1S78D

Insights into erbb signaling from the structure of the erbb2-pertuzumab complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRQAPGKGLEWVADVNPNSGGSIYNQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into ErbB signaling from the structure of the ErbB2-pertuzumab complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Receptor protein-tyrosine kinase erbB-2
total genus 37
structure length 222
sequence length 222
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s78D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s78D01
5E5RB 3S36H 4P5KA 5JPMB 4JY4A 1QFWH 3TV3H 4XCCH 1VERA 3ZKNC 3RKDD 3RVXD 3B2UC 3NACL 1IVLA 1R3IH 1JRHL 1ZOXA 5C09E 2Q7YA 5FYLE 1K4DB 3MV8A 2EE6A 1DBMH 3BFOA 3IXTB 3SQOL 1MWAA 2D4FA 1UM6H 4OBRA 3ARXA 4XAWL 4KZDH 2NW2A 3RHWF 1JNNL 1TZGL 4LARL 2OZ4H 3IDYC 5ITFA 1CU4H 1MFBH 4AENA 2BJMH 4ONGL 1MPAL 2GAZA 4LBEB 5AD0A 3CAFA 2PCPB 2DLFH 4HMDA 2H2PC 4LLYB 3SDDB 2BVOB 2WNGA 5A43C 3GRWL 5ESVA 1F8TH 2PO6A 1QPXA 4PRHE 2R0KL 4Y88A 3BQUC 3IRZA 1JPFB 1ZHKB 2Q8BL 3I6KB 3PXHA 3L3IA 3DHMA 5AUMB 5CZVH 3KYNA 2Q7YB 2G75B 4OLUH 2J8UE 3WJLC 3MLVH 3IS0X 1G7IA 2HJLA 1TNMA 4QOKD 3BN3B 2YD3A 4Y16D 5D1ZD 5EDXA 2XKNA 1DN0A 1RZJC 4FQIH 2XYCA 2C7UA 1U8NB 1ZKAA 1A7NH 1EVUA 3MRFA 3I50L 5DFTA 4ZUTA 3RNKB 3CNKA 5F6HJ 1XF2A 3SPVB 5M7QA 4NSKB 4RFEA 3KLDA 5HHXL 3U2SB 4U6XB 2HYMA 1FAIL 2UWEA 3WE6B 5D2NC 4UQ3A 8FABB 6FABH 1I8IA 1MFAH 5E56A 1LP9E 1HSAB 1A7QH 1NCUA 4X4MA 3RVXC 2X5PA 5CJXC 1WLHA 3V0VB 5JNYA 4QRQA 2ATPB 1IAKB 4I48A 2NY2D 4ELKA 2P5EA 4MQXC 1G7MB 5DK3A 3CUPB 2GK0B 4UV7L 5EUKA 4MHHG 1HHKA 3QUZA 1PFCA 1SYVB 5D7JB 3SPVA 4Y5XC 3QJHB 1UT9A 5FM4A 2PTUA 1OTSD 2YXFA 1LO2H 4S2SB 4ZFZB 5D7KE 1P4LA 1NC2D 1PKQB 1P84K 4DZBA 4XNXH 4Z76A 4TVSa 4GKOA 4PRAB 5C08D 1ZHNA 3LKNA 1NAMB 4IRZH 1HI6A 4LSRH 5D5MB 3X17A 5ICXB 3ZKXC 4JM4L 1VSCA 1S3KH 2QJDA 4P4KB 3N06B 2B7DT 3UAJC 1KELL 3WXWL 5JZ7C 5DC0A 5I19H 3D48R 2JB6B 1D7FA 5C0AD 2VDRL 2LAAA 1F4YL 3D85B 3MRDB 3QDJB 2F9BT 2FJFB 4HUUA 4H1LA 2WW8A 3GK8H 1Z5LB 1VKXB 4D0BB 2KZ1B 4KKLC 3TVMB 2QSTA 4NO2A 3QYCA 1MCSA 1CGYA 4MA1B 4I48B 4RX4D 4PJBB 1G9EA 3G5ZB 1MAMH 4YHYB 1X5GA 2CR6A 1I75A 4XAKE 1MCCA 3RDTC 4P2OB 1NAMA 3TPUB 3MYZA 4HLZH 1B0RA 1LEGA 3WD5L 4KROD 1QRND 2Y07L 5CGYC 2HN7B 3QDJE 1GYAA 1YECL 1UJ3A 2VDNL 2BNUA 2CUHA 4XP1H 5FYKE 3NPSB 4ZD3H 5CEZL 4Q6IB 4Z7VF 1PG7L 3EO1A 5TE4H 5ACMA 4OFVA 4PJDE 3G5VB 2UZXB 4N8VG 3L6FA 4XH2B 4XT1C 2PO6C 3C6LB 3L3DA 3MOAL 4LCWE 3BISA 2CJUH 2GY5A 4JFEE 3LMJL 3MV01 4FQLL 3AC0A 1NGQL 5DLMH 4WWKC 4DZ8B 3QISA 2EH8H 4KTDL 1NCBH 4MB5A 4LCCB 4XB8A 1RIHH 1OAYL 4XAKD 1WWWX 1XGYH 4OGAC 1DL7L 4ONOA 5I73C 3VDAA 5FGSA 2GTWA 1MHEB 3F7PC 3G04A 4HS6B 5EFIA 1MFBL 3DGGA 5C9JB 4WU5B 1CFTA 2EZ0D 1ITCA 4HPOL 5IMMA 4ZFFB 3T0EC 3RWEA 2J4WL 1MQKH 2IALB 3MODL 3L3HA 3GSOA 1XZ0B 3CFIC 2VZVA 4JY6A 3MRIA 3V7MA 1BX2A 5JPNB 5IJKC 3G6AA 4KXZI 3QAZC 1FJ1A 2C3HA 1JNHA 1IKFH 2WP3O 5DVOA 5DVKA 3WFZA 3QIUD 5INCA 1QNZH 3EO1B 1FG2A 4HIEA 3VFUA 3EYFA 2VB5A 1NBYB 3TBTB 3OKDA 3BMVA 3QEUA 5BV7L 1I8KB 1I9RH 5C3LD 2C4XA 3Q2CA 1RV6X 2Y1VA 1FFNA 3ZKMC 5IQ9A 4FMKA 4B41A 3EFFB 1AE6L 5B4MD 1HDMA 3LSOB 4MZ3A 1MHEA 3O2DH 5L8KB 1B6DA 2UVEA 5GS1C 4NQDE 1KPVB 3QIUA 2DQJH 1FNSL 3RVUC 3HZYA 1NCTA 4QYOA 2C4FU 4OZGE 3KG5A 4FQ1H 3ZYOA 5I30H 3TESA 3LIZL 1AO7D 5J12C 3DO7A 4F33B 1L7IL 3CFJB 3EAKA 4HFWA 4U31A 4DW2H 4LLUB 3WSQL 4PP2A 1TITA 5GISL 3QDMB 2XZCL 1CFNB 2GJJA 4NO5B 3HI1B 4X6CA 2QR0A 1AD0A 2ICWA 3F58L 4N1HB 3JV4B 2VL5A 3S4SB 2ZUTA 5DJ8B 4KAQL 1GGUA 3EO0B 3T4YA 3MLRL 5E4EC 4FZEH 4PJXE 5HGDB 3VFPB 2EDJA 4OUUA 4YPGA 2O93L 2Y23A 3H9SD 4PJEA 3X3GL 5EB9A 4WO4D 3QG6A 1MFAL 1VFOA 4GXUM 4RAVA 3PJSB 2QSCL 5IEKB 2DDQH 4OLYL 4S1SL 2H45A 3UROR 1DP0A 2YPLB 2HVKA 4XNUH 3PGFH 5T5NG 3UTOA 4DAGL 1SEQH 4GKSA 1NCCL 3QEQE 4YXHH 5KZCD 2ZNWA 4LHJB 4EOWL 2YC1B 1BREA 3S9DB 1A3LL 1UXWA 1MY7A 2D0GA 4U1GB 4NO3B 3CDGB 5BV7H 2O5YH 4HUMB 1CBVL 2NY4C 5L0QB 1JK8B 1IFHL 4JHZA 3RWFB 5F8QC 4CNIA 1BM3L 4EUPH 4U2ZA 4WI9A 1MCJA 1VPOH 1EO7A 3CSBA 1S3KL 1U91A 4W70A 3V4PL 3V5KB 1IM9A 5D5MF 1RK1B 3FN0L 3F7VA 5H35B 2LTQC 3RDTD 1M71B 2WBWB 4IRJD 5DUML 1CZ8H 1R3LA 3OJDA 1UACH 2QADC 3HC4H 4GKSB 4J3SA 3VI3F 4G8EB 3H0TA 2Q6WA 4QHUB 3V6BR 4WI6A 3WUWG 1HQRA 4CVUA 4PV9A 5DVMA 3T77B 2UWEF 2C1OA 2UY7A 1GIGH 5HDQH 1LEIA 3SDAD 5F70A 4P57B 4FQJH 3BAEH 1NH6A 4S1DC 3L3GA 3LD8B 3C08L 3VG9B 1T03H 4GG6F 3VRLF 3G6DH 1F02I 2YD8A 3O3BB 2DMBA 2RCSH 2AGJH 3V5KA 2WBJD 3FT3B 5DJ8A 1IC1A 4KZDL 4LF3B 5BS0A 3ZHDA 4S1QL 3IDMA 1D5ZA 3DX9A 3FO2A 5SX5H 4MHHI 1T5WB 2CKNA 4FS0A 1WITA 3RU8L 2VR9A 2AXGA 1NMAL 4HCRH 3KWWA 4RFNB 4NYLA 5JLZB 3QBTB 4DK6A 5TE4L 1UEMA 1EFXA 2X4UB 5KVFL 1KNOB 4HS3A 2IPTH 5IESH 2JK5A 1YPZA 2MCG1 1S7SB 5HHQA 3T2QA 4NUGH 6FABL 2YSSB 3W0WB 5HHNB 5D96B 3AU1A 2R2EA 4TSBH 5JOEA 1U3HC 4XC3L 3WD5H 3EYOB 4LSSH 5I71B 1HYRC 1RUPL 5DURD 4ZMAT 1QFHA 3TBYA 7CGTA 3VFMA 3MO1B 3ARPA 4HX1A 3GFUA 4I5BA 4YPJA 5ID1B 1Q0YH 4F15C 5LBSL 1AIFA 3BN9D 4JKLA 4D94A 3W2DH 3QXDA 4NYLB 5HDBF 5ICYA 4Z7VA 4XPAH 2D7TH 1XF2B 1WFNA 4O58H 4NC2B 5TGBA 3KLHD 3P3YA 1Z3GH 4UQ2B 2NY7L 2OR9L 5BRZE 1PG7H 5F7MC 1NFDA 3GSVB 1BEYL 3HI6L 4JGMA 4RNRB 3T0XA 3W9EA 1P4IL 1M05A 1UWEH 4P4RB 4U1JB 3KAAA 2DYPA 2XRAL 3B2VH 4UAOB 5D6DC 4O2CA 1UCBH 1LO0L 3FO1A 1BOYA 2FRGP 5HHOE 4B7IA 1URLA 3H7BB 4ZS7L 4BZ1L 3I6GB 4M6MH 4UDUA 5ID1A 5AUMA 5FYLH 1XR9A 1OARH 4TSAL 2BC4A 5EC1B 4E41E 2MOVA 4HK3N 4KI5D 4P5TB 1CDGA 5AWNL 5HDQL 5L2JA 3NIGF 1QD0A 3FB8B 4KVNH 1GPOH 4KDWA 3WNKA 4UQ2A 3V4UH 3BAEL 4L4VB 3MLSH 1CT8B 1RHHB 4OLXH 3TLRA 1P4BH 3TN0C 4J8RB 4OCYL 1L7TL 1N59B 4Y1AA 3WNMA 3F65A 5GGSY 2X05A 4NQCB 5F3BB 1KNOA 3GGWB 3ARFA 1NJ9A 3EYQC 1LNUB 1WFOA 2ZCLL 4EBQH 1JGEB 1JV5B 4PJDA 1UWGH 4NUJA 4FG6C 1LP9A 2AV7B 2QQQA 4LDLB 4WEBL 2A6KB 3K74B 5GS0L 5I1DB 3FT4A 5CWSB 2JB5L 4G9DB 4JO1H 3W0WE 3VFWB 5KVGH 1J9CT 2R2BB 1VACB 1Z3GL 4ZUVB 4Z5RB 3BW9A 3VFTB 3MYJA 5F97E 2HP4A 4P2QD 3X14B 2VE6B 4QHLB 1BIIB 2AVGA 3RPIB 1HWGB 5D71H 2X1WL 4GW1A 3Q6FB 3MRJB 5DT1H 3TA3A 5I8CA 2I9LB 5GGQL 3ULUL 3C9NA 2LU4A 1DEEA 1I3RB 3PQYD 4LSSL 1A8JH 3GNML 3BT2L 4YDJB 5IBTL 2QSVA 4QGTA 3O6LH 1N7MH 2Z8VC 4L4JA 4FABL 5D96C 5IKCB 4FG6D 1AJ7L 3T3MF 4OIIL 1FIGL 2BY1A 4NQVA 1ACYH 1ED3B 4P23D 4HAGA 4I9WE 3C60C 4R97B 5T3XL 1FVDA 1IQDA 2WIMA 3H9ZA 3WMSA 3VFTA 3OKNA 4LPVA 2W38A 4WWID 3GI9L 4X9GA 3OAYK 5IK3A 5GS1B 5D1XC 3EOAB 4LASL 5KS9F 1AHWA 5F21B 2EECA 3DVGB 4S2SA 3MGOA 3PDGA 3ZT6A 4HHAA 2X40A 4JDZA 4G42A 3RTQD 1GAFH 1S7VA 1GXEA 1ETZA 1NBZB 5HHOD 2G2RA 5JDSB 2ZUQC 2OL3A 4H1LB 1CU4L 1ES0A 3O2VH 2Z35B 2XKSA 2A2QT 1MI5E 5EPMB 1I8LA 1HHJA 4XC1L 4AEEA 4WUUE 3X13A 2GSIB 3QZWG 4EEEA 2FJHA 3KLHC 1GGYA 1KIRA 1NC2A 3P0VH 2J3SA 2WBKA 3NGBC 4WW2F 2Y5EA 2IFGA 4MZ2A 2JLLA 2WWKO 2AJSH 3R0NA 2GKIA 1MFCH 3ULVF 4LOUC 3NZ8B 4LLMB 5F7EH 5C9KA 2CXGA 3QUKA 5I18H 1NAKL 3E1F1 1IC7H 2FL5A 2XG5A 1ZVYA 1SJEA 4YJZL 4G80B 4IMLB 5I1CH 3HUJE 4JFDA 1HHJB 4D2NA 3MLUL 4RCAA 2NY2B 3MV9E 4F58H 1FVCA 5D93C 2LV4A 2J12B 4PPTA 3HAEB 4NKDB 3FQRB 3QEHB 5FV2A 4JHWH 1T1ZA 2R1YB 2ADIA 1ZHLB 3L3KA 4X5XA 1TTGA 4PJHB 2Q7NA 3M8OL 4NOFA 3GI9H 1XMWA 2JKXA 3ET9F 5JPNA 1XF3B 5GRJH 1YYLL 4NQEE 1U58A 1JNHB 1Q9OB 1YEFL 4XVJH 1AGEB 4EN3C 4U3HA 1UH2A 2J8UA 4EI5C 1ZSDB 4O51A 5C07E 5DGQA 3STZA 4NNYA 4PLNC 1OF2B 4PP1D 5EBWA 4NBYB 2VDMH 5E2TL 5T3ZE 4NBXB 1J8HB 3ARDC 4KKCD 1R5VA 3TC9A 1PDKA 3MRNA 1I4FA 4L3EB 3BSZH 3DTXA 5JXAH 1F13A 2IANA 3QEGL 5C0AB 1NQBA 2NZ9C 3EIFA 4IMKC 3LS5L 3PDDA 1MCHA 3MOQA 3P11H 3PV7A 2BY2A 4PRIE 5HYSG 5HYSB 3PQYE 5F7EL 1DVFA 2AJUH 4CAGA 3EYVA 4LP5A 4NT6A 4R26L 4JM2F 4GS7B 1MF2H 1YEHH 4P4KA 1YN7A 1Q9OA 5AYUL 2NY6B 4KUZH 4MSWB 3ZKXB 3IKKA 5DJAB 4PV8A 3V6ZA 4Q2ZA 2FEEI 1W0VB 2EE2A 5KJRH 2DBJA 1AQDB 4JKWA 1YUHB 3HTLX 4J3UA 3CH1B 1JGVL 3G5ZA 3FJTA 4R6UA 3MRQA 3MBEA 3PV6A 4D0CA 4HULB 4NO2B 3BYYA 4X80L 4G9FA 4G43A 1EEQA 3GMLA 4WEUD 4GRLD 5HHVH 4DN4L 3IAGC 4ZPTB 3TIEA 4MD5B 2DWDA 5EWIH 3DYMA 1WZ1H 4OZIB 1T7VA 4I0KA 2J5LC 2HRPH 3GJEA 5I75C 3OAUH 3T04D 1BQHA 3AREB 1KG0A 3HPJB 3OL2A 1X5XA 3R0MA 5CKGA 1QLEH 3ARSA 4ZOBA 1T20B 3WFHA 1WIOA 4OF8A 2RFXB 1JGDA 1PJ9A 2OXGA 3EOTH 1RZIA 3S3SA 4AMKH 3WEXA 3QQNA 4ODVL 3TJEH 4QTIL 2GI7A 3IDMB 1Q1JH 1VGKA 4TVPD 2F54A 4JO4L 5E9DD 1RK1A 4DQOH 1G6RL 3REVB 3UTTD 3RWJA 1QBBA 1U0QA 2X4NA 4HJGB 5FHBH 3H3PH 3B3IA 3F6IA 3IDJB 2ZSWA 5E03A 3IU3B 5KSBB 3AB0C 4QCIB 5T1LA 2ZZUT 1Q94A 5EO9B 5DDHA 2FO1A 2Z9TA 3K2UH 5IJKA 3KR3L 2DQTL 4FQQA 3CVHA 4NUGL 4HWBH 3MV9B 4GOSA 4KK6C 1LGVA 3MRRB 5DQ9A 4O4YL 1KEML 4LAJH 4M1GH 2A6JB 4WEMB 5FOJA 3FQUB 3MA7B 3DECA 2ED9A 5DS8B 1ZTXL 4M43H 1J10A 5DWUH 3WSQH 2CLVB 3DRQA 5AZ2H 4OTXL 3HLAA 2IBGA 3TT3L 5DGRA 3T0EE 2H9GB 3DXAE 3GJEB 1NGPL 2F54B 1YQVL 3FQNA 2R8SL 3CD4A 3ARFC 4OGAD 4NZUH 5J8OA 4K8RC 3JWOC 4FFVD 4LEOA 3WXVH 2YPKB 3JUZA 3TN0A 2FO4A 4X6CB 3RI5K 1A5FH 5E1AB 3FCTB 3GJFA 5E8EA 1A9EA 1UXSA 4Z78B 4YFLF 1MI5B 2V6HA 1S7UA 3RUGA 3B8YA 1KIUA 4NWTH 1QBLH 3MRBA 1TQBC 4LQFL 1F11B 4EKXA 4PYGA 1TQCC 2BERA 2XN9E 1F97A 4PRNB 1FNEA 1N64L 4Y4FD 4ZYKA 2A9ML 3WS6C 3HC0B 1OGAE 1K5NA 1QLEL 3WLBB 3SDCA 4KROC 4XB7A 3LKPB 3F7QA 5D7SL 1KLUB 3X3FH 1L0XA 1N59A 4G6JL 5FA4B 2ESVD 5D2LA 2UVFA 2FJGB 5L8JB 4OCYH 2YPVL 5BS0D 2X89D 5E8OA 2FNBA 2FBJH 3DGCR 4YUEH 3BT2H 2A9NH 2Q3ZA 4KMQA 3BOVA 3CZFA 4KKLD 3LN4A 4W6WB 3CDGA 2BMKB 3LH2H 5FDWA 4MJ5A 4U2YA 5E2JA 1D5IL 1FSKB 4UT6L 4WGVB 1XR9B 5JXAL 4NHCH 3LRHA 2PF6A 1BGXL 1JPTH 3NH7H 4HQQH 1VACA 1V7NH 3VXRD 2NXZC 4I5BB 2R8SH 2DTML 3NPZB 2XQYG 4AQOA 5AZ2L 2UY6A 2E27H 3SDDA 3OSKA 5SX5K 4KJPD 4GXVH 4Y8AA 3EJYD 2WIIA 3T0AA 2APWA 3LN4B 4M7LT 4U3XA 3VFSB 5H8DA 3SDDD 5BQ7A 4JFDE 1T1WB 5I15H 1MCEA 4KHTL 1OTTD 3NIGE 1N6VA 4KKAC 3DPBA 3O6LL 4NRYA 3CPLB 5JW4N 4DKEH 5EN2A 5BVPH 4Z7UB 5CILL 5BV7C 4H88L 1S9XA 5FA3B 4S1RL 3FB6A 4GAJH 3CSPA 1DQQB 1VCAA 4JQVA 2EDFA 3MMEA 3G08B 1P7QA 2IPUG 5GGSB 1P1ZB 4PRNA 1FGNH 4NRZA 1H9VA 3SKMA 1T89A 3T0DA 1FZMB 4HGWB 2ZOKB 5D8JH 5ISZA 3TYFA 5IVNA 4MQXD 2YPVH 3IETA 2NY2C 3GSWB 3RVVD 4PJ5E 2YSSA 3DMMC 1PY9A 4BQ6A 4R4FH 1HEZA 2EXYC 4F3FB 4RMWA 4MXVE 5D2NA 1CICB 3M17B 4JGUA 3S35L 3PL6D 3B8SA 2G5RA 3U0TB 4I2XA 2X4UA 4NHUB 5CSBA 2VKWA 4G8GE 3IJYA 5I0DA 4HX1B 3RUGE 4ELMB 4BELD 1ZEAH 3I6LD 2AQ2A 5TPWH 5IHLB 2VDLL 4NC0B 1I7ZB 5HYIA 5GIRA 1JI2A 1WZ1L 4YGVA 1I3GH 3VXSD 4Z77A 4Z7WF 5BJTB 4XNMA 4EQ3A 2F8VA 1M7XA 4JZOA 2CIIA 1T66D 2RR3A 3PABB 4ZUUA 2VR4A 1ETZB 1NBZA 1R5IA 1ZS8A 4L8SA 2Y72A 1OAKL 4B50A 3VGDA 4HSQA 3OMZA 4MGXA 4RSVA 5FKPA 3RWGB 1KSRA 3SEPA 3D3VE 2AERT 4TSAH 1S8DA 1A6UH 3UTSE 1S9KC 2HTKD 3HG1D 3OKLA 4U1MA 5SWQA 1HE7A 3RGVB 1GJIA 1NLBH 2B1AL 2B8OT 3O3DB 4P5TD 1PKQA 5HSFA 1ACZA 4QRSA 3MXVH 5ITBL 1JPST 1CIDA 2Q8AL 2KQNA 2NMSA 2AKRA 1FH5L 5FYJH 3VRLE 3KYOA 4ODTH 5EU3A 3U4AA 3IDXH 4R4BB 2VLJE 5D5MA 2J88L 1GGCL 2DQEL 35C8H 1K6QH 3EHBC 3UTZB 4K8RH 5HVHB 4TTDC 3EO9L 4LSUH 5ILTL 4F2MA 1J1PL 5DSCB 4Z7WA 4JDZB 4K9EC 3VI3E 1F3DH 1SQ2N 4N5UA 3MGTA 5T1KA 5F96H 4FQJL 1WCBB 5E99H 1U8QB 3VU2A 4X4YA 1CVRA 4BZYA 4CVZA 1K6QL 1JPFA 2EH7L 3MSPA 4KKBD 5T1KD 1ZEAL 4Z5RA 4LU5L 1KXTB 2CLRA 3HNSH 5GS3A 3UZQA 1RUKH 3DJ9A 1I7ZA 3IDUA 4ZUWB 5IFAH 4PLKD 2BRRH 2WLYA 1TVHB 4NQVB 3FQWA 4P2OC 4HMCA 4NM8H 1UB6A 3OXSB 3MV8D 3LPFA 2V17L 4WTXA 1Q8MA 2DM4A 4GMSL 4LQ1A 1MQKL 3RWGA 1PG7X 5D7LE 4XVSL 1ZAGA 1U3HD 3EKCA 1DEEB 3OKNB 1OLLA 2HLFD 3V5DB 3R06B 5I1LB 4QF1A 4XMPH 3Q6FA 5C2UB 3JWDH 3U2SA 3MJ9L 3RHWK 4K94H 1K9TA 5I1GL 3BGAA 4XPGL 3NABH 1A6VH 4ZS6D 4PJAE 2R1XB 2Z93B 2CIKA 3UBXG 1OAXH 1BIHA 1T21B 1CFSA 3TV3L 3ZDYE 1TCMA 1HKFA 3SE3C 2FEEL 3P4LA 4Y5XA 3RTQB 3VFVB 5EU6A 3DHJA 3BZEB 5C0DA 1N5YL 3BXNA 3ALWA 3SDXB 1FN4A 3C6LA 4CW1A 5GRWA 1QP1A 4DGYH 5CHNB 2NTSP 4OZHA 5JOPD 2E7LC 1MLCB 5MEQB 4EOWH 3SDAC 1Q72L 3FOMA 4OZFB 4ETYA 5GRVL 3WKMH 3QUKB 3V8OA 2VDPH 1FFQA 5CJXA 1MH5A 4KKNA 3MFFB 2WANA 4UT7H 3ME0A 4NJAH 2NTFA 5JORA 1Z0NA 3U48A 3RWEB 4OZIA 1S7QB 1L0YA 5H94A 3OKOB 4QRTB 3FHAA 5H2BA 1VGEH 1IC4H 3WHE0 1BF2A 5DJXA 1P9MA 3P0YL 3GBLA 4M9PA 1N4XH 5B39B 5MENE 5CAYB 3MLVL 2BNQD 1LVEA 5DRWB 2EYTA 4GXVL 1EFQA 4MNQD 3BPLB 2X9WA 1HYSD 5IFHH 5IQ7L 3MJ8A 4BFIA 2EO9A 1A64A 1A3RH 3F8UB 1IGIH 5IG7B 3M8OH 1ZA6A 1YUHA 4LLDB 4WVRA 1T89C 4YWGL 3WBDA 3TPUA 2OR8A 2R1XA 5F6HI 1DBKL 4UT9H 1F8TL 4YHNB 1YEGL 3N0PB 3LEVH 4P4KD 1NDMB 2GT9A 2VAJA 4AYFA 5ID0B 4MCYB 3QRGL 4OF7A 4LVHB 4OKVA 2VUYA 1TJHL 1J0JA 2V2XA 4ELMF 3ZDXF 4J6RL 1B0RB 4UNUA 4X8JA 2N4IA 2F54E 4LKXB 1UGNA 3L3KB 4XWOC 4U1SB 2B0SH 3HAEH 1HSBB 1KF9B 1MIMH 1SYSA 5DUMH 2ARWA 3STBA 1OAZL 3Q3GA 5EOCH 4CMHB 4ODWB 5IEHB 4X6FB 1MWAH 4WO4B 4NWUL 2D7PA 2A83B 4P3DA 1HXMA 3OXRA 3X11A 3S35H 2GJ6E 3O41A 2D7QA 4JRYD 4S1QH 2BZDA 1KENH 4R26H 3UXFA 2O26U 1INDL 4TPRH 5IGXL 2NXYC 3CVHB 3ARYA 2AGJL 2VDOL 5I1AB 4MJ6B 4QT5A 2D7NA 1KCRL 4F80A 2IAMB 4TRPH 1I7TA 3O8XA 3B9EA 3NOIA 2NY6D 3RQ3A 12E8H 1AHWC 1HH6A 2EEDA 5SWSE 1EIBA 2BCKA 1KTLB 3FCTA 3GJFB 2H9GA 3C6LD 3NIDF 1ZA6B 2VXSH 3CFKB 1R3HB 4OCXH 2WQ8A 4Y2DD 4HIJB 5T3XH 2WZPD 4K23L 4NZTH 3X11B 3GMQB 5FKAB 2A77L 3VJ6B 1BJ1J 4LSVL 4LKCB 4LRIA 3BQUB 4R0LB 3OB0H 3ESUF 4Z0BL 4I18A 5C3TA 2XNAA 4JM2A 3UYOD 1KULA 4HUXB 1XF1A 2D9QB 4JN2B 5IB2A 1IEBA 3IFNL 3K46A 1E4XI 4MJ6A 4HKBA 3VG0L 3W2DL 5KN5B 4PJGE 3D39A 4M6NH 4YX2H 1HDMB 3LSOA 3QI9A 1YY8B 3ROOA 1NMCB 4WWKD 3QIUB 4NQXA 4EVNB 2CPCA 2B39A 4LLVB 1DBBH 4GW5A 2W59A 3SE9H 2ZSWB 1UYWL 2BHZA 4HV8A 4DEPC 4CGTA 1KB9K 4PGZA 1BFOB 3LQAH 4IHOA 3BPNC 3MXWL 4WGWB 5B38B 4DTGH 3C5SA 2X1PA 1JWUB 4PG2A 4EUPB 5KVGL 4OV5B 3HZVB 2ADFL 1IGMH 1I7TB 4BK4A 5LGHL 5FB8A 4JZJC 2CGRH 4IJ3B 3IU4L 3CDFA 5HD8D 4Y5VA 2EEAA 4OCWH 5IEKA 3WS3A 1PLGL 4OM0L 4WI2A 3RPKA 1H15B 5BVJB 2WMPA 3MV9D 4JFPA 3MNVB 1L6ZA 1D5MA 2JCCF 3AREC 3CMOH 3VRIA 3VWJC 5CGMA 3MGAA 4OIAA 2GYSA 2NY1B 1CGVA 4N0CC 4XP4L 5DC9B 1I3UA 1SVZA 3DNKA 4Y19A 4C4KT 4UV4H 1P84J 1ZVSA 2YD2A 4U0RB 3VXPB 4RDQG 5ESAA 1T2JA 1MWAB 3H9SB 5D70H 2J8UF 2O5XH 3UTTA 4HPYH 1IKNA 4HIXH 4YXLH 4AIZA 1AFVH 2HT4D 5DO2D 1JWMB 3AFLA 3V4VL 2KKQA 1AGFB 1BFSA 8CGTA 4P5KB 2PTTB 4M7JL 4WW2A 2GITA 3A67L 1MF2L 5IROC 2J6EH 3UC0L 4YHIA 4M5YH 3IJHA 5EU5A 2A77H 3GB7B 1B3JA 2FCBA 5F6IC 5B3JE 1Q9WA 3KPRA 1NBVL 4WJ5A 1EGJL 3WS3B 1AP2B 3GNMH 5C0NC 3C87A 2RBLA 2X1QA 3B9KC 5E95B 1HQRB 4FQ1L 1JN6B 3LS5H 3HCVA 3ARBC 3BE1L 1NSNH 1A9BA 4YX2L 3K7UA 5KSVA 5MEND 1P2CA 3DRTA 4IDJH 1ZVSB 3VXPA 2VN7A 1NLDL 5E5UB 3TGXA 1U91B 4LASH 4MXQD 3STLA 4EIZC 2X4SA 4KZEH 2OYPA 4XWGH 2ESVB 1X5FA 1LDSA 1H15A 2FX7H 4MD0B 3MRCB 1KXVC 1FZKA 3OKLB 2ZCHL 3U83A 1INEL 2WWMC 3B5TA 3TVMC 3F58H 4K2UL 3RWIB 3PHQA 5ANMA 1EHXA 1MJ7L 5FECA 4LCYA 1EAJA 2KH2B 4G8GA 3ARZA 4HW6A 3QO1A 1UJ3C 1FNSH 4MWFB 1FO0H 4YHLH 2AAVA 3DBXB 3IDGB 2F5BL 3FRUB 1T5WA 4P3WA 2OZ4L 5HVGB 2P5EE 2PR4L 3R1GL 4QRUA 4XZUB 5IV2A 4CN1A 4WI5A 3SDCC 3BRFA 3KDMA 4YK4B 4FXKA 3QJHA 2L7UA 1QHOA 2I9TB 3VD9A 2BXZA 3EYUH 4MXWL 4XVTL 5DR5L 2R4RH 5HYJE 1CLYH 3MGOB 5CZXC 3JBG7 1JBJA 5C86A 2EKJA 1HHGA 1AQKH 1G7PB 1CD1B 3OHXA 1G7MA 4HBCH 4K3JH 3LKQA 2ICEA 4X83A 1RMFL 4O5LL 1BAFL 2BSSA 4B53A 2OLDA 4J7RA 3QFDB 1WSST 1FFOA 1DQQA 1RFDH 3DUUB 1B4JH 2AEQL 4N0UB 4PJXF 4PR5A 4YGVB 4PGDB 4Z7UA 5IWLA 2VZTA 1FZKB 5D7IA 1H8OA 4PY8J 3TP4A 1Z2KA 4PJCA 1S7VB 3CVIH 2DQUH 5AWNH 2HKFH 3D85A 3MRDA 4KGJA 4RISH 4GW1B 4GRWF 2AK4A 5CILH 1JF6A 5F3BA 5AZEH 4OFIA 5IOPA 3HZMB 3VXQB 3DX7B 4X98A 5J1TC 1NCBL 5IVZA 2JE8A 1RHHA 3B2UD 1K8IA 4DOHB 3BPLC 5JUEL 1VDGA 1XGTA 1S8DB 4FQPA 2F8XC 4K7PH 5FUZL 4OZGF 5DD3H 4APQA 4M43L 3CIQA 2V2WB 1BJ1H 1DUYA 3L3IB 4IRSC 2BK8A 5FGBC 3BW9B 2CKBL 3QCTH 3VXUE 4Z77B 3WFBL 5E2VH 2R4RL 1J05B 3BEWB 3KPQB 4NQCE 4R8WH 5L88H 1CK0L 1NGXB 4KUCD 4OZHB 2AKRB 5F1NA 4M1DL 2EXWC 4L4VE 1AGDA 2CMRL 4TSCL 3MFGB 3UO1L 3HG1B 4DVRL 1PEWA 3LH2L 3RGVD 1GZPA 3L7EA 5D71L 3BZEA 4OFPA 3GGWA 2XWBB 3O6FA 5DT1L 5J3HD 1I3GL 1IC7L 1JHLL 4I77L 2DQEH 3F5WA 1I9RL 1KIQB 3O6FD 3HE6D 5DFWH 1XT5A 4DUVA 1DN0B 1CYGA 2XFXA 5GS2H 3Q1SL 4EI6A 4MCYA 5IGXH 3HR5B 1JF1B 5MHSD 2UYLA 5K9QI 3DV4A 2VXVH 2B2XL 4M7ZB 3PWPE 1CFTB 5HYFA 2J8UB 3FT2A 4MDIB 1MELA 1CICC 1CFVH 5IG7A 4XP5H 3D3VA 1IBGH 3KPTA 5FYKH 3NIFE 3J7HA 5ICZB 4K3GA 4WO4A 1IRAY 3DSFL 4OAWA 5ALCL 4JZJA 4P23B 1CLOH 1MCPH 4S10A 3BI9X 2DQIH 1JIBA 1BFTA 1OP9A 5B3JF 5ERWB 2ESVE 3C2AH 1KCKA 1LE9B 2CMRH 4TSCH 1SEBB 1XGPA 3LQMA 3PP4H 4OV6F 3TJHC 3WDIA 4MS8D 1FQ9C 3AXLA 2DN7A 4R8WL 4CDHA 4X4ME 2YMXH 2P48B 5C0GA 4ZG1A 3S97C 1K4CB 4HXAL 3KPQA 2DJUA 4TNVF 1IAOA 3OG4B 5DWUL 5I15L 2HT3D 3P0VL 2PCPA 3RBGA 3UC0H 3PWPB 4GRLB 4HUWB 4BQ9A 1I3VA 3DO3A 5F9WC 1G9NC 3BH9A 4FFWD 5CEZH 1PVHA 3VH8G 4M6OL 4KJWD 4R9HA 4D0BA 1G7QB 1MRCH 3FL7A 3GRWH 2JCCE 1CR9H 1FE8H 1ZHLA 1JHTB 1OSPH 1TFHA 1B90A 3BE1H 1KB9J 3EO9H 4LSUL 5ILTH 1CS6A 1FRGL 5CSZA 4F9PA 3BDBA 3BVNA 5JO5A 1A14H 3UDWA 4E41A 2Y5TB 3LY6A 1KN2L 3S5LA 3NFNA 1JZ4A 2E5EA 3WKML 1JL8A 3ARUA 4TOYH 2YD4A 4AK1A 5DHVB 4YR6B 3PWUA 4LVNC 2XOTA 4QLRA 3QDGE 1F90H 1HXYA 4H25B 3H9HB 2BXYA 3ILPA 1D9KA 2ARJQ 4KK9D 3TZVC 4ISVA 1BFOA 4DJMA 2CDEB 2W9LA 1NGYA 3RZCA 5TDNA 1CD9B 2JIXA 4D3CL 1FPTH 5ISZE 1AGBB 4AEFA 2AJZA 1W0WB 2PYED 1A1MB 3SGKA 3QAZB 4UBDD 2BNQB 5CD3B 4G7YH 4X80H 4ZOAA 5DVLA 2ZUXA 3B5GA 3QWOB 1YEKH 4J3WA 1RZJH 2FX8L 3SJVE 4UT9L 1S9YB 2GCYB 4RAUB 3H0TB 1MFNA 4X8JB 1U93B 2DAVA 4PJEB 4KPHL 5FCUL 1TPXC 4L5FL 4G6AD 4G6JH 4IS6A 3CX2A 1IGYB 3HPJA 4X8XA 1A6AB 1PX4A 2BRRL 3K0WA 3LB6C 1RU9H 3QQ9D 1AQKL 3DX6B 5ALBH 3SBWC 3WFHB 2IMMA 1W0WA 3QDGD 3MACH 5TDPB 4NJ9L 3P0YH 3RWHA 1J0KA 1NFIA 5JXEA 5TDNB 1MSPA 1ZLUH 1KFAH 1XFPA 5C0AA 2DTSA 1IILE 1HINH 3ARGC 1YJDC 4PYHA 4FXLA 3DIFB 5FGCE 3VFGL 2YK1H 3RX8A 3C5ZD 4OLZH 2W0LA 4H25A 4ZNEE 1OD9A 3OF6D 2Z31B 3C60A 3NCYP 4S0SD 5DJAA 4ZNCD 4WDIA 1CDHA 1LK2B 5HGHB 4Q9QH 1NBVH 3DVFA 4TUJA 1Q94B 4F7CB 3QCVL 5JQ6L 1YPZE 5CKAA 3QG7H 2CRZA 4LEXH 3WFBH 4X6DE 3RJDA 2QQNL 3IFLH 3FO0L 4PLJC 1OWWA 3Q48A 1SJHB 4MA8L 2UV3A 3BPCB 3NCCB 4IOFC 2GITB 4XMKH 3UBXI 1U8HA 2IBZY 1C16B 4PRID 4NQUA 1AD0B 4Y4HD 2ATKB 3WHE1 1YNLL 2BVUA 3RX7A 4K71B 4G8FA 3GM8A 1A7BA 5E8OB 5A16B 5E6IA 2OL3H 2YWYA 1C08A 5D2LB 1WTGT 5DRXB 2H32H 2I5YL 5EOTB 3MJ9H 3S5LG 2W9DH 3GRWA 3P30H 4JDTL 3ZYZA 2VMFA 4G6FB 1NDGB 3BKML 5AG8A 5ANMB 2N7BA 2D31A 4HC1L 2VDPL 3HUJA 2GIYA 4O2CB 4F9LC 1ZHBA 2P7TA 2A9NL 4TUJB 3SGDI 4HJJH 5C07D 1IT9H 1AP2A 4QRRD 2FSEB 3DOSA 1TQCB 1KFAL 2V7HB 3DURB 43CAB 5CJQH 1OPGH 2F53B 4M5ZH 3UTTB 3KXFA 4U1HB 4PREA 4NCC1 1JGVH 5TGBB 1TETL 4YK4C 3GMOA 4HXBH 4YH6A 4HIHA 1KC5H 3GEWB 4WNQB 5J56B 5IBLC 5E08H 4L4VA 3HE7B 4XCCL 4G8FB 5BQ7B 5CJ5A 5LJYH 4WUKH 3FQNB 1KCUL 2HJKA 5J13C 1WF5A 2PXYD 4JREC 1OPGL 4U49A 4GSDH 1TJIL 3PHOA 2M8XA 3QIBA 1LWRA 4YHZL 4KDVA 1HN1A 3KLAB 5GRVK 1FNHA 7FABL 1FNAA 3WIHH 5C6TL 2I5YH 3DARA 1YNLH 5HPMA 5C92A 2YKLH 3QCTL 1NMBH 4M7LH 1QSFA 1RI8A 2F54D 4PGJA 3WUWB 4GJTB 4KMLB 3VXSB 1D5ZB 3DX9B 3FO2B 3QUXC 4P3CH 4PJAF 5IV2B 2I25N 3BDXA 3LKPA 1U2HA 1H3GA 4DWHA 1ONQA 4XNQA 5MENA 3HC0A 3L3JB 3KPPB 3L95A 3KPOA 2YKLL 4HPYL 3LEYL 4XCFH 5B21A 3U0WH 1AXIB 5BW7A 3SDXE 1M7IB 4LSRL 1I9JL 1T5XB 4JFFE 3DUUA 1WBXB 1FDLH 3MLZH 5MEOA 4JG0H 3C6SB 5I1GH 1OY3B 4NQSA 1T03L 1YNKL 1FRGH 1PKQE 3WFCL 2ICEB 1T0MA 2NNAB 2DKUA 2LVCA 2P8MA 4OI7A 4WWKA 4R4BA 3KWWB 2V9RA 3TZVA 4UUJA 3GK8L 2C1PA 1XAUA 3BWAB 3DX7A 2IH1B 2WUBH 1QPPA 3QP3A 2VLJA 1S5HB 2EDQA 3AAZA 4U6XA 1M7IA 3S8WA 4AL8H 4WEBH 1KENL 3KS0J 4XNZC 2QQLH 2YD1A 1JTPA 3FN3A 3S4SG 4YBLB 3VGAB 4WFHE 2IQAB 4Y4HC 4HXBL 4O2FA 4GKZB 3KPLB 2XQBH 1P9MC 1YYMH 2P8MB 4MQSB 5JW4R 4IOFD 1QYGH 4OZFG 3GSNH 4XTRD 5DTFA 2ENSA 4NQSB 5EC2A 2FX8H 5EC1A 1QQDB 3ZDZE 4XBGB 1JI1A 4NO0D 4ONGH 5FO8A 3WXVL 1U42A 3IETB 4XNMB 4G7YL 2BVQB 3VXMA 1AD9A 1FORH 3O11B 2GUOB 3MV7A 4JLRB 4OGYL 4QWWD 4YHKH 3THML 4ZO7A 2FGWL 1SYVA 2B5IB 1G6VK 5I6XB 4R3SA 5JR1H 5JW4Q 4U6HB 4OTXH 1RZ8A 1LNUA 2W9EL 3M17A 1YMHB 3GIZH 3I85A 1XGQB 4GAGH 2G2RB 4U1MB 1NFKA 1PZ5B 4UB0L 1JGEA 1JV5A 4PRPD 2ATPA 2IPKB 4H1LH 4PJFF 4ODUA 4Q74A 3B43A 3SE3A 3CUPA 5L2JB 4LU5H 2Y25A 1KACB 1IEAA 1ULVA 3ZTNL 3HMWL 1E4XH 4OGXH 1R5WA 1EJOH 4PD4J 1HHHA 1E28B 1MREL 1X3DA 3QSKB 3PL6B 5E0QA 1CDJA 3O2WH 2OJEA 2PO6B 3BRDA 1HQ4B 2XTJE 1JGLH 1J1PH 1QEWB 4N90E 4X7TA 5CHNA 5LAXA 4PJDB 3UMTA 3HMWH 2BVOA 3KJ6H 1G6RA 1Z9MA 3H7LA 4X5XB 4JVPA 5D9SB 1T83C 5EA0H 2VIRB 3S3JA 3A67H 2C7UB 1A7OL 1DBML 2UUDK 5JW3L 3VXNB 5I19L 4PJIA 5EU6B 2G75A 2JB5H 3W5NA 2OJZH 4WI8A 1AFVL 1YDPA 2VDRH 4OT1H 5DR5H 3T3PF 5L2KE 4KTEH 4PJBE 1N6QH 3VXMB 1EMTH 5GRUL 3NCFB 1IAOB 1RZJL 1N2RB 1OGTA 5IM7A 1FZOB 4F7PB 1P7KB 3QH3B 4EXKA 3MLSL 2EE3A 4F58L 3DETD 3ZTJH 43C9B 4CVWA 1GZPB 2IH3A 4JRXB 4HIEB 3E0GA 4Z7QF 3VE0B 1KYOK 1OM3H 1J8HA 4I0PC 3CFBB 4D3CH 3QWQB 5F7LB 4GW4A 5I8EA 1UJ3B 5D1QC 4OLWH 1MUJB 3RKPA 1RJYB 4G42B 4KJWC 2XIDA 3FT2B 3SQBA 5GZOC 1W0VA 3GM0A 4G3YL 1UB5A 4POZD 1CTNA 3ES6B 5ACLA 4DOHE 2QBWA 3R06A 1RURL 2XZQL 5T1KB 3KJ6L 5D1QD 1R0AH 3BJ91 4ORGA 3RIFF 5CUSH 4DGIH 2XFXB 2NR6C 2I07B 1RJZA 3TNNB 5IB5A 4QF1B 1BBDH 2YD6A 3QEGH 5E94B 2ZJSL 2VSCA 1LE5A 3X13B 4ZAKB 2P44B 3VI4E 3VG0H 1CDIA 4HUNB 4N0UE 4ZUWA 3QUMB 4IRSB 5KVDH 5CUSL 1IL1A 3K1DA 2ED8A 2X9YA 5CBEA 4L8DB 3QA3B 2E9JA 1SYSB 2E9BA 2G5BA 2XT1B 4UV7H 1FYTD 4Y7MA 1H3TA 4JG1L 1QLFB 5KANI 3TIDB 5FXCH 2OMBA 2EDEA 5B38G 3QXAA 1F4WH 1VEMA 1II4E 1N4XL 2GCYA 4RAUA 3FAXA 3MROA 4YBHA 4QYOB 4PRDB 3NCJH 2HRLA 1MCLA 1KJMA 3IYLW 1QBLL 1DZBA 3PWNA 1BHGA 1OM3L 2JCCB 3QUZD 2XG4A 1J11A 5E99L 3GI8L 4O00A 2AJZB 2WAHA 4JFQA 4PTTB 1MAKA 5GGUB 5F1SA 1WVZA 1VADB 2JJVA 1LO3H 4WY7L 5GGTH 2R56H 3O45A 5DK0A 1A0QH 4WIQA 5JXEC 5HDLA 2DI7A 5FGBA 2E6QA 3CFEB 2MHAB 3CFKA 3N1FC 3TO2B 1KB5L 2MNUA 3VFPA 4AY0A 4DFHA 1T04B 4GRWE 4JCMA 1RURH 2XZQH 2FGZA 1QFOA 1R0AL 3MLWL 3REVA 1ZLWK 4HBCL 4K3JL 4NQXB 1KJMB 1G7QA 4RWYH 3MXVL 5ITBH 4L4TB 1YY8A 3MBEC 4RGNC 3CMGA 2X1OA 3WNNA 3L3GB 4QRPD 1KBGL 4F57H 2FHCA 4OKVB 5HHME 1NC4A 4B7LA 4FQXA 1U3YA 3HNTH 4YHNA 5CSZB 1D6VH 1V3JA 4HS6A 4XXCC 2EDWA 4DK3A 3CX5K 4YHKL 2XV6B 2YD9A 5AAMA 3QXWA 2G5BB 3NFNB 3GMLB 1LO5A 3D18A 5AEAA 3RVWC 1Q9LB 2VSDA 2I26N 5I66B 5IQ9B 1DVFB 3G5XB 2IBBA 4MD5A 1JNNH 1TZGH 4LARH 3O45B 4Y2DA 4HWNA 1KGCE 2X4TB 2HG5B 3RL2B 4ZPTA 4ODXB 1J7VR 5EZLB 2FYYB 1GH7A 2Z31C 3VFRA 4M6ML 5HXMA 4LHUG 3AY4C 3QHFH 5H37H 1MJ7H 3HPLA 1SM3H 3PWUB 5F9AC 3U0WL 3QO0A 1L0QA 4QTHA 1B0WA 2O5ZL 1XGRB 1MCDA 4TTGA 4PJIF 1KIPA 4JQXA 3E2HC 2V5SA 1Q0XH 5L9DL 4TN9A 4DTGL 1I1AD 5HGAB 4CMMA 1A7PH 1KTDB 2KZWA 3GSQB 4ZXBC 1LEKB 4OIIH 2DWDB 1JNJA 2MJWA 3ALXA 2VXTL 1QSVA 1A6UL 3CX5J 1FL3B 3E6HA 2CK2A 2V7NA 4MJ2A 4OD3H 5F3HB 2PTTA 3JV0A 4WW2B 4Z0XA 5DRXA 1BPVA 2GY7B 2Z92B 4G6KH 4W4OC 1JWMA 4DGVL 1O7SA 4D9QE 2E6PA 3HPLB 1RIUH 4IRJA 3L3DB 2BMKA 2FR4B 4JFED 4HKZA 2M2DA 4OM1L 3SGEH 5FA4A 1EHNA 4Y4FA 4KGLA 2VDQL 5DEGB 4C54A 5FHAH 4G7VH 1MCOL 2NW3A 3OZ9L 4BSJA 3ILQC 5I8OL 1DQDL 3PNWA 3FT3A 2H6PA 4ZSOA 2AJXL 3BD3A 1QHPA 2BC4B 4URTB 1OCWH 1SJHA 2A9MH 2NYYD 3PWJA 1QLRA 1P7QB 4GQ9L 3PE9A 1YJDL 3GB7A 2H32B 2DMKA 2ZOLA 4JPKH 4IIQB 4NPYA 4YDLC 5C0BA 2PYEE 5DUBA 1NL0L 2YR3A 4GAYA 3E8UH 3L7FB 4ETQB 4Y2DB 1G1CA 4HS3B 4G8EA 3P11L 4D8PA 3ARFB 3IKCA 4GS7C 5EWIL 2QADB 4K7PX 5DA0B 1I7UA 2H2SD 5DD6B 2WQRA 4EVNA 2OMNA 1WICA 1PSKH 3X12A 3EYOA 4PRIB 1LK3H 4WFGE 3K80A 1OP3H 4CMMB 4YDLB 2DIAA 4XNYH 1CE1H 2CH8A 2QTEA 3U4EA 4UIMB 4P2RE 1PGRB 4H20H 5HYJB 1QYGL 5C0AE 4PBVC 4NDMA 5EG6C 5L2KA 4WWKB 3B9KD 5HJ3B 5C2BH 1H0DA 1ZTXH 2NLJB 1WAAF 5K59E 4PD4K 3FB5B 2AXGB 1Z9SA 3HFMH 4Y4KD 2R2CA 3DV6A 4WFFD 3FRPA 3CZFB 5IVXF 1EFXB 5C07B 5JHDE 1WWAX 2AJYH 2V9TA 4U1KB 2DD8L 2R29H 1X7QA 1B2WH 1YN6A 5DO2C 2JTDA 2BOCB 1BP3B 4NQEB 5JIKA 4FFZH 1NFDF 1BBDL 4H26A 1T6WA 2IG2H 1UZ8A 1WISA 2VERN 5BVPL 3HE7D 2OS7A 5IFJA 4MA7H 4JLRA 2VQUA 4GG6B 3D69A 4DGYL 1VFBB 4LHQB 4OGXL 3TJEL 2BOBB 4HWEL 4AG4L 5IIEB 2GJ6B 3P73B 3QI9D 4XGZA 3X14A 5KVMC 2EDBA 2VZUA 4Z7WB 5SWZE 4AEHL 5K9OB 3FB5A 2A6IB 3NVQA 2VISB 4HWBA 4MA8H 5A2LH 1JYXA 1R5IB 1ZS8B 4L8SB 3EYSH 1H0DB 3KLAA 5F88B 4AT6A 1BVZA 4FQHB 5I1EH 2HWZL 5I0ZA 2IC2A 5FUOH 4K7FA 3C2AL 2ZUWA 4U1KA 5IKCA 1YEKL 4XMLL 3BH8B 3O3EB 1JPSL 5D1ZA 1D5IH 4U6VH 4UT6H 5C70A 4WENB 5DMJB 3RY4A 4LVOC 4QHLA 3MBXH 4YHOL 5IF0A 2YK1L 3VXSE 3BIAX 1V7ML 5KSVB 2R29L 3TZVB 1X5JA 1QFPA 1XGYL 4MA3A 3DSFH 3SE8L 5M95B 3MRHB 5IHUH 1NUFA 4PJXA 4G8GD 4JY4B 4OUOA 1CQKA 4NJ9H 3FFCA 4O2EA 5E24E 1NEZA 5KW9L 3SQOH 3ARGD 2EDKA 1TETH 2AP2A 5LGHH 1NKRA 4EI5A 3KLSA 2D3VA 4MNQA 4AL8L 4OZ4B 4XNQB 5CD5D 5MENB 3Q5OA 4JE4B 3HMXA 2QQLL 1YEHL 1IEHA 1BVKB 3KPOB 2OXHA 3FRUA 3EJZD 4BFGA 2MPAH 4KWUA 1QKZH 5A3ID 3LB6D 1MIML 4JDVB 4JPIA 4MJIE 4PJIB 4RGOH 4D9RE 2V2TA 3MXWH 5GRZA 5ITFB 4Y89A 5L2KD 4L8CA 1BZQK 3SBWA 3VXUD 1DLFL 1N8ZA 5GGQH 3ULUH 3O81A 1Y6MR 3LAFA 3P30L 1OGTB 4JDTH 5IM7B 1YEIH 4ZNEA 2IH3B 1DJSA 1GHFL 3FB8A 3C6LC 1MRCL 5LAXB 4DVRH 3IXAA 4CJ0A 3OAZK 2O61B 2F53E 1ZHKA 2D7OA 4WHTB 2HMID 3QXUA 4O9HH 3VXTA 2NY6C 2XICA 4KDTA 3BKYH 3ZDXE 1HSAA 2UUDH 1VFUA 4I4WA 3KPNB 1MH5B 2ZWLT 5FAAA 4UNVA 5ERWA 5IFAL 4NO0B 1QO3B 5EUOA 1GZQB 5DD3L 1YYLH 5EIIA 4O9HL 3GMMB 5D2LE 1UH3A 2XZAH 5GGVL 2VXSL 2VITA 5CJOL 3BIKB 1T3FB 1JPTL 1L7TH 1UENA 2CXKA 3VXRE 5I1HH 1E27A 4LPYA 3MNZB 1RUAH 1YY9C 4PGDA 1IGJA 1U8OA 1QSEE 2FL5B 4G9FD 1M7DA 4R3SB 2HKFL 2ICCA 5M94B 3PWPD 1NGZA 4PJEF 1UCTA 3UPRA 3RNQB 1OTUD 3SGDH 3LKQB 4PB9H 3IFNH 1Q1JL 4WHYH 4WV1C 4XAWH 4LCCA 3NGBB 2R0LH 1FHGA 4M7KH 3QPXL 5FO7B 2QSQA 1J86A 1E4WL 2VXUL 3DX8B 4HUVA 2X70A 2V2WA 1MCFA 4LCWD 1YMMA 3QNXA 3OGOE 4JM2D 2B2XH 3U36A 3L6FB 4OD1H 5EA0L 4Y5YB 4OQTH 1HYSC 1KB5H 4R7DA 2BHYA 3JZ7A 2DQFB 3MV7E 3RL1A 2XWJA 4PJ7E 2B1HH 4JY6B 3VCLB 2XY2A 3AS3A 2VC2H 3V7AG 2EYRB 4GO6B 3MLYH 5D6CA 1NGWB 3P9LB 1VADA 5EU6D 3V5DA 3NIDE 1V3MA 4UOW0 3V0VA 2IGFH 5JNYB 4YQXL 3FQXB 3VWJB 1FFPB 1U6AH 2JCCA 3VXMD 5GGVH 3REWA 4NP4H 1VFAB 4PJHA 3SJVB 3BPOC 3OV6A 5T3ZD 4WW1A 4GG8B 5DEFB 3C09C 2C3GA 3FO9B 4JQIH 4JRWA 1W8NA 5GGRA 2MHAA 5CEZE 2PYEB 5HYEA 1QR1B 4Q7DA 1EH9A 1NC2B 1D5BB 1QG3A 3B3IB 1X4ZA 3QB7C 1IC4L 4GMTH 4EIGB 5CEYB 2G9HB 3HE6B 1KTLA 3RZCB 3QDJA 4RA3A 3WDJA 5E00A 1JHKH 3U4BL 1ROWA 1TTUA 3GSRA 3BKJL 1E6OL 5C0RH 5F7DB 3DX6A 4Q9QL 1X6LA 4ZO8A 4E5XB 2F74B 3BP4B 3LKNB 2DQJL 1UC6A 4PP2B 4XNUL 1FORL 4HKJB 5EUOE 2HA1A 4I0PD 4LFHD 1ZGLP 1HI6B 2IG2L 1AE6H 4PJIE 4MJIB 3LZFH 5D7IF 5E70A 1SBBA 3QNZA 4P2OA 4LLAA 4F37F 1CE6B 2X7LA 4I18C 5EULV 3L5XH 5GS1A 2WUCH 1GGBH 1QA9B 3N50A 4ELME 5C0RL 1A4JA 1I9IL 3DETC 4KHTH 3NPSC 2YWZA 1RFDL 4Z7NF 5GS0D 1XH3A 3KNBA 1BAFH 1Z5LA 1ZLUK 5FCSH 1T2QL 4JG1H 4NRXB 3BP5B 1JHTA 3ILPB 1IARB 3AMLA 5DQJA 5CZVL 2PN5A 4ZAKD 5D70L 4P2OD 4M5ZL 1XIWD 3G6JF 1RJZB 2QHRL 4IRSD 1RIVL 1YNTB 2YBRB 4OJFH 4LPUA 2VLLB 2YHGA 2C9AA 2FWOB 5DD5L 2D0HA 4Y19E 2DQCH 4ZFGL 4RGMB 4GLRI 4DN4H 3ULUD 1FYTB 1WAAE 3GSQA 3DROA 3IS1X 1U8JA 3SGJA 2A73B 3T2OA 1KPUA 2IBZX 2DDQL 4OLYH 4S1SH 4LLWB 4PGBB 2X42A 3I9GL 4M8QB 1WFUA 5I1IH 3UEZA 4M9OA 3FMGL 4Z18A 1XIWA 4KI1A 3WL9A 4N9OB 4HWZB 3IFPB 4NM8L 3WO4B 4QRRE 1NDGA 3MOAH 1FG2B 4ZFZA 2OP4L 2V17H 4JFXB 4NNPH 5IFHL 3EHBD 5BZDB 1ZLWH 5HHMB 1MHCA 1UZ6E 4WV1B 4AEIH 4ZUSB 5J6GB 4YBQD 5JW3H 3DURA 2PW2A 4TNVK 1RUQL 3KXFE 3OTTA 3CH1A 4OFKA 2D4DA 5A2FA 2ZUYA 5CZXD 1PY4A 4K94L 4JANB 4P49A 4EDXA 5DJ0B 4CMHC 2FD6H 1FFNB 4QHMB 5HVWA 4L4TD 1RPQA 1ZSDA 3NZHH 3O3AB 4M8QA 2NX5B 2NY5L 4M6NL 5JMOC 1VB9A 1Y0LA 2DI9A 4QRPB 5HHXH 5JHDB 3RFZC 1GGCH 2JK5B 5C6PB 2BFVL 2D31B 5EO1B 2P24A 1D6EA 4W81A 4D0DB 3ARDA 4OZFA 1G9NL 1WWBX 4KK8C 3LCYA 1KJ2H 4KHXH 4XHJD 1C5DA 3MCKB 4HIJA 5KVFH 4E9LA 5BMFL 1JPGA 3MA9H 3EFDH 4R4NC 5I66A 4PJFA 2C3WA 2DM3A 4Q9BA 1C1EL 1DN2A 3WIFB 5LWYH 2RJMA 4PJ9C 3RWHB 2ADGB 5C0BB 2BCKB 4MQ7A 1KPUB 4OZHE 1U8PB 1Q9WB 1X4YA 4J23A 2HRPL 5FM5O 3AY4A 2R0WH 4Y19D 2DMCA 4PUBL 4MSWA 2Z31A 4NFCA 2VISA 1FFRA 4YDIL 3ABZA 5EOTA 3U30C 5K93A 2C1OB 3N1QC 3MRRA 4LEOB 3U46A 2XKUA 4GRMB 4FQQB 4DN3H 1EO5A 2X09A 4MJ5B 2W0FA 4PGEA 4J2XA 4HKZB 4WHDA 5DMKA 5E1AA 4Z78A 1IM9B 1ZWIB 1UZ8B 5I73B 5LGKA 1F2XK 3A0OA 4NQDD 3HNVH 1JRHH 4LCUB 1KPRA 4JZNB 3KS0H 5B39G 3RWFA 4YXKH 2V7NB 2YPLD 2OZ4A 1EHLH 4NM4H 4HF5H 4YXLL 1TZIB 4JFEB 5IMOB 1S7TA 4ZD3L 5KZCB 3DUSA 2JF1A 1DQDH 1BMGA 2A6DB 1UH4A 4ZPVA 5ADPL 4LCYB 1MI5A 3QUXD 1DDHB 2HT4C 1V8HA 4TUKH 1D9KC 2H3NA 3U30B 1LO3L 3RUGB 1GPOL 4KC3B 4NQDA 5T1DH 1G7PA 1C5CL 4ZQKA 3V2AR 3GBNH 1S7WB 1OB1A 1UVQA 4LPCA 3C5SB 4OI8A 4Y4HB 4QHKI 3V9FA 4ZTOL 5DRZA 1NCNA 1CK0H 5IFJB 1KJ3L 3WS6A 3EDDA 4N0UA 5IMOA 4KVCH 5DQDH 1E0OB 3UDWC 4KTEL 3NA9L 5K33A 1T1XB 4GKNA 1CFQB 3VXME 1VA9A 4J4PC 3VFOB 1KJ2L 2BVQA 4X5LA 4JFYA 2JJUA 4GRMA 3PIQA 2VLKB 5KS9E 2EDXA 2AJUL 1VGEL 4PGEB 4XRCB 3DV6B 4M3JA 2DQTH 5DTFB 5JW5A 2NY3B 5JOPE 2E3VA 1W72H 3KJ4C 1PW3A 1G0DA 1RZGB 5F89A 4GAJL 4ONFH 4MAUH 1JZ6A 3B9KB 4F9LA 1P6AB 2VWEE 5FYKD 3KHOA 3KPSD 4NQEA 5J13B 3BIBX 4PRPB 4QHNA 2CIIB 3PABA 4ZUUB 5I1JH 4Y4KB 4H26B 5J9PB 1JWSB 5FA3A 4QOKA 5DXWA 5FYJE 2PW1A 2VAAA 3STLB 1U2CA 4OD1L 4HDIB 1VHPA 2CDFB 2D9CA 4ZOEA 4PLOB 2EIDA 4L4TE 1ONQB 1KCVH 5IB1A 1S7WA 2EIZB 1T1WA 4P3CL 5GXBB 3FFCD 3BKCH 3AS2A 1TPXB 1I1AC 5IR1B 4GRWB 4PJ8D 5A2JH 6CGTA 5DURB 4UIKL 1LP9F 1JTOA 5ESQB 3OAYH 4DUXA 3C6SA 3VMOA 1MWAL 3MMEB 4G9DA 2VYRE 1RVFL 5GPRA 4MNHA 3MRLA 2ESVA 1N3NB 3W9DB 4GT7A 4OZGB 5DMGC 3MNZA 5C0JA 5FOBB 3QJFB 4G8IB 4PJCF 3BHBB 4NN6C 2VDKL 1HZHL 1JPSH 1N26A 3WFCH 2VITB 1DLHB 4Z7UF 3SKOB 4OFYA 4E41D 3FB6B 1NEUA 4ERSH 4FTVD 1WT5C 5D2NB 3MRPA 3CLEH 1HILA 2EDYA 2NQCA 4KMTL 4OCWL 4XPHL 4DFIA 1HWHB 3ARGA 4FHBD 1G6RB 3TO4C 3GKWL 5ICZA 3JTSA 4BH8B 5FM5M 1YJDH 2YD5A 2C3XA 2AJXH 4DEPB 4JO3L 4OZFH 2C5DC 1J0HA 4UINH 4OZ4A 5FK9A 1OP5H 3ULSA 3NTCL 4FNLL 3ARVA 1NCAH 2DJSA 4ONHA 3NZ8A 3FT4B 5CWSA 4WCYL 1XCTA 2HN7A 3MBED 4RGND 2D7MA 4WRLA 4FP8H 4HFUH 2Y07H 4DVBB 3KPRD 4HC1H 3QFJB 5INDB 4I3SL 3ARGB 3WNPA 5IB1B 4FFZL 3RTQA 3VFVA 1RZFL 3QWRA 2QSCH 2HFFA 3GBML 4H8WC 1N8ZB 5FGRA 1QSEA 1KCRH 4JN1L 3V0WL 4WCYH 3SGEI 5E8NB 5F9WB 5FIEA 4HFUL 4FP8L 2YUVA 1S9VB 4R2GC 5IW1A 1R5VB 5C0IB 2HLAA 3T65A 5C0FB 1NEZB 1DUZA 4OZGA 3D3VD 3QUZC 2CSPA 1XCTB 1DUYB 4KH2A 5J12B 2IFFH 4GAGL 5GRJL 5C08A 1ZT7A 2V5TA 3NAAL 2VZOA 4UB0H 5FK9B 4ACPA 3GMPA 2A0LD 4OIBA 4WUUB 5IMLB 2F58H 1A4JB 4BH7A 5ABDE 1NC4D 4PJGB 1BOGB 1EXUA 4DKFL 3I02A 1A6TB 4RMQA 5IW3A 4F2MB 1ADQA 2Q86A 5CMAB 4YDKL 4KMTH 1J88A 4XPHH 1MVUB 5FF6A 5I1IL 4IRZL 1PSKL 5E7FA 5EU7C 4PJFE 4RISL 5J6HB 1MAJA 5HHVL 4BFEA 2OL3B 1F42A 4D9LL 3ULUF 5SX4H 3OXRB 2ORBL 3C08H 3FFCE 2OTUB 5EPMA 3V95A 1SY6A 5KSBF 1YQVH 3FOLB 4PRHD 4RMSA 1PKOA 3KYMA 3ELAT 3W11D 1ES0B 3OG6B 4Q0XH 2KUTA 2QHRH 4KRLB 5HY9A 3PWNB 3OKEB 4NM4L 3MCLH 2AJSL 3QEQA 5I76A 2AK1H 3QUZB 5FYJD 4LCWA 2APBA 2XXCB 3OR6B 3WIIL 5F93C 2EE9A 1CF8L 3V52H 3TH2T 5AYUH 5BOPA 2D0FA 1I8MB 3SKUD 2EEBA 3GSXB 4LQFH 1G9MC 4IIQC 4JFZH 4DZBB 1NGZB 1YC8A 4JJHA 4XPAL 5IUSA 2P8LA 3TH4T 2ZUUA 3SKJL 5C0CA 2PR4H 2WUBL 4LLDA 4OM1H 3AUVA 2XTJC 1KG0B 3QEQD 1DUZB 4RBPH 4AH2A 1UEYA 2E8YA 3H3PL 4N9GA 4WFFE 2FEDC 1BD2D 2ICWB 4HCRA 3D2UA 5KOMC 5I1HL 1FE8L 3U79A 3TJHD 4OD3L 1UKSA 1BQLL 4PJGA 4X6DF 2DF3A 4DKEL 2CKBA 4RRPA 1QA9A 3U36B 4DKFH 1WEJH 2DBLL 2X4QA 2VXTH 2GHWB 5K9QG 3GHBL 2CKBH 5CMAA 1MRDL 5TH2B 3SY0A 5IQ7H 5L6YL 3BDYL 1MJ8H 3HRPA 3PWPA 1NCDL 5HTSA 4R96B 4NZTL 5HI4C 1QFUH 1ORQA 3S37H 1RZIB 3IU3A 3WE6A 4ZXBB 3ES6A 3OZ9H 3O41B 1U3JA 2RGSA 1LE9A 2CO6B 1GVIA 1H5BA 1RAMA 3PWLB 3JTTA 3NABL 3SKNA 5IROA 1SEBA 3IDYB 1FGVL 4PRBA 4Q9RH 1FL5A 5E94A 4D0CB 2QR0B 5C08E 2L0DA 1OGAD 2V2XB 4GBXD 1ZGLM 4QRTA 4UTBL 3P4NA 5FO9A 1EEUA 5D1QB 4GMSH 3RZCD 3SO3C 4M02A 3WL9B 3MRMB 4HS8L 5I18L 3SE4C 3GSOB 4RA0C 1Y0LB 3B9VA 1J8HD 4QRPA 1IAII 5KJRL 5C8JA 4FQ2L 3AREA 1N64H 1CFVL 1A47A 3NA4A 5F1KC 4L3ED 4OF5A 4I0PB 3LDBC 3S88L 4KY1L 4MJID 1ZMYA 3EGSA 1KIQA 3OWEA 4XCYB 4OGZA 4QXWA 4XPGH 1C5DB 2P8PB 1HXMB 3B6SB 1WCQA 4D9QD 4NN5C 4P5TC 1P5UA 2NW3B 3K4ZA 4MB3A 2Z92A 1JTTA 4QKXB 1JGLL 32C2B 2VDKH 1HCVA 2IPUK 4H8WH 1C16A 3OJVC 1F4XL 1QACA 2ZCKH 2FR4A 4MDIA 3O3AA 3D6GA 3KNBB 3QIWD 4WY7H 5EBMB 3S7GA 1CG9A 1KCLA 1CXLA 1K5NB 3WLBA 4Z7QE 3IRPX 3IT8D 1DSFL 1XIWB 35C8L 3T1FB 3VWKC 4AM0B 3PWLA 1PG7W 5E2TH 4KRNA 1EMTL 1JUFA 1MFEL 2OJZL 3VDBA 1I85C 2VLMD 2R4SH 3H3BC 4I0PA 3JXAA 3PHOB 3MV9A 3H2WA 4FQXB 1IGML 2AXJA 3ULVC 5EZJB 4CVXA 2AJ3A 2KBGA 1E4WH 2VXUH 2W65B 3I3DA 4CN4A 5L6YH 3D39E 1L4IA 4AG4H 2YBRA 1K2DA 1L7IH 1G7JB 4ZSOE 3LHPL 4MA7L 2XA8L 4X0KB 1Q9LA 3DMMD 2WBJA 4LVNB 3SDYL 3LKSB 4ZTPH 5F3HA 1EJ6A 2E7CA 5KVDL 3BGMB 3EYQD 3TBVB 4Q6IA 3F12B 3NH7L 4HQQL 3ZE1E 1OT1A 1RZFH 4HWZA 2A73A 4UU9B 5HHMD 3G5XA 3STZB 2J88H 2AS5M 2VC2L 5TQ0H 4FA8A 1A6AA 4Y4HA 2BY3A 4WDIB 3IDIA 4EDWL 1EFXD 2CD0A 3VA6A 2H1PH 5CSGA 1HHIB 4Q58C 3QO0B 3EJJX 1N0LA 3W0WA 3B83A 5D72L 1TXKA 1TQBB 1MY5A 3F7VB 5IBUB 2Y36H 4EUPA 5DZOA 3LKRA 5HI3D 3GMQA 3MACL 1B0GB 3ETBF 5FKAA 1OTTC 3U7YH 3WIIH 5DQ9B 1UFUA 5GRXG 4HZAA 4BK5A 2PETA 3T4AB 1UQSA 4I8DA 1YEDA 4LPWA 2SEBA 3SCMA 2VR5A 5J06A 3ULUE 1M71A 3O4LD 2VLJB 3HLAB 5GS2D 4IOIA 2X41A 3HR6A 3BWAA 3NN8B 2A83A 1WUNT 4P5MB 4D8PB 2GJ6D 3QI9B 2FECI 2HFEA 3QDGA 3NCYS 2QLVB 5CINH 2BOCA 5SWZB 3IJSB 4WTWA 3VFNA 3LKRB 2HKHL 4AZ8A 3ARBA 3QZWA 4HLZG 2OQJB 2FATH 4U05A 1IMHC 2BX5A 5C0BD 1FFOB 4GG6E 5T1MB 2IAMA 3PWJB 1FZMA 4XP5L 1TZHA 4GG6A 3CXHJ 2IADB 4U7KA 4P46D 1DANU 1T2QH 4JCLA 2K9UA 4U4BA 1CF8H 4X6DB 3VGBA 1A6WH 2QQKH 3EOBA 1MRDH 5BRZA 4LAQH 3CK0H 4I3RL 5KAQF 4X7CC 1FP5A 5CCKL 1MI5D 1AI1H 1Y18A 2W0FB 4UOW1 3TYGH 5SV3A 3LQAL 2I27N 2A1WH 1C7TA 5FEBA 1RK0B 4KVNL 3MV11 4G8GB 2XTJD 4L9LC 4N90D 4NQDB 2X4RA 3GO1L 5DHVH 3WFEL 4YHLL 3NZHL 1GAFL 4MNQE 4CBPA 3MLZL 3CVHL 3R8BB 4HK0A 3MPCA 4P9HL 3BYTA 1YPZF 4PFEA 4QXUL 4U3CA 2YZ8A 1TZIA 3DYOA 4JFEA 5KSUB 3FB7B 2Y9RT 4N0CD 1UCBL 4K8RD 1U8LB 4UIMA 2VLRA 1Q0XL 1PX3A 3ARFD 5CP3H 3KDMB 5IBUG 1A7PL 2GTZB 1KPRB 4JZNA 4MAYC 4UTAH 4P5MA 2APTA 4HJGA 1WC7A 2HAZA 2J7LA 1NCDH 4QNPE 5BMFH 3VXUB 1QSEB 4OKDA 3BRGC 4FFYH 2MQ3A 5C7XL 3WJLA 5I1KL 3MRPB 3T8XA 3T0EA 3OPZL 5C0CE 3VXRB 3QULB 2H8PB 3S96B 4UV4L 1DFBL 1TNNA 2GW5A 1P4BL 3MV7D 4PLJD 5F7WC 4HGKC 3V5HB 4KK6D 4X7DC 3QXVA 4NRZB 2MKWA 3HB3D 5I9QB 3VRJB 5ICYB 4GLRH 3ULSB 3OAZH 3TYFB 5ISZB 2P46B 3LQAC 1FBIL 2IJ0C 5E4IA 4WTZA 1S9XB 2B4CC 4MVBC 4P5TA 4LIQH 5A2KH 4NN6B 4PS4L 2VLKD 4KK5D 2N1KA 5I74C 1M05B 4MLIA 4P2QA 3QUXA 4U1NA 4R7NB 3QXTA 3H42L 5TF0A 5A40E 5J0BA 3U82B 1U8OB 4CN6A 3HAEG 1U8IB 2ADJB 3FO1B 3T2NH 1MCWW 3ROLA 3QHTC 5C09D 4P23A 2CDFA 4R2GD 3U9PL 4NZJA 4BM7A 1T0NA 2MQ0A 3HNSL 4ODHH 4RDQF 3GIZL 4OI9A 5EOCL 4EXPX 3FONB 5FFLA 2VXVL 1IFHH 4LRIC 4M1GL 5D7JC 3OKMA 2Z35A 5F71A 2NW2B 2V7HA 4IDLA 4Y4KA 1OAUH 3L3OA 3MX0A 5D9SA 1FGNL 4KZEL 1N3NA 2HJLB 3CFCL 3ECBA 1IT9L 5FHAL 4HK3J 1FZOA 2F5AL 2Z93A 2CRMA 4IDJL 2JB6A 1P53A 3ZE0F 4Z95H 5FOBA 3FFCB 4O2EB 2D2OA 3GKZA 3O4OB 4NZUL 1H3PL 4PJ8B 5LCVH 4ONFL 1SMAA 3OPZH 3AU1B 3TT3H 4LSQH 1NL0H 5DHXB 5DHYA 1T1YB 1IZJA 2FIRT 2ICWI 4X9BA 2VDML 5HHOA 3VXQA 2H8PA 3FTGA 4NBZB 3TO4D 5GZNC 4BJLA 4O4YH 1I4FB 1MRFH 3D2UB 4KK5C 1YEEH 5DJ6A 4UZGA 2OTUA 4HMEA 4Z9KB 2Z8WC 1CTOA 4C56E 3KYOB 3TZVD 4ZO6A 1EAPA 1HOCB 3QJFA 4ZDHB 5D5ME 2R0KH 1J05A 3BEWA 3MNWB 4LGPB 2E9WA 3QHFL 5GGRB 5FF6B 4MA1C 3EOAA 5JPMA 1MFDH 4QXGL 5DJZA 1HXYB 4PJXB 3UYRL 4AIXA 1U58B 1IE5A 3LS4L 4JB9L 5FECB 3ORJA 3ARTA 3MROB 2YA2A 2C3VA 4WFHD 4XWOD 1UB5B 2HTLC 1XGTB 2NZ9D 3U7WL 2Z91A 2F5AH 2HJFA 5KVEL 4EN3B 5KS9A 5IOPB 4EUPG 1I8IB 1TVHA 5C0IA 1RIVH 2BNRB 2CLZB 2P5WE 5TE6L 1C7SA 5KSBE 2CLRB 4POYA 3HFML 4JDVA 4OLWL 1JRHI 1P6FA 3HA0A 3EOTL 1QFWL 3VMNA 1KUMA 3T2NL 3ZT7A 3INUH 3GKWH 3UTQA 1CGUA 2I60H 3HS0B 5CJQL 1BZ9A 1AHWB 1TJGL 1UG9A 2O5XL 4J4PA 5J89A 1U93A 3I6LE 5F72S 4HJJL 2OCFD 5DJZB 4CU8A 3I02B 3RGHA 4EN3A 4I2XE 1CD1A 4XI5C 4KTYA 1QVOA 5EU4B 4OZHF 5EO0B 1WGOA 2MKLC 5D2NE 4CDGC 4C4KO 2EDRA 3QXAB 2C3VB 4HH8A 2RFXA 4JFHE 3QRGH 3VFWA 4C57C 1JNLH 4Z6AT 3P9WB 1QBAA 3QCUH 1KEGL 2LAGB 4YDKH 4A6YH 1FC1A 3RRQA 2R2BA 1MUJA 4XBPA 3MRFB 3IDXL 1VGKB 5FUOL 5LWYL 1CL7L 3QNXB 3B9DA 1EA9C 3LMJH 4FQLH 2ITCA 1U3HB 1FZJB 3Q0HA 3W39B 4L8BA 4OT1L 5EBLA 1HH6B 5B22A 3CFDB 4P99A 4JQIL 4L1DA 4PRHB 2ZUQB 4KHXL 1I8MA 3VGGA 3Q6GH 2LU3A 5TQ0L 2EIEA 4LLUA 3BUYA 1NGWA 3P40A 3UAJD 2EYRA 1OF2A 4BZ2H 5I1JL 1BQSA 1J1OL 4MNGB 2Z4QA 4LCWB 1A14L 3AB0B 1MPAH 2NTFB 3CVHH 4RBPK 2K7PA 3MRKA 1NDMA 1XGRA 3VFGH 1G7HA 4QXGH 3EO0A 3GI8H 3T4YB 1OAYH 3JSSA 3KPMA 3W82A 3EYVB 3KYMB 3Q6GL 3O6KH 4NT6B 1FDLL 2PUQT 2PW2B 3S4SA 5E8DL 5DJ0A 1U8NA 3P4NB 3O6MH 5FO9B 2R1WA 4GSDL 1HKLH 4QRRA 3LHPH 5DJXB 3RGVC 2MPAL 3QUMA 3SCMC 3VFRB 5C0EB 3RNKA 1N5AB 3A6OA 3W39A 1C08B 4BQCA 2NY3C 2HLFC 5H94B 1F45A 3EDEA 1LO4H 2ZG2A 3OB0K 1F6AA 5DJCB 5TF1H 1MHCB 4JHAH 2I07A 4LSVH 4LVEA 1UWGL 5BZDA 4JM4H 4RX4A 1BD2B 1BBJB 4UOJA 2W65A 1S7RB 1NLBL 2B1AH 1HNGA 2DBLH 2GT9B 5ID0A 4XCYA 3C60D 3QQ3B 2AQ1A 2CUMA 4PIRF 5DJ2B 4JPVL 3PP4L 4Z7VE 1LEKA 2YEZB 2GTWB 4LSPL 1W8OA 1BD2E 4C83A 2YUZA 1F11A 3G6JA 2H6PB 2EDNA 3CMOL 1A5FL 4JEGB 3BD4A 4LSDA 5MI0B 4QHMA 1JPGB 2X4QB 1CGSL 2DICA 4GRWH 4YGAB 4NN7B 3CLFL 3G04B 3GSNL 3HE7A 3D39D 2DOCA 2WP3T 1SMOA 4TUKL 3ULVD 4KTDH 5E9DA 5IT2H 3RX5A 4LSPH 4Z7NE 2DQDH 1WZLA 1I1AA 1JGUL 5DMIH 5JW4M 5BZWB 4KK8D 1FVCB 43C9A 3MRQB 4R96A 3WXWH 4MNGE 5CS7A 2DQGL 1MHPL 3O3BA 1FL6A 4XP1L 3HUJB 2VLRE 3EYUL 3GHBH 4X6CF 4XVTH 4Y16C 3QIWC 4GBXB 1YEJH 2L7JA 3QQ3A 3I3BA 4QT5B 3WV0A 2NPLX 5ICXA 1FCGA 4PB9L 3IGAB 1IQWH 1IM9D 2ERJB 5D1XB 4CADA 3MRBB 4H5SA 3OJMB 3QIWA 2HTKC 1RIUL 5D1QA 2R56L 1NSNL 3OX8A 1F6AB 1A1NB 4HJ0C 1IAMA 3DUSB 1TVBB 1T4KA 1CXHA 3DXAA 3D18B 4KJYA 1FGVH 1R3KB 4LDEB 4J3XA 4DGVH 3KPPA 4JRYB 4Z7OE 2YN5A 1DEDA 1KYOJ 1W72L 1ZXQA 4KI5C 2Z8RA 5BO1L 4YEEA 5DD0H 3HI1A 3M1BA 1KJ2A 5T3ZL 5DMKB 1A7RL 5D7SH 1L9MA 1IZKA 4K2UH 3F7YA 2ZSVA 4YAQA 4K71C 5ELIA 5J4MA 3QIWB 4GBXC 4AJ0A 4JFFA 1M6OB 1YECH 1AXTH 1IEBB 3HN3A 1EO8H 5CLTA 2XNAB 4BFBD 5CIPB 4XXDA 2BVTA 4PJ7F 2YPKA 2FZ3B 2VABB 4YHPA 4ERSL 4X6EA 1BGXH 4XPFL 2MCPH 3G9VA 2GEEA 5SX4I 4XMPL 5SWZA 4QRPE 4LP4A 4UMGA 3O3UN 5DK2B 4ZAKC 3MLUH 3V6OA 3CCHB 1QKZL 2Y7QB 4S11A 1INDH 4FQIL 3AS1A 2R69H 2X9XA 3ARBD 4FZ8L 4YZFF 2EDDA 2NY3D 5EORL 4HG4K 1RZGA 3KXFB 5F89B 2EIBA 2GJ6A 1K2DB 4LGRB 4PJCE 4XGZB 3OX8B 5E08L 3SCMD 4JKKA 43CAA 2CRYA 3UJIH 5DA4A 1T0MB 1DBAH 1W2KT 4HKBB 2DIBA 1OW0C 3NFPA 3Q1SH 2ZOLB 4YDVA 3SDDC 1FV1B 4JFFB 4M7ZC 1CBVH 2H32A 1Y6KR 3MJ7B 4L5FH 1VENA 3O4LE 2ARJA 3S36X 4QRUB 4XZUA 4HGWA 2R0LL 3QCUL 1KEGH 3Q5TA 1D3CA 3V0WH 2VZ1A 5MP6L 4IOIB 4P3DB 4MDJA 3BD5A 3O2VL 2A6KA 4OB5H 1Q38A 5D2LF 1UKQA 3VGFA 1YNKH 3SO5A 4UAOC 3IKCB 1REIA 3LEVL 1R6VA 5E2UH 2Y6SC 4WU7B 4MD4A 3H9SA 5GSRB 1I8KA 1NGPH 4YWGH 2E7BA 4N5EC 3ZE2E 3V0AC 1NUGA 4IIQA 4NPYB 4X4ZA 2XRAH 3B2VL 5MEPB 4Y19B 3S6CA 1FIEA 4N8CL 5LQBH 4BSWA 1AIFB 3KYKH 4RWHA 3VDCA 4HG4J 3RPIA 2F53A 2XZZA 4XBEL 2WIIB 3L7FA 3MR9B 2HVJA 4U1GC 3OB8A 2A6DA 4UQ3B 4ENEC 3RWIA 4TOYL 3TEUA 2OR7A 4PRIA 1A6PA 4JN1H 5JQ6H 15C8L 1XEDA 4QTHB 3V5HA 2Z0BA 4XI5D 1DANT 1NLDH 2ID5A 2DTMH 3JTSB 2NY4D 4BH8A 1CDUA 1W0YT 1UZ6F 3O2DL 1ZWIA 3GBNL 3GUTB 2ATKA 1JN6A 3WFEH 1P2CB 1MREH 5EN2B 3TYGL 5E6IB 1G6RH 1F00I 4NZDA 2EC9T 4WI4A 2KPNA 5E6YA 4ONHB 1JWSA 3TT1L 1JHKL 3GMMA 5MHSE 3QUXB 4U1NB 2PYFA 3RAJH 3TA3D 4TNWK 2W60B 3QRFM 3PDOB 4J1UB 4W68A 3SKMB 1U8LA 2AJVL 1IAIH 2XTJB 5KTEH 4KV5E 3KPRB 3IXTA 1J87A 1M4KA 2ZUVA 3NMEA 1K4DA 1VPOL 2R4SL 5IP4A 1S5IH 5ADOL 4P59H 2HTLD 1FSKC 5B38A 3A6BH 1G0YR 1H3UA 5FDYA 2ZPKH 3IDNB 4LNRB 4Q0XL 4GKZA 1F6LL 4U0QB 1BWWA 1BZ7B 3O3EA 2J6EA 2DQHL 1EUTA 2IQ9H 3PGFL 4J8RA 1FLRL 5EIIB 3VH8A 5I16A 4RIRB 5D1ZB 1EUUA 3SDCB 3FN9A 4OSUL 5F9OH 3RVUD 4JAMB 4WUUD 3AAZB 5ACZA 5TPWL 4A2MA 5B4MC 2EH8L 3MV7B 1SJEB 4GXUN 3CGTA 4XX1G 1QNZL 3QFDA 4H0HB 2XN9D 3KPSB 1IAIM 5EUOF 3VRJA 1KEMH 3BPNB 5FGCB 4LMQE 4FTVE 2R1YA 3WJJA 4YHYC 1TIUA 1NKOA 3L5WA 5BJTA 3KPLA 4LEXL 4KQ4L 3F6LA 2PW1B 4ZUTB 3ZHKA 25C8L 3L3JA 2HT2D 5D7JA 5GJTL 4U6HA 1AR1C 4JKMA 2YA1A 4A6YA 3NCBB 4FQCL 4EI5B 3T0ED 5FYJU 1RUAL 3G5YA 1L6XA 2OJEB 3GSXA 2XPGB 5I8KL 5D7JD 3LEYH 4XCFL 1J12A 1YMMD 4F8QA 1U8QA 4HHAB 1IAKA 3VMPA 1CLZH 1FH5H 3TA3C 4HKJA 3QEQB 5I76B 2VLRD 3BP4A 4QRQB 2IANE 3KPSA 3D1MC 4ZFOL 2P43B 4X4XB 3G08A 4MCZB 3TWCL 4LSQL 4M62L 2EKSA 1MCBA 2CDGB 3BVNB 3K8MA 4JAMA 4QGYA 1ZT1A 1ADQH 2MFNA 5TE7L 3PQYA 3S5LB 2V5YA 3FQWB 5IB4A 2XPGA 1DVFC 3HB3C 4AENB 2DI8A 1GOGA 1ZANL 3MLYL 4OGYH 2DLFL 4I3SH 3D85D 5F88A 2W1NA 3CFCH 1CICA 3GIVB 3ZZ1A 1TLKA 4ENED 2AEWA 1Y6NR 3L9RB 2GFBB 1ITBB 5I1CL 2YUXA 4JRXA 2WWKT 3MBEB 4RGNB 1ZT4B 3MUY1 4UIKH 4APQD 4MAYD 1JF1A 3QFJD 4LNVA 1IGIL 4JFHD 1DCLA 4TULL 4FFYL 1N2RA 1TMCB 4IOSD 3FN0H 4N8PA 5B8CC 4N5ED 1F90L 4RQQA 1ZT7B 2Y6SD 3UTQB 2VQTA 4PGCB 4LLYA 1MLCA 4PP1C 1OGAB 5DUPH 2OK0H 4KROB 1CLZL 1IGJB 1X5IA 2VDNH 3WN5A 1DQJB 5ESVB 3O8XC 4U1SA 4CW1B 4RZCA 4EN3D 2XWBA 3O6FB 4XNYL 3GMRB 1JHLH 4IJ3C 2O5YL 4JZJB 2UZIH 3DYPA 3BXNB 3SDXA 2YRZA 2VJXA 3P4OB 3S35X 4PRBB 2KDGA 4F7MB 3RGVA 5E5MB 3SKNB 1IJ9A 4ZS6C 1FBIH 4MXVF 3W81A 3DX8A 3Q5YA 1U92A 3ARRA 3QDAA 2JIXD 1V5JA 3VA2C 1V3LA 4X6CE 5GHWL 5L8LB 5HGAA 3UTTE 1HIMH 3ISWA 1E4XL 1RQ5A 1X44A 3BWUC 4HGMA 5JORB 1N6QL 1I1YB 2IWGA 4ZFFA 2XA8H 1PQZB 4OF6A 3MJ6A 3MRMA 3QUMH 5BZWA 1DE4B 4WFEE 1LMKA 4Z0BH 3D9AH 3FOMB 1NAML 4JPWL 5B39A 5GS0H 4XCEB 1GGTA 5ALBL 4XP9H 4N0FA 2FYYA 1NFDE 4NIKB 1BD2A 4KDTC 4LOUD 3AMKA 4OAWB 2HG5A 3IFPA 3P4OA 2VZ3A 2P24B 4R0LC 5EZIL 2AXFB 4N9GB 3CLEL 2F8OA 2R39A 3A6CL 3EDFA 1T80A 1B4RA 4Z95L 1AQDA 3AS0A 1FL5B 3V6FB 5HHPA 5C9JA 2YA0A 3ESVF