1S78D

Insights into erbb signaling from the structure of the erbb2-pertuzumab complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRQAPGKGLEWVADVNPNSGGSIYNQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor protein-tyrosine kinase erbB-2
publication title Insights into ErbB signaling from the structure of the ErbB2-pertuzumab complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 37
structure length 222
sequence length 222
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s78D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s78D01
3NIGF 3MR9A 4GXVL 4PJXA 4ERSH 2VDML 3KPLB 4KUZL 1Q9WB 1EMTH 2R4SH 4PB9H 3MRKB 5L88H 2JK5B 2D7PA 1TTUA 3HKFA 3AS1A 4HMDA 4BELD 3AAZA 3Q5OA 3B3IA 2HT3C 2APVA 3DMMC 1MFEH 3RY5A 1YMHB 2BC4A 4OFYA 4X5WB 4PTTB 4ZAKA 1GZPB 3FRPG 1HHHA 3OXRB 1IMHC 2DM2A 4TUJA 1A8JH 5B4MC 3MRMA 5CGYC 5E2UH 5D6CA 4E41A 1DEDA 1NCAH 2J4WL 4J4PD 4L4VA 3IKCA 3BIAX 4NHCH 3MLXL 3BGMA 1CIUA 4C56A 5BO1H 4XNXH 3VFMB 4GAGL 4OGYH 1NEZA 4UZGA 5LGHH 3VXSA 5I1HH 1BD2A 3P4MA 3RWGA 3RY6A 2JELH 2RAMA 1BBDH 1Z2KA 3ARGA 4HBCL 3UYRL 1CLOH 3BD3A 4PRNB 3PQYB 4DN4H 2BNUA 4MNGA 2FO4A 4JPIA 3P4NA 4HPYL 4I3GA 3DXAA 4K8RH 4Q0XH 2HLFD 4JG0H 2AABH 5FO9B 4WY7L 3GSNL 4X7CC 1NGWB 2P8LB 5D2LF 1FVEB 3WNKA 4QTIH 4J3WA 4JRYE 3SCMC 3PWNB 4U0RB 1MCWM 3DGCR 5C71A 2PYEE 4P2RA 4H8WH 1OB1A 4W4NA 1PDKA 3MFGB 5TF1L 2ED9A 3ZSTA 5I30H 3O2WH 1GHFL 2HT3D 3DMMD 3DROA 3U0WH 3LD8B 5E03A 1JGLL 1OL0A 2AJSL 4YAQB 5B4MD 5CGYD 3MRDA 4Z7NE 4Y16C 4PGBA 1MJJA 2E7BA 4XBEH 4YQXL 4OZHE 3TWCH 3FJTA 3HNVH 4PS4L 5FYJL 2YN3A 3HTLX 4JAMB 1NAKH 1T21B 4QRRB 5IQ7H 4OCNC 4I3RL 2IC2A 2L0DA 1U8HA 4XP6H 4OF5A 5IBTH 3DX7A 4UUJA 5EA0H 4L8CB 4CU8A 4NRYB 1PEZA 4U1HB 4G9FA 3FQRA 5K59F 2G9HB 1KCLA 2HVKB 1QSEB 1NGZA 4N1EA 3FN0H 2Q86A 2HH0L 4RGOL 2K7QA 5ILTH 1VHPA 4IRJC 3QHFH 4HWUA 3UTSD 3CXHJ 4LKCA 2FJGB 3PWJB 3ZE0E 5HYJE 1S9VA 3V6OC 1WITA 4ZXBC 3MA7A 3MOBH 4AM0A 5IROA 1KJ2L 5DRWB 4OD3H 5CEZH 3ALWA 1PQZA 2BOCA 4H0HB 4D3CH 4OLUL 5HDOA 2W91A 1TCRA 3CK0L 3CLFH 3SCMD 4Z5RA 2F19H 1BQUA 4F58H 5CEXB 5AWNL 3ROLB 5FUZH 4D2NA 3KLSA 2BERA 4HJ0C 2YS4A 4FP8H 1LO2H 4KRMB 5MEOA 3QDJA 1RUKL 2DIJA 5MI0B 1ACZA 3KPSD 1DBMH 2C3VA 2EO1A 5C09B 2X4PA 3VFVB 3TBWA 5HDBF 1CE1L 5TE7L 4DEPC 5L2KE 4Y16D 1F5WA 4TQEH 5GIRB 2QADC 2ZCLL 2AQ3A 4KZDL 4RCAA 3DLQR 3WEXB 3D85B 3T3MF 3HUJA 5HI5C 1WLHA 5BOZG 3DPBA 4LHUD 2RBLA 3KYOB 5IK3B 3FFDA 3B2UC 3WNOA 1QBBA 1MAJA 3WHE1 1AXSB 4KY1H 2P45B 4LARL 5I1GL 3VW3L 5HPMB 3FO9A 12E8H 3S34H 4I2XB 2AJUL 2AI0L 4WVRA 4K7PH 5HGBA 3FFCA 4I0PB 2CXGA 3WE6A 5E8OB 2V9TA 1CTOA 4YHKL 4IRJD 4HXBL 5FV1L 1UM4H 3V2AR 1RUQL 1JNJA 5B8CC 1NBVL 1MCRA 1U8OB 5DC9B 4ZXBD 4OKDA 4RISH 1QLFB 1AP2B 3WJJC 3RVTC 2VUOA 3ECBA 5BV7L 1BIIA 4K8RC 4U1LB 1KN4H 3GO1H 2APTA 4OUOA 2MTPA 2FRGP 5M95B 3UTTA 3SE8L 4DGYL 4YGVA 1CTNA 2EDNA 2R2BA 4HKZA 3DNKA 4HJ0D 3ZTNH 3B9EA 3PHOA 1YEKH 1CF8L 1HQ4A 5A2IH 3MYJB 2HJLB 3DYOA 5TE6L 5C2BH 1CFNA 2L7UA 2E6PA 1QLRA 3VA2C 3FQTA 4FMFA 4WI2A 5T3XH 4XNQA 3QI9C 2QADD 1A7OL 4LPUA 4LCCC 1OPGH 5F93C 4G8EA 3KLAB 5F88B 4M61A 5HI5D 2XZAH 1A1MB 1CFSA 3NCJL 2ZUUA 1KEML 4R26L 3B2UD 3PGFL 4NPYB 4NRZB 4MQ7B 1BM3H 3P0YH 1CGVA 3UZVB 4PRHE 4KPHH 3G5YB 3QQ3B 5IBUG 2A6DA 2VIRA 3LIZH 4EQ2A 3K3QA 4ZSOA 2AEIT 5D7KD 1IC5H 3MLSH 5DD6B 3LPWA 3H2WA 4ZMAT 3JTSA 1TENA 3LN5B 2YR3A 4KJYA 1PKOA 4Y8DC 3ZDXF 4OBSA 3QFJD 35C8H 5T5FH 3UTOA 3RVTD 4XCEA 2OK0H 5D6DC 4R96B 4UDTB 3WIHH 4K8RD 3DI3B 3FB5A 1M7IB 5ACMA 3OKEA 3MNWA 2LU7A 3TN0A 4EKXA 4K3EH 2NY1C 2EDBA 3DVNA 4PTUA 1UWXH 5HGAA 4M4RA 3FMGH 1MCOL 3MV7E 5GRXG 4XMLH 3I02A 4WFFE 3H42H 3RBSA 1BOGA 4NN7B 1U8LA 3IFNL 2Q76A 1KB5A 3S96A 2NMSA 5I17A 4L9LB 4R4BA 3CZFA 3KXFE 3EYQC 2V2TB 3QG7L 3VFOA 3MLUH 1DQQA 1B9ZA 1BVLA 3QI9D 4KFZC 4KKBC 4X4ME 5FV2A 3E2HC 3HS0A 3PNWA 3HPJA 3DOSA 4NO2A 3K81A 5D2NC 5F6IC 1DFBL 1QQDB 1E28A 4QY8A 2D31B 1QLEH 4XP4L 1UG9A 3HPLB 3STBA 3VI3E 3V6FA 3TVMB 4YWGH 1N4XL 5HYSA 3OHXB 3V0WL 1DLHA 1P4IL 3DX9A 3F7VB 4JHAH 1OP5H 5CZKA 5DVNA 5EOQL 3O4OC 3VXMB 1AKJD 3P9LA 2VAJA 1YC7A 4PJEF 3BKJL 3IXAA 4HFWB 4TSCH 4J8RA 4UTBH 1ZT1A 1HOCA 1FNFA 3L1OH 4ODHH 4QHLA 2ZUSA 1JF6A 3C8KB 5CP7A 1XGQA 2HKHH 3U0TA 3B9KA 3TCLA 4LP5A 1MHPL 1KF9B 2AJ3B 3CH1B 1ZLVK 1J1PL 3BT2L 2ADGB 5SX5H 1I8MB 4M8QA 1RJCA 2ZKHH 4UI2A 5ITBL 3RWDA 4UU9B 1K4CB 1HH6B 3R1GL 5ICZB 1PKQA 3WDIA 5DQDH 4YDKH 2F74B 3AXLB 1XGTB 2NY1D 3T4AA 2VLKB 5C0BA 1CFQB 3FTGB 5EH1A 1XR8B 4PJDA 2X10A 1UM5H 3BWAA 1JZ3A 1CYGA 3U4AA 2K7PA 4K9EH 4KKBD 4I4WA 1OT1A 2CLZA 3BW9A 2YBRA 4PV8A 1I8KB 2VR5A 1LDSA 3DRQA 5DRXB 4JQIH 5DTFA 3KPSE 3WFCH 4NQDE 1UFUA 3QZWA 1KB9J 4GW4B 4FXGA 4P2OC 2DBJA 4FQJH 5KZCB 1G7PB 4CDHA 5M7QA 2DLGA 3O4LE 4NWUH 1EO8H 5JPMA 3T0EB 3QDGE 4JANB 3WFEH 2QSCH 1Q1JL 1X5ZA 4ZYKB 1ZAGA 2DD8H 3LKRA 2YUVA 3MUGA 1AXTL 4CVUA 2CKBL 3S98A 1F4YH 4AENA 3LHPH 2GTWA 1LO5A 4MA7L 3JV4A 4LNRA 3WD5H 3I3BA 3MGOA 2P5EA 2D03H 1RJYB 2ZG1A 2F53D 1SVZA 5SWZD 2I25N 2QTEA 4IMKA 2IH3A 2K9UA 1DZBA 4TSAL 5CHNB 3EIFA 4TOYL 1JPFA 2D7QA 3VD9A 3V0AC 5DMJB 2GSIA 2GHWB 1YEGH 1QSFE 1G0XA 4RNRB 3REVB 5I71B 4LBEA 2EE3A 5D1QA 4NOBA 2AEPH 1IL1B 2D3VA 2DYPA 3OAUL 3MREA 2E9IA 4OLWH 4GAYA 5EU7C 2WK2A 3K8MA 1G7HB 4ZPTA 1BJ1H 5CGMA 4P3CL 3CPLA 4BSVA 3S5LG 4KWUA 1NFDA 1WCBB 3SDCA 3MFFA 4CN1A 1JK8B 2HFGH 3GBMH 4XWOC 1EEZA 4P2OD 3BKYH 5FGBA 1CG9A 5L8KB 1A7BA 4HF5H 3LSOA 1ERNA 4OT1L 4E5XB 3P3YA 3QIWB 4YXKH 5C0AA 4MA8L 3X3FL 1G9NL 4OJFL 1A14L 1MWAH 4KMTL 4L4TB 1ZHNB 2VC2H 1A3LH 2AEQL 4OCMC 2BNQE 4JKPH 2H9GB 4C4KO 1HIML 3LCYA 4HIXH 3QDMA 3W11C 4XCFL 2P24B 2AK4B 2WIIA 1G7LA 3RWEB 1TETH 1ORSA 4UB0L 3AMLA 5EUOB 4L3CA 2HT4C 1OGAA 5I16A 4K3DH 3EOBB 5T1MB 1OP3H 3O3DA 1P84J 2H8PB 2OTWA 1DBBL 4RFNC 5CZVH 1JNLL 3ZYJA 5J06A 4R0LC 3MC0A 1NC4A 2R0LL 4IDJL 2AXFB 2ESVD 4WUUA 3NCYS 1QVOB 1QD0A 1I85A 3TM6A 2YD6A 2Z4QA 4GBXB 1Z9SA 3BKCL 3C2AH 5IW6B 2IANB 3F5WB 1HCVA 3FHAA 3U7YL 4WCYL 1VSCA 1C8PA 5FECA 3MRLB 2QQLH 1NGPH 2IAMB 3ES6A 3GSVA 4JPVL 4Z7WE 3CFBA 4MA3B 4X6BA 2E27L 1BFTA 3MBEC 3W9EA 2VISB 1QSZA 4PJCF 3IU3A 4OGXL 2NCMA 2W07A 4HPOL 3ARQA 3M17A 1D6EA 1OM3L 3AU1B 5A43C 1Z5LB 4MVBC 1EJ6A 4XWOD 3WUWB 2VZTA 3UBXA 4IMLA 1R3KA 3I6KA 1DCLA 3KHQA 1P7HL 1DQTA 3QUXB 3RFZC 5A40E 3M1BA 1EFXB 5I19H 4NCC1 1XCTB 1CU4H 1NAML 4J1UA 5EC2A 5EUKA 1BFOB 2HFFB 4U49A 1JMXA 5KS9E 3PDOB 3W11D 4PRPA 1ZGLP 3RX8A 2EEDA 4HIHA 2YOCA 4J2XA 2QBWA 1VEMA 2HT4D 3F12B 5LBSH 1ZLUH 4MDIA 5C0FA 4EI5C 3NCYP 5ADOH 4JDZB 4XPTH 2WINB 1YEEL 4PLNC 3MO1A 1ZSDB 4OLZH 1VACA 5E99L 5BMFH 5IIEA 4F7EA 5TQ2H 2VLLA 1AQKH 3BSZH 4LDEB 1QBLL 3CFCH 4OF8A 1YPZE 3SE3A 4YNYB 3UTQA 1EIBA 3SDDA 4FQCH 3BD5A 4LCWD 3MBED 4XPHH 4DKDC 3H9ZA 1BFVL 5CEZE 3QUYD 2F54D 1RJLA 1KTRL 2WBWB 3CFIC 43CAB 1U92B 1I1AC 1C7SA 5SWSA 4N0UB 3DX8A 1L7IL 3OAYK 1A6VL 4JM2A 4XC3L 4MVBD 4O5LL 1QRND 3CDGA 4HUMB 4QXGH 1LK3H 4LRNH 3BZEB 1AO7D 3KPRB 3R0MA 1LE5B 2P44B 2VXVH 4PY7A 3H6JA 5I73B 3HMXA 3P2TA 2XFXA 1J18A 1MNUH 1WFOA 2ZSVB 2XA8L 1A4KB 3RZWA 2X1OA 3AROA 4AJ0A 4N0RA 3HC0A 5IMMA 1TVHB 2Y5TA 3TO4C 1MCWW 3GNML 1Z3GL 4JFDD 4EI5D 2EDRA 3AS2A 1FPTH 5E94A 5J13B 5GRJL 4P46A 3RGVA 2B0SH 4CNIB 5I1LB 4XVTL 3MTRA 5F72S 4X98A 3TZVC 3S35X 3BI9X 1T1ZB 3RBGA 1IGIH 3L3IB 2X4QB 5FM8A 5C0NC 3KYKH 1I7RA 1RULL 3IS1X 4GUPB 4RBPH 4YR6B 1JWUA 3FO2B 1GGIL 2EYTA 3KYMB 4LVHC 2R29L 1FFQA 5DA4A 4ZFGH 3ARSA 4PJ7A 5D93C 1A7NL 1FFPB 1LK2A 5DMYA 2R1YB 2XWTB 4AMKH 1F3JB 3QIUC 1C5CH 2P7TA 3O9WC 5GGRY 4MXVE 3WL9A 4G5ZH 3MROB 3JV6A 2DBLL 4HZLB 1IQWH 4PJFF 5CEYB 2Z35A 3MZGB 4NHUB 4EN3B 1I1AD 1KNOA 3QBTB 5GGTA 5ICYB 1G7MB 5HI3C 2BNRD 2OX5A 2JCCE 2WWKT 1OAXH 4GXVH 2VLRA 4NQUA 5E2WL 1CGTA 5DVKA 4UILL 3KPPA 2H26A 2WUBL 5CJQL 1QFWH 2VDRH 5FGSA 5T3XE 1JZ7A 3NTCH 3IDJB 3DIFA 1U8MB 3TO4D 3FQXB 4D0CA 2Y6SC 1XZ0A 3LEVL 1W2KT 1QO3A 3TZVD 3DUHA 1KCUL 2CIIB 4GAGH 4IDLA 5C0ND 4HUXB 2EH7L 1GXEA 4RA3A 3HZKB 4HBCH 1J8HA 5CIPH 5CKAA 1IAIL 1FH5L 1UCBL 1MCJA 3PGDA 3PE9A 4XXCA 5F9WB 1IKFH 2BZDA 5ESVB 4HPYH 1N6QL 3UYPA 3BRFA 3QIUD 3O9WD 3HI1A 5K9QG 5T1LA 3X14B 5HHXL 3UPCA 5B3JE 5K9OB 1HDMA 4MZ2A 3GSNH 1CFBA 3ET9F 3L9RB 1RZFL 1RZKC 1KBGL 3OJVC 5JQ6L 5HI3D 5KSAB 1P6AB 3WFZA 3I6GB 5F1OB 5IMOA 5LCVH 1S9KC 2XTJC 2B1AL 3W9DB 1U3ZA 2DIAA 5J1AA 3EGSB 4BQBA 4G9DB 5C9JA 1CT8A 1D6VH 2V5RA 3D39B 4JFHE 3QNYA 4AL8L 4MA1C 1INEH 4R90L 1U3HA 4W6YB 2VDOH 1FYHB 3VWJB 2ZNXA 4JKMA 5JXEA 3D0VB 4PJBE 1NSNL 1D7FA 2D4FA 3LKPA 1TZHB 2QHRH 4JLRB 4YHLL 1S7SB 2Y6SD 4R7NA 3U7WL 4JFZL 4YQXH 2IEPA 3AB0B 3C09B 5FYJH 2ENSA 4JRYA 3WO4B 4QNPE 5FK9B 4HS3B 1ZHKB 4WO4C 3GSUB 4BZ2H 1I8LC 2PYEA 4PJHB 1CGWA 3ROOA 5GGSA 4JFXA 5HHMD 2GJ6B 4CU6A 1UH2A 2WP3T 4Q6IC 3RUGF 3B6SA 3SE4C 1F4XL 3EO1A 3BGFC 1B90A 3OAZK 3QDHA 3CC5B 3OKMB 4YXLL 1PG7W 2BVOB 3SOBH 4XP9L 1PD6A 5JNYA 3NFNA 4D9LL 5FKPA 2HH0H 4P4KB 3VDBA 3RNQA 1QPXA 4CMHC 1W72A 5J11C 5DO2C 4NO0A 2DDQH 4OZHA 5B21A 3GMQB 5DMKA 4YFLF 5IB4B 3IDIA 3TJEL 4O51B 5DHYA 2XTJD 1TFHA 4BK4A 1FGVH 1GOFA 3CK0H 4KJQC 3QB7C 3LV3B 3VXRE 5D7LE 4M7KL 3RWFA 5MERA 1H3UA 4AH2B 1JPST 4KAQH 3VH8B 5F21B 4I2XE 1FFRA 1N5AB 3IT8D 2LABA 5DQ9B 5F1SA 1NJ9B 3NIFE 5IOPB 4ODVL 3CSYA 5I1IL 4ZS7L 4ORGB 5HYJA 4RDQF 1R3IL 4OZFA 4S10A 1U42A 3OKLA 4W4OC 5D7SH 2WZPD 1Q9LB 4JCMA 1A5FL 5JTWA 4GLRI 5TE7H 5ESQA 1JMZA 2ZCLH 1J1OL 2JIXD 2Z8SA 3VXQA 1T7WA 3V6BR 1WEJH 2Z93A 3WS6A 4WO4D 1ND0A 3DVFA 4HLZH 4X5LA 1C16A 3FQUB 4LPWA 5JW3H 3ARFA 4LARH 5I1GH 1JFQH 3VW3H 2HFEB 1A6WL 2AI0H 2AJUH 5FO8B 2NX5D 4ODUB 5J12C 3QXDA 2W65B 1DQJB 1I7ZB 2EEBA 5BZWA 1X5GA 4B50A 5JIKA 3UTZB 4YHKH 5HHQB 3RZCB 4NNYA 4RAUA 2YUWA 3CFDA 3LRHA 5L6YL 1HN1A 4ODSL 1X5FA 5DO2D 4U1JA 1SBSL 2MSPA 4G42A 5IESL 2AJVL 3BXNB 5DK3A 4OCXL 5IHUH 4IBLT 4HKJB 1A02N 3JWOL 5HHNB 3U30C 3H9YA 2APFA 2JLLA 4KJQD 3QULB 3L7EB 2W60A 2CRIA 2I27N 4DGYH 2VDQL 3MV8E 3SDAA 4WEUD 5ICXB 5F7EL 4XVJL 4PREA 4QRPB 2DWDA 4R4FH 2XPGA 1CF8H 5DJDB 3VXOA 1L9MA 3L6FA 4K94L 1ZLVH 2VR9A 3GMOA 2KL6A 5GGUB 3VGAC 1P2CB 3C9NA 5H8DA 3GJFA 4ZO7A 1XMWA 5KAQF 3QUML 3DI2B 5EFIB 1X5KA 2DWEB 1M7DA 4HCRA 1RZ8A 1A7OH 1WICA 5CJXA 5JW4Q 3C8HA 1UYWH 4LGSB 1OSZB 3PWVB 3ZYOA 4ZFOB 2UY6A 4GQPH 3U48A 3DX6A 25C8H 2XY2A 1RZGA 3JZ7A 3NCJH 5EO9B 1WZLA 5E8EB 4H26B 1XIWB 4MAUL 4R26H 3QEUA 3PGFH 5EU6D 3UAJC 5B39A 5C0GA 1CBVL 3ARBB 1OQXA 5DJ8A 2HYMA 1IGFL 5HGDB 3S3SA 4DQOL 3ULVH 1N0XL 2CLRB 4Y19D 2V9QA 1DQML 1RIUL 3MRJA 2VZVA 4OTXL 4RMRA 1JPGA 4EIZC 4LSTH 1D5BB 2Y07H 1WUNT 3QEGH 2CO6B 5HHOE 1D5XA 2YHGA 3C5ZB 1R24A 3CFJB 3CU1A 3OKOA 3CXHK 5HDBE 3PIQB 1N3NA 2J6EA 4PRHA 5CP3A 4PJGB 5DYOB 2VLJE 4OZ4A 4PJ5E 1EXUA 3PP4L 4FABL 4XAKE 2EIEA 4GW5B 1U8PA 4H0IA 1T7VA 1EPFA 4H1LA 2VITB 4S0SD 1N26A 3IFNH 3SGJC 4XPGL 3X3GL 1NMAH 1U91B 2DQJH 5ERWA 1WBYB 8CGTA 4G80B 5JHLH 2YD8A 1FIGH 3KGRA 5SWQB 4BSWB 1FYTD 4K2UL 1DFBH 1FZMB 4W6WB 1P53A 3SJVB 3EOTL 3MLWH 1FNLA 5D1XB 3UAJD 4ELKB 4P2CG 3MACH 3MV7A 5IG7B 3V0WH 1P4IH 4HJGB 2L4OA 4APQA 2DMCA 2DLHA 3BKJH 2J88L 1KUMA 1JGVH 2AKRA 3BH9B 1MELA 5AUMA 2VZUA 1R3JA 3BX7C 3KXFA 4RMWA 1X5IA 4JGUA 3H3PH 3TYGL 4X4MA 4OZIB 3D2UB 5F97E 4LSSH 1J1PH 5LGJB 1LD9A 3KPTA 4LCUA 5MEND 1ADQL 3O11B 1M6OB 5AZ2H 3R1GH 4DZ8B 4QRSB 1B4JH 2W0FB 4YX2L 1RUML 2X1XR 3NIDE 3T65B 2YK1L 5FKAB 1QFWM 4P4RA 2EYSB 4IRSB 4B5EA 4O9HL 4KKCC 3QWRD 5DD1H 4UDUB 5BV7C 1KSRA 3MCKB 1QR1B 4JB9H 1WAAF 3OJ2C 1VFUA 3I6LD 4U1KB 1KELL 4IIQB 4K7FB 1A1OB 3P0VH 3ZDXE 4ZNEE 1DE4A 3O6MH 2ADJB 3RP1A 3VFWB 5JO5A 3GMLA 3U0PA 2ZUQB 1I1FA 5E0QA 1MCDA 3VMNA 1QSVA 4OFDA 1ZGLM 1ZTXL 4JZJC 1ZOXA 1FVCA 1WJ3A 5JDSB 1AGBA 3VG9B 1HEZB 4X6EB 4KRNA 1A21A 1KT2B 1T04A 1IT9H 1AXTH 3MYZA 3KS0J 4FQ1L 4G6FD 4KVNH 3CX5J 3V5KA 1KJ3H 1YEJL 2FR4B 4MWFB 5I0ZA 1A64A 1IGCL 4PJ8A 5E70A 3FO1A 4PRID 4MA7H 4RX4D 4UOW1 3O3AB 4NQDA 4FZ8H 1KPRA 2KKQA 3E6FA 2VXTL 2OQJA 5ISZB 3O4LA 1DTUA 2ZZUT 2ADFH 4TSAH 4NRXA 5T1KD 4TOYH 5ALBH 1NDMB 2MCG1 4N8VB 3QDGA 3S4SG 5K93A 2YSSB 1MHEB 1O7SA 4KKCD 5DRZB 5F70A 1FZOA 3GSQB 4S1SH 5C8JB 4NZDA 5C86A 4YHYC 2DJSA 3ARUA 1NMCB 3ZTJG 2Z31A 3PDDA 3OAUH 3HG1E 3QIBA 4I18A 4MB5A 5JW5B 1U8QA 2CDEA 4PJEE 4KRPB 1LEKB 3SO3B 4MCYB 4HV8B 1REIA 3ARDA 1Z9OA 4NKQB 4JFQA 3ZTJH 2HG5A 3SGKC 5FUOH 5I1CH 5D71L 2VABA 3LKNB 5IV2A 2V17L 1CWVA 2XG4A 3AFLA 4GRLC 4AIZB 4OT1H 5FB8A 1QSFA 5IGXH 4MA8H 3U79A 1G9NH 3X3FH 5LG1A 5DSCB 2CDFA 1CL7H 3VFTB 5J3HC 1H3PH 4YC2C 4OQTH 3MRBA 2MPAL 2R23B 1U9KA 1J0KA 5DR5L 3GHBL 5FFLA 4WU7A 4GRWB 3QAZC 3LKQA 3VE0B 5ID0B 1H5BB 3QXAB 1DBBH 3PDGA 3IDGA 4KTDL 2BX5A 4FHBD 1SYVA 3FO0L 4OSUH 5IM7A 2W0LA 4IDJH 5FDWA 4X6FB 4K07A 3KLHC 4NFBA 2E5EA 1G9MH 4F15B 4GG8A 4PJXB 5IB2A 4JR9H 3O41A 4HKXB 2BNQA 3H9HB 5F1NB 1IAMA 3U7YH 2K1MA 4UNUA 4WHCA 2LU3A 3QSKB 4JPVH 3AAZB 1MI5E 3A6BH 3B3IB 3HZYB 2DLTA 1QEWB 4MJID 4NFCA 2BC4B 3B5TA 5TDNB 3LN4A 4ZAKB 4Y5XA 1SMOA 5C0DA 4OGXH 3GRWH 3MRMB 1I8IA 1V3MA 5D6CB 1QFWI 2Y36H 4X8JA 5F7WC 4QHNA 4L4VB 3T1FA 1C5DB 4FZEL 2FIRT 3LH2H 3WLWC 3RHWK 2CXKA 4C56B 1T80A 3IFPB 4XP1H 1CDIA 1NEZB 1BJMA 3VXSB 1BD2B 3P4MB 3RWGB 5F9AC 1EA9C 1NAMH 3ARGB 2XQBL 4Z7WA 3RL2A 2HN7A 2LQRA 5C08D 5TPWH 3ARVA 3S35H 3STZA 3OZ9H 2BNUB 4MNGB 2FO4B 4JPIB 2W9EL 2CK0H 3DXAB 1YEHH 4A2MA 5FYJE 4NM8L 4XNYL 2WIMA 1T1XA 2JJTA 4N0UE 3NH7L 2VE6A 1T20B 5T5NF 3H9SD 4G6AC 1OTUC 5KAQG 2P5WE 1YEEH 4JGJA 5TJWK 2R0KL 5GHWH 3CMOH 4IOSD 1AGEA 1JPTL 3PHSA 5IVXF 3WFHA 5FM5M 3KLHD 2MQCA 3HMWH 2MQ0A 2NW2B 4PJIF 5J1TC 4NBZB 4P2RB 2EYRA 1QBLH 1IJ9A 4U2ZA 4EXKA 5KS9A 1OB1B 2DI7A 5K9QI 1MF2L 3P4OA 4QTHB 5I6XB 4L8BA 3DROB 4MQXC 1AHWC 2Z0BA 3G04B 2DQGL 1BFVH 4Z7OF 5EIIA 3DYPA 2OM5A 1J9CT 4GXUM 1CE6A 2KZ1B 3MJGX 3MRDB 4IOIA 4ELMF 4PGBB 1MJJB 5F7HA 4H5SA 1XF2A 3CFKA 4MNQE 3B5GA 4XC3H 4YHIA 3WLWD 4O5LH 3NMEA 1MREH 5D6DA 4N1CA 4J6RL 4NKOA 1U8HB 1YPZA 7FABL 3QHTC 3DX7B 5LXGL 4UUJB 4J3XA 5FCUL 1M4KA 4G9FB 1FBIL 1CFVL 3FQRB 4NKMA 3QQ4B 3U82B 4P5TA 4LLUA 3WN5A 5BS0E 3IJSA 1NGZB 4QEGA 2R69H 3ZE2E 2Q86B 2R9HC 3HFML 3NGBB 4LKCB 3OPZH 5J6HA 1Z3GH 4TVPL 4G6AD 1OTUD 1Q9OB 4PGCA 4URTB 3MA7B 5I66A 3G5ZA 3IU4H 4AM0B 4PJCE 5GRJH 2BOCB 3OKYA 1TCRB 3T3PE 2A1WL 5TH2B 4Z5RB 1ACYL 3AY4A 3KYNA 3TT1L 2BOBB 4HX1A 2R56L 2I9LA 2DLIA 4M00A 4NZTH 4JJ5A 1GGIH 3TBTA 4GG6F 2R29H 4G8FA 5ALCL 5E4EC 4UQ2A 1KEGH 1A7NH 4MQXD 1NCCL 4ODTH 4W68A 4Y4FA 5MEOB 4Z76A 3QDJB 3PWLA 4G6ML 2C3VB 5TE4L 1I3RA 1EGJL 3TBWB 2EDTA 3MSPA 3MUHL 5D9SA 3T4YA 4HT1L 1E6OH 1FO0L 1FE8H 4FQPA 4NJAL 3HRZA 3HUJB 1Q9WA 3HR5B 3BP4A 5ID1A 2V7NA 3A6CH 2ZOLB 5EO0B 3FFDB 2CO7B 1MCKA 3IB4A 1DDHA 3IJHB 4J3TA 1RHFA 4NQEE 2FDBP 3KHOA 3VFGL 2DQDL 3FFCB 4OFPA 3RIFK 5E2VH 3WE6B 4HMEA 4LOUC 1IC7L 2R9HD 4NM4L 5FYKL 4XNUL 1T2XA 2FD6L 3RWHA 3W0WD 4JHZA 2NXYC 3CNKA 5BJTA 2F58L 3GHEH 3LEVH 2YEZA 2YRZA 2EXWC 3VFMA 3ECBB 2JCCA 1BIIB 4YBLB 4CL7A 3ULVE 1RSFA 1L6ZA 3D39E 4YGVB 2EH7H 2R2BB 4Y4KA 4PB0L 4HKZB 5DZLA 2NNAA 1PEWA 1FH5H 2UYLA 1UCBH 2VRAA 5DMGC 1HQ4B 5FO9A 5E56A 2GYSA 4OLYH 1N6QH 1CFNB 1FSKC 3AVEA 4U0RC 5HHXH 1OWRM 4PYHA 3FQTB 4M1GL 3VFPA 2D7OA 4XNQB 4OB5H 3TCXA 1KBGH 2R4RL 4MJIE 4WRLA 3HE6A 5JQ6H 4G8EB 3RNKA 4JCLA 4M61B 2X5PA 1KCVL 4J12A 1OW0C 2B1AH 1IEAB 3MQIA 5JUEL 1CFSB 3B2VL 3JWDH 3LD8C 3BPOB 2XZCL 3P30H 4PGZA 3RHWF 3MJ6A 4AL8H 4MD5A 2A6DB 2VIRB 1YN7A 1CR9L 1IAKA 4ZSOB 2V7HA 4GFTB 5F7LB 4YAQA 4KU1A 3WIHA 1N6UA 4LOUD 4KJYB 1JPSH 5E95B 1NSNH 3L3KB 5T3ZH 1CICC 5DHXB 1NGYA 3VXUD 2NXYD 1KN2L 3GI8L 3Q5YA 4P9MH 1QA9A 4YHLH 1ZLWH 1T21A 3U7WH 2XV6B 3VD7A 1EDQA 1XGUA 1Q38A 2EXWD 4XCEB 2VERN 3PQYD 4PJFE 1A9EA 3FB5B 2ZUXA 3OKEB 4U1HA 5HYFA 3H9SE 4UOJA 4PD4K 2ICWI 4PTUB 5HGAB 1CVRA 1CVSC 1UEYA 2NR6C 1F4XH 2HVKA 4R9HA 2XXCB 4PJBA 1RFDL 3MXWH 3I02B 1RZJC 2VXUL 3BWUC 4JVWA 1G6RL 5DMGD 1BOGB 1U8LB 2FJGA 3BOVA 4XP9H 1Y6NR 5DWUH 3G08B 3G6JB 2I07B 3CZFB 5EU4A 3VFOB 1U36A 3ELAT 3TIDB 1DQQB 1BVLB 3DVGA 3HS0B 3PNWB 4ONFL 4HUNB 2FLBT 3FB7A 3HPJB 3TJEH 4NO2B 5J57B 5E1HB 5D5MF 1E28B 3ARTA 3L5HA 3D3VD 4QY8B 1V3JA 4N8PA 4QWWC 5MI0C 1P7QA 4M7KH 3FQWA 4FXKA 3S36L 5F1IA 5HYSB 1DLHB 4JO3H 3DX9B 3BPLB 1JWSA 1KGCE 1BQSA 3P9LB 3K1KC 1KOAA 3IXAB 4TNVK 1ZT1B 1HOCB 3B43A 4K3GA 4QHLB 3VFVA 4QRRD 5I1IH 4JFFD 1Q0XH 3MBXL 5CP7B 1SY6H 5GIRA 5FYJU 1AGFA 1XGQB 1CICD 2I5YL 3U0TB 3ZDZE 3B9KB 3TCLB 2Y7QA 1Y6MR 3VWKC 5ACLA 2H3NB 3WEXA 2VSDA 4GMSL 3QUYA 4M8QB 1J1OH 5GS0H 4DGIL 2PNDA 3KR3H 3RWDB 3EUUA 5IK3A 5TF0A 3VXRA 5D7LA 4I0PC 1AXSA 1PKQB 2QSVA 2FEEL 4AEHL 4RFOL 3C8DA 3U36A 2FGWL 2NY0B 4I2XA 1FHGA 3T4AB 3ARWA 5C0BB 2NR6D 4QRPE 3RKPA 2E7LC 4RMVA 1IFHL 5DVLA 4PJDB 1I7TB 1MCBA 4X4YB 3BZ4B 3VXNA 2FH6A 2YD5A 5EBMA 1X6LA 4S11A 1IGML 3BWAB 3QUZA 4P3DA 1NGXA 1X6NA 2DQHL 3KYAA 1QLFA 1AP2A 4HHAA 4LRIA 4LHJB 1SBSH 4I4WB 2CLZB 3BW9B 5HVGB 2YBRB 1AJ7L 3BAEL 3LRGA 2AJVH 3DRQB 2A38A 4P3WA 4PV8B 1RI8A 4OCXH 5DTFB 5EDXA 5D8JH 4QWWD 3OF6A 4G43A 15C8L 4FXGB 5GJTL 4UT6L 2NXZB 5C09D 4CMMA 5JPMB 3MYJA 1XH3A 5F7EH 4KI5F 1MPAL 1Z0MA 2EEAA 2KDGA 4PG9A 2KUTA 1EJOL 3D85D 1F58L 4K94H 3LS5L 3RUGE 1N64H 3TIEA 2C3WA 4YPGB 5IBLC 4AENB 2Z92A 2GTWB 2CGRH 4PYGA 3QUMH 2QKIA 2JJUA 3VWKD 3KLAA 3BE1H 3RIFF 3UP1A 3RL1B 2VDLL 3S9DB 3JV4B 3ULUH 1YEFL 4LNRB 1A1MA 3BKMH 4C4KT 2X4SA 2P5EB 4NZRL 4GKZA 2Y25A 1NBQA 4I0PD 4NRZA 2IH3B 1UZ6F 3V4PH 2CK2A 2F8VA 3MV8A 4MAUH 2MNUA 5DUBA 1ZA6A 2NY2B 1JPFB 3I84A 5LJYH 5KOMC 4OLXH 1CBVH 5KSBB 4NQCE 2GSIB 3LN5A 1IGYA 4X7EC 3S88L 4LBEB 2J12B 4UT9L 5D1QB 4MCZA 3WJLC 1JF1A 1DQMH 1RIUH 2DYPB 3MREB 4M62L 3SE9L 1KACB 4OTXH 4K3HA 2DQFB 4FTVE 3S5LA 4ZPTB 4FQHB 1ORQA 2YA2A 4BFIA 3CPLB 3R06A 4BSVB 3PGCA 1MWAA 1OLLA 3SJVE 3MFFB 4NN7C 3FL7A 2FATL 3PABA 4GQ9H 1EEZB 1ZHBA 3MV9E 2FJFA 1QP1A 1HCFX 4L9LC 1P4BL 3LSOB 4G8IA 4Q9RH 2R0ZL 2ZUTA 4FQ2H 4FABH 5C0AB 4HKBA 1OF2A 5SX4I 3RTQB 1K4DA 1J0HA 3D48R 5FHAL 2HAZA 3QDMB 4XPGH 2WIIB 1G7LB 3CDYA 4HBQA 4O4YL 1ORSB 4KV5F 3GK8L 5JW4N 5HHOA 3TVMC 4L3CB 1R5WA 2HRPL 1QQDA 3GM0A 5E4IA 5INDB 5KJRL 3OMZA 1CL7I 1KC5L 1I1CA 3O3DB 3HPLA 2OTWB 4KK9C 2Z91A 1EBPA 2VLJA 3F7VA 4PJ5A 1NC4B 4M8VA 4U1MB 2FJHA 3SKUD 5FM5O 2BK8A 4HFWA 2FZ3B 3CLEL 5I8EA 2VH5H 1BZ9A 3OKKB 1EHNA 5I0DA 3FAWA 3C8KA 4B41A 5FECB 5CBEA 2HJKA 3ES6B 3GSVB 5DZNA 3WNPA 4X6BB 5F7KC 4X7SL 2RJMA 1FNEA 3IU3B 4WV1C 3X12A 4H0GA 2B4CC 2EC8A 2Y06L 4P2QE 4DKEL 1UT9A 5HD8C 4KDTA 3M17B 3VGGA 1D6EB 2BVQA 1UXSA 1DN2A 1WWAX 3G6DL 1EVTC 2GEEA 1ADQH 3AXLA 1XGTA 1OLZA 3TF7C 2CRYA 4RMUA 1MRCL 3FTGA 3QUKA 4NP4L 3UBXB 4YX2H 1RUMH 1R3KB 1XR8A 3A67L 1CXHA 1J0JA 3I6KB 4JRXB 2YK1H 6CGTA 4WTZG 3M1BB 1OAZL 4Z0XA 2FL5A 4GW1A 4O9HH 4L9DA 4LLVA 1KTDA 3D3VE 4J1UB 5EUKB 3JWOC 2LTQB 1OARH 4OCYL 4PRPB 2NPLX 2D7TL 3IDXL 4OFVA 4HIHB 3CSPA 1I8KA 4TNVF 3TVMD 3UDWA 1H9VA 4KTEL 3T0EC 1RMFL 3VXMD 5C0FB 4GW4A 4JFFE 1NKOA 4L3EB 2MKLC 4KK9D 5ISZE 2P47B 3MO1B 5JQHC 4ONGH 1G0DA 1VACB 5IIEB 3O6LL 4F7EB 2VL5A 3P11H 2VLLB 9CGTA 2QL1A 4Y1AE 2ITDB 4LLYA 2XTLA 2FGZA 4QOKE 1H0DA 3ZKQD 2G2RA 4XX1G 5F7NC 3UTQB 3WCYA 3KJ4B 3SDDB 1JIBA 4U05A 4FQQB 3S37X 4JE4B 1MCQA 1D5ZA 1RUAL 1IGCH 5HY9A 2VLKD 1RJLB 1FFOA 2G75A 5HD8D 4ZNEA 4RSVA 2WWMC 4TYUA 4XGZA 5E8PB 3PV6A 3DSFL 5CHNA 5SWSB 5I71C 3DX8B 4JM2B 3OB0K 2VXTH 1M71A 4MQTB 3CDGB 1LGVA 4ODXA 1PLGL 4M3KB 4U7KA 4RNRA 3HAEB 3REVA 1S8DA 1B88A 1MJ8L 3TA3A 1MIEH 4M6NL 1TQCB 4PY7B 4WI3A 2B2XL 1DBJL 3BD4A 3BPNB 3C5JA 5IESH 1ZWIA 5KZCD 1UZ8A 1OAQH 4PV9A 1SJVA 3QIWC 4PJGF 3HC0B 5IMMB 5E5RB 2XOTA 4OAWA 5I8KH 3T0ED 4QRTA 1RZIA 1M1SA 1UKSA 4MHHG 5D71H 4P46B 4XNZC 4YHZH 5DC0A 3RGVB 2V17H 1RZ7H 4ZD3H 4JVPA 1B2WH 1FC1A 4WENB 5D1ZB 1FP5A 3TH2T 4MAYC 5IFJA 4X98B 3B9DA 4L29A 2H9GA 3Q48A 1NC2A 1ED3A 1JWUB 2FX9L 4JFYA 2EYTB 3RWEA 5IEHA 3BIBX 3HG1A 2DRUA 4PJEA 1LK2B 2NY7L 4XHQA 3D1MC 3PP3K 4JY5L 2VDPH 1AGCA 1KCSL 2MPAH 2Y4SA 4DZBA 2X89A 3EOBA 5F89A 3T8XA 4MX7A 2P7TB 3PWUA 3JV6B 2WWMD 2AQ2A 4GBXC 1J11A 1KNOB 4Q9BA 2AXFA 3N0PB 4ZS6C 1S7RA 1E4KA 4E9LA 2IAMC 2K3TA 1AD0A 4M6MH 3S3PA 5IW6A 3CVHL 3FAXA 3O2DL 2AXJA 2VLRB 4QYOA 3TT3L 2AJYH 3KPPB 4HK3J 4MA3A 5DD3H 2H26B 3UTPD 5T33H 4JO4L 4X6DF 3ZDYF 3BYYA 2D2OA 2PTTA 1TTFA 4D9RD 2CRZA 4ETYA 4WFGE 1R0AL 1ZE3C 4PP2B 3QIWD 3DIFB 1M05A 1ZGLA 4L4TD 1C5BH 4D0CB 2XRAL 2A0LC 1XZ0B 4FZEH 3EZJB 5CIPA 3QUXA 2IMNA 4MJ5B 1EFXA 1QO3B 3PWPD 3CZJA 2AK4D 4MAYD 5IW1A 2MMXA 3PDOA 4PUBH 2B39A 3GSNA 3EFDL 3BP7A 4ZTOL 1MI5A 4FFZL 5T3ZE 4Y4HA 2ED7A 3PGDB 1QNZL 5JDJA 1I4FA 4PG2A 1YJDL 1RHHA 4Y2DC 2H2PC 2W9EH 4G8GE 2OJZL 3GMMA 2CQVA 4LK4A 3HI1B 1TZGL 5T1LB 3N1GC 4NM8H 4DK6A 4XNYH 1NCNA 1HDMB 3MPCA 3MNVA 4GBXD 4WFHD 4F9PA 2IAND 4BQCA 1K6QH 1KXTB 3NH7H 1JHLL 3U9PL 4ZS6D 4R8WL 4D9QE 3I75A 2R0KH 2IAMD 3ABZA 4OIIH 4L8SC 4OD1L 5IMOB 1JPTH 5J1AB 4LASL 2HKFH 4YNYA 5C9JB 4HH8A 4JG1L 4K55A 2A2QT 1CT8B 5EZOH 4HEPG 2PUQT 4RIRA 3QNYB 2I60H 1U3HB 2XWBA 1L0QA 4NYLB 5E9DE 2YD3A 2CH8A 2DQGH 43CAA 1K85A 3VXPA 1MEXL 1ZVHA 5KTEH 4N0UA 2W59A 3LKPB 3SKJH 1D9KA 5EO1A 5IVZA 2V5TA 2P5WA 4MDJA 2A0LD 2FWOA 4R7NB 1I9IL 5I73C 2APXA 3BZEA 2MOVA 3LEYH 4XMKH 1Q8MA 4Y89A 3VJ6A 4Y5VA 2OTUA 2PYEB 1BMGA 1V7MH 4J6RH 3ROOB 3AMKA 2XN9E 7FABH 3GMPA 5HI4C 4JFXB 5EIQA 3UJIL 5J7CC 1JRHL 5FCUH 3B6SB 1CQYA 1T0PB 5I9QB 3EO1B 4M4PA 1W0VA 1CXEA 4GMTL 5J13C 4F2MA 2J2ZA 2FBOJ 4LU5L 3GBNL 1OD7A 4Y2DD 2H2PD 1YYML 2C1OA 4YLQT 5JNYB 3NFNB 1KB5L 5FKPB 3VGFA 3IGAB 1NUNB 3RNQB 1W72B 4JEGB 4HS8L 4NO0B 4OZGE 4MNQA 4U3CA 1WZMA 4RWYL 4OZHB 4CNIA 1HHJA 4TVPH 1J88A 5DMKB 1IAOB 2X42A 5EBGA 4HJJL 3IDIB 3V52H 1S7UA 5DHYB 5FUCC 3X13A 4TSBH 2A1WH 3RWFB 1ACYH 5MERB 3TT1H 1C12A 1J0ZA 4P0DA 1TXKA 3E6HB 3RDTB 4EN3C 1JGUL 4KZEL 5BS0A 5CFHA 1OAYL 4QRQA 1NCWH 1NCCH 3MROA 3CSYB 5I8OL 2PTUA 5HYJB 1RJZA 3LQZA 5IWLC 3MCLH 4OZFB 3KPRD 3OKLB 2DJ4A 2BHYA 4LSQL 3MZTA 4HWEH 4PJCA 3KPNB 2N7AA 5ESQB 5C0CE 3QEQE 3VXQB 4HT1H 3JTTB 2Z93B 5AG9A 4NJAH 1ND0B 2GY7B 4XBGA 1TITA 1EHLL 1D5IH 1C16B 2JB5L 5HI4D 1A6ZA 1VGKA 3NZ8B 3MLYH 4JFEE 2G60H 4YJZL 3ARFB 1GOHA 2JTDA 4LMQE 3VRLF 1NCBH 4D8PB 1HILA 1BEYH 1JZ2A 4PJIE 1LO3L 3QXDB 3ULUE 2WUCL 5B38B 4NNYB 1IM9A 3CFDB 4NM4H 4RAUB 5L2KB 5I1KL 1UH3A 2VR4A 3TNNA 4U1JB 1EFQA 2H6PA 1L9NA 4G42B 4Z7OE 5IEKA 3HLAB 5GGVL 2BHUA 4OD2A 4EDWH 2CIIA 1IILE 3ZLQC 4ELME 1NFIA 2H32H 3HZKA 4HZAA 4KK6C 2DLFH 4NQEA 4BH8A 2UVFA 4KI5C 4EN3D 3HB3C 3EO9H 3MXVL 4ZFZA 4ZQKA 5KSAC 5L7XL 2WWKO 4M7JL 5K9OA 3L6FB 5CUSH 1KLUA 3GMOB 4OI7A 3K80A 1FJ1B 3C6SB 3C9NB 4P2YA 3GJFB 5IHZA 3I6GA 1JV5A 1M7DB 2NY5C 4NDMA 2OMNA 2DQEL 4WWKC 1RZ8B 1BJ8A 3EGSA 3ESUF 4LLQA 3WHXA 3VWJC 1WVZA 4HS6A 1JBJA 3LEXA 1QKZH 1UJ3A 4LMQI 1VB9A 4WW2B 3DX6B 3D39A 1RZGB 3O3EA 4OUUA 1U2HA 3B2VH 3MRGB 1MQKH 4XCCL 4UOW0 5L0QB 3QEUB 4K71B 5B39B 2DQTH 3D25A 5C0GB 2FECL 1CS6A 5DJ8B 2ICWA 1UACL 2B8OT 3PWPE 5ELIA 3D18A 5C07D 1F6FB 2VL4A 2BDNH 4KHTL 3AB0C 4NBXB 5BW7C 4BH7A 3THMH 3G6JE 3MRJB 4JHWH 3QG6A 2XZQH 4GG6E 3D9AL 4JN1H 1JPGB 4GKSA 1KN2H 3GI8H 4HS3A 1ZHKA 4FN0A 4Q58C 1OY3B 4FQIH 1I3GH 2VXQL 3TLRA 1R24B 2D9QB 4JY4A 3OKOB 1Y18A 1BZQK 3BDYL 1N3NB 4X6CF 4PRHB 4KK6D 1IEBA 4P4KC 3CC5A 4OZ4B 1HXMA 1EXUB 1F6LL 4P48A 3Q3GA 4KI5D 3HB3D 4S2SB 1LMKA 4DCQA 2VXSL 4F57L 1U8PB 1RFDH 5KSAD 2VXUH 4PY8J 3MLVH 3P9WB 3ZMRA 1URLA 3CAFA 4D0BA 4YXHL 1GAFL 4F7MA 5IFHH 4J3SA 5ERWB 1LEIA 1SEQL 4WWKD 4NC2B 3G6AA 4P5MB 4PJFA 4XPAH 5CAYB 3LV3A 3VWJD 1LP9E 4M1DL 4ZUUA 2NQCA 4MSWA 3UCRA 5A2FA 4LAJH 2FX7H 1FLRL 4GAFB 1H8SA 3ZE1F 4YHML 4APQB 5GGRA 4ZDHA 5J56B 4WGWB 2AKRB 2CLVA 5AUMB 1FN4A 1R3JB 1V5JA 4Z7VB 3E8UL 3KXFB 3MBXH 3HUJF 4PJ9A 3FQNA 4EEEA 5EU3A 5AYUL 2GJ6D 3DMMB 4JM4L 4QCIA 4ZG1A 3CD4A 4JHBA 4GMSH 1U8JA 5H37G 3ZYIA 1LD9B 4C59B 3QXWA 4DGIH 2OLDA 3U6RA 5C70A 5CSZA 1T5XA 5JORA 2B7DT 3RZCC 4P4KD 5H37H 4AEHH 4RFOH 1AC6A 2FGWH 4K3JH 2Q20A 4P4RB 3UTZA 4PPTA 1T5WA 4XX1E 3UJJL 1NGQL 4M48L 1ZVYA 1ONQA 3FONA 4EXPX 4OM0L 3U46A 1J05B 4HKJA 3N1PC 1DL7H 1OGTB 1AJ7H 1VPOL 3UTSB 3QULA 1DE4B 3HZMA 1GOGA 1DVFC 1TZIA 5ABDE 3GMLB 1RK1A 1T0MA 3U0PB 2X4NA 4YK4C 2I24N 4QRPA 4UT6H 1FVCB 3TO2A 5KSBE 3QNXA 1RUPH 5AD0B 1AGBB 3SCMB 3ZHDA 5KVGL 5L8JB 3BZFA 2B5IC 4Z95H 3H7BB 1T04B 1EJOH 1FNSL 3J8F7 4NN5B 3V5KB 3LS5H 4ALAH 3OV6A 1J86A 4OCWL 5CLTA 2D4DA 3GIVA 3I50H 4HIJB 4XPBL 3G5VA 4PJ8B 4TRPL 1NLDL 3FO1B 1OSPH 2A74B 3KPSB 3ORJA 5DLMH 4RGNE 1YEFH 2OI9B 4NQDB 4AQOA 2QQQA 1XIWA 4NZRH 1KPRB 2O5XH 4Y16B 3E6FB 5DHVH 2OQJB 3O4LB 2GY5A 5FYKD 3S4SA 3PJSA 3ARBA 4RMSA 4NRXB 5HVHB 3RZCD 3L3OB 4UT7L 3QDGB 5KVFH 4DGVL 5C3LD 1YDPA 4LHUB 5DQJB 2BCKA 1FZOB 2KPNA 1F4WL 3TC9A 4ZPVA 3V4VL 3RUGA 5L8LB 3C5ZC 5GRUL 1A6UL 3MLTB 1CQKA 2Z31B 1DQLL 3QIBB 3SE9H 4I18B 2UZIL 1U8QB 2CDEB 1KTLB 2RB8A 3ARDB 5I1DA 1AE6L 1Z9MA 2AXGA 4KKAC 4J3VA 1F4AA 1DVFD 5IV2B 4WU5A 1VEOA 3OGCB 2VO5A 2VN4A 4OQTA 4NQCA 3U1SL 4DKFL 1QSFB 4PP1C 4NN6B 2VITA 3F6LA 5F8QC 1P6FA 4IRZL 4GRMA 5C7XL 5GGQL 2UVEA 2CDFB 4MMXC 3EBAA 3AM8C 1AFVL 4CJ0A 4M43H 4FTVA 5DMIL 3MRBB 4O4YH 3FT3A 5D1XC 3OKDA 4MHHI 1G7QA 3OB8A 1Z6JT 2HRPH 4WU7B 1C1EL 3DBXB 3IVKB 3SJVA 3LKQB 4TPRL 5KJRH 3W2DH 3PF2A 4DVBA 5BRZE 5CZXC 3S37H 4POYA 1T2JA 4U6VL 2VKWA 4HK0A 3MV9A 4U2YA 5GGTL 3IDGB 2BJML 2X44D 2Z9TA 4KVCH 1SYVB 5IM7B 4JRXE 5FDWB 5SV3A 3CLEH 4GG8B 4Z0BL 5IB2B 2BNQB 1XGPA 3FB6A 3GRWA 3LVEA 3C5ZD 3G5XB 4KI5E 3LN4B 2VZSA 4CRPA 4Y5XB 3MLRL 1I8IB 2A6IA 4KKAD 4IRSC 1GIGL 1JTPA 1XF3A 2PXYC 1L4IA 3WDHA 2W0FA 3G6DH 3QFJB 1C08B 4QHNB 4PJDF 1NAMA 4GKNA 4YZFF 2EICA 1YY8A 4HUKB 4NP4H 5K33A 5KVDL 4QF1A 4PP1D 1JUFB 5B22A 3LQAC 1MFCL 4IIQC 5DJ0A 3UZEA 1J0IA 3MCKA 1QR1A 1WWWX 4Z7WB 3RL2B 1F8TL 2HN7B 3V5HA 4OF6A 1FNAA 4V1DD 4D0DB 3T0AA 3IDXH 4K7FA 2ZUQC 5D1XD 3DURA 4P2QA 4CN4A 1JYVA 1CZ8L 4U0QB 5IMLA 4KTEH 1T1XB 1RMFH 1S7TA 3VG9C 5CZXD 1XCQA 4KUCD 4LFHD 1IEHA 2WMPA 2XQYK 4NNXA 3QI9B 1J1XL 4NO5A 1QHOA 3LPFA 2W0PA 1MQ8A 3ZKNC 3ALPA 3BJ91 3S97C 1K2DA 3O6LH 4IJ3C 1OOAA 4LLWA 3ZL4H 1OW0A 4QRUA 1RZKL 3D2UD 5GRVL 1DBAH 1T03H 3CFEA 3D3VA 3TJHC 2EYRB 1N59A 3NABH 4OFIA 5KS9B 3HC4L 2FR4A 4LPTA 1XF1A 3MRPA 2BY3A 4JO1L 3P4OB 5IT2L 4L8BB 4TVPE 4M7LL 3QHZH 2AV1A 1A7PH 5EIIB 3O2VL 5DD0L 4JFFA 4QKXB 5ISZA 4IRSD 4WHDA 1CE6B 2DTMH 2OXGA 2PXYD 2AV7A 4IOIB 4PJAE 3UXFA 3DSFH 4H5SB 1XF2B 1T89A 3CFKB 4KV5E 1HYSC 4S1QH 1NMCC 2E6QA 4U1IA 4ZTPL 4Y1AA 4KRPC 3BH8A 4QOKA 1YPZB 3QCTL 4LHUG 4XCNB 3SO3C 4QXTA 3OKNA 3WSQL 1X5YA 1EO5A 4M6NH 3T04D 2YUXA 2B2XH 2ATKA 4NKMB 1HNGA 1NFDF 1QACA 1MLCA 4LLUB 4P5TB 3WN5B 3DTXA 3KS0H 2WQRA 2XA3A 4MJ4A 2JE8A 4FA8A 4ZUSA 2C5DC 3DGGA 3VI4F 5J6HB 4HSQA 4PGCB 5I66B 3G5ZB 4DVRL 3EKCA 1GYAA 4U6XA 1T6VN 2ZJSL 3ZKND 3L3JA 3T77B 4A6YH 5D2NB 5EOCH 3JVGC 3W82A 3TJHD 3KYNB 1MCSA 2SEBA 1MCPH 4N90E 2P8MA 5J8OA 4EOWH 4HX1B 2I9LB 4LPXA 2FX9H 4JJ5B 3TBTB 5HGGS 4G8FB 2R23A 1H5BC 4UQ2B 3WIFA 2CR6A 3O4OB 4QGTA 2GK0A 4NKIL 2OL3B 2NY7H 4Y4FB 3RVXC 2R8SL 5HDLA 4PGDB 5FHBL 2DQCL 3AREA 4MB4A 4F15C 3QXAA 5MEQA 5K9JL 3I9GL 2UWEE 5FGCE 4E42A 5I2IB 5D9SB 2R1XB 1UM6L 1HYSD 3T4YB 2B1HL 2O5ZH 2OCFD 1JE6A 2ZNWA 4XB8A 4PIRF 4HKXA 3HRZB 1KCKA 2R15A 2VUYA 3H9HA 3BP4B 5F1NA 3CVHH 5ID1B 2F53B 3O2DH 4KRPD 2V7NB 4ZAKC 2ORBH 2IGFL 1U41A 5C1MB 1DDHB 2VDKL 3HZYA 1QEWA 4U1SA 5TDNA 4JO4H 3P40A 3OR6A 1GL4B 5GRVK 1SBBA 4OGZA 1R0AH 1KLGA 3NACH 4BA8A 2HWZH 5E08H 1C5DA 2X4OA 3RWHB 1U6AH 4DFIA 2BXYA 5BJTB 3RY6C 2LVCA 3ARGC 3JV0A 2QQNH 2YEZB 3H7LA 3D87B 3IFPA 2BSSA 2JCCB 3OJMB 2E9WA 1CFTB 2VWEC 3F7YB 3QPXH 5F9DC 2OZ4L 4Y4KB 2NNAB 3EFDH 4ZTOH 1MHCA 4FFZH 4HXAL 1S5IL 3RPIA 2UYLB 4OM1H 3V0VA 5I15L 2IPKA 1QNZH 3RVXD 4S1RH 2YPLE 1X5LA 5E6IA 3U9UA 1T20A 5MHSE 3BRDA 1YEIH 2EO9A 3VFPB 2Q3ZA 1TNNA 2XKNA 4AEIH 3HR6A 4CN6A 3O81A 5BZDA 3OG6B 2VTFA 3HE6B 2GSGA 5EBLA 3RNKB 4Z18A 2NW2A 1YNLH 4OD1H 5I6XC 3N9GL 4OFYD 1G0YR 1CD8A 2OR7A 4O58L 4UTAL 5IBUB 4WEBL 4QTHA 3BISA 4E41D 4MD5B 3G04A 3JBG7 4WI4A 4L4VD 1YN7B 1EEUA 1RIVH 1IAKB 4HUUB 4ODBD 4G8GA 2V7HB 4NQVA 4JM2F 4F8TA 1XGYH 2C7UA 4C56D 4OV5A 5EORL 3PL6A 3QH3A 5CLWA 3FN3A 1I9JL 4YO0A 4M5ZL 5F96H 1A7RH 1NGYB 3VXSD 1HKLH 3N1FC 1BD2D 1QA9B 3ARGD 1O7VA 1SVCP 5I74C 5EN2A 1XGUB 5HHPB 1YMME 3L95A 2IQ9L 4Z8FL 2GTZA 1A9EB 3TESA 2JB6A 3DXAD 3ZO0A 3VRIB 4R2GC 3QXTA 3NGBC 1FZKA 3UJIH 2J7LA 3QQ4A 4X5XA 5E9DA 3QO0A 3QFDA 3AUVA 4PJBB 1KPVB 2DQUL 1KIRA 5IROC 1S7QA 4L5FL 4LU5H 3N85L 3WBDA 3BYTA 1J5OL 3P77B 1KFAH 1Q9OA 3ZT5A 2AVGA 3ZDYE 4YEEA 5LQBL 2FHBA 4P2RD 2R0WL 5EU4B 4RWYH 1ETZA 3DVGB 4KGJA 4HJJH 3FB7B 4M6OL 1MFBL 5TH2A 3Q6GL 4PJ7F 2XN9A 4ZUTA 2BOBA 4HWZA 1P7QB 4LEXL 3FQWB 1SY6A 1TJHH 4FXKB 5F1IB 2LU4A 1YC8A 3ZKXB 1JWSB 4KZEH 5JHDE 1DUYA 1OAYH 4FQXA 1P4LB 5EBWA 4WUKL 1MJUH 5GSVA 2DM3A 1A22B 3DUUA 1IGJA 4OZGA 5EG6C 1AGFB 1T83A 1PBYA 5JOPE 2OL3H 2Y7QB 5GRZA 1PAMA 4Y8AA 4YUEL 3QUYB 1A0QL 3HR5A 4G9FD 4AY0A 1MCIA 1MCNA 5EO0A 2ZOLA 5EC1A 3VXRB 1ZKAA 2DICA 5AAWA 3GJFK 1L6XA 5D7LB 4P23A 1TQBB 3R8QA 2IALB 3IJHA 4R2GD 2O5YL 4UIKH 1M7XA 1QFUL 3U36B 1GZQA 3HRPA 4CUCA 5ENWB 3GBLA 1CGSH 4FRWA 1AO7B 3OTTA 1T3FA 4M1CC 1CD9B 3VXNB 5EBMB 2EKSA 2WUCH 3E3QC 4RMTA 4YBLC 4YEFA 3QUZB 3NPSC 4P3DB 1NGXB 1WZ1L 5I1KH 2MQ3A 1PG7L 4OF0A 4HHAB 3O3BA 2MCPL 5C0CA 3QEQA 5DD5H 3FOMA 5C0EA 2DQIL 3QZWG 2X6MA 5F7FA 5F7YC 4OIBA 1YJDC 2X1WL 4JFDB 1HZHL 3QDJD 4I9WE 1HI6A 4G43B 4JFEA 1MLBA 4WFED 4XMPL 4I3SL 1OTSC 4CMMB 5FA4A 3QUMA 4MD4A 4KHXH 4PJIA 3EZ8A 1XH3B 2COQA 3QA3B 4G7VH 3W81A 5BVPH 3OJDA 4NC1C 4PG9B 3A6OA 1KENL 4LAQL 3LZFH 3TIEB 2Q8BL 1FORH 4RA0C 2Z92B 3BPOC 2MHAA 1WISA 3MODH 2QKIB 1JHTA 5J6GA 5ADPL 1G7JA 2BVPA 2DQEH 3QDAA 1IEAA 3B83A 3V4UL 2X4SB 4GKZB 4ELMA 3HNTL 2CSPA 2X7LA 3FFCD 2R2HB 2ATPA 1WIUA 1VERA 1AR1C 1LQSR 3MV8B 4XCCH 5DUBB 1ZA6B 3BZDA 3BJLA 4NC0B 1TJGH 3Q1SL 4BM7A 5JR1L 5DF0A 1UACH 4G3YL 1IGYB 4M1CD 4NO3A 4X99A 5GSRA 1A9BA 3L3KA 4MCZB 1JF1B 4AK1A 2DMKA 2KBGA 1CXIA 5C0RL 5GISL 2YXFA 2YMXL 1TLKA 5F6HJ 3UTTD 3TN0C 1YUHB 3S5LB 3HI5L 4L8DA 1ORQB 1VKXA 4BFIB 3R06B 3PGCB 1MWAB 4LCYB 2VXQH 1DSFL 1MCCA 1U95B 3M45A 3PABB 1NL0L 1UGNA 1ZHBB 2FJFB 2XIDA 1OTSD 4LQ1A 3RWIA 1IBGH 4G8IB 1UWGL 2BSED 3EJYC 3PWPA 4Z7NF 3RAJL 4HKBB 1OF2B 1QFHA 1K4DB 5C0IB 4OZHF 1FFNA 4M5YL 3G08A 4KMLB 3G6JA 2LV4A 4LCIL 2I07A 1FC2D 4Z7VE 4GG6A 1AQDA 4CBPA 2PW2A 2EH8H 3TIDA 5GJSL 2VZ3A 2E9BA 3QCUL 1E6JL 1GAFH 5L9DH 3GKWL 3W39B 1LO4H 5HHOB 1SEQH 1R5WB 3N1QC 2NW3A 2Z91B 5D7IF 1AR1D 4G7YH 1KTKE 4BYHA 1MSPA 2PW1A 2R4SL 3BHBA 3NPZB 2VLJB 3EAKA 5L88L 4PJ5B 4GLRH 4KROC 2FJHB 5F9OL 3BUYA 3B9KC 5FAAA 1MFEL 5I8EB 1BZ9B 2EECA 3KNBB 4YHOL 5CBEB 2HJKB 1ADQA 3EJZC 4GSDL 5E24E 5DUML 2H3NA 1NCAL 1B6DA 2DTSA 1FNEB 1AR2A 3TN0D 4NHCL 5AYUH 1AY1L 2NY0C 4JM4H 3X12B 1UADC 3VU2A 5BO1L 4UV4L 1LP9A 2HTLC 3UTSE 2QQKH 4XNXL 2BVQB 1UXSB 2Q8AL 3K46A 4UNVA 2IQAB 5LGHL 1WCQA 2JELL 1BBDL 1KV3A 3A0OA 3QUKB 3JUYA 4WTZA 4ZUWA 1I7TA 5DUPH 3EJYD 4X4YA 5F71A 2ITCA 3B5HA 3BZ4A 4XNMB 4Z0XB 5DT1H 4JG0L 2FL5B 4GW1B 1YQ2A 4LLVB 1KTDB 3ZHLA 1UEMA 3NCEB 3EYQD 5IB5A 3V5DA 4M48H 3WXVL 4Z6AT 1CK0L 4OM0H 3GIZL 3HE7A 5J1SC 1AC0A 4DUWA 2ZP0T 5CS7A 4F9LA 3BEVA 2ZCHL 4B7LA 3REWA 2NY6C 1CI5A 1DLFH 2ED8A 3GSXB 4YHNA 4KROD 5I30L 5JZ7C 3QRFM 1N7MH 3B9KD 2VL5B 1WBZA 4NCDA 3U0WL 4LLYB 3QISA 5KVGH 1H0DB 3BVNA 3MOAH 4X6CE 4YPGA 5A2LH 2G2RB 3GFUA 3EJZD 4MA1B 1FNSH 3P73B 4MXWH 4IMKC 3EHBC 3RL1A 1SEBA 4XBEL 3TWCL 4OCWH 3HNVL 1D5ZB 2NY0D 2WV3A 2NY2C 3V95A 5HY9B 4TRPH 1FFOB 1X5AA 5C0BD 1LO0H 3MLZH 1NAKL 3WFBH 5IQ7L 2G75B 3N50A 2HTLD 2IG2H 1L7TH 2CJUH 4N9GA 3M8OH 4XGZB 1E4WH 4XP6L 3V6OE 2QJDA 3W5MA 4NQTA 5IBTL 3PV6B 4CAGA 2E7HA 5D1QC 3MRHA 4NUGL 1M71B 4XI5C 3KJ6H 1ZLSH 4M03A 5KSBA 3TP4A 4UT7H 2Q7YA 3GSOA 2RFXA 4ODXB 3WV0A 3F7RA 3O0RH 3QEHA 1S8DB 4WO4B 2A77L 1GRWA 1A6AA 4DGVH 2HP4A 3TA3B 3MA9L 4X7DC 2YD1A 5E8DH 2XQYG 4Q6IB 3MV11 1KPUA 5GRUH 2DQFA 3SDCC 3C6LA 4FQHA 3C5JB 4PGEA 3WLBA 5E00A 1ZWIB 3U4BH 1NCUA 5FGBC 1UZ8B 5LGKA 1MVUA 1DBKH 5ESAA 4PV9B 4UNTA 2NX5B 1LILA 4QHMA 1RPQA 4OAWB 4POZC 4F33B 4QXWA 1AE6H 4CMHB 4QRTB 1RZIB 4P99A 2NY6D 1FL3B 3NN8A 3GDBA 3ZHKA 3RTQA 5JZ7D 3K4ZA 2GK2A 5IFJB 4FP8L 1LNUB 3U1SH 3BESR 4L29B 1NC2B 4JDTH 4N0FA 2EC9U 4LVOB 4YHPA 4IRZH 5C7XH 2VB5A 5GGQH 1ED3B 2EIBA 3HC3H 2P5ED 4JFYB 5IEHB 4MGXA 2DKUA 3HG1B 1JN6A 2EIZA 2ICEA 3EHBD 4PJEB 5D7KE 5DMIH 5INDA 1AGCB 4DZBB 4NJ9H 2NY2D 5F89B 3T8XB 1K8IA 4MX7B 3PWUB 1XF4B 1I85C 3RKDC 3VFNB 3QFJE 2IBZX 4TPRH 3IFLH 2DI8A 4OLVL 4U1MA 5D1QD 1GGCH 1S7RB 1CCZA 5H94A 4EVNA 4XI5D 2FZ3A 4AG4L 1KCRH 2DYPD 1AD0B 4JFPA 3OKKA 12E8L 3I85A 4K7PL 2A9MH 1GPOH 3I2CH 2E3VA 2AK1L 4QYOB 3NFSL 4HC1L 4GS7B 1CDBA 1I9RH 1X5XA 1SJHA 4BK5A 2F5AH 1UM4L 2IH1A 3SDCD 4X4XA 4XWGL 5EZJA 2PTTB 1Q0YL 5IJKA 3BO8A 3C60A 3MUJA 2OMBA 3ILQC 4LDLB 4MB3A 4RISL 4XCYA 3VI3F 4Y19B 4TUKH 4AEEA 1JGEA 5C0AD 4POZD 5JA8B 5BRZA 1KN4L 3GO1L 1M05B 1ZGLB 1G6VK 1GIGH 1RU9L 3WO3B 1O5DT 3NVQA 5HDQH 2A73A 4ONOA 4DTGH 2QR0A 5CIPB 4JRXA 3B9VA 3QDMD 3ZTNL 5KG9A 1JJUA 4KMQA 5IW1B 5KVDH 1YNKL 1T2QH 4C57C 1T1WA 1OGAD 3MGAA 1JZ6A 1GGTA 3D0LA 3GSNB 5DA0B 3BP7B 1MI5B 1IKNA 4Y4HB 1F8TH 5T3XL 2NLJA 1I4FB 3VA6A 1OPGL 1E4JA 1NC4D 1RHHB 4NQXA 3GMMB 3SKOA 4WUUD 3IFOA 1BGXH 4L3EA 2VDNL 1ZT7A 2Y5EA 3RKDD 5KSVA 4LL9A 3MNVB 4FNLL 2XYCA 4RRPA 4X9HA 3SE3C 4QHKJ 4TUOA 3CXDH 3B8SA 3KJ4C 4KPHL 3I75B 2IBGA 2ZSWA 3SDDC 1GH7A 5ACZA 4WW1B 2V2WA 2ITDA 2GFBA 1ZMYA 5FYLD 4FQLH 1MUJB 5IFAL 2DM7A 1RZKH 1Q94A 2GJZA 1H3WM 3LB6C 2F8XC 1V7NL 3C5SA 4P9HC 1OVZA 2PO6A 2FHCA 4RIRB 3LOWA 4FQQA 4N0YH 1MRDL 2XWBB 4JM2C 5T5FL 3BMVA 1BAFH 1K5NA 4XZUA 5GS1A 3IDNA 3ILQD 4IEFB 3QQ9C 2OK0L 1V05A 5E8PA 3VXPB 3BQUC 5DD0H 1D9KB 5EO1B 5IVZB 1I1RA 4IS6A 4NUJA 2P5WB 4HUWA 4JZOA 4MDJB 2FWOB 1U3YA 3HAEA 2J8UE 4NQSB 3FMGL 4PRPD 2Z8VC 4H20H 2D0FA 1BBJB 5D2NE 3BPNC 4XMLL 3VJ6B 1SM3L 4ZTPH 4Y5VB 2OTUB 2EE2A 4LNVA 3T2QA 3GMPB 5HJ3A 1DJSA 4N9OB 3PHQA 3CIQA 1W0VB 3UPRA 3S8WA 4F2MB 3VRJA 4P46C 1KJ2B 3RGVC 2FB4H 1BX2B 1IGTB 2C1OB 3EYUH 3LKOA 4YDVA 4BFBD 3GSRA 4PJAA 2PCPA 4PD4J 1QLEL 4MNQB 1RZJL 1HHJB 5D1ZA 2QSQA 3SDDD 3WDJA 4JHAL 1S7UB 2CD0A 1BOYA 2XNAB 2F53E 4NGHL 5SWZE 3X13B 4UTBL 4F37K 2LVEA 3L1OL 3LB6D 4HWBH 2CUMA 4R97B 1C12B 1LEGA 3FZUC 3O8XA 1DANT 5EZIH 5SWSD 4PBVC 4JM2D 5BS0B 4QRQB 3QQ9D 4NKIH 2R8SH 2AQ1A 5FHBH 2DQCH 4R4NC 1RJZB 1P7KA 4KQ4L 3LQZB 3Q5TA 5A16A 3BQUD 5K9JH 5DQDL 4YDKL 1EEYA 4PJCB 5J89A 4OF3A 4G6KL 5DVOA 2N4IA 4OGAC 2VDMH 4KUZH 1GC1C 3F6IA 4X7TA 4XBGB 1A6ZB 1VGKB 1FLTX 1UM5L 1RY7B 1RV6X 3PG2A 2VDKH 1HILB 4K9EL 4TULL 4PP2A 1YNTA 4P46D 1AI1L 3FT4B 3RGVD 3UX9B 4GT7A 4JQIL 5BV7B 4Z7UE 2X1QA 3WFCL 2UWEA 1IM9B 5IVOA 2J4WH 2H32A 4WEMB 4N8CL 3RVWC 3TNNB 3EYFA 4MJ5A 3PUCA 2H6PB 1EO8L 3MLXH 5DURB 4LQFL 4KK8C 5IEKB 4OD2B 4XXCC 2IBZY 2QSCL 3HI6L 3MRCB 2WBJC 1NFIB 3EYOA 3UYRH 5IQ9A 4XAWL 4NQEB 4BH8B 2ESVE 3FZUD 3LHPL 5I18L 2OZ4H 2F9BT 3SDXF 4HXAH 2X4RA 1S5IH 4ZOEA 4ZFZB 4ZQKB 3QXVA 3HZVA 4WY7H 1KLUB 4R4ND 2HJFA 2UZYB 4Z9KB 4RAVB 5EU7E 3GGWA 2VLRD 4BUHA 5IHZB 1JV5B 4NDMB 4ZOBA 3CH8A 5KS9F 1U3HC 3EFFB 1D5MA 4LLQB 5E1AB 3WHXB 4HS6B 4OGAD 1UB5A 5JXEC 2BHZA 3LEXB 5KW9L 1UJ3B 3N9GH 3O3EB 4OUUB 4U1NA 1P9MA 3EDFA 4O58H 5TF1H 3LKSA 1OCWL 2GQHA 4NYLA 3MRRA 4OLWL 2X70A 1OP5K 2HLAB 3D25B 4CVZB 4BUGA 1GHFH 1TPXB 2ICWB 3D18B 2WNGA 4RFEB 2YPLA 3O6FA 3MNZA 1JGLH 2AJSH 2VLMD 5CILL 4BH7B 1QFOA 1OGAE 3OR7A 5FEBA 2DL2A 3QG6B 5EORH 5DGQA 2EXYC 3GBML 1I9JH 4M5ZH 4GKSB 2FECI 3BKYL 3UEZA 4MJIB 1YPZF 4PS4H 3GZKA 2PN5A 3TYFA 1J8HD 5I9QC 1FV1B 1T1YB 4I3RH 4KK8D 4JY4B 2IQ9H 1Y18B 2VC2L 2WBJD 1A3LL 1QBML 5EOTB 4JKPL 2ZG2A 1IEBB 5T1LD 3NIGE 2JJSA 4OQ1A 4KDVA 1HXMB 2EDQA 2YKLL 3Q3GB 4DCQB 2DQUH 3IGAA 4RGOH 4L5FH 4K3DL 5DI8A 1A47A 1J5OH 1B0RA 2FYYB 4LCWE 4AYFA 4D0BB 5C08B 1HHKA 1IAOA 2RHEA 4F7MB 5LQBH 1KJ2H 2R0WH 3X11A 2F54E 3I3DA 1LEIB 1YMMA 3G6AB 4OLUH 1U3HD 4PJFB 3F7PC 2ZCKL 4M6OH 3GB7A 5JXED 1U8NB 2D9CA 3V9FA 4ZUUB 5AWNH 3Q6GH 4MSWB 3H9SB 3E6HA 3RDTA 1QRNE 4LEXH 2QQLL 1VEPA 1NGPL 2PF6A 2XXMB 1AO7E 4JFOA 1RUKH 1OAKL 1WT5A 1XAUA 5GGRB 4ZDHB 3VFSA 2BVEA 5IR1B 3MUY1 4JRYD 2CLVB 5ITFA 4JQVA 1RAMA 1FN4B 3WS6C 3GUTB 3SDYL 1CE1H 2XKSA 3KPNA 2ERJB 4JQXA 4OV6F 2PYED 2EXYD 4PJ9B 3FQNB 4RAHA 5J9PA 5EU3B 2W92A 4KZDH 3JTTA 4QCIB 3ARFC 3T09A 1U8JB 1A0QH 5D2LE 4HDIA 3T2NL 5JLZB 4LGRB 4JFDE 3U6RB 5I19L 1WC7A 4U31A 4XVSL 4DFHA 3NZ8A 5CSZB 1T5XB 5EZLB 1CU4L 5JORB 2B4CL 4D8PA 3CX2A 1QFUH 4LHQB 2BVTA 3TEUA 4OCLC 4NO0D 5JHDA 4Q6YA 5B38A 1T5WB 4F37F 2V5SA 1W0WB 4HXBH 5L2KA 2WAHA 4WI9A 3MUZ1 1RUQH 5F3BB 3DO7A 1NBVH 3SHSA 1ONQB 3FONB 1WZ1H 3U46B 4G6JL 1VFAA 3HLAA 5HVFB 4OLZL 5BV7H 3SDAC 3RVVC 5BMFL 1AQKL 5C2UB 3BSZL 3BGAA 3FCTA 3SE8H 3HZMB 1TZIB 2FSEB 3CFCL 1HZHH 1RK1B 1T0MB 2C4XA 2BNRE 2X4NB 2CKBB 4CKVX 5HYJD 4I0KA 4I3SH 5GS2D 2J3SA 3RJQB 1SYSA 1DQDL 3TO2B 2XI9A 4XPHL 1KG0A 3QNXB 4V2CB 4Y5YA 1X9QA 1UVQB 5TE6H 5CJXC 3BZFB 1A4JB 1FJ1A 3BPCB 3C6SA 5K59E 4LAQH 1QTYT 1I75A 5DHVA 2Q8BH 2BSTB 3GIVB 5C0JB 4K71C 3G5VB 4LF3A 3ARFD 4WW2A 2YXMA 1OP3K 5CBAA 3MRGA 5E7BA 1BQHG 1KEMH 3ME0A 4I1NB 1WK0A 1A3RL 2FLRT 3S4SB 3PJSB 3X17A 4DAGL 1GGYA 5B3JF 5MP6L 1R3HA 1KIPA 2DI9A 4PJ7E 3BP6A 1MFDL 1S7XA 1YDPB 2G5RA 2BCKB 4NWTL 4R6UA 4ZPVB 3RUGB 5EU5A 4ZOCA 4OF7A 1MIML 3QWQB 2Y23A 2EDJA 2GJJA 4KGLA 5C0RH 1FPTL 5CSBA 3AS0A 4GO6B 1OAUL 1JL8A 2B0SL 3VMPA 4HUVA 1FQ9C 3HI5H 4LSPL 3SDAD 3RVVD 2WM0A 5I1DB 4HFUL 2AXGB 4J4PA 3TV3L 1IGIL 5GPRA 3W0WB 4PJBF 1XFPA 5JMOC 4WU5B 1UWEL 4ZFGL 1NL0H 4S2SA 3T3ME 1MCOH 4WNQA 4WHTA 4NQCB 5KVEL 1UWGH 3RAJH 4UV7L 1FGNL 4MMZC 4I48B 3IF1B 1HXYA 4GRMB 2AXHA 3TBYA 5CSGA 1ES0B 4G5ZL 2YPKA 3HHRB 1EAJA 1TVDA 4QNPF 3QG7H 1KLFA 2UY7A 1UJTA 2UZXB 4FTVB 3VFUA 4P5MA 3QCUH 3FT3B 1ZLUK 3OKDB 1G7QB 4QT5A 3RY4A 1F97A 1OAXL 1KXQE 3F7QA 4APQC 4XP4H 4DVBB 4HK0B 3MV9B 4DUVA 1N4XH 2C4FT 4POUB 3SBWA 1QFWL 4DOHE 2VDRL 3CCHA 1NBZA 2EDDA 1INQA 2YPVL 5EOQH 1J8HE 4U6TA 1KIQA 2PKDA 5F9OH 3ZYZA 5FF6A 4F80A 1JNNL 2DF3A 3NTCL 1XGPB 3FB6B 5HHME 4Z7VA 4YHOH 1EZVX 1JTTA 1LVEA 3DMMA 4GSDH 1MHPH 5DUMH 3BT2H 4EI6B 4M9OA 4PRHD 5ANME 1HSAA 4EUPG 3V8CA 5ITBH 1AY1H 4U4BA 1JHKL 4XC1L 2CIKA 3Q6FA 4UV4H 1B0GA 2A6IB 4PR5A 1XF3B 2Q8AH 3NIFF 5DS8A 3VXUB 2DIBA 2NXYB 4EUPH 1NAMB 4GKNB 2HA1A 1YY8B 2CUHA 4WI7A 4HWNA 2XTJE 4QF1B 1IKFL 2FIKA 5DJ0B 1S9YA 1YQVL 2H45A 2OP4L 3V5HB 1J05A 3KVQA 4LDOB 3IDMB 3WXVH 3IAGC 4S1DC 1OGTA 1CK0H 3U83A 2P43B 3DURB 4P2QB 3UTSA 3GIZH 5LCVL 3MV7D 5DDHB 5IMLB 4WFFD 1FSKB 2ZCHH 2EDHA 5IHBA 1S7TB 1CGXA 4APQD 4BZ1L 1XCQB 1NH6A 1FG2A 1D6VL 4J3UA 3EYSL 4NNXB 3ZSSA 1U8IB 1INEL 5AD0A 4NN5C 4NO5B 3KXFD 2OYPA 2VDOL 3SCMA 2KZWA 1G9EA 5DGRA 1K2DB 1Q1JH 4LLWB 4QRUB 3H7BA 4PJ8C 3CFEB 3D3VB 4RBPK 1N59B 2CKBH 2OI9C 1AD9B 1JWMB 3MRPB 2QHRL 4C55A 4HIJA 2G5BA 4X9FA 2A74A 3K74B 3KPSA 2NX5E 2AV1B 5HVHC 3SKNA 2OTPA 5KSUA 5T1DL 1S9WA 4BZ2L 2X4TA 4JFFB 4Y16A 1A6TA 1CICB 4DN3L 2AV7B 2DL9A 3L3OA 4NUGH 2Z31C 2XG5A 4Q7DA 3QIBC 5KN5A 2X1PA 4LHUA 4I18C 4U1IB 4WDIA 4WGVB 4Y1AB 5DQJA 4LP4A 3AC0A 3KPQA 2A77H 2A6KB 3BH8B 3QR2A 4L1HA 4QOKB 4X6CA 4QXTB 5D7IE 3SOBL 3OKNB 3MA9H 3WNMA 3MLTA 3ARDC 2FHFA 2NY4B 2DDQL 1BQLL 4FG6C 2ATKB 1KTLA 1MLCB 3DTXB 4S1DD 5SX4H 1KJVA 4P3CH 5DK0A 1T4KA 4IRJA 4JKKA 5HHVL 4ZUSB 4A6YA 3DGGB 3L3GA 3V6OA 1FGVL 3MGTA 5ETUA 3C2SA 4NN6C 4QHUA 3OGCA 4ZXBA 4U3HA 1PX4A 2X40A 3BEWA 4KAQL 2GKIA 4RZCB 4OLEA 4U6XB 4OJFH 4HW6A 1A14H 4ISVA 3L3JB 4KMTH 4Q9QL 2AEQH 4PJ8D 1HIMH 4XH2A 2SEBB 1N5YL 2P8MB 3EO0B 5EU6E 4NQDD 4XCFH 5D7SL 1LE9A 1E0OB 4UB0H 3OAYH 3WIFB 4HQQL 3O4LD 2LFGA 2GK0B 3IDYC 3DBXA 4Y19E 3IVKA 1FNGA 1WEJL 1NCDL 3AREB 3QDGD 4LVNB 3CVHA 4RDQG 3O2DA 2A9NL 5MEQB 2X4UB 1JNLH 4E42B 5JW3L 4OLVH 5CJOL 2R0LH 5IUSA 3VWKB 1JFQL 4AG4H 2Z31D 2JKXA 4O2EA 1QR4A 3QIBD 3BKCH 3IXTA 2ARJA 3T2PA 1BFSA 5KANG 4H88L 4WCYH 4EDXB 2IBBA 4Y5XC 4ZFFB 2AK1H 2EKJA 3G5XA 3NFSH 1JCKA 4HC1H 1K9TA 3ARDD 1H3TA 4UMGA 2E27H 2AP2A 3FRPA 4FG6D 4U1SB 1OHQA 4RGMC 2W38A 2OXHA 3OR6B 4XWGH 4KDWA 1Q0YH 4HPOH 5IHUL 1OM3H 1KLGB 1F3DH 3QFJA 1C08A 1QSFD 1EAPB 2RR3A 5B8CA 1ZEAL 2X4OB 4JN2A 1RU9H 1OP9A 3WJJA 4C54A 4GRLD 1WBXA 2Q87A 8FABA 1FYTE 4EBQL 1JUFA 2BSSB 4R4FL 1YNKH 5J3HD 3KDMB 1MCEA 4D0DA 2JJTC 1YN6A 5DJ6B 4H8WC 1MHCB 3RPIB 1S3KL 3V0VB 5D7JC 1PGRB 2IPKB 1UYWL 5I1EL 3NIDF 5E6IB 1EZVY 3U9UB 2VDNH 25C8L 3EDJA 2XY1A 1IVLA 3QI9A 2Q3AA 4U1GB 2BNQD 4PRBB 3LS4L 1IZKA 3T0BA 4FNLH 4LCCA 4N5UA 2XKNB 1HINL 4LVEA 5BZDB 5E99H 5BCAA 2GSGB 2H41A 5EBLB 3B9AA 2OR9L 5MENE 3IETA 3ULVL 4F8QA 4P49A 2NY5L 4BKLB 5IFAH 5HXMA 2M26A 1V7NH 2FO1A 1AKJA 4LSTL 3EDKA 1MRDH 3DV6A 2Y07L 3KPOB 1E4XL 1DR9A 3QEGL 4G8GB 3WS3A 4NQVB 4XP5L 3MJ9L 2F5BL 2RIKA 2C7UB 4W81A 1NANH 2C9AA 4OV5B 3PL6B 3QH3B 1CD1A 4YDLB 1L7IH 1A6VH 4YO0B 3IJYA 2GW5A 3I6LE 5JXAL 1S7VA 5EN2B 4ZNCD 3L95B 2IADB 4HGMA 4XCNA 4P5TC 4W70A 3WN5C 4UQ3A 1CIDA 1SM3H 2GTZB 5E7FA 4WJ5A 2JB6B 5DJAA 3L3DA 5DJCB 1FZKB 4X5XB 4KI1A 1CGUA 3V79C 1X3DA 1G1CA 1NMAL 3QO0B 5E9DB 5DK2B 2DQJL 3QFDB 2XA8H 5JHLL 3H3KA 1KIRB 5D7JD 5DJZB 1S7QB 2EDOA 2ZPKL 1FIGL 3OXSB 4HH9A 1YZZA 5E5UB 5CCKL 3GNMH 3GJEA 3C87A 1F00I 2WSKA 3P9MA 4Q74A 3AY4C 3MLWL 4C83A 1RZJH 4FS0A 2J8UA 1ETZB 4XVTH 4PRIE 1JI1A 3T77A 4UIMA 3CGTA 3MACL 5D2NA 1DEEB 1N2RA 4NGHH 5EUOF 2XN9B 4Y4FC 4ZUTB 3CSGA 1RULH 4HWZB 1JGVL 1T7XA 3RI5K 3UO1L 1UENA 4M9PA 2V9RA 3ESVF 2QV2A 3H3PL 2OL3A 2GT9A 4PGDA 4LSSL 1DUYB 4FQXB 1DUZA 4Q2ZA 5EBWB 5GSVB 2DBLH 1SQ2N 5I2IA 2OR8A 3DUUB 1IGJB 4OZGB 1CDHA 2R1XA 5AZ2L 4KQ4H 2LAGB 3ISWA 1QRKA 1B4JL 2A6JB 1HHGA 3GMNB 4NT6A 4WV1B 1VADA 2F53A 3OAZH 5SWZA 4G6KH 2YUZA 1BPVA 4L3AA 4P5TD 3OX8A 5E2WH 5EC1B 5CEZD 5DD1L 4P23B 4UILH 4N0CC 2WUBH 1F90L 3KPMB 2PYFB 5CJQH 4LLDA 5EPMA 1GZQB 4JB9L 3QJHA 7CGTA 1SJXA 2YD7A 1WTGT 4TULH 2EDYA 5CD3A 4BZYA 1T3FB 1AI1H 1VFBA