A 1KT1A 1HG5A 2X6JA 4AIFA 5LP0A 2ZGGA 3CVWA 4DK5A 3EU9A 1A5EA 4ZFHA 2VJ8A 3IBEA 3D9NA 5FQ6A 2LO6A 3TG5A 1V54E 1JWFA 5BV1A 4JC8A 4C48B 3Q9UC 5ANLA 2XS1A 4RSYA 4UQYA 2BKGA 3MA5A 4R7LA 2XPYA 1G3NB 4LCTA 4F6RD 5CMWA 2IONA 5ENRD 4I9CA 1N4PA 2BTDA 3WXXA 2XRYA 1EPUA 2CG2A 4DLOA 4BTAA 3ULYA 2P9UG 4G8KA 4ANWA 4GTTA 5IY5E 3APCA 3IXEA 4U7EB 4J8SA 1SZAA 4OAUC 5FIOA 2L0TB 5LX8A 2FI7A 5FQ8A 4UI9C 2R17C 4YDYA 2AWIA 1NFIE 2LXLA 2AVPA 1OY3D 4V3IA 1MX6A 1PAQA 3UT8A 3QNKA 1RW2A 3HDXA 3CHRA 4CGWA 3FH8A 4AY5A 1WAO1 2AXVA 3ZUVB 4J8EA 4MBGA 3CHMA 2JABA 3Q79A 4BESA 3FTWA 1BD8A 3G2SA
chains in the Genus database with same CATH topology
5EIDA 3UI2A 1MJ0A 1MYOA 1QYMA 2Y1LE 4HLLA 5AARA 5CEAA 2NYJA 4DX5D 1N0RA 4HI8A 5EYPF 5KNHD 1YYHA 2ZGGA 1MX2A 2P2CP 3EU9A 1BLXB 3W9FA 3W9GA 1A5EA 1N0QA 5HS0A 4ZFHA 3HG0D 4YDWA 3DEOA 2F8YA 5EILA 2HE0A 1IKND 3LJNA 4U8VD 4K5CA 3NOGD 4U95D 5ENQD 5CERB 1K1AA 2DZOA 1K1BA 3V2XA 3NBNB 3ZNGA 5KBAA 4ZHBA 1UOHA 1BI8B 3V31A 4C48B 3Q9NC 1SVXA 4JB8P 3Q9UC 3SO8A 4K5BA 4CZ2D 3TWXA 2BKGA 2V4HC 3D9HA 1BI7B 2J8SD 3AAAC 3JUEA 5AN8A 4TUMA 4DRXE 4DX6D 1D9SA 4LG6A 2ZGDA 5ENSD 3TWRA 2F37A 1G3NB 5ENTD 5JMND 4F6RD 2DVWA 3UTMA 5ENRD 4HI9A 4DUIA 1TR4A 1WDYA 4ATZD 3TWQA 4F1PA 3TWUA 4DX7D 2RFAA 5CECB 4J7WA 2BKKB 2ETBA 5BXUA 1AP7A 5EYLA 1N11A 1OT8A 2PNNA 3B7BA 3J5PA 3V79K 2F8XK 2KBXA 4QFVA 4O60A 5HKPA 3HRAA 2XZTG 4G8KA 4RLYA 4A63B 1MX4A 2FO1E 2AJAA 3ZU7B 5ITZF 4DX1A 4G8LA 3IXEA 2ETCA 3B95A 1WG0A 3KEAA 2DWZA 5ENPD 2A5EA 4GPMA 5CEDB 4HBDA 4OAUC 4HB5A 3T8KA 2DZNA 5FIOA 4NIKA 5HRYA 5FINA 4J8YA 2V5QC 1YMPA 2L6BA 2RFMA 2VGEA 5JA4D 5D66A 4QQIA 4BEPA 4YDYA 4N5QA 3TWSA 3TWVA 1NFIE 4O1PA 4GMRA 5AQ7A 5AQAA 4U8YD 4O1OA 4Z68A 5CBNA 4BETA 1K3ZD 2B0OE 4HRNA 4BERA 2KXPC 4HQDA 3JXIA 5KWDA 4OAVB 3J5QB 4UUCA 3TWTA 1OY3D 1YCSB 3AJIA 5EIBE 1MX6A 4HRLA 1IXVA 2QC9A 4K5AB 3T9KA 3EHRA 4DX2A 1AWCB 5EN5D 4U96D 3V30A 1S70B 2Y0BG 3ZKJA 4B93B 4BSZB 4CYMD 4HNAD 5KNGA 3F6QA 1SW6A 3NOCD 1DCQA 4HRMB 2XZDG 2MYOA 3JXJA 3ZUVB 3C5RA 5BXOA 1BU9A 5AQBA 3EHQA 4LSZE 5ENOD 2ETAA 2JABA 5AAOA 5AQ9A 2XEEA 3DEPA 4LNUD 3TWWA 4BESA 2XENA 1BD8A 1DC2A 3V2OA 2QYJA 3UXGA 5CBOA 2XEHA 1IHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EID A;  3UI2 A;  1MJ0 A;  1MYO A;  1QYM A;  2Y1L E;  4HLL A;  5AAR A;  5CEA A;  2NYJ A;  4DX5 D;  1N0R A;  4HI8 A;  5EYP F;  5KNH D;  1YYH A;  2ZGG A;  1MX2 A;  2P2C P;  3EU9 A;  1BLX B;  3W9F A;  3W9G A;  1A5E A;  1N0Q A;  5HS0 A;  4ZFH A;  3HG0 D;  4YDW A;  3DEO A;  2F8Y A;  5EIL A;  2HE0 A;  1IKN D;  3LJN A;  4U8V D;  4K5C A;  3NOG D;  4U95 D;  5ENQ D;  5CER B;  1K1A A;  2DZO A;  1K1B A;  3V2X A;  3NBN B;  3ZNG A;  5KBA A;  4ZHB A;  1UOH A;  1BI8 B;  3V31 A;  4C48 B;  3Q9N C;  1SVX A;  4JB8 P;  3Q9U C;  3SO8 A;  4K5B A;  4CZ2 D;  3TWX A;  2BKG A;  2V4H C;  3D9H A;  1BI7 B;  2J8S D;  3AAA C;  3JUE A;  5AN8 A;  4TUM A;  4DRX E;  4DX6 D;  1D9S A;  4LG6 A;  2ZGD A;  5ENS D;  3TWR A;  2F37 A;  1G3N B;  5ENT D;  5JMN D;  4F6R D;  2DVW A;  3UTM A;  5ENR D;  4HI9 A;  4DUI A;  1TR4 A;  1WDY A;  4ATZ D;  3TWQ A;  4F1P A;  3TWU A;  4DX7 D;  2RFA A;  5CEC B;  4J7W A;  2BKK B;  2ETB A;  5BXU A;  1AP7 A;  5EYL A;  1N11 A;  1OT8 A;  2PNN A;  3B7B A;  3J5P A;  3V79 K;  2F8X K;  2KBX A;  4QFV A;  4O60 A;  5HKP A;  3HRA A;  2XZT G;  4G8K A;  4RLY A;  4A63 B;  1MX4 A;  2FO1 E;  2AJA A;  3ZU7 B;  5ITZ F;  4DX1 A;  4G8L A;  3IXE A;  2ETC A;  3B95 A;  1WG0 A;  3KEA A;  2DWZ A;  5ENP D;  2A5E A;  4GPM A;  5CED B;  4HBD A;  4OAU C;  4HB5 A;  3T8K A;  2DZN A;  5FIO A;  4NIK A;  5HRY A;  5FIN A;  4J8Y A;  2V5Q C;  1YMP A;  2L6B A;  2RFM A;  2VGE A;  5JA4 D;  5D66 A;  4QQI A;  4BEP A;  4YDY A;  4N5Q A;  3TWS A;  3TWV A;  1NFI E;  4O1P A;  4GMR A;  5AQ7 A;  5AQA A;  4U8Y D;  4O1O A;  4Z68 A;  5CBN A;  4BET A;  1K3Z D;  2B0O E;  4HRN A;  4BER A;  2KXP C;  4HQD A;  3JXI A;  5KWD A;  4OAV B;  3J5Q B;  4UUC A;  3TWT A;  1OY3 D;  1YCS B;  3AJI A;  5EIB E;  1MX6 A;  4HRL A;  1IXV A;  2QC9 A;  4K5A B;  3T9K A;  3EHR A;  4DX2 A;  1AWC B;  5EN5 D;  4U96 D;  3V30 A;  1S70 B;  2Y0B G;  3ZKJ A;  4B93 B;  4BSZ B;  4CYM D;  4HNA D;  5KNG A;  3F6Q A;  1SW6 A;  3NOC D;  1DCQ A;  4HRM B;  2XZD G;  2MYO A;  3JXJ A;  3ZUV B;  3C5R A;  5BXO A;  1BU9 A;  5AQB A;  3EHQ A;  4LSZ E;  5ENO D;  2ETA A;  2JAB A;  5AAO A;  5AQ9 A;  2XEE A;  3DEP A;  4LNU D;  3TWW A;  4BES A;  2XEN A;  1BD8 A;  1DC2 A;  3V2O A;  2QYJ A;  3UXG A;  5CBO A;  2XEH A;  1IHB A; 
#chains in the Genus database with same CATH topology
 3KD7 A;  4IYP A;  1MX2 A;  1UG3 A;  3TXN A;  1N0Q A;  1E7U A;  4YDW A;  3GYZ A;  4U07 A;  4CGV A;  4G2V A;  4BWR A;  3LVR E;  2P9I G;  3D9P A;  2BUG A;  2OEV A;  1NP7 A;  3FH5 A;  4PS8 A;  3IEG A;  3ZEF A;  3E30 A;  3UM0 A;  4HLE A;  4KVM A;  4E85 A;  2ZIS A;  5AYW D;  3SZ7 A;  4FP7 A;  1GW6 A;  3IHY A;  3EHM A;  4RG9 A;  2J09 A;  2EIK E;  3APD A;  3KEA A;  3ZIM A;  3FFL A;  2KCV A;  1KZP A;  4UQZ A;  4WAF A;  4GTR A;  4GTP A;  3PRE A;  2JEK A;  3B7U X;  1QQE A;  4GMR A;  5CHE E;  3RO3 A;  3BQO A;  3RRU A;  3LPZ A;  1S70 B;  1HF8 A;  3BUA A;  3FUN A;  1FT2 A;  1FVH A;  5AQB A;  3T5X A;  4LSZ E;  2ETA A;  4O6F A;  5AAO A;  1DC2 A;  3MGB A;  1QBQ A;  3UT4 A;  5CBO A;  2Y3A A;  5LOZ A;  3PRZ A;  3FTU A;  2HM8 A;  1LD8 A;  2E0I A;  3UIO C;  2IOL A;  2LNI A;  3Q4A B;  1K1A A;  3UMV A;  5FJY A;  3NBN B;  2IJG X;  2CG3 A;  3EIQ C;  4AP2 A;  1WY6 A;  4U04 A;  1O5M A;  4CZ2 D;  4U0U A;  1Y6I A;  1TJC A;  2CHX A;  2MHK A;  3JUE A;  4HOU A;  4Y6W A;  3CHO A;  4GZ6 A;  3ABM E;  4EZK A;  2EIL E;  4DJA A;  5EYL A;  2X6H A;  3EUV A;  3UKU G;  3MKQ B;  2Q7F A;  4H7X A;  3Q7F A;  2DWZ A;  4XE0 A;  4GPM A;  2VSN A;  3HXC A;  4BY6 A;  2LSV A;  2WXJ A;  4BX8 A;  3FTX A;  1E90 A;  3D9J A;  2L6B A;  3ZYL A;  1OCZ E;  1RZ4 A;  3SBT B;  3NZU A;  3QAR A;  4G24 A;  3J5Q B;  3UT7 A;  1IQU A;  2WXG A;  5KCM A;  2L6J A;  3CSF A;  3FWV A;  3QDN A;  4NUR A;  5ENO D;  1X5B A;  2DIW A;  2C2L A;  3FU0 A;  5KNH D;  1P5Q A;  3TGO A;  5FZS A;  4DX5 D;  4JA9 A;  3SF4 A;  2H6G A;  5FQ4 A;  3KS2 A;  1FCH A;  3FHE A;  3B7T A;  1NL4 A;  3U9W A;  3ML9 A;  3D9I A;  3E33 A;  4A1S A;  2KCK A;  2WXH A;  1XNF A;  5AN8 A;  2ZGD A;  4UQX A;  3CQG B;  3TWR A;  3Q5M A;  3UX4 A;  2I1J A;  3C72 A;  3DXM G;  4LEU A;  2CFZ A;  2VTB B;  4KYO B;  1JPL A;  1BPO A;  1OT8 A;  3J5P A;  2X6I A;  2WXF A;  3CHQ A;  3FEY A;  5EKQ D;  3HRA A;  5A6C A;  3DST A;  2KZT B;  3MKQ A;  5CED B;  5HQ8 A;  3FU5 A;  4Y6C A;  4C0M A;  4HOS A;  2WXI A;  3URZ A;  4JEH A;  2LXM A;  4J8Y A;  4O1P A;  1IQR A;  4IUL A;  4B0Z A;  4B8C B;  1OWL A;  4FC8 A;  4EZL A;  3AJI A;  3EHR A;  3OXF A;  1SW6 A;  2C0L A;  4HRM B;  3JXJ A;  4P29 A;  1Z5S C;  3RIB A;  5AJL A;  1N4R A;  3R9M A;  4Q96 A;  2QYJ A;  2EIN E;  4TRQ A;  5EID A;  1QZ2 A;  4PUC A;  2LAI A;  3ZPJ A;  4Q69 A;  4YND A;  4N2Q A;  1JUQ A;  5M72 A;  5G55 A;  1L5J A;  4JHR A;  5ENQ D;  3V2X A;  2WM9 A;  4WND A;  5J08 A;  5ANR A;  2IY0 C;  3MKR A;  4B8A A;  2MOW A;  3Q49 B;  3SO8 A;  1HE8 A;  3CLJ A;  1HH8 A;  2M63 A;  1OCR E;  4I6G A;  4GZD A;  3TJP A;  2VYI A;  3E34 A;  3CK8 A;  4KZ0 A;  2NSZ A;  4F1S A;  4BFR A;  3T5V A;  3ZXP A;  2ETB A;  1TN6 A;  1N11 A;  2P58 C;  1D8D A;  2XEV A;  2VSX E;  4KVO A;  2WXO A;  2E2E A;  4RG6 A;  2VGE A;  4BEP A;  2VGX B;  3RK6 A;  4U0Z A;  2XQ0 A;  3Q47 B;  3KEZ A;  2KCL A;  4FUL A;  2A5U A;  5A23 A;  3SFY A;  5EIB E;  5A7D B;  1N4Q A;  3CVL A;  3OTN A;  4NRH B;  2YNQ A;  5FTP A;  4AXH A;  3ABK E;  4HNA D;  1H2U A;  1DCQ A;  3CHP A;  3O48 A;  2GRO B;  2CHZ A;  3SY2 A;  3CST A;  5C1D A;  1H2T C;  3RJV A;  4FHJ A;  4CCA A;  2WXL A;  3JQ1 A;  1IHB A;  1QYM A;  3CK9 A;  5CEA A;  3UUX A;  3S2A A;  5AIJ A;  4JA7 A;  4WNE A;  3QWV A;  2XCB A;  5BNW A;  5CER B;  3CGH A;  2CHW A;  4CT0 A;  3HXD A;  3I4G A;  3FDH A;  3SD5 A;  2P9L G;  4ILI A;  5E75 A;  4A3T A;  1EF1 C;  4HS2 A;  3Q7A A;  2WPV A;  4GTM A;  4DX6 D;  1D8E A;  1Y8M A;  3UM1 A;  4LG6 A;  1N4S A;  3EU5 A;  5CMY A;  5ENS D;  2GRL A;  4TXR A;  4L9P A;  4DUI A;  4Q94 A;  2I2O A;  4D10 C;  4KZC A;  3B7B A;  5FZQ A;  4FU3 A;  1H19 A;  4I1A A;  5BV0 A;  4G8L A;  3ZYQ A;  2WMO A;  2X38 A;  4UWL A;  3CQC B;  3LVQ E;  1ELW A;  4XKC A;  4HB5 A;  4M7C A;  3AG1 E;  3EHN A;  4NIK A;  1KZO A;  2J4B A;  2YIN A;  3ASO E;  4ATG A;  5D0O D;  5AQA A;  1NA3 A;  2XGO A;  3PS6 A;  4O1O A;  4BET A;  4PH4 B;  4OAV B;  2OEW A;  3JXI A;  3R9A B;  1IXV A;  3ULE G;  4J0U A;  2ZIR A;  4BT8 A;  2QZA A;  3RKV A;  1OCO E;  3BU8 A;  1ZBP A;  3LXU X;  4GAA A;  3BG0 B;  4GA2 A;  3S7F A;  2B6C A;  3MJW A;  2QYU A;  3V2O A;  3VTX A;  1UN9 A;  2P9K G;  3PZ2 A;  3CVX A;  5EYP F;  1YYH A;  4M3O A;  1BLX B;  3FUH A;  3NB2 A;  3ABL E;  3FTY A;  2DZO A;  5AJD A;  1E8W A;  5ARG A;  2Y4U A;  4AY6 A;  3L17 A;  2V4H C;  4APF A;  1D9S A;  4RVB A;  4UWG A;  2F37 A;  5JMN D;  4EPZ A;  4FA6 A;  3ZN3 A;  5JHA A;  4I43 A;  5D2M C;  3FY4 A;  1WDY A;  4JVS A;  3D3M A;  4DX7 D;  2JLB A;  2LSU A;  4J7W A;  2IO3 C;  3GZ2 A;  3UIP C;  5HKP A;  1MX4 A;  3PUK A;  2J07 A;  2V4L A;  2H6F A;  3QK0 A;  5D0Q D;  4HFG A;  3GZS A;  1HZ4 A;  5BUZ A;  5D66 A;  3MZL B;  3TL5 A;  3MV2 B;  3C98 A;  4GCO A;  1TNY A;  5KWD A;  2IFU A;  3TWT A;  3QAQ A;  2R5S A;  4ANU A;  3RO2 A;  1Z3X A;  3MX3 A;  3QB2 A;  4B93 B;  3SQV A;  3E37 A;  2X3M A;  3NAW A;  1BU9 A;  2J4D A;  3U64 A;  2ZU6 B;  3ESK A;  3TWW A;  1U3C A;  1ELK A;  5DBK A;  5KJK A;  4AJW A;  3DXK G;  4K0R A;  3ASH A;  4PDX A;  2P2C P;  5LFA A;  4L23 A;  3DEO A;  5EIL A;  2R2L A;  2KM4 A;  2EQX A;  3C3R A;  1VDY A;  4WWN A;  4GA1 A;  3V31 A;  5HI7 A;  3IKO B;  1S63 A;  4YVO A;  2WMN A;  1SA4 A;  4GYW A;  3O4Z A;  2J9Q A;  2UY1 B;  3L08 A;  3V79 K;  1Z6T A;  1H6K A;  2GRN B;  3DSS A;  3AU4 A;  1ZU2 A;  2FO1 E;  1IYG A;  1S0P A;  2PM6 A;  4C9B B;  3AU5 A;  3DPD A;  3RRM B;  3TWV A;  1LTX A;  3NQP A;  1O1R A;  2XGM A;  3GZ1 A;  4UUC A;  1UJK A;  3E32 A;  5EX0 A;  1E7V A;  3ONK A;  4JL0 A;  4JPS A;  4U96 D;  4PS7 A;  4BSZ B;  4BSX A;  3ONL A;  2WB2 A;  4JHK A;  3G2U A;  2V0P A;  4WNF A;  3AS8 A;  3Q78 A;  1DCE A;  3UXG A;  1OUV A;  3TXM A;  1E8Y A;  4UWH A;  3L13 A;  3FEX A;  4CEM A;  3NOG D;  4U95 D;  1OWN A;  2RKK A;  3BEE A;  3LY7 A;  3U66 A;  2I9C A;  2WQ7 A;  2QFC A;  2WVI A;  4GCN A;  4X8Q A;  3KSQ A;  5FQ7 A;  1BI7 B;  3DBS A;  2OV8 A;  2PQR A;  4E6H A;  4NAC A;  3ASD A;  2R03 A;  3G2T A;  4ATZ D;  5BXU A;  4LER A;  3LKU A;  3BG1 B;  3OAW A;  4XZ4 A;  4AM9 A;  1UJJ A;  4B94 A;  2ETC A;  5ENP D;  4N3A A;  4CRW A;  3PUJ A;  3FUJ A;  3LCA A;  1TNU A;  3FU6 A;  2GRR B;  1KT0 A;  3LYA A;  3NF1 A;  3L6A A;  5CBN A;  2J08 A;  5FT9 A;  4B89 A;  3FTZ A;  2H6H A;  2GRM A;  2L0I A;  3AG4 E;  2QC9 A;  4YDO A;  2J49 A;  3S7J A;  4I17 A;  3SI5 A;  5G04 C;  4AOF A;  4GMJ A;  4EBA A;  1O1T A;  4GA0 A;  3L22 A;  1HO8 A;  3ZW3 A;  5HS0 A;  3MV3 B;  3PDN A;  5T4Y A;  4GYY A;  3DWL G;  1PC2 A;  3ZHE B;  3B7S A;  3L16 A;  3RU0 A;  4NQ0 A;  2VSO E;  3SNX A;  4K5B A;  4DPR A;  3QKY A;  1N54 A;  2J8S D;  2X6F A;  2WXM A;  3HXF A;  4LNB A;  2IF4 A;  1K8K G;  3AS4 A;  3UTM A;  1NZN A;  1FVF A;  1QNF A;  4DLQ A;  3KAE A;  1MHQ A;  4N5C A;  2BKK B;  4GTS A;  3N71 A;  4I2Z A;  3UKR G;  4XI9 A;  3SBS A;  2IQC A;  4EEC A;  4FJY A;  1S64 A;  2HYZ A;  4GTV A;  3E4B A;  2PZI A;  4WNG A;  3T8K A;  4TXP A;  3CIA A;  3T8M A;  2L9B A;  5AEN A;  5G05 C;  3G2W A;  3ASG A;  1MZC A;  3CVY A;  4LRZ A;  1JCR A;  3C3Q A;  1N95 A;  2DCP A;  4ACL A;  2MRI A;  4HRN A;  4HQD A;  3GW4 A;  3ZRH A;  3HXE A;  2VTB A;  1HFA A;  1HU3 A;  3LY9 A;  2WXR A;  3VTY A;  3FP3 A;  2GRQ B;  2Y0B G;  2ZXW E;  2KZT A;  3P1U A;  1JCS A;  3VLF A;  2OCC E;  3HXB A;  4ILH B;  5AQ9 A;  4KMO A;  3FU3 A;  1ZB1 A;  3QOU A;  2Y1L E;  4KXK B;  1TN8 A;  3LY8 A;  2KC7 A;  4G25 A;  2F8Y A;  5ENN A;  1K1B A;  4GML A;  1KPS B;  4A1G A;  4GU5 A;  5BW8 C;  1E8Z A;  2XGS A;  3EIJ A;  1SVX A;  4I1O B;  3X2Q E;  3TWX A;  2XHE A;  3QWP A;  2DVW A;  3S7D A;  4HI9 A;  1JCQ A;  4H7Y A;  3ASF A;  4XKB A;  1A17 A;  2WQ6 A;  3AG3 E;  3CVQ A;  4MS6 A;  2BED A;  2KBX A;  3U4T A;  4F7A A;  2FEZ A;  4RLY A;  1PY1 A;  4YDE A;  2NC9 A;  2OVB A;  5C2Y A;  5EDS A;  2A5E A;  4K03 A;  1FT1 A;  5JJT A;  4IRU A;  2RG8 A;  3DSX A;  3I5P A;  4A3V A;  3ZXS A;  5BT1 A;  3HIZ A;  2IO2 C;  4AEZ C;  2OVF A;  3PNL B;  3PH0 C;  4U8Y D;  2YHC A;  3ZYM A;  2KXP C;  4N39 A;  2FF4 A;  2VSY A;  1OWM A;  4GPK A;  3ESL A;  2Y69 E;  4DX2 A;  5EN5 D;  5EX3 A;  4AVX A;  2XZD G;  3CVP A;  3C5R A;  4I1M A;  3ZGQ A;  4W9R A;  2KAT A;  1OCC E;  2XEN A;  2VGX A;  4MKT A;  2RD0 A;  1TNB A;  1X81 A;  4GTO A;  2NYJ A;  1N0R A;  3CVV A;  1DVP A;  4WWO A;  3D9K A;  4OVV A;  3HG0 D;  4JHJ A;  3FUE A;  1O1S A;  5JJ6 A;  5ARF A;  3LEW A;  3ML8 A;  2VQ2 A;  4JD2 G;  2AXU A;  1H0A A;  4JB8 P;  3ASN E;  3R7Q A;  4UWK A;  1FPP A;  4EZJ A;  3D9H A;  1TN7 A;  4TXQ A;  4G26 A;  5T8I A;  1W3B A;  4UWF A;  4ACK A;  3PZ3 A;  1TR4 A;  4FHK A;  4F1P A;  3TWU A;  4MLP A;  2OND A;  3ZYK A;  1EDU A;  5CEC B;  2AXZ A;  1AP7 A;  4OYS A;  4CDM A;  4CDR A;  2A4Z A;  2XZT G;  4A63 B;  5LCW J;  5ITZ F;  4KT6 B;  1WG0 A;  4RQI A;  2XPI A;  4HBD A;  4ILG A;  4BX9 A;  4DI3 A;  1WM5 A;  4FJZ A;  1LF8 A;  2ILR A;  5HRY A;  3KSL A;  3HHM A;  3TWS A;  5AQ7 A;  1DNP A;  2X6K A;  4U0S A;  1K3Z D;  3CV0 A;  2DYS E;  4BER A;  1TNZ A;  4G1T A;  4HRL A;  1TEZ A;  4K5A B;  3V30 A;  1SA5 A;  5KNG A;  1H6P A;  3VLD A;  3ZVV A;  5G04 J;  2MYO A;  2FO7 A;  2XCC A;  5BXO A;  1EYH A;  4EHM A;  2HR2 A;  2WXP A;  4WWP A;  4FLB A;  1INZ A;  2WXN A;  2IOS A;  3FUK A;  3AG2 E;  4C0E A;  1HS6 A;  3ENE A;  3QJZ A;  3TG4 A;  4IN3 B;  4BT9 A;  2AW6 A;  3U3W A;  2NXP A;  1UOH A;  3PZ4 A;  2XPZ A;  2FUL A;  4L2L A;  3CKB A;  2I6H A;  2C0M A;  4L1B A;  1N94 A;  3MYV A;  5ENT D;  1SQM A;  2PL2 A;  3DPY A;  2EIM E;  3MCX A;  2R02 A;  3L82 A;  2I1K A;  2RFA A;  2Y4T A;  3JCK C;  2EIJ E;  4J8D A;  4HOR A;  3Q75 A;  4QFV A;  4O60 A;  5BPP A;  3MEK A;  3P2B A;  1UN8 A;  3Q15 A;  3UM3 A;  3B7R L;  1E8X A;  4CDN A;  3CK7 A;  5G05 J;  5FIN A;  4BTB A;  3LDZ A;  4G23 A;  3LJ3 A;  3PEU B;  3PVL A;  4WUY A;  2OOE A;  3ZFW A;  4ANX A;  1Q2Z A;  3ZKJ A;  4GTQ A;  5B3S E;  3WG7 E;  1HX8 A;  3FUM A;  4F53 A;  1HG2 A;  1TNO A;  4J6I A;  1OXJ A;  5B1B E;  3DEP A;  5FWQ A;  1ELR A;  1MJ0 A;  5AAR A;  4HVB A;  3SFZ A;  1NA0 A;  4N2S A;  4EBA G;  3W9G A;  3TAX A;  1V55 E;  3L9T A;  5G2N A;  5KBA A;  3DSW A;  4ZHB A;  3L54 A;  5DIZ A;  4ME2 A;  2XS8 A;  3K9I A;  2F0Y A;  2P9P G;  5H7P A;  4DRX E;  4PS3 A;  4TUM A;  3JQ0 A;  3UPV A;  3PEV B;  3FUD A;  3C3O A;  4GZ3 A;  4LUN U;  3TWQ A;  3FUF A;  2PQN A;  3B13 A;  4L2Y A;  3QWW A;  1KLX A;  4CT4 A;  1YA0 A;  3CHS A;  4I2W A;  3PZD A;  5KJN A;  2R05 A;  4EQF A;  2HO1 A;  4DI4 A;  3CKC A;  1LD7 A;  2AJA A;  3ZU7 B;  3B95 A;  4JZY A;  4JXT A;  2DZN A;  3S7B A;  5KJM A;  4F3V A;  5JA4 D;  4N5Q A;  2UY1 A;  2B0O E;  3RAU A;  4XI0 A;  3EJN A;  3OXL A;  5CRU A;  3QC1 A;  3HVE B;  4GYO A;  5LCW C;  1Z3Y A;  1AWC B;  5JHB A;  3F6Q A;  2IU1 A;  3DSV A;  3DSU A;  2CFU A;  2XEE A;  4LNU D;  3LS8 A;  4ANV A;  2GGF A;  3Q73 A;  2XEH A;  3ISM C;  3UI2 A;  4HLL A;  4HI8 A;  2GRP B;  3D9O A;  3D9M A;  3PNT B;  2V8S E;  1XGW A;  4I9E A;  1N52 A;  3FUI A;  4HOT A;  2HE0 A;  1IKN D;  3LJN A;  4U8V D;  5B1A E;  2LAH A;  3ZNG A;  2BF0 X;  3FUL A;  1NI1 A;  3CEQ A;  1BI8 B;  4APO A;  3PE3 A;  3Q9N C;  2WXQ A;  2XRZ A;  1OWO A;  4XEI G;  3AAA C;  3I4R B;  4YVQ C;  1MQS A;  3HYM B;  1U2V G;  4UI9 J;  4JW1 A;  1U3D A;  3RSE G;  2F8X K;  3I3N A;  5T3R A;  3SHF A;  4XIF A;  1OWP A;  4URK A;  3SGH A;  2FBN A;  5JJ7 A;  3NZS A;  4MRU A;  4FAD A;  3APF A;  5J90 A;  4XX5 A;  4JEU A;  5CCL A;  1H6O A;  2V5Q C;  2RFM A;  5FZR A;  4QQI A;  2P9S G;  3VLE A;  2IEJ A;  4Z68 A;  4U63 A;  4G11 A;  1H2V C;  1YCS B;  4J8F A;  3T9K A;  3FTV A;  1N9A A;  3HVE A;  3CVN A;  4LNG A;  4GZC A;  4N3B A;  1HXI A;  1JWG A;  1UW4 B;  4GB9 A;  4I6J A;  3W9F A;  4K5C A;  5E76 A;  2YHE A;  2V5F A;  4L7T A;  1B89 A;  3R7R A;  4I6E A;  2YQ8 A;  3FTS A;  4HOQ A;  5CRV A;  3CVU A;  3IV0 A;  3AS5 A;  4UI9 K;  5CCM A;  3JYS A;  4FLH A;  3PZ1 A;  3EDT B;  3UQ3 A;  2PNN A;  3G2V A;  4GZ5 A;  4AV7 A;  3ZHE A;  1TJF A;  2GW1 A;  3RRN B;  3FH7 A;  4DX1 A;  4U8H A;  2H6I A;  4TV3 A;  2DBA A;  2WQH A;  2WXK A;  2QY7 A;  4TUU A;  3DRA A;  1YMP A;  3ULQ A;  3UIN C;  3PE4 A;  2DYR E;  1E96 B;  3UM2 A;  4A55 A;  1SZ9 A;  3D9L A;  3SFX A;  2VGY A;  2LUH A;  4HXI A;  3CR3 A;  4KBQ A;  4CYM D;  3JUI A;  3NOC D;  4N3C A;  4OVU A;  3EHQ A;  3OXG A;  2P9N G;  2R59 A;  4ABN A;  2UWJ G;  5KJL A;  3IHV A;  1IHG A;  1MYO A;  1TYQ G;  2PM7 A;  1KT1 A;  1HG5 A;  2X6J A;  4AIF A;  5LP0 A;  2ZGG A;  3CVW A;  4DK5 A;  3EU9 A;  1A5E A;  4ZFH A;  2VJ8 A;  3IBE A;  3D9N A;  5FQ6 A;  2LO6 A;  3TG5 A;  1V54 E;  1JWF A;  5BV1 A;  4JC8 A;  4C48 B;  3Q9U C;  5ANL A;  2XS1 A;  4RSY A;  4UQY A;  2BKG A;  3MA5 A;  4R7L A;  2XPY A;  1G3N B;  4LCT A;  4F6R D;  5CMW A;  2ION A;  5ENR D;  4I9C A;  1N4P A;  2BTD A;  3WXX A;  2XRY A;  1EPU A;  2CG2 A;  4DLO A;  4BTA A;  3ULY A;  2P9U G;  4G8K A;  4ANW A;  4GTT A;  5IY5 E;  3APC A;  3IXE A;  4U7E B;  4J8S A;  1SZA A;  4OAU C;  5FIO A;  2L0T B;  5LX8 A;  2FI7 A;  5FQ8 A;  4UI9 C;  2R17 C;  4YDY A;  2AWI A;  1NFI E;  2LXL A;  2AVP A;  1OY3 D;  4V3I A;  1MX6 A;  1PAQ A;  3UT8 A;  3QNK A;  1RW2 A;  3HDX A;  3CHR A;  4CGW A;  3FH8 A;  4AY5 A;  1WAO 1;  2AXV A;  3ZUV B;  4J8E A;  4MBG A;  3CHM A;  2JAB A;  3Q79 A;  4BES A;  3FTW A;  1BD8 A;  3G2S A; 
#chains in the Genus database with same CATH homology
 5EID A;  3UI2 A;  1MJ0 A;  1MYO A;  1QYM A;  2Y1L E;  4HLL A;  5AAR A;  5CEA A;  2NYJ A;  4DX5 D;  1N0R A;  4HI8 A;  5EYP F;  5KNH D;  1YYH A;  2ZGG A;  1MX2 A;  2P2C P;  3EU9 A;  1BLX B;  3W9F A;  3W9G A;  1A5E A;  1N0Q A;  5HS0 A;  4ZFH A;  3HG0 D;  4YDW A;  3DEO A;  2F8Y A;  5EIL A;  2HE0 A;  1IKN D;  3LJN A;  4U8V D;  4K5C A;  3NOG D;  4U95 D;  5ENQ D;  5CER B;  1K1A A;  2DZO A;  1K1B A;  3V2X A;  3NBN B;  3ZNG A;  5KBA A;  4ZHB A;  1UOH A;  1BI8 B;  3V31 A;  4C48 B;  3Q9N C;  1SVX A;  4JB8 P;  3Q9U C;  3SO8 A;  4K5B A;  4CZ2 D;  3TWX A;  2BKG A;  2V4H C;  3D9H A;  1BI7 B;  2J8S D;  3AAA C;  3JUE A;  5AN8 A;  4TUM A;  4DRX E;  4DX6 D;  1D9S A;  4LG6 A;  2ZGD A;  5ENS D;  3TWR A;  2F37 A;  1G3N B;  5ENT D;  5JMN D;  4F6R D;  2DVW A;  3UTM A;  5ENR D;  4HI9 A;  4DUI A;  1TR4 A;  1WDY A;  4ATZ D;  3TWQ A;  4F1P A;  3TWU A;  4DX7 D;  2RFA A;  5CEC B;  4J7W A;  2BKK B;  2ETB A;  5BXU A;  1AP7 A;  5EYL A;  1N11 A;  1OT8 A;  2PNN A;  3B7B A;  3J5P A;  3V79 K;  2F8X K;  2KBX A;  4QFV A;  4O60 A;  5HKP A;  3HRA A;  2XZT G;  4G8K A;  4RLY A;  4A63 B;  1MX4 A;  2FO1 E;  2AJA A;  3ZU7 B;  5ITZ F;  4DX1 A;  4G8L A;  3IXE A;  2ETC A;  3B95 A;  1WG0 A;  3KEA A;  2DWZ A;  5ENP D;  2A5E A;  4GPM A;  5CED B;  4HBD A;  4OAU C;  4HB5 A;  3T8K A;  2DZN A;  5FIO A;  4NIK A;  5HRY A;  5FIN A;  4J8Y A;  2V5Q C;  1YMP A;  2L6B A;  2RFM A;  2VGE A;  5JA4 D;  5D66 A;  4QQI A;  4BEP A;  4YDY A;  4N5Q A;  3TWS A;  3TWV A;  1NFI E;  4O1P A;  4GMR A;  5AQ7 A;  5AQA A;  4U8Y D;  4O1O A;  4Z68 A;  5CBN A;  4BET A;  1K3Z D;  2B0O E;  4HRN A;  4BER A;  2KXP C;  4HQD A;  3JXI A;  5KWD A;  4OAV B;  3J5Q B;  4UUC A;  3TWT A;  1OY3 D;  1YCS B;  3AJI A;  5EIB E;  1MX6 A;  4HRL A;  1IXV A;  2QC9 A;  4K5A B;  3T9K A;  3EHR A;  4DX2 A;  1AWC B;  5EN5 D;  4U96 D;  3V30 A;  1S70 B;  2Y0B G;  3ZKJ A;  4B93 B;  4BSZ B;  4CYM D;  4HNA D;  5KNG A;  3F6Q A;  1SW6 A;  3NOC D;  1DCQ A;  4HRM B;  2XZD G;  2MYO A;  3JXJ A;  3ZUV B;  3C5R A;  5BXO A;  1BU9 A;  5AQB A;  3EHQ A;  4LSZ E;  5ENO D;  2ETA A;  2JAB A;  5AAO A;  5AQ9 A;  2XEE A;  3DEP A;  4LNU D;  3TWW A;  4BES A;  2XEN A;  1BD8 A;  1DC2 A;  3V2O A;  2QYJ A;  3UXG A;  5CBO A;  2XEH A;  1IHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...