1S72E

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1s72E01
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1s72E02
3J7ZG 1VQLE 3CPWE 3DLLE 1YHQE 5GAHG 1QVGE 1K8AG 5GAGG 1VQPE 1VQOE 1N8RG 1S72E 5MLCH 5DM6E 3CC7E 3PIPE 1Q82G 1M90G 5DM7E 1KQSE 3PIOE 1JJ2E 1VQ7E 4UY8G 1YJ9E 3CC2E 3CCRE 4WF9E 1YI2E 3CXCE 4WCEE 1KD1G 3CCJE 3CCQE 1Q7YG 4IO9E 4WFAE 3CCLE 1K73G 1VQKE 1VQ9E 5GAEG 5JVHE 3G71E 1YITE 3I55E 1KC8G 3CCUE 2CQLA 3CCME 1NJIG 1YIJE 2QA4E 2QEXE 3I56E 3CC4E 2ZJRE 3G6EE 5AN9B 3CCEE 1K9MG 1W2BE 1VQ8E 1VQNE 3CCVE 4WFBE 1YJNE 1M1KG 3CMAE 1Q81G 4WFNE 2ZJPE 1QVFE 1VQ4E 3CCSE 2OTLE 1VQ6E 1VQ5E 5HL7E 2OTJE 1YJWE 5H1SI 1Q86G 3CD6E 5GADG 3CF5E 2ZJQE 3OW2E 4U67E 1RL6A 4IOCE 4IOAE 3CMEE 1VQME 5JVGE 3G4SE
chains in the Genus database with same CATH superfamily
3J7ZG 1VQLE 2OL6O 2I5ZO 3CPWE 3DLLE 5B2AO 1YHQE 5GAHG 3CKFA 1QVGE 1K8AG 1OSPO 5GAGG 1VQPE 1VQOE 1N8RG 1S72E 5MLCH 5DM6E 3CC7E 3IGEA 3PIPE 5B10O 1Q82G 1M90G 5DM7E 1KQSE 3PIOE 1JJ2E 1VQ7E 4UY8G 1YJ9E 1FJ1E 3CC2E 3CCRE 1RJLC 4WF9E 2OYBO 1YI2E 3CXCE 4WCEE 1KD1G 3CCJE 3CCQE 1Q7YG 4IO9E 4WFAE 3CCLE 1K73G 3EC5A 2OY1O 3CKGA 1VQKE 1VQ9E 5B3MO 2AF5A 5GAEG 5JVHE 3G71E 1YITE 3I55E 1KC8G 3CCUE 2CQLA 3CCME 1NJIG 1YIJE 2QA4E 2G8CO 2QEXE 3I56E 3CC4E 2ZJRE 2PI3O 5B11O 2OY5O 3G6EE 5AN9B 2HKDA 3CCEE 2OY8A 2OL7A 1K9MG 1W2BE 1VQ8E 1VQNE 2FKGA 3CCVE 4WFBE 1P4PA 1YJNE 2I5VO 1M1KG 3IG9A 3CMAE 1Q81G 4WFNE 2ZJPE 1QVFE 2FKJA 1VQ4E 3CCSE 2OTLE 1VQ6E 2OY7A 1VQ5E 2OL8O 5HL7E 2OTJE 1YJWE 5H1SI 3AUMO 1Q86G 3CD6E 5GADG 3CF5E 2ZJQE 3OW2E 4U67E 1RL6A 4IOCE 4IOAE 3CMEE 1VQME 5JVGE 3G4SE
chains in the Genus database with same CATH topology
3J7ZG 1VQLE 3CPWE 3DLLE 1YHQE 5GAHG 1QVGE 1K8AG 5GAGG 1VQPE 1VQOE 1N8RG 1S72E 5MLCH 5DM6E 3CC7E 3PIPE 1Q82G 1M90G 5DM7E 1KQSE 3PIOE 1JJ2E 1VQ7E 4UY8G 1YJ9E 3CC2E 3CCRE 4WF9E 1YI2E 3CXCE 4WCEE 1KD1G 3CCJE 3CCQE 1Q7YG 4IO9E 4WFAE 3CCLE 1K73G 1VQKE 1VQ9E 5GAEG 5JVHE 3G71E 1YITE 3I55E 1KC8G 3CCUE 2CQLA 3CCME 1NJIG 1YIJE 2QA4E 2QEXE 3I56E 3CC4E 2ZJRE 3G6EE 5AN9B 3CCEE 1K9MG 1W2BE 1VQ8E 1VQNE 3CCVE 4WFBE 1YJNE 1M1KG 3CMAE 1Q81G 4WFNE 2ZJPE 1QVFE 1VQ4E 3CCSE 2OTLE 1VQ6E 1VQ5E 5HL7E 2OTJE 1YJWE 5H1SI 1Q86G 3CD6E 5GADG 3CF5E 2ZJQE 3OW2E 4U67E 1RL6A 4IOCE 4IOAE 3CMEE 1VQME 5JVGE 3G4SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Z G;  1VQL E;  3CPW E;  3DLL E;  1YHQ E;  5GAH G;  1QVG E;  1K8A G;  5GAG G;  1VQP E;  1VQO E;  1N8R G;  1S72 E;  5MLC H;  5DM6 E;  3CC7 E;  3PIP E;  1Q82 G;  1M90 G;  5DM7 E;  1KQS E;  3PIO E;  1JJ2 E;  1VQ7 E;  4UY8 G;  1YJ9 E;  3CC2 E;  3CCR E;  4WF9 E;  1YI2 E;  3CXC E;  4WCE E;  1KD1 G;  3CCJ E;  3CCQ E;  1Q7Y G;  4IO9 E;  4WFA E;  3CCL E;  1K73 G;  1VQK E;  1VQ9 E;  5GAE G;  5JVH E;  3G71 E;  1YIT E;  3I55 E;  1KC8 G;  3CCU E;  2CQL A;  3CCM E;  1NJI G;  1YIJ E;  2QA4 E;  2QEX E;  3I56 E;  3CC4 E;  2ZJR E;  3G6E E;  5AN9 B;  3CCE E;  1K9M G;  1W2B E;  1VQ8 E;  1VQN E;  3CCV E;  4WFB E;  1YJN E;  1M1K G;  3CMA E;  1Q81 G;  4WFN E;  2ZJP E;  1QVF E;  1VQ4 E;  3CCS E;  2OTL E;  1VQ6 E;  1VQ5 E;  5HL7 E;  2OTJ E;  1YJW E;  5H1S I;  1Q86 G;  3CD6 E;  5GAD G;  3CF5 E;  2ZJQ E;  3OW2 E;  4U67 E;  1RL6 A;  4IOC E;  4IOA E;  3CME E;  1VQM E;  5JVG E;  3G4S E; 
#chains in the Genus database with same CATH topology
 3J7Z G;  1VQL E;  2OL6 O;  2I5Z O;  3CPW E;  3DLL E;  5B2A O;  1YHQ E;  5GAH G;  3CKF A;  1QVG E;  1K8A G;  1OSP O;  5GAG G;  1VQP E;  1VQO E;  1N8R G;  1S72 E;  5MLC H;  5DM6 E;  3CC7 E;  3IGE A;  3PIP E;  5B10 O;  1Q82 G;  1M90 G;  5DM7 E;  1KQS E;  3PIO E;  1JJ2 E;  1VQ7 E;  4UY8 G;  1YJ9 E;  1FJ1 E;  3CC2 E;  3CCR E;  1RJL C;  4WF9 E;  2OYB O;  1YI2 E;  3CXC E;  4WCE E;  1KD1 G;  3CCJ E;  3CCQ E;  1Q7Y G;  4IO9 E;  4WFA E;  3CCL E;  1K73 G;  3EC5 A;  2OY1 O;  3CKG A;  1VQK E;  1VQ9 E;  5B3M O;  2AF5 A;  5GAE G;  5JVH E;  3G71 E;  1YIT E;  3I55 E;  1KC8 G;  3CCU E;  2CQL A;  3CCM E;  1NJI G;  1YIJ E;  2QA4 E;  2G8C O;  2QEX E;  3I56 E;  3CC4 E;  2ZJR E;  2PI3 O;  5B11 O;  2OY5 O;  3G6E E;  5AN9 B;  2HKD A;  3CCE E;  2OY8 A;  2OL7 A;  1K9M G;  1W2B E;  1VQ8 E;  1VQN E;  2FKG A;  3CCV E;  4WFB E;  1P4P A;  1YJN E;  2I5V O;  1M1K G;  3IG9 A;  3CMA E;  1Q81 G;  4WFN E;  2ZJP E;  1QVF E;  2FKJ A;  1VQ4 E;  3CCS E;  2OTL E;  1VQ6 E;  2OY7 A;  1VQ5 E;  2OL8 O;  5HL7 E;  2OTJ E;  1YJW E;  5H1S I;  3AUM O;  1Q86 G;  3CD6 E;  5GAD G;  3CF5 E;  2ZJQ E;  3OW2 E;  4U67 E;  1RL6 A;  4IOC E;  4IOA E;  3CME E;  1VQM E;  5JVG E;  3G4S E; 
#chains in the Genus database with same CATH homology
 3J7Z G;  1VQL E;  3CPW E;  3DLL E;  1YHQ E;  5GAH G;  1QVG E;  1K8A G;  5GAG G;  1VQP E;  1VQO E;  1N8R G;  1S72 E;  5MLC H;  5DM6 E;  3CC7 E;  3PIP E;  1Q82 G;  1M90 G;  5DM7 E;  1KQS E;  3PIO E;  1JJ2 E;  1VQ7 E;  4UY8 G;  1YJ9 E;  3CC2 E;  3CCR E;  4WF9 E;  1YI2 E;  3CXC E;  4WCE E;  1KD1 G;  3CCJ E;  3CCQ E;  1Q7Y G;  4IO9 E;  4WFA E;  3CCL E;  1K73 G;  1VQK E;  1VQ9 E;  5GAE G;  5JVH E;  3G71 E;  1YIT E;  3I55 E;  1KC8 G;  3CCU E;  2CQL A;  3CCM E;  1NJI G;  1YIJ E;  2QA4 E;  2QEX E;  3I56 E;  3CC4 E;  2ZJR E;  3G6E E;  5AN9 B;  3CCE E;  1K9M G;  1W2B E;  1VQ8 E;  1VQN E;  3CCV E;  4WFB E;  1YJN E;  1M1K G;  3CMA E;  1Q81 G;  4WFN E;  2ZJP E;  1QVF E;  1VQ4 E;  3CCS E;  2OTL E;  1VQ6 E;  1VQ5 E;  5HL7 E;  2OTJ E;  1YJW E;  5H1S I;  1Q86 G;  3CD6 E;  5GAD G;  3CF5 E;  2ZJQ E;  3OW2 E;  4U67 E;  1RL6 A;  4IOC E;  4IOA E;  3CME E;  1VQM E;  5JVG E;  3G4S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...