1S78D

Insights into erbb signaling from the structure of the erbb2-pertuzumab complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRQAPGKGLEWVADVNPNSGGSIYNQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into ErbB signaling from the structure of the ErbB2-pertuzumab complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Receptor protein-tyrosine kinase erbB-2
total genus 37
structure length 222
sequence length 222
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s78D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s78D01
5IM7B 1FE8H 1FC1A 4I0PC 1P9MC 1HIMH 4EZMA 1N7ML 1JGEA 3P2TA 1NLBH 1GGYA 5AZEL 4LQ1A 3F5WB 3KPPB 2GW5A 2VLKE 1QFUL 4ODTL 4GG8A 1TCMA 1H0DA 3OTTA 3GMRA 1FV1A 2YWZA 4ESKA 3BO8B 4OCMC 1J1PH 1DEEB 3GHBL 3FTGB 4LDEB 5EWIL 3CH1A 4ZXBB 3U7AA 3MV8D 5I8OL 2NTFB 1WISA 3K8MA 5H94A 4P5KA 1PGRB 4Z18A 3RWGB 1HHGA 2MTPA 2Z8SA 3U7WL 3KYNB 3O8XA 4LCWA 2H26A 2L7UA 5D2NC 3R06A 1S7RA 1TJHL 4JFED 4R96A 4APQC 1PG7X 4DN4L 2JE8A 4GRLB 1P6FA 1A6AB 4KKLD 2EDNA 1VA9A 4I48B 3C9NA 2GSIB 4TUKL 4I48A 1G1CA 3H9SA 3HPLB 3I6LE 4WEBL 4D0DA 1E6JL 4M4RA 1MJJA 1MFEH 4MAYB 3DMMD 2BVUA 2DYPD 4JFQB 4IIQB 1JPTL 3QZWG 1KLUB 4DZBB 5TJWK 3THMH 3VFTB 1OB1B 2YSSB 5F3BB 4AENB 3EW3B 1A6UH 4NQCB 4GBXA 4KROC 5F3BA 1HYSD 2NY5C 5ICXA 3ARBB 3AROA 3IRPX 2C3HA 3UBXG 3GJFB 3V7AG 1RSFA 3FB5B 4P9ML 1U58B 4N5UA 2GJZB 4JN1L 2AAVA 2CQVA 5LXGL 3OKDB 2XZCH 1J8HD 4HD9A 4O2FB 3QQ9C 1MH5A 4NC1C 2OR7A 3K4AA 1SQ2N 2BNQA 5IP4A 1Y18A 4HK3J 4U1SB 2E7MA 1RK0B 1V5JA 3MUY1 1Z6JT 4MJID 1NAKH 4Y1AE 4ZQKA 2H2SD 3GBMH 4MXWH 3T0BA 5EBMB 3TT1L 5TDNA 2JKXA 4QHNB 1I3GL 4AIZB 3A0OA 5GS2H 3P4MB 4PRHE 2D9QB 4LNRA 3M17A 4S0SD 3F58L 1I1FB 5B39G 3FQWB 5DJYA 2Y23A 1Q94B 3ELAT 3NCBB 4KQ3H 5JHLH 1JHLH 4YFDB 1SEBA 1EBPA 4FQ1H 4AEEA 2FZ3A 4X6FB 1MQ8A 2DBLH 4PRDA 3LPFA 3ARDD 4GXVL 4DGVH 4ZNEE 3B4NA 4PRBB 1C16B 5JPMA 1WQVT 3GSQB 2F9BT 2K3TA 4URTB 2FJGB 2FBJH 5LBSH 5DJ2B 3GSWB 5F7NC 5C3TA 2WBKA 2HAZA 5EPMB 2E6PA 1DVFB 1BX2B 1CZ8L 1Z0MA 3VI3F 4LAJH 3MLSH 5CP7A 1RJYB 4MQTB 1AQKL 1O0VA 3KPRA 1NBYB 3WDHA 5D1QD 3KYNA 4HEPG 3SO3C 5HHME 1IEBA 2VYRE 4GW5B 4S1QL 4DZ8A 3VXMD 3X12B 3L7EB 3NCYS 3WNPA 5HGGS 1L0YA 2Q76B 2KQNA 4LSQL 4WCYH 5CSZB 1T21B 3DGGA 3P4OA 3HI5L 5T3XL 4LU5L 1EGJL 4Z78A 4YZFF 5GRZA 5E7BA 4I1NB 3TWCH 3NIGF 5IFJB 3QFDB 4OGZA 1P1ZA 3L5WA 3QUXC 4HX1A 3UJIL 3DX7A 1HZHL 1BFTA 1ORQA 2JCCE 3WL9B 3GK8H 3W9DB 4ZFZB 1F4WL 1RUPH 5IOPA 1UWGL 1WJ3A 3UAJD 4BFGA 1CLCA 4Y2DA 1HH9A 1RHFA 4LPCA 1OT1A 1HH9B 3TBSB 3JWNC 1N4XH 1SMAA 1WFTA 2X4RA 4PJ9B 1TZHB 3IFNL 5F88A 4WFFE 3CPLA 3P4NB 5D70L 3BJLA 3VRLF 5IT2L 1VFOA 2L4OA 4LDLB 4UB0H 2CKBH 1DQJA 2H9GA 1U2HA 2CDEB 4G8GD 5KVGH 1CYGA 4MA7L 4QF1A 4XB8A 3BUYB 3MRMB 1D5MA 2FJFB 3SGKA 4MJIE 2WIIA 3SDYH 2GY5A 4MZ3A 1D5MB 2DMBA 2FJFA 4DFIA 4KI1A 2D0GA 3CVHA 3QO0A 1QNZL 1LE9B 1W72B 3UTTB 2B5IB 3H42L 5DHVA 3UTSD 3HKFA 4OFYD 1CICA 3IDMA 5C9JA 3LN5B 4F15C 3NGBB 1GHFL 3MGOA 4RFNB 3RA7L 2DQIL 5GGRY 4OGYH 2DBLL 3HZKB 3MNWA 4PJAF 5E9DB 2DM3A 5FYKL 4HG4K 1V3MA 5LCVL 2EEDA 5F9WC 1MOEA 1UZ6F 4HKZA 4NP4L 3LRGA 4G8GA 1TNNA 2EDQA 1QBBA 4MNGA 5I1CL 2AS5M 2VXQL 3JWDL 2CUHA 4FFYL 1KCVH 3QNYB 3X3GH 1J1OL 1TFHA 3RBSA 5LQBL 5SX4H 3RNKA 1RFDL 3OB0K 5GGSB 3MRNA 4MA1B 1NLBL 4ETQA 5DO2C 4HJJL 3OKLA 3MLZH 2DI8A 1JZ3A 3GRWA 4GXUM 2EH8L 3QT2A 1Z3GH 3RUGA 3WUWB 2VMFA 3GIZH 5JHDB 1MIEL 3ZTJH 5BZDB 1A0QH 2V9TA 2VWEC 1T20A 4C83B 3SDCA 4UDUA 5GIRA 5F1OB 1A5FL 1J0YA 5IV2B 4OAWA 4OD1H 6FABH 2YPVH 4M5YH 1AFVH 1JHTA 2PW2A 2VLJA 3D2UD 5L8LB 3CFDB 1QR1B 1JV5B 3DRTB 2DWEB 3AM8A 4O9HH 1ORQB 2C4FT 4RMVA 3WL9A 4HSQA 3O8XD 1P69B 3ARED 1LDSA 3M1BA 1FZMA 3BEVA 1CZ8H 2R2BA 1X5XA 1MEXL 2YR3A 4FP8L 3TZVB 3C5ZC 1LQSR 1J05B 2JB5H 5C0GA 1BM3L 3OZ9H 1MCJA 4QRTB 2RCSH 1T89C 4EBQL 1ZTXL 3BPCB 4EUPA 1ZHLB 3TBSA 1AR1D 5SWZE 3QIUB 1AJ7L 4EOWL 1CE1L 5JXED 5E1HB 1R5WB 1UJ3C 3HI6H 3V6ZA 5IB4B 1QBMH 1D5ZB 3GMOA 5GXBB 1NGQH 1WBXB 4YE4L 1DLHA 1G7MB 2GSIA 2G5RA 2XZQL 3W2DH 4G8EA 3QWOB 2B20A 3D3VB 4OZ4A 4UOW1 5DD0L 2DJSA 5IB1B 2ED9A 2VR9A 3RA7H 4QOKA 4XRCB 3QRGL 5I0ZA 5L0QC 2NLJA 2GAZA 4G6KL 1FO0A 4ODHL 1OTUD 3GSNL 3RHWF 3X13B 4F33B 4L3CA 2EIZA 4OLXL 5DC0A 5FO8B 3PV7A 4JQXA 2F53D 2NYYD 5IW1A 5ICXB 4NQDB 5JA8B 5HHVL 3G04B 4QWWC 1GIGH 35C8H 1DBMH 4G9DA 2MHAB 1VFBA 1A21A 3G5XA 2QKIA 5HYFA 1PZUB 5A16A 4JRXB 3WFBH 3CLFH 1UT9A 1I1AC 3P73A 3FO9A 1NC2A 2X10A 5INDB 3HPJA 1MJJB 1M71B 3BE1L 1LO4L 3MR9B 3HPJB 5LWYH 4PV8A 4QYOA 3PWPA 3M07A 4CJ0A 2VAAA 3BZEB 2GK0A 2RGSA 4PJBB 2BVQB 1CFTA 3GIVB 3LN4B 5CIPH 1HHIB 1WFNA 5EH1A 3WO4B 3BPNC 3F7VB 4GKZB 4KRPC 3FFCB 1WGOA 3IF1A 5FF6A 3VA2C 3M17B 5IJKA 1OM3H 1GRWA 3TLRA 5MEOA 1LO0H 5JUEL 2QSVA 4Z7OE 2QADB 1H3PL 3NCEB 3BH9A 3QQ4A 5IFHH 4NN5C 2ZG2A 1F11A 3D87B 3JV4B 4NO0B 1BD2E 4YDJA 4DKFL 3PNWA 4WDIA 1JFQH 5C07E 1BQHA 2DQCL 2HTLC 4I0PD 1CT8B 3VG0L 2PKDA 3PGCA 2LU7A 4Z7UB 5TPWL 5L8JB 5C6WH 1QFPA 1OAYH 5T1KB 2WANA 2WSKA 2P45B 4R90L 5EUOF 2QADD 4KUCD 4XPAL 4ZFOB 1UACL 4Z76B 2OTUB 4QRRB 2XRAH 1F6FB 1RUKL 1ES0A 3O45B 1IEHA 1V7NH 1AI1L 2R2HB 4J12A 4YHLL 1P5UA 4R7DA 3G08A 3LEXB 4BSVB 3UTPD 1GOGA 2ATPB 3LMJL 1I7ZA 1UYWL 3MJ6A 3KS0J 3QULA 3D18A 4KKLC 5FXCH 3C8HA 4OM0L 3LH2L 3U4EA 4QHUB 5EULV 2GT9B 2Y5EA 2IBZY 4ONHA 3VWKC 2IH3A 1HHJA 1E28A 2K7PA 4YFLI 5C0BB 1FVEB 1F8TL 3QEGL 2IH1A 4HS6B 5HYJD 1MAML 2F53A 5DD3L 4KK5D 4MAYC 1JF1B 3RAJL 1RJCA 5AYQA 4DOHE 4DTGH 3RUGB 3EDFA 2J12B 3UTSA 1FL6B 5B38G 4J3OC 3C60B 4Y5YC 5T5FH 1P53A 5FB8B 4DKDC 1RV6X 4U1KB 5ERWB 2CH8A 2G2RA 4ZOEA 4YXKL 3NFNA 3P0VL 4OT1L 3TZVA 2CIIA 4UV4L 1DBKL 4MA8H 4PD4J 4OZFG 3RY4A 4K9EH 5C8JA 1MI5A 3H6JA 3MUGB 1T1ZB 3VFGH 1XCQA 2K9UA 4PLOB 5EBWB 2Q87A 1CFNB 5I9QC 2D31A 4D9QD 1G7PA 4XXDA 3BGFC 4PJAE 4HT1L 4PJ5E 1OLZA 3QPQD 1NJ9A 4YXLH 4ZG1A 5A43C 1S7TB 3CSBA 4N1EA 4PRAA 1BFOA 3OKNA 3OR6A 5FV2A 1NGPH 1JYNA 4NT6A 4M1DH 4OKDA 3TCLB 1KN4H 1RIHL 2HMIC 2UWEE 2ZG3A 2VXQH 1AHWC 1W2KT 2V17H 1KTKE 2Z91B 2P49B 1NC4A 2YC1A 4QGYA 3FT2B 1GPOL 3EFFA 5TQ0H 3K0WA 4KRMB 4OD3L 2V5YA 3MA7B 5EU6A 2HJKB 1QYGH 1TQCC 2HP4A 5GSVB 1PZ5B 4YE4H 2VLJD 5IQ7L 5EG6C 3IJSB 1VPOH 3H3BC 1P4BL 3HZMB 1EMTL 3ZLQC 1T4KA 1HOCB 2HWZL 4JLRA 4WWKC 1FFOA 4YDLB 2W9EL 1QEWA 2M8XA 4P59H 5ICYA 3D9AH 5E8EB 2FEEL 3NTCH 3ALXA 1N5YL 3KAAA 1X5HA 2V7HA 5DHXB 2VC2L 4WTZG 4WFGE 1HINL 1ERNA 3DV6A 2VR4A 5FUCC 4O51B 3GI8H 3IFPA 3D69B 2V2WA 3GBLA 4MXVE 4OV6F 4RSVA 5J1AA 2YZ1A 43C9A 2R1YA 5K9QI 1QBAA 3KXFA 1Z2KA 1H3UA 2X1OA 4HWZA 5CLTA 3BRGC 3H3PL 1BP3B 2DLTA 4NN6C 3QG7L 3DMMC 4R2GD 1AO7D 2NY5H 3DSFL 1IGYB 3DHJA 5J0BA 2BY2A 2EC8A 1JHLL 1I9JL 3V8OA 5E08L 4YBQC 1RUMH 3HZYA 5KVFL 2XQYG 2R69H 1XEDA 2ZSWB 4HKBA 5DJ6A 5FDYA 3GSUA 4OQTH 4XCFH 4ELKB 4Z7NE 5FM4A 1EUTA 2YEZB 5E00A 3OPZL 5DC9B 3BGMB 1XF1A 2NZIA 4X4XA 1G7IB 2O5ZL 5IMLA 4JQXC 2E27H 1WFOA 1KEGL 4K8RC 1T1WB 2NY7L 3GEWB 4QHKJ 2X6MA 5MENA 2VLLA 3QIBD 2R2EA 1TXKA 4K3EH 3G6DL 3OZ9L 1KPVB 4TQEL 4X6BA 4XX1G 4R7NB 2ZUQC 3MO1B 2GY7B 1T5XB 4U1GB 1N64L 2NTSP 4FABH 4Y5VA 4O2CB 4WHYG 3DVGA 1T6WA 4ZTOL 4OM1L 3W2DL 3FQTB 4J8RA 4PFEA 5MEND 5EU4A 1KB5A 4FZ8H 1E28B 1YC8A 3UPCA 3ILPB 3IJYB 3OF6D 5D1QA 2Q8AH 4Y4HB 2GCYB 4FZ8L 3LAFA 5MENE 4X6CF 1FCGA 2C3VB 4M7JH 4UUJB 3O4LE 4NQVA 3WN5B 4AMKH 1N6UA 1IT9H 4RGNB 4OZHB 3C2SA 4ZDHB 3TO2B 4X9GA 4MCYA 2R15A 4JFOB 4GW5A 1JF6A 3SJVE 2WLYA 2IF7A 2HFEB 3ROOA 3KPOB 3QB7C 4PB9L 1CU4H 3KXFD 3WYRA 3LKQB 5DEFA 4J1UA 1S7SB 4NZTH 4O2EB 4QXGL 2HMID 1UM5H 3BKML 3TBYB 4FQHA 4OCSL 5EC2A 1NGYA 3MQIA 1VADA 1MCWW 3L9RB 5DRNB 3WNNA 4BK5A 1P2CA 2AXJA 1S7UA 4ZD3H 4KRLB 3RY6C 5DMYA 4EN3B 4UTBH 4N90E 3WXWH 5IEHB 3MFFA 3N85L 2KZWA 5IROC 1P5VA 1IAIL 5EIVA 3D85A 3I9GH 4YGVB 2FX7H 2NXYB 3KYOA 1N0XL 3LKNA 4K3JL 1KN2H 3H8NA 4X5XA 4HLZH 1AC6A 3DV4B 3DXAB 5KAQG 4HUVB 1RVFL 3U4AA 3RU8H 4LLAA 5GGSA 4RMTA 2MCPH 3KPPA 5FYLH 4RMWA 4JFDA 3VFOA 1ADQA 5FYLL 2YRPA 2ESVE 4Y4FB 4NN7C 4W68A 1VHPA 2WP3T 4UT9L 4FQCL 1XR8B 1S5HB 3O6FB 3BP4B 1NGZA 1Q0YH 1CGSL 4NPYA 5IBLC 1JWMB 3U82B 4LLDB 1FNEA 2NYYC 4JO2L 4KXZI 2BHUA 3FB5A 5EORH 1JZ4A 4YHKL 1X4YA 4O2CA 2XTLA 3LD8B 4JKPH 4PJAA 3P0VH 1UB6B 4OT1H 2ADIA 3PP4L 4M8QA 1CFVH 3G5ZB 4PGCB 3D9AL 5FUOH 3T0ED 1RK0A 4XVUC 5D1XC 3AMLA 3TBTB 4X8XA 2QLVB 4WU5B 4HFUH 2HVKA 2FLBT 5KANI 4RX4A 5D2LF 4L4JA 3F7QA 4YBLB 2J8UF 4OD3H 2Q20A 2C1PA 1A3RL 3MZGB 4KKAC 5ILTH 4YC2C 1IGIL 2Z0BA 2OBGA 1UGNA 2UWEF 2X4UB 4H1LA 5F7MC 3GMMB 1ZHKB 5AWNH 4ONGL 1B88A 4PRAB 4H5SA 1YEGH 3SOBH 4HPOH 1I8KB 5KSAC 4M61B 4MDIA 1AE6H 1DEEA 1BWWA 5HPMA 3DYMA 4IHOA 3D3VE 4PUBL 4JE4B 2V2XB 4M7LL 3V6OA 3LRSB 2LU4A 3LS5H 1JRHL 4XCFL 4KI5D 5F44A 3C08L 2PW1B 3PHOA 5JXEA 1FFPB 1U8MB 2EDLA 3AB0C 2EDTA 4QTIL 1J0IA 2CDFA 1NANI 3P30H 3MRBA 3VFVB 4N8VA 1MUJA 3CZFB 4HS3B 3FQXB 5GZNC 2CDGA 4G8GB 4XBPA 4MLSA 1IILE 3H3PH 3G5XB 4NT6B 2XY1A 5M95B 3S35H 1IM9B 4NO3B 2MSPA 2AKRB 4X80H 3QJHA 3TJEL 2FD6H 5A1AA 2LTQB 3JXAA 3EDDA 3DO3A 3T0EB 5HHQA 5EZIH 4MMXC 3UYPA 4I3RH 4HIXL 2R56H 2BVPA 2X4SA 4FA8A 3QCUH 3MV8B 1KTRL 3BSZL 3VE0A 4JJ5A 3S8WA 5BXFB 2P1YA 4JM4L 4YX2L 2FO4A 4U1IA 1VEPA 4JO2H 2DI9A 3IU3A 2KQMA 1OM3L 1IAMA 3EYOB 4GOSA 1FZOB 1D6VL 3BEWB 3QWQB 3UTPE 4OIAA 2X4QB 5FYJD 2DQJL 4KJQC 1KCSH 3BPOB 1NC2D 1TETH 5D2LA 3ULVC 3KPSB 4MJ5A 3EJZC 3L5IA 3BUTA 1NC4B 1FNGA 2YC1B 4LSSH 5CHNB 3FRPG 4LPWA 2APVA 1XCTB 1JGVH 3MYJB 3ZTNH 5EUOE 2DQGH 5DJ6B 1BD2B 5J11C 5T1LD 3SDAC 5TFSL 4NC2B 2BMKA 2DBJA 4QHKI 4ENEC 3VI3E 2NNAB 3QA3B 4JANB 5JLZB 3ARTA 4NRZB 1UADC 2VNCA 4BFIB 3OX8A 1KJ2L 1J87A 1A7PH 4ZFZA 1NC4D 3PQYE 4ZO8A 1D9KA 4KKCD 5I15H 5EOCJ 1NFKA 5DFWH 2FX8H 1AD0A 5MEPB 2ZCLH 3DHMA 5F7UA 1WC7A 1KLGB 2NXZD 4KZDH 4KZEH 2FZ3B 4X6FA 5TGBA 1CFSB 4KZDL 1T21A 4WUUE 2Z4QB 4JGMA 3MREA 4MWFA 4Y7MA 4ELKA 3QNXB 2COQA 2DWDB 5BMFL 3O2DA 2ARJQ 3HRPA 3OKEB 4OM0H 1DL7H 2BY3A 1NFDA 1YUHB 2NXZB 4PJFE 1Q1JH 1JRHI 5CMAA 2EDHA 3WFZA 1T7XA 4NGHL 4HCRA 1NCNA 1S5HA 3GHEL 2DLGA 5CJBA 2P24A 4RIRB 1AH1A 4S1DD 4MXQC 5H8DA 4MNQA 4PGDA 1OD9A 5EIIA 4G9DB 1IBGH 1K6QL 4YHYB 2FBOJ 1IL1A 3WNMA 4NHCH 2V5MA 4L8SC 4XNQB 5GS1C 5L2KB 1HYRC 3QEQD 1Z9MA 3ARBC 3HFML 3EYSL 3LKOA 5E2WH 3RIFK 3SGDI 5CGYD 6CGTA 3W9EB 5ALBL 1PW3A 3QHFL 1WWBX 4LBEA 1WWCA 2F5AL 1ZVSA 4WUKH 3V6BR 3X11B 4NBYB 4WWKA 5FYKH 3DRQA 5B8CC 3OG6B 3I50L 4JFFA 4J3XA 3ARGD 1F13A 2XZAH 3UO1L 3U79A 4G3YL 2JTDA 5SWQB 2VXVL 1RUAL 3MRPB 5E5MA 4OSUH 4PR5B 3EYFA 2VZOA 2E5EA 1FG2B 2RQ8A 4QF1B 1N8ZA 4OJFH 1OY3B 1KB9K 5JMRA 3PNWB 1OL0A 4PGZA 4KKBD 1Z5LA 3VDCA 2Z31A 4GKOA 2X4OA 4HUXB 2B0SL 4PJDA 4RBPK 2NR6C 3PG2A 2YK1H 5ID0A 3OR7B 2BXZA 3H9SD 3VGHA 2R8SH 3D2UB 5F97E 2WBWB 1FCCA 5F7HA 1JBJA 3ARGA 4HPOL 4R3SA 4P2RD 1WFUA 1FAIH 1MCLA 2J7LA 5IVNA 4HEME 4Z0BH 1AFVL 2V7NB 4NZRL 5CD5D 1NL0H 2PXYB 1U8OB 4I8DA 1XGRA 2P43B 4OAWB 1BLNA 3WFEL 5C0RL 1JGVL 3QAZB 3B5TA 2B4CC 3LKQA 2PO6A 1A6TB 3U9PH 1ZGLM 3ULVD 5CSGA 1BEYH 2MHAA 2IBZX 5EUOB 5GJTH 4Y5YA 5CSBA 2DAVA 1XGQA 2NY0C 3WIHL 4W4OA 5EUOA 4QT5A 4CU6A 4Y5YB 2OL3B 4IMKC 3E0GA 5DVNA 5IKCB 1XGPB 1G7LA 3HLAA 4FMKA 4KMTH 5TF0A 1BIIB 2RAMA 1T3FA 1VB9A 2F8OA 3MRJB 1TJGH 1AKJD 3HMXL 2IGFH 4RIRA 4FFZL 4LIQH 1YNTA 2DKSA 3Q0HA 2HKHH 3V6OE 3IAGC 3O2DH 4AYFA 3U0PA 4L3EA 1L0QA 3L5HA 4Q0XH 2NXZC 3PP3H 3FQRA 3O2DL 1FYHB 4I4WA 3QUYD 4X8JA 5E00B 3ARFB 2NX5A 4XMPL 4M7KH 3WNLA 4UOJA 1NSNH 5ECJE 4LCIH 4LEOB 5D1ZD 2OJZL 5C2UB 4HUKB 3ZHKA 3JWOH 4GRWF 3WFCL 1UJTA 3HB3C 4ZAKC 5KS9A 3TJEH 1E4KC 4X6BB 5K59F 3SJVD 4P2OB 4HFWB 3VWJB 3KXFE 4HMCA 2HA1A 5D7LB 4K2UH 3ZT6A 1HQRB 1KFAL 3CVIL 4ZFOL 1OW0A 2QSCH 3B3IA 5C0JA 3EO9H 4UQ3A 1NCDH 2VE6B 4FQQB 3NABH 2OCFD 4PRIB 1HEZB 3PL6C 4DCQA 3QUZB 4WI7A 5DJCA 1CDHA 3DBXA 5BRZB 4NUGL 2MNUA 5CJ8A 2YD4A 4NUGH 4KVNL 3K1DA 4OZFA 5FYJL 5CEXA 1MFAL 5BW7A 1ZMYA 4H26B 4K8RH 3VGEA 1UM6L 3X13A 5BVJB 3H9HB 3RNKB 1RU9L 2D0FA 2XZAL 1X4ZA 1I1AD 4PIRF 1MI5D 5J57B 3UBXA 3U4BL 4JRXE 1RZKC 4RISH 5KN5A 1B0WA 4KKAD 2JF1A 3QNZA 4JPKH 1JZ7A 3TM6A 1TETL 3SDXB 1MFBH 1UZ8A 4KDTA 3ZDXE 1LP9F 3DGGB 1S9XB 1F02I 1JI2A 3FB8B 4M00A 1TVHB 1AGFB 1IC4L 3GSVA 4WY7L 3MRLB 1U91A 4WUKL 1X5JA 4P48A 2BMKB 3VXSA 3RWDA 4KKBC 1WZLA 2QQQA 1IC1A 4EJ1C 3VD4A 3GSXA 2IGFL 1A6VH 4IS6B 1XGUB 5ITBH 2AK1H 1T0PB 4WFHE 5B8CB 1ITBB 4OCXH 1IRAY 2W60B 1XGTA 3RVWC 1I7TB 4XBGA 4EN3A 5GS2D 4NP4H 5J8OA 4MLIA 1QFOA 1KLGA 3QHZL 4PJHE 4MGXA 1NMBL 4PJ8B 3GSNB 5FOBA 5FECB 4U6TA 5BJTB 2CO7B 2W0PA 1DN0A 4R97B 1T83C 3MMEA 4TSBL 4ZUWA 3M8OL 3CPLB 4KVCH 1G7IA 1F58L 1TTFA 4AT6A 4CW1A 1WCQA 4ZTPL 4XAWH 2CK0H 1ZLVK 1I85C 4LRIA 4LCCA 1DBBH 1P84K 1YNKH 3B6SA 5DQDH 5B3JE 3LZFL 5J9PA 2IAMB 3DJ9A 1PSKL 4G7VL 2AJSH 1FZOA 5CJXC 1W72A 4HBCH 5EU6B 1H3WM 3GMLA 3OF6A 1H15B 2R1XB 4YXLL 2HTKD 5CWSB 3QUZD 3SN6N 2IPUK 4F9LA 1BFVH 1N4XL 4N9OB 2YMXL 4YK4C 5BRZD 2Z35A 4ERSL 4LCWE 4JKLA 1IEBB 4YDVA 3EBAA 4HC1L 3VFGL 1FVCB 4BQ6A 4NQSA 1N26A 2CPCA 4WI5A 3ROLB 3VCLB 2BOBA 3EZJB 4XNXH 2V5TA 1UKSA 3LEVH 1S9KC 4HS6A 4GAYA 1A6UL 3DROB 2FJHB 2XOTA 5ANME 4RGOL 5DI8A 3Q6FB 3A67H 3F58H 3Q5TA 3JTTA 5BS0B 3HI5H 4N9GA 1IC5H 2A0LC 3O11A 5EA0H 2OM5A 2ERJB 1BFSA 3AVEA 3MBXL 4F37K 2JB6A 2FR4B 2W9LA 1QSFE 4OKVA 1NH6A 4NWTH 4P2RA 3QDJE 3P4OB 2PXYC 5B3NA 3V6FB 3E6HB 3BIKA 4IRSD 1ZE3C 4N1CA 4P99A 1SY6H 3RWHB 2X4OB 4HUXA 1KCVL 2J8UA 2ZUTA 4AIXA 1S7QA 2GTWB 2FWOA 5AD0A 3SKJH 3MLUL 1U8LB 4X7SH 4MXQD 5IBTH 3VFVA 4KKCC 2PO6C 4M1DL 1U8PB 4LAQH 4FQJL 1ZEAH 4R4NC 2V17L 1SYSB 2CGRL 3T0EC 1FNHA 4P2OA 3VWJA 4LU5H 3LVEA 4MQ7B 5HI4D 4K3DL 1KTDA 1UC6A 2XTJE 4KVNH 1B0GB 2VDKH 4OLEA 3SGKC 4WIQA 3FMGH 2CUMA 2QEJA 4JHAH 3S36X 4PJCF 3CFJA 3GBML 1N6QL 5SX5K 3GJEB 4F7MB 2FEEI 3JBG7 4QT5B 5ETUA 5F7EL 2AJ3A 4JB9L 5KVDL 3RWJA 4G7YL 4PJCE 1L7IL 2A9MH 4XVSL 3T4AA 3P9MB 5CD3B 1F4YL 4OUOA 1RJYA 2DQEL 4OLWH 5CEZL 3AU1B 2ZCLL 1NGZB 1K8IA 1DE4B 5DUPL 2BC4A 1B0RB 4Y88A 1Z9LA 5DMKB 5JW4M 3WEXA 5AEAA 1HINH 1Z0NA 4RWHA 5EOTA 1WEJL 3IDUA 1HKLH 1VFBB 4YC2B 4IJ3B 1HQ4B 3QG6A 3DVGB 4PLKD 1MCPH 1IAIM 2Q86A 4HWEL 3JV0A 3EKCA 2GITB 3FT4A 3P40A 2A83B 4OCYH 5HYJB 3L7FB 4M6OH 1CVRA 2XA3A 2OQJA 3P9WB 2R0ZL 1DEDA 1P7QA 5IQ9A 4WUUA 2CRMA 2VSDA 3HMXH 4WEBH 2A9NL 5JDSB 3VU2A 2AV1B 1KENH 3QQ9D 2Z92B 4ORZC 1Q0XL 4XCEA 3KR3H 3RWFB 4RAHA 5F6HJ 5FK9B 1ZV5A 1I7RB 5FK9A 3CD4A 3MCKA 3O11B 2X89A 4F7TA 4X4XB 2FL5A 3AREA 4HF5H 3GJFH 4O00A 5JPNB 1J1PL 3GHBH 4HC1H 1T03L 3UC0L 3T2OA 4XPHL 3L3DA 4YDJB 2HT3D 3VA6A 2J8UB 1A9BA 1KTLA 1JYXA 3ULUF 1HXMA 3AS0A 3L3OA 2ED7A 4IOIB 1HXMB 1MCIA 1E4JA 1QZ1A 2YSSA 3AXLB 5C86A 1KIRA 1OQXA 5EUKA 3MJ7B 2AXGB 4TUKH 2DTML 3ZE0E 4XRCA 4ZPVA 2AEPH 3LZFH 4HZLA 4RQQB 3MBXH 1T1YB 1GC1L 3M45A 1ZA3A 2JJTC 3G6AB 3H9YA 4EN3D 1JHTB 2JK5A 5GGQH 4EI5C 5IB4A 3CXDL 3V6ZB 2JJSC 2BSRA 3V5HB 3ARPA 4M48L 2FECI 3MBEC 3Q1SH 3WUZA 3ZYOA 4OLVL 1BFVL 4JN1H 3DI2B 5J12B 1IT9L 1GGCH 4KJPC 3LEYL 2X4PA 4IRZH 4GRLC 4P2QE 1QRNA 4HGMA 1R3JB 4JZJA 4IIQA 1BOGA 1N5YH 4K3JH 4MJIA 2XPGA 1FNAA 3BESR 2RHEA 1IGCL 2XPGB 4MNQB 5DRWB 4B53A 3GSNA 5EOTB 5D1ZB 2Q1EA 2QQLL 1EXUB 1DR9A 4FG6D 2IPKA 3CK0H 3CZJA 4ZTPH 2NNAA 3K4ZA 2GTWA 3CH8A 1QHOA 2ZPKL 4OZIF 1FNSH 4UT9H 1YPZF 1QFWM 4JN2B 3V6FA 3RVUD 1RZ7H 2HN7B 4TSAH 3S34L 3SPVB 3HB3D 4S2SA 1NMBH 4TUOB 3BMWA 3WD5H 2DKMA 4QHLB 3UTTA 3DVFA 4NM8H 4EIGB 1CE1H 1RQ5A 5C08A 4M1CC 3K2MC 4P2YA 5JW5A 3NCCB 1KJMB 4JRXD 2PF6A 1TPXB 4TULH 1OSZB 4P4KB 2PYEA 3SGJA 4ERSH 4XPGH 1C7TA 3QFDA 2X4NB 5FIEA 3KG5A 1YEHH 2G60H 3HHRB 3CFBB 3CSPA 1F00I 5A16B 4ISVB 3ARVA 2BVEA 5EU7E 3U0WL 2OR9L 2NW3A 2Z91A 4QCIA 4ZPTA 3ROLA 2IG2L 3VCLA 3BIAX 1I1YB 5JXAL 4H20H 3SDCD 1MREL 3T3MF 1FZKB 3G9VA 2VITA 3CLEL 3OKKA 5D1XB 3IJHA 2EIZB 1CFTB 2J3SA 3EJJX 2FX9H 4NO2A 4LCWD 2RBLA 4PPTA 1DN0B 4QOKE 5IK3B 4AQ1B 3O2VL 4UINH 3IS0X 2ZCKH 4JFYA 3EYOA 5D71H 4JFDE 4PRPD 4YGAB 3KLDA 2WINA 3L3KB 4ODVH 4P46B 2ATPA 4TQEH 1F6AB 5CINL 1SEQH 1YEKL 5B21A 2D7QA 5KW9H 4PJCA 2VDQH 5BVPL 3ORJA 2GITA 1WK0A 3FT4B 3SKOA 3NIFF 2NY3B 1EV2E 1E4WL 2HFTA 1YQVH 2YD3A 3DUSB 1VEMA 5JMOC 3QUZA 5DJCB 3AREB 1L7TL 4XP5L 3O4LD 3VFNB 5D1ZA 4YHOL 1MRFL 5CILH 1XZ0A 2P5WE 5BOPA 3RL2B 3JV4A 1BZ9B 3W39A 5FHAH 1GHFH 2PTTA 3IDGA 4HJGB 2XN9B 2D3VA 3K4DA 4P2CG 4M3JA 3QA3A 4POZD 3VD7A 3MJ7A 4FQXC 4WHYH 3VXQA 3UCRA 4Q74A 2HFGL 4KROB 4JO1L 4P2QB 3OWEA 3A6BL 2PYED 1D5BA 4K3EL 4W6WB 2DQDH 2A0LD 2OTUA 4QRRA 4JG1H 1X5GA 1CFNA 3S96B 5ESVB 2YUVA 2J6EL 4IOFD 5I76A 1JGLL 3VXME 2QQKH 3O9WB 4LEXH 2YK1L 5C0EB 5IVXE 3BWAA 2YA2A 3R0MA 1I9JH 4I5BA 4U7SA 3OKDA 4GRLA 1DBKH 4MVBD 5K9OB 2GIYA 1IARB 2XICA 2VLJE 4K9EL 1I7TA 5CJOL 1RUPL 2NY4D 4MMZC 5I1IH 1ETZA 1FZJB 4FQLH 3QEGH 2E9IA 1H3VA 1ETZB 1FZJA 5EU6D 2WBJC 2R0LL 1YMME 3JV6A 4OZGE 3GMQB 1RZKH 4UUJA 4DTGL 1VGEH 3GIVA 2JIXB 2VC2H 4MQSB 3L1OL 5HI4C 3V0WL 3V79C 1NGPL 4EDWH 1BJMA 1ZK9A 3PDGA 3W0WB 4JM2A 4NZJA 4FQ2H 5TH2A 1MJ7H 1R3IL 1T04B 4G8FB 5CMAB 5CIPA 4XMLH 1DBAH 3R1GH 1F11B 2YPLB 5GGUB 5A2FA 1ZVSB 3AU1A 2HRLA 1V3LA 4WUUB 4M7LT 2MFNA 4UMGA 5F9JA 2QL1A 4JPWH 1EFXD 3FFDB 2O93L 2HJFA 1CFSA 4J4PC 1A3LH 3GMRB 4P9HH 3O2VH 4I77L 4G8IA 5DD0H 1II4E 1U42A 4K71B 5C0IB 2LVEA 2UZYB 5E8NB 1MSPA 4ELMF 3DBXB 1SVZA 2A74A 1RJLA 4KGLA 3TN0B 4A6YH 2VZ1A 3C6LC 3JWOL 2CXKA 1GYAA 1XF5B 2EO9A 5DVLA 1T0MA 2Q8BL 3IDNA 1X5YA 4U3HA 3V5DB 3WFEH 1HILB 3EYVB 5JXAH 4LPTA 4XP4L 5DO2D 1H3PH 4KJYB 5C9KA 2B0SH 4P5MA 5I1DA 3X11A 3GRWH 2HT4C 1XGPA 2VDQL 3OR7A 5GQBA 1MCNA 3ARFC 3BZFB 4X6EA 3S88L 1U58A 1JTOA 4U4BA 2Y9RT 4G9FB 1OOAA 4NNPH 4NO0D 1TQCB 4HQQH 2NMSA 3EYSH 1S78D 4DZBA 1LO4H 1CGWA 5JPNA 3BP4A 5I75C 4P2RB 4PGBA 5GGSY 4TVPL 2ZKHH 3MV8E 3HRZA 3NCJH 4OZFH 2XRAL 3OQ3B 4C56E 4O51A 4FFVC 4FQLL 4Z78B 2EE9A 3FB7B 1AHWA 4KGJA 4S1SL 5MI0B 4KK5C 4MAYD 1YN7A 1JGDA 2ZCKL 3S97C 1S3KH 2OMBA 4NQTA 5E6ID 5F7LB 3ZHLA 3ET9F 3MTRA 2ICES 1NCUA 1LP9B 4HJJH 1E27B 3V4VH 4M1GH 4ONFH 4DW2H 1U0QA 4JQIL 1K3ZA 1HNFA 3TVMC 1G0XA 2R23A 1JVKA 4XNMB 4WJ5A 4YFEA 1KBGH 3OAUH 1GZPB 1QD0A 2YKLL 2Q7YA 3MSPA 5C70A 4L4VD 4CMMA 4J2XA 2DQTH 2VDPH 3RTQB 1EVTC 3BW9B 1YEHL 4DGYL 2P44B 4GBXD 5EU5A 4GS7C 1SJEB 3MV7D 1NUGA 1Y0LA 1RULH 5KS9E 3NZHH 1I9RL 4YDKH 4MHHI 4YHOH 3UYRH 1U2CA 4YDKL 2EH7L 2HN7A 1H8OA 3HE7C 5D1XA 4OZFB 1G9MC 5C09E 4DQOL 4IMLA 4PRHA 3T1WA 1BQUA 1JTPA 1UM4L 3V4PL 3QEQE 3D0LB 1T5XA 2CKBL 4I9WD 2FGWH 1ZTXH 3ZTNL 3VWKA 1A3QA 3WJLA 4LSRL 4XBPB 1AJ7H 2Z35B 3LHPH 2IPKB 2IBGA 4N8VB 3KLHC 4KK9D 5DURD 4XPTL 1A6WH 1FORH 2AEQH 5ADPH 4ZFFA 4EVNA 4U1MB 3QIBC 2A2QT 5C7XH 3T2NL 3MODL 5KANG 4Y4HA 2WQRA 1KIQA 2Y5TA 2V7HB 2YPLE 1A0QL 1WTLA 3EGSA 3I6KB 3CAFA 3DV6B 1NEZG 1UH2A 3ZKXC 1BBJB 4PYGA 5GRJH 4ZUVA 2ENYA 3TF7C 1GAFL 3TFKD 2EE6A 1U93A 1DANU 4D0BB 1J10A 1Q9OA 3AAZB 3OJDB 5C0BA 1S7WA 3QZWA 4WUUD 4L4VE 3RTQD 2JB6B 1PAMA 3BEWA 3X3GL 3QO1A 2R1WB 1T2XA 1JZ8A 3ZT7A 5HHXL 3SKMB 3FB8A 1FAKT 3UTTD 1EEYB 1U3JA 2VDLL 3VFPB 2WIIB 2C3XA 3MLSL 5SV3A 1BM3H 1JGEB 3V8CA 1G0YR 5AUMA 1JNNL 4OZHE 3MOBL 1KPUA 3QDHA 4L4VA 5FYLE 2D03L 3BGMA 1A2YA 2HT4D 3MXVL 1K6QH 4HUWA 5I6XB 4PV9B 3O41A 1CGXA 2ZUYA 1A7NH 4I0KA 1AR1C 3QDJD 5CP7B 3QIWD 5CBEA 2VISB 3IXAB 1KCKA 3EYUH 2JK5B 2XKUA 4GRWH 5H35B 4CN1A 5IUSA 4JPWL 1MHPH 4JKPL 2YBRB 2P5EE 3CDCA 1P1ZB 3P9LB 4HX1B 1IZKA 3NN8A 1YYML 1FIEA 3C60D 2V2WB 1U6AH 3FKUS 3FO0H 5J06A 3IFNH 4X9FA 4RA3A 1IAIH 5D96B 3NFPB 4FXLA 3G6JE 2HT2D 4A6YB 4PJ9C 4D9RE 4TSCH 2DL9A 4IMLB 5SWZD 4LLWA 5I71B 1X5IA 2VDRL 4UIMB 3A67L 1H9VA 4JREC 5D6DA 4CVZA 4LPUA 4NQVB 3BYYA 4AEFA 1M05B 5J6HA 2QHRH 5IJKC 1HOCA 1QFWI 5IHZB 4IDLA 2A6KA 3N0PB 5B3JF 4RQQA 2FSEB 2DJUA 1EH9A 3C8KB 5DDHB 5INDA 2Y36L 1BJ1H 2C4XA 1ZANL 3S3PA 3DX8B 3WLBB 1DLFH 4XBGB 1UJ3A 4NNYB 1VFAB 4H88H 1IAKA 3IXTB 1ZT7B 3AY4A 1C5BL 3O3AB 5D4QA 3VXOB 3HC3H 3CDGB 1KCSL 4Z8FH 2FX9L 2F58H 3MRFA 5E6ZA 5HGBB 1RUQH 4QHNA 4AIZA 4LSVL 3CLFL 1IM9D 2V9RA 3LHPL 4ODSH 3FN3A 1EEUA 4N0CD 1KJ3H 5DSCB 4GRLD 4FNLH 2H1PH 3QUKA 3CFBA 1T0NB 5DQDL 4ZUSB 3GGWB 1R3KA 4HAGA 4HXAL 4ZO9A 5EZIL 1CLZL 2ZOKB 1E4KA 3F7PC 3TZVD 5EU6E 1JGUL 5DR5L 1BZ7A 3QH3B 4Z7UA 2GCYA 1V7NL 4HWUA 4LGPB 1WBXA 3T3ME 3VGAB 4WV1C 5DRXA 5I1JH 1NKOA 2L7JA 2MWCA 2BSTB 3HG1B 5DVOA 4Q0XL 3LD8C 3D2UA 4YZFE 2UWEA 1PY4A 3U36B 4LVHB 4JO4L 4AEIL 1N59B 4CADA 1KEGH 1N59A 4TVPD 5E0QA 3QDMB 3BP5B 3SE4A 3RQ3A 2OZ4L 1IAII 1MFDL 4MDJB 2FR4A 4N0UA 3LY6A 1B4JH 3LCYA 1JUFA 2I5YH 5DMIH 1NMAL 4NHUA 3UDWC 4RX4D 5E95B 2X89D 5B38B 5GISL 4HIHA 3SGEI 4FZEL 2PYEE 1SEQL 1F4AA 4V2BA 3RDTA 1DN2A 1MI5E 2YWYA 4O02H 2UZIL 5CZXC 5J13C 4RGMC 4N0YH 3DO7A 3NIGE 5DS8B 4L8BB 4KROD 4G8GE 5IIEA 4JO3H 1PY9A 3V4UH 3IFLH 3P73B 3T0DA 5IEKB 4M6MH 4U2YA 1FLRL 1R3JA 4JZJB 4M8QB 4Q9BA 1UKTA 5F8QC 5C6TH 3CCHA 2VXSL 1QFWH 4XP9H 3S37H 4GKNA 4ZODA 3I02A 2EDJA 3SDCC 2CKNA 1CF8L 4L1DA 1UQSA 3TWCL 3QFJB 3L95B 3KS0H 4X8JB 5IR1B 3C6LB 5I1LB 3VXUD 3BQUD 1IQDA 1L7IH 2A9ML 1SHMA 1XH3B 3IDGB 5J3HD 4Z6AT 1UZ6E 3OPZH 1JNNH 4U6YA 4JKMA 4OCXL 1K2DB 3DX8A 3MRGB 4DN4H 3QDGB 3BUYA 3MRMA 4Y1AD 1EUUA 3WJLC 4Z8FL 3ARQA 4D3CH 4MD5B 4H8WH 4BFIA 1T5WA 1JYVA 2VDLH 1QLEL 4NUJB 5EBGA 5KZCD 5ID0B 1JK8A 3L3OB 1FVDA 3JUZA 5D7JA 1ZSDB 4J4PD 4EXKA 3L3JB 3MZTA 2WV3A 3BO8A 3HNTL 4F33A 2O5XL 5GPRA 2AEWA 5I8OH 4HKJB 3MREB 1SMOA 2VLRB 2NY2B 4P9MH 5CWSA 3IAPA 1WT5C 2A6JA 5J4MA 2HLAB 2WBJB 3QH3A 4WEUD 1CS6A 3MA9L 3ILPA 2BDNL 5FM8A 5IVXA 3KPMA 5E2JA 3QIBA 2H8PB 4QRRD 1MELA 5EZJB 2G9HA 4G9FD 4Z7QF 5C07A 1HI6B 3TO4C 1N5AB 3WV0A 4AG4L 3FQUA 5EFIA 4Y16D 5JW3H 1HWGB 4BELD 4UILH 5DF0A 5ICYB 3ULVE 1NAMA 4NKIL 4BZYA 2A77L 3RDTD 5TF1H 2BJML 1WCBB 3ZT5A 1CXLA 3ULVF 2F74A 4MB3A 5J6GB 1R0AH 3TVMB 5D2LB 3FT3A 4NNYA 5EC1A 4F9PC 3MACH 4MNHA 3BKMH 1P4BH 1EERB 1U8KB 2NY5L 4NC0B 5JQ6H 4RMUA 5IW6A 2N56A 1U8QA 1DQJB 2H9GB 1I3RA 1XGTB 4AIOA 4CUCA 2E7LA 4KI5F 4XAKD 1RHHB 1LK2B 2VLKD 5B8CA 4OI7A 2IMMA 4KTEL 2WWKO 4LMQE 4AMKL 4X5WA 4OIIL 4HIIB 5ESQB 2F19H 3RY5A 2R4RH 4L3ED 4NSKB 2X4TA 5DHVB 2I5YL 3OHXA 5D8JH 1CQKA 1AO7E 4D9RD 5CFHA 5JNYA 2ATKA 1F45A 1R5VB 2VE6A 4UQ2B 1Q9KA 2UVEA 4JZJC 2PYEB 2B1AH 2PETA 3MLUH 4KMTL 2VTFA 1A47A 3IT8D 3FO0L 4M7ZC 4BSWB 2YBRA 1FFNA 2DD8H 5DD5H 3QEHB 2R2EB 5CZXD 1VKXB 3BP6A 4XBEH 2M26A 4J4PA 4PLNC 2QSCL 1MCDA 3MNVA 4BKLB 3AFLA 3A6OA 3SPVA 3SGDH 1Q9OB 4S2SB 2F15A 5DFVD 3SJVA 1ZSDA 4DUWA 3GSRA 4PJBF 4NN6B 4P9HC 3EFDH 1OB1A 3V5KA 2VZTA 4XP6L 3QHZH 4P2RE 3QCUL 1D5IL 2BSRB 3ZHDA 4MB4A 5J7CC 5M94B 4UV7L 3MLWL 5JUEH 5DJZA 2DMKA 2I07B 3W9DA 2HG5A 3L1OH 5HGDB 4YEEA 3SDXE 5EC2B 3NFNB 5C07D 3RWIA 3HC3L 5I8KL 4LIQL 1P7QB 3UTTE 3F12B 4JFEB 2VWEE 4RRPG 2DYPA 1UQSB 3DROA 3SE8H 4Y1AB 4XVJH 4X6DF 5TDNB 3GK8L 3AS3A 4HUMB 4MCYB 1I75A 2H2SC 2ZZUT 4IJ3C 2O61A 1L9MA 3MFFB 5LAXA 5AYUH 4I4WB 2EE2A 1UKQA 1DQQA 4EI6B 2BSSA 3QDJA 1QSFA 2ARJB 1MFCL 4LASH 4KAQL 1S9WB 1RD6A 1OTSC 1MFCH 4LASL 5IW6B 1HN1A 1KLFA 3PGCB 5ENWA 4NWUL 1UXWB 2BNQD 4OLXH 3OSKA 4QXWA 5SWSA 4NWUH 1A1OA 2FECL 2IJ0C 3C5JA 1KEMH 1YNLL 2A6IA 5JIIA 1QUNA 3IFOA 1OCWH 5C0BE 3GJFA 2OL3L 5DLML 3M8OH 3IDIB 2SEBB 5E6IB 4FQJH 1I4FB 4TRPL 2B1AL 1X7QB 3LKNB 4XI5C 1BF8A 1UM5L 5HVFB 2HH0L 1P7KB 2MOVA 5F7DA 2BNQB 2R1XA 1E0OB 1VFAA 5JHLL 4NZUL 1E4XI 1IJ9A 2LU3A 4EQ3A 1NCBL 3BD4A 3OKYA 1SBBA 3C60C 5F7YC 3PWJA 4XPAH 4PRIE 4ELMB 4HMDA 1U8NA 1SY6A 4CMHB 4JFDB 3VFOB 4TTGA 1RZGA 4C58B 1K8IB 3B2VH 3EDEA 4HG4J 3IDXL 1LEIA 3LKRA 5FYKE 3C8DA 4PJFF 3S35X 1EAPB 4PJXE 2XTJD 4EI5B 5I16B 4Y4KB 4L3CB 2EXYD 4Y4FD 3TA3C 2FH6A 4YQXL 1U91B 3VXRD 1F6AA 1C08A 4ZUWB 5IWLC 3GSVB 3NZ8A 1EA9C 3FB6B 3FOLB 3LEVL 1T04A 4JY6A 3TZVC 4I5BB 1I8IB 4NKIH 1CICC 4KI5E 1T7ZA 2DS4A 2MJWA 3D5OF 4KRPD 4KY1H 5ITFA 2B2XH 4YHZH 3NH7H 1G9NC 2P7TA 4LEXL 2NW2A 2VISA 5FYJE 1MCOL 2KBGA 2R4SH 2P4AB 3FFDA 4R26H 4X5XB 2MQCA 4PJXB 3LN5A 3VXRA 3MPCA 4LARL 1ZOXA 3IKCA 2NY6D 4EDWL 3NCYP 4UV7H 5HYSG 5F9WB 5I74B 5FYJU 2FNBA 3WO4C 1FJ1A 4FTVA 2F19L 3BP7A 3EAKA 5BV7H 5HYSB 2W1NA 4GSDL 1WBZB 3U7WH 3V5DA 4OJFL 3GNMH 2R0WH 3K74B 2P24B 3BFOA 1QQDA 4KVCL 5D1QB 3GM0A 4U6VH 1S9VB 1JF5A 1TZIB 1T7WA 4WFEE 3FOMA 1RZFL 5F1NA 3T8XB 2J5LC 3BKYL 5T3XH 1QEWB 1WITA 3NCMA 4P5KB 3WUWA 1DBAL 2CKBA 2CSPA 5INCA 4Q58C 1IE5A 4L4TD 3LS5L 1I8MA 3V9FA 5TE6H 1K9TA 4NDMA 4RMSA 1U92B 4R0LA 2W9DL 4QHMB 1GIGL 4XPFH 3LIZL 3GI9L 1L6XA 4M02A 1IGMH 3L9RA 4GQPH 1OPGL 3KDMA 3Q6FA 3CX2A 3OJDA 1WICA 1LE5B 4HIIA 4JHWH 3SKUD 1MCEA 4HLZG 1FNLA 4LCYA 4QXUH 4QRTA 2F53B 2ZSWA 3KPSA 5HGHB 4LMQI 5JO5A 3V0AC 4XGZA 3MJ8B 3LQMA 5CBAB 4EXPX 3RP1A 2XG4A 4P57A 4XHJD 4U0RC 2ILLA 1UXWA 3IS1X 2O5YL 3EO1A 1E6OH 1Y0LB 2P47B 3BN9D 2R8SL 4YHYC 3ZSTA 4PJEF 5EU5B 1LO5B 5C08D 1CGUA 5E5RB 3NACH 4XVTL 4Y19E 1PEZA 2R4SL 5DQJB 1BVKA 1INEL 1DQML 3T04D 2J4WH 4CN6A 1RY7B 1NAMB 2IAMA 4FRWA 4BH8B 2VDOH 3U1SL 3PXHA 3GMPB 4X6CB 5ANMA 3HC4H 5T1DL 3D0LA 3TNNA 1MEXH 5DJ8B 1KCUL 2XQBH 1FYTB 1Q9LB 4LP5A 4KC3B 4P5MB 5I1DB 4AM0B 4Z76A 4JKWA 1BFOB 2VH5H 3OKNB 4PRPA 4O02L 1FFOB 3WIIH 3OGCA 5DRZB 2DD8L 2NW3B 5DD5L 3HCVA 2N4IA 3ZDZE 1G7HA 1CD1B 2CO6B 2VLMD 1GGBL 1BGXH 1WTGT 3SDXF 4QRPD 1MH5B 4JO3L 5HGDA 4EVNB 4YWGL 1EGJA 2EEAA 3IGAB 5BZWA 2DQUL 1KENL 5IB2B 4KMLB 1MRFH 5I1AB 2Z92A 5HTSA 5I6XC 3DETC 3ARDB 3KJ4B 1T1XB 4O58H 5JA9A 3DECA 1C8PA 2HKFL 4KPHH 4H88L 3FFCE 1HKLL 3DARA 3C5ZA 3PWUB 3DSNA 2DI7A 2NY2D 4OF0A 4PJDE 4YK4B 1NDGA 4ZSOA 3GMMA 1NBYA 3GKWL 5FUZH 5C0DA 4MA1C 2BRRL 2A83A 1YEEH 1OGTB 4ZOBA 4HJ0D 4YHKH 1ND0A 5JIHA 4G8FA 5CAYB 2OP4H 1AGFA 3EOBA 4Q9RH 5ITFB 2HH0H 4OCWL 5L7XH 3DMMB 2H1PL 3RWCA 2RFXB 2VUYA 3MOQA 3P77B 1FDLH 2WQ8A 3IFPB 2X7LB 1CLZH 5FDWA 4K3HA 3NBNA 4OF5A 4MD4B 1T22B 1EJOL 4JFPB 4LKCB 4RFNC 4JVUA 4PYHA 3VFMA 3P11H 4RAUA 1MVUB 3WSQL 5HGHA 1E6OL 3WHXB 5C09B 5EU7C 4LLQA 4G7VH 1EEZA 1ZKAA 1ZGLA 2LAGB 2Z4QA 4KTDL 4HK3N 2H2PC 3ULSB 2BNUB 1TZGH 4PJHB 4OLYH 3GSQA 4H1LG 1HHKB 3B5HA 4LARH 4GS7B 1PZ5A 3DX7B 5GGTA 3OJVC 4H8WC 4TPRH 3SHSA 1HDMB 1MFNA 2Y06H 1SY6L 3VFSB 4IMKA 1SJXA 1I3UA 5DD3H 4WU7A 5F71A 3UZEA 4P23A 5IVZA 4G9FA 4PRNA 3SO5A 1AD9A 3CFCH 4PREA 5DEGB 3DXAD 4G6JH 1NFDE 5HVGB 1EAPA 1CTOA 1X9QA 3EHBD 5A3IC 2DJ4A 2QHRL 2JJVA 2B1HH 2D0HA 5D2LE 4NJ9L 5E7FA 2W9DH 4MJ4A 1AXSB 1A6ZA 1RPQA 3EOTH 4PBVC 4RRPA 1EHLL 3IKKA 32C2B 2PCPB 1YEFL 4LNVA 3VXPB 1EHXA 2MCG1 3E1F1 4JHAL 4XNZB 5IOPB 5DDHA 3C5SA 3NCFB 4Q7DA 4YFLF 1NDMB 1MLBA 1Q0YL 3TBVA 1UWXH 4CDHA 3TBYA 3D39D 3HAEA 5E8DL 5F1IA 4FXGA 4M48H 2FYYB 4UIMA 3ZKNC 5I0DA 1MFBL 1OGAA 4XI5D 4Y4KA 4XGZB 2CLZA 1KYOJ 1YMHA 4P23C 5HGAA 4AEHH 5SWZB 4Q9QH 4IRZL 1T2QL 3GJEA 4F7MA 2E7HA 3V4UL 1AC0A 5DJ0B 1G7JA 2V5SA 3U7YL 3ZE1E 3MROB 1ROWA 2RFXA 4KHTL 5BO1L 3ZDYF 1IAKB 3IXTA 4H0HB 3RL2A 2DKUA 1HXYA 5GGVH 1INDL 1X3DA 1BZ7B 5K9JH 2AJSL 3VXTA 4EIZC 3O6KL 5DRNA 4M6OL 3TN0C 4HXBL 3SE4C 2EDXA 5IB3B 5FA4A 1B0RA 4NQEB 1DUZB 1W0VB 5D9SB 5GGRB 3PGDB 4R96B 3QPXL 3RL1A 2F8VA 4KFZC 4Z7VA 4P2QA 2VJXA 4U7KA 1RIUL 1W0WB 4QWWD 5BZDA 3F8UB 1I1FA 1IM9A 4NO3A 1AE6L 3MO1A 3L7FA 4JM2F 3LDBB 2Y07L 2ITDB 1B0GA 2ZOLB 4HF5L 4WRLA 5C0CA 3T4YB 5DR5H 4KK8D 4OB5L 1C1EH 3RDTB 5JOPE 1EHNA 1I1AA 4BSWA 3RIAF 4EN3C 1RMFH 3MLVH 4F57H 2NY1B 4RFOH 1CD1A 4I13B 1HDMA 3JVGA 3D69A 4NIKB 1PKOA 1MHCB 2AABH 5F6HI 2J8OA 2DOCA 5ICZB 3F7RA 3DRQB 5EOCL 5L88L 3BT2H 4KXZH 5IHZA 4N0UE 3G5ZA 5EA0L 4V2CB 5AZEH 4C83A 4PJ5D 1ONQB 3BT2L 2CXGA 5JHDA 3QRGH 5AAWA 3QAZC 1FNGB 5CHNA 4WENB 4HKBB 3S4SG 2UUDK 2AEPL 4PJGB 4IDJH 4PJHF 4YAQB 1FNEB 4MA8L 3NTCL 3BSZH 2M2DA 4PJEE 1BREA 2PO6D 4LVHC 4Y5VC 1B2WH 1FL3A 3PQYD 1QQDB 2ADJB 4R4ND 3SKJL 3C6SB 1A1NA 1C5DB 3H0TA 2HG5B 4OQTA 3BPNB 4TSBH 4Z7UE 3RU8L 3WLWC 3ZSSA 1FZMB 4LLUB 4MJ6B 3TO4B 4ZS6C 5HDBF 1A8JH 4M5ZL 1MJ8L 2B8OT 1K4DB 4Y4KD 3TPUB 1YJDH 3L7EA 4MSWA 3PHSA 4ZOAA 3HZKA 3MNWB 5E9DA 4PJ9A 3RVUC 1GJIA 1KBGL 1NCCL 2LV4A 1CXKA 2AJZA 5B4MC 5IW1B 2YKLH 3X14A 4U0QB 1TZGL 1Q9LA 4QEGA 4Y5XB 1CDCA 4G80A 5E8PB 3RWJB 3FQXA 3SY0A 2XN9A 3QUYA 3O6KH 4HLJA 2EKJA 5DJ2A 3DX9A 3P11L 1QG3A 2CRZA 1XF4B 2IMNA 5JTWA 3LMJH 1BVKB 1LK3H 1EFXA 4YXKH 1B3JA 4LHQB 3T77A 3O0RL 1AKJB 4LSSL 4M43L 1TVBA 3O9WA 3AREC 2BVPB 3HR5B 1TITA 4M6AA 4AEHL 5F88B 3PL6B 4UT7H 5I2IA 3VD9A 2XY2A 2NY3C 5C0BD 5D7JD 4G42B 4AM0A 4CVWA 4UDUB 5GIRB 1XF2A 3BRDA 1KCLA 5DD6B 5MERA 5HYQA 1VFUA 1GGIL 2A1WH 1R0AL 2AXFA 1PSKH 4BH7A 3K1KC 1N7MH 3MC0A 3I6KA 1KGCD 1T89A 3O4LA 3QXAA 5E4EB 1FE8L 2H8PA 2HVKB 2Y5TB 3DVNA 1LE9A 3U6RA 1NEUA 2B1HL 3EZ8A 3TV3L 2EICA 1QSFD 2VQTA 2C3VA 3EOTL 5D96C 4ODHH 1JWUB 4N9GB 4JJ5B 5FUCE 3TT3L 5DC4B 4NQEE 5IB5A 1XH3A 3WUWG 1UXSB 2HVJA 3PQYA 1QYGL 1YPZB 5K9KB 4LNRB 2KDGA 3SDCB 3OHXB 4ZAKA 5F96H 3EYQD 2AJVH 1PVHA 3R1GL 3U4BH 4Q9RL 4ZPTB 3GHEH 3U46A 4YHML 3GNML 1P7QD 3IDYB 4LRNH 4Y4FC 3PF2A 5C1MB 3S6CA 3T0EE 5C7XL 1U8HB 3NA9L 4PJ7B 3CMOH 4PRBA 3T65B 4N1HB 1A1NB 3H0TB 5FM5M 3UBXB 1H15A 1YEKH 4ZMAT 1J7VR 5KSBE 4U1HB 3IB4A 2V2XA 4NJAL 1UB5B 2VZUA 5KSUB 1NCDL 4ETYA 3IVKA 4QXUL 3I6GA 2IADB 4LVNC 3ZZ1A 1SJHB 3QG7H 4MX7A 3BKJH 2AVGA 1DDHA 2Q7NA 3V5KB 4LPYA 1GOHA 3ZTJG 1WZMA 3RWDB 3Q5YA 3G5YA 4NFDA 3BZFA 1ZEAL 5BV7C 4S1DC 5JZ7D 3FQUB 4LAQL 4XC1H 3O9WD 4YQXH 1FSKC 1H5BC 4LCIL 4K8RL 1CE6A 3GSOB 3SE3C 2IPTH 3VFSA 2OJZH 4G6AD 2BJMH 4QYOB 3BZDA 3HI6L 1EZVX 2WWKT 2XWBB 1AP2B 2VDOL 4FG6C 3U1SH 2YRZA 4WU5A 2A6DA 4PS4H 4EDXA 1I1AB 2YD8A 1GZPA 4RDQF 2H3NB 1J9CT 4DGIL 2EDYA 5M7QA 1IFHH 2IQ9L 1FL6A 2O5YH 1EJ6A 2EZ0C 3GSNH 1LO3H 2AGJL 5I8CB 3JSSA 1MRDH 4PJFB 3SBWC 3B2UC 3QIUC 4Y4HD 1TTUA 4XCNB 4Z7WF 1R3LA 4LLMA 4TSAL 3PWNB 2VSCA 5B39B 1GVIA 1UJ3B 3TBVB 3PWPB 2DIBA 3MRCB 4KUZL 3FO1A 1ORSB 2AJXH 5MEQB 5IB3A 1UWEH 1V05A 3R06B 4P3DB 1UH4A 5GSRB 3PJSB 4WHTA 1DLHB 4K7FB 3G04A 5EN2A 4QRUB 1JWSB 1QR4A 3MYZA 5E8EA 4F7CB 1G7JB 4ZFGH 4HWNA 5DK2B 3KPRE 3WS3B 4XCYA 4ZO6A 4PJ5A 1FO0B 3KPLA 4OQTL 4R26L 4NZTL 4LRIC 2UY6A 2GYSA 5JPMB 4ZYKB 1MHCA 5IFHL 1FH5H 5MENB 3PWJB 4GXUN 4C56A 2ESVA 4PG2A 3O6MH 5I74C 3VGDA 1G6RH 4G5ZL 1D5BB 4JFXB 3SDAA 3ZYIA 2NY0D 3F6LA 5GS0C 1LK3L 2DQGL 5ESVA 4OSUL 5I1HL 1FFQA 2NCMA 3GBNL 3QSKB 1B4JL 4DK6A 3TIEB 5GHWL 4CJ1A 1HQ4A 4P0DA 4Y1AA 1NBQA 1QHPA 2CLRB 3CLEH 4NOFA 3C5JB 1NEZA 4DAGL 1E4WH 1QRND 5HDBE 1DUZA 4KDVA 3VFWA 1UEMA 1PD6A 3MUGA 4OM1H 5J1TC 5BZWB 2IH3B 4PJIA 4LSDA 4YEFA 3AY4C 1CDJA 4ORGB 3WHE1 4MAUL 2W9EH 4GMSH 4WY7H 4CVZB 3VGBA 1P7KA 1JPSL 2M1KA 1S7RB 3HUJA 3L95A 1I7ZB 4K7PX 2YEZA 4M6NH 4PRHD 2IAMD 2VERN 1RUAH 1NDGB 4TOYL 4K71C 1A3LL 3S7GA 3WCYA 3LN9A 2FLRT 4NYLB 4XC1L 4HUNB 5EO1A 5CKAA 4GG6B 1JRHH 1KT2A 4L4VB 2G5BB 3UP1A 1IGCH 2VH5L 1HHJB 1FYTD 4WU7B 1WSST 3NOIA 4Z7VF 4GW4A 4Y0GA 2V7NA 3CK0L 5FOJA 5BS0E 4UNVA 2IG2H 3K7UA 3J7HA 5HVWA 4ZFGL 4R3SB 3QYCA 5JW4Q 3CXHJ 4XX1E 1FAIL 3S5LG 2PNDA 1X4XA 3G5YB 4OF8A 5F6IB 4ZD3L 2I9TA 3GKZA 3QDMA 3S37X 5LGJB 2P8MB 5DYOA 3EOYG 2UZXB 4X4YB 1JP5A 2EXYC 3TA3D 4YXHL 4UI2A 2G9HB 1LO0L 4OQ1A 3WLWD 5BOZG 3N9GH 3SCMB 4AQOA 1CD8A 3PWPE 1T1XA 4M8VA 1JWUA 2J8HA 3ESVF 3BZEA 1H8SA 4AL8H 1NUFA 4WI2A 5F3HB 1MCSA 4M62H 3SGEH 4YHNA 1MAMH 4PB0L 5DUBB 4JFFB 5TE4L 2BOCB 3RAJH 4CVXA 4S1RL 2EDWA 4XXCC 5LGHH 4TNWK 4D9QE 4D0BA 3HAEH 5J6GA 2MPAL 2XWJB 5I18H 4IRJD 1DUYA 4LEOA 4YBLC 3TIEA 3SCMD 2IFGA 3PDOA 1OWWA 4OTXL 4NHCL 4PJ9D 3C2AL 3WE6A 5HDLA 2DMCA 4PJCB 3NA9H 5I75B 2H45A 3UTZB 3ARXA 1JGDB 2I27N 3EFDL 4LGSB 3W11D 3MUZ1 3SE3A 5D71L 1I3RB 4JO4H 3T0VA 3REWB 5GRXG 1U3HB 1YDPA 2XFXB 1OP3H 2D7TH 1A4JA 4JFFE 3MX0A 4U6XA 3KNBA 4FTVB 1QSVA 5D7JC 1KB9J 3VXUA 1HSAB 1KCUH 4RAVB 2R4RL 5CUSH 1OAZH 4WJ5B 3BKJL 1XR9B 3C08H 4LSTL 3LDBC 1I3GH 5SWZA 2WM0A 3CFEA 2X1QA 1G1YA 1QVOB 2EYSB 5HHXH 3I6LD 1CXIA 4AT6B 1YYLH 2C7UA 3TEUA 4F37F 2P8LB 1J8HB 1T4KB 3SOBL 1U3ZA 4KTYA 1U8NB 5T5FL 3WJJC 1RZJC 3DTXB 4Y2DC 2BC4B 4Z5RB 4ALAH 2XZCL 1FFPA 1BF2A 1P7HL 4R8WH 4RFEA 4U1LA 2JELL 3HG1E 4X7FC 2Q76A 5E6IC 3S34H 1IQDB 3N06B 1WV7T 2NY3D 4TPRL 3T08A 1HSBA 4GG6F 5FYLD 4JHZA 2FHCA 1PDKA 1INQB 4FQIL 2NY4C 1T80A 3BH8B 3HTLX 1QBLH 4O4YH 1MFDH 1A7OL 2J6EH 3ZE2E 5IG7A 1BD2D 1CIUA 4C57C 5HHNB 2OS7A 1Q1JL 2WWMD 3HAEB 2XXMB 4U1SA 3QEUB 3FN0L 5D7IB 3BN9C 4V1DB 1F3JB 5F3HA 3UPRA 1VEOA 2R56L 5K33A 2ZUXA 3MCKB 1NKRA 4JM2D 5L8KB 5E8NA 5GZOC 4MA3B 1UVQB 2ZWLT 4QTHA 4LLQB 5SWSD 2E6QA 1JMZA 2CRIA 1I9RH 5IHLB 4PLJC 1BQHG 5F89B 5IKCA 5JZ7C 4PJ5B 1ZHNB 3L3IB 1QLRA 3EYUL 3SDAD 3H9ZA 5DVKA 2DDQH 3HE6B 4L5FL 1Z9OA 2GAZB 1U95A 1ACZA 1KLUA 3MGTA 4CN4A 1A1OB 3FAXA 3MRNB 5IMOB 5D9SA 5GGRA 3UX9B 5DRXB 1D5XB 3QXDB 2DB8A 4TNVF 4POYA 1JI1A 5E2VL 5T1KA 4OZ4B 4E42B 1RZ8A 2D03H 5DLMH 5KW9L 5JORA 1IC4H 4JY5H 1QLEH 2OLDA 1YJDC 1CXFA 5HDOA 4OGXH 3WIFA 5FO7A 3CC5B 5F7DB 5T3ZE 3O8XB 1I8MB 1D9KC 3QNXA 3KVQA 4DKAA 5F9AC 2FIKB 3KWWB 3ARDA 4L8SB 3CDGA 5HBBA 4I18B 1FPTH 4OZIB 3CU1A 3BEVB 4KHXL 4ZQKB 3BWUC 3F7VA 3T2PA 5IIEB 1MFAH 3MNVB 2EIEA 4BKLA 4L4TA 3L5XL 4PP2A 2WZPD 1J0ZA 5MEPA 4PGEA 4JM2B 1XR8A 1MLBB 1NDMA 1JPFB 4R4BA 3TBWA 3CVHL 2D7NA 3ZE1F 2APTA 1NGXB 3FCTA 1KYOK 2APBA 3RGVC 1R3KB 3LQAC 3GMQA 3U30C 1T66D 2EDDA 2EH8H 5K9QG 3E2HC 1NGYB 3P4NA 4CDGC 3TO4D 2VIRB 3MCLH 3GSUB 3BH8A 5MERB 4FTVD 5AD0B 3R0NA 4F7PB 2EZ0D 4Y8DC 5HHMB 3RHWK 3LKOB 5L88H 2V6HA 4MXVF 5IJVB 2E7LC 4C56D 3W5NA 5KSVB 2P7TB 4G6FB 5IEHA 5T3ZH 3S9DB 1U36A 4NN5B 1BECA 1KTDB 5CUSL 4HV8A 2JCCA 4H25B 3VH8B 4GUPB 3UYRL 3WFHA 3CX5J 2Y4SA 1KCRH 5DA4A 5T1MB 3ZYZA 3LV3A 1VACB 5C0AA 3MUJA 2EDFA 4RCAA 1A6AA 5T1KD 3OXSA 4HGWB 1MIML 3QQ3B 2DLIA 1Q94A 2BY0A 5HYEA 5E8OB 4GRWE 3OKEA 2X1PA 5DK0A 1K3IA 1KELL 3HE6A 1DCLA 4R0LC 4IRSA 2B5IC 3CSYB 2BXYA 2EYTA 2H6PA 3LKSB 4NQXB 4GW1B 3IJSA 1J8KA 1O7VA 1D6EA 1HH6A 3WFCH 5GSVA 1MVFA 4MQXD 4ZTOH 3GMLB 4ELMA 4XP1L 1H5BA 2EYRB 4YHPB 1VGKB 3BPLC 2MKLC 4TVSa 1RJZA 5F9DC 1JCKA 4EQ2A 4JFHE 3UTQB 2AXFB 1ZLUK 7FABL 1QSFB 4NCDA 5GZOD 1PKQE 4YAQA 1JGUH 3O4LB 4CNIB 1WZKA 5IG7B 3KPOA 2Z93A 3T09A 3KWWA 5K93A 3ZE2F 1EEQA 1VCAA 3NAAL 4ZAKD 5F9JB 2I9LB 3FONB 4YR6A 1NMAH 3VMOA 3SQBA 4U05A 5GGTH 4FZEH 4KDWA 4ODWB 2GFBA 4FQXB 4WEMB 3GKWH 5FUZL 1A22B 3KXFB 5K9KA 5D7LE 5GRVK 3FCTB 5DUBA 1TJHH 3RTQA 4LLUA 4MJ6A 1MI5B 3IRZA 3TO4A 3GZKA 3MRPA 5E5MB 1YMMD 4G6AC 5IFAH 4GLRH 3KLAA 5T5NF 4I2XA 5I71C 4HH9A 2DQUH 2Y25A 3EO9L 4Y5XA 5LVEA 1FDLL 1KFAH 5JNYB 4KWUA 1GPOH 4DN3H 2UY7A 4G80B 1D9KD 5E8PA 1JYWA 3MBEB 3SDDA 1S7XA 3RX8A 4M1CD 4RGMB 4ISVA 1BVLA 1JL8A 4ODUA 2NZ9C 4G6FD 3TA3A 2CDGB 3MGAA 1OAXH 4LP4A 4P3CL 4ODBD 4MAYA 2BOCA 2FDBP 1H8NA 1XIWC 3RJDA 1ZXQA 4GUPA 1QLFA 4ODSL 3WFHB 1TVBB 3OB0H 3LS4L 5E99L 3E6FB 2EDBA 5T1DH 4U1MA 3FL7A 5HHOA 3E6FA 3TVMA 5C0EA 4NO5A 3MOBH 3MRRB 5E94B 4P46D 4P2OD 3VWJD 4N8PA 1BHGA 3C60A 1MRCL 3CUPA 4MNGE 4HKZB 1SVCP 1EZVY 2CKBB 1XGQB 4LSUL 4TN9A 1A7OH 1ODAA 5DT1H 1BGXL 4WV1B 5DQ9B 1P4IL 5CZVH 1E27A 4XP1H 1T83A 3MRHA 4PG9B 1LHZA 2X4QA 5J3HC 5JQHC 2W59A 3TPUA 1CF8H 1JZ2A 4NFCA 2EXWD 4NN7B 5F1SA 4B41A 1I8LA 2AQ1A 1CXEA 4ZS6D 2ADGA 3HC4L 2IBBA 4GAJH 9CGTA 1Q9KB 3B2VL 5JW3L 3WDIA 5MHSE 1TPXC 3C6SA 3V4PH 5E2TH 1FJ1B 4WI8A 1SEBB 4GSDH 3WFDL 4JY5L 1G0DA 3FT2A 5CD5C 5FB8A 3OXRA 2FBJL 2P8LA 2Q8BH 4LSRH 5LQBH 5GS0D 1TNMA 2YUWA 3DVIA 2OQJB 4PS4L 4P4KD 5CEXB 5LGKA 5HI5C 5L0QB 4BJLA 2DTMH 3RX7A 4N0RA 1WBYB 3K2UH 5DHYB 3PJSA 4WHTB 4XXDB 2ZNWA 2FJGA 1T2QH 1YNKL 1HEZA 4DCQB 3PGDA 2P8PA 4U0RB 3H2WA 4HZLB 1EHAA 2EE3A 2JJSA 4PJ8A 2QHLA 4L8DA 4Z7WB 1CDGA 1CK0L 1MLCA 1TVDA 4LCWB 5E1AB 4P5TD 1EEZB 1F3DH 3U0TA 4H26A 5C0FB 3ZO0A 4K94L 4LLWB 1LD9A 3L5JA 3B9DA 2ZJSH 4X6EB 3EDJA 3VG0H 4JDZA 5FA3A 2X1XR 3CU7A 4OLUH 2V2TA 3ISWA 1K85A 2X70A 2X9YA 4KJPD 3CCHB 2MMXA 4WGWB 3ARUA 4M1GL 4ONFL 1IKNC 2A1WL 4EDXB 4RBPH 5ALCH 5DFTA 3RZCB 1RK1A 2J6EA 3C8KA 1FBIH 3LB6C 3QCVL 4YHMH 3KPQA 5I76B 4OCYL 4LSUH 2DRUA 4UAOC 2DLHA 3S37L 5IBUB 1Z3GL 3VMNA 1WLHA 1M05A 2Q3ZA 1KIUA 4NHUB 4FQHB 4NCC1 1KSRA 2XZQH 1CT8A 3AC0A 3VXPA 1NQBA 3KYMB 2Y7QA 2VRAA 3HLAB 1G6RL 4AJ0A 4F7PA 4JN2A 5GJSH 5CCKL 2Z9TA 5EBMA 2XACC 3MLWH 3B9KA 4PUBH 4KJWD 2YA1A 5I66A 4KKNA 4MCZA 1ZT7A 2BCKA 1P9MA 4IRJA 4D8PA 5IB2A 3MLTB 2A6DB 5GRUL 1G9ML 1WC7B 4WO4D 2ADGB 1MPAH 1F8TH 5JR1L 4EEEA 3G5VB 4YH6A 2CMRH 1D7FA 1KJ2H 1R5VA 1RZIB 4P2QD 5SV4A 1GZQB 3FN9A 1G7MA 4HUUB 1AGEA 1OAUH 4U6HA 2FX8L 5C0IA 4MNGB 1DQQB 2WUCL 2LVCA 3PDDA 4BYHA 3E2HB 4I18A 1DZBA 2AI0H 4K3DH 1QFUH 8FABB 3QXUA 5IFAL 3BHBA 2IANE 4ODXA 1J0HA 1OSPH 5CEYB 4XCYB 5FHAL 1NGQL 1OP5K 2BFVL 3TYGL 1E4XH 1MY5A 3UPAA 4F2MA 4XMKH 4GAGL 3DYOA 4PY8J 2IADA 5CS7A 1MIEH 1S7VB 3GO1L 1ZHBB 1AI1H 2GHWB 3V95A 1NSNL 4CGTA 1RZ7L 3KHQA 3BDBA 4NQEA 5HD8C 2R39A 1O7SA 4B5EA 1M7DA 3CFKB 5HXMA 4I3SL 1IAOB 2P8PB 1MRDL 4M7ZB 1SYSA 3Q5OA 2DLFL 4A2MA 4BA8A 1J18A 1ND0B 1KB5B 3K46A 3LS4H 1GGCL 4U1JB 1MJ7L 2R9HC 1KV3A 1K8DB 1R3LB 4LLMB 1RURL 4F3FA 5LGHL 4AH2A 1YMMA 1P4LB 5KSAD 3W0WD 1FYTE 1FC2D 1WT5A 4JDZB 1OD7A 1LNUA 4K3GA 1DVFD 1TCRA 1KF9B 4Y16A 4ZXBC 1UWGH 3WIIL 2R2BB 3PWUA 3OKLB 2WAHA 1AY1L 3VRJB 5I1IL 4E0RB 1YECH 2MQ3A 4KI5C 4P23B 5C0AD 4ORGA 4LFHG 4UBDC 5FECA 4PR5A 3BVNA 3D25A 4APQB 3VFPA 5I19L 5E70A 3QIWB 2XG5A 4ZUSA 4NKOA 3GFUA 3MJ8A 1SBSL 2XN9E 2HFFB 1QR1A 1A6ZB 1BD2A 2EYTB 4NZRH 4FQ2L 3OX8B 1WBYA 3TVMD 1E6JH 4IS6A 3RX5A 4X9HA 3CFIC 5D7SH 1CBVL 3ECBB 5D5MB 1FNFA 5AZ2L 4G6ML 1NLDH 4TUJB 2YD2A 4RAUB 3WHE0 2SEBA 2VQUA 5KTEL 2C1OB 2OJEA 5I9QB 2AJVL 2YRLA 2OXHA 3PHQB 3MLYL 4L29A 2AW2A 5DK3A 2OZ4A 1JNLL 5LCVH 3PHOB 3L3KA 5IVXB 4P9HL 3PWVA 4OBRA 1OSPL 3EJZD 3HE7D 5HHQB 1RUKH 4QNPE 4NC1E 1UB6A 4IDJL 2X4SB 4GG6A 1M7IB 3QUYB 3TGXA 1CDIA 5CEYA 1JNJA 3BQUA 2QBWA 3RI5K 1AR2A 3IDYC 1Q72L 3P3YA 3OAZK 5IEKA 4Y2DB 1U8JB 4OUUB 1YA5A 1TVHA 3A6BH 3QCTH 4RMQA 1L4IA 5EOQH 5E94A 4MNQE 1L6ZA 1PJ9A 1K2DA 1BOYA 5CEZD 1CD0A 3MRQB 4M61A 2KUTA 2Q6WA 3BH9B 3QQ4B 3SDDD 4O9HL 4FFWC 4PJGA 1BVLB 4ODUB 4L3AA 3MRHB 3EUUA 2OR9H 3OKOA 3UYOD 4E9LA 1KNOA 2XIDA 3QUMA 3QPXH 1MREH 1NJ9B 1ZGLP 2YZ8A 1U8IB 1A7RL 4PJEB 5C0AB 1KN2L 2VZVA 5IT2H 4D0CA 4C55A 4CVXB 4JVPA 3OMZA 4S0TD 4U6HB 3BD5A 4Q97A 4QRSB 3LQAH 1XF5A 3GGWA 4EUPG 4LQFH 3QEHA 2E8ZA 1F58H 4MD0A 2MKWA 2GUOA 1QPPA 1LO2L 2YUZA 4LSTH 1WBZA 2PYFB 3O8XC 1IGIH 4WW2F 1INDH 1CXHA 4RGNE 3WS3A 4ONGH 1ZT1A 3DXAA 4KY1L 2ED8A 4TULL 1LD9B 4GW1A 4GAYB 1YY9D 2NXYD 1IGML 4JAMA 1OP5H 5A2JH 2E9JA 5BRZE 1PG7W 1ZWIA 1KJ2B 5DJXB 4OCWH 3UZVB 1NBVL 1H3XA 1OGAE 4W70A 3VXSD 8FABA 3T8XA 4FQ1L 4E5XA 3KPRB 5LG1A 1WIUA 4UU9B 3RL1B 4OGYL 3KYAA 2C26A 5FKPB 5GGVY 4CAGA 3JWDC 2JCCB 4H25A 3VH8A 3BI9X 5E9DD 5DRWA 1ZA3B 2I24N 3ULVH 1M4KA 4RZCA 3KPQB 4PP1D 3NZ8B 1U8KA 4QHMA 2HKFH 2F5BH 2ESVD 4X6CE 1HHHA 2F8XC 3GM8A 3JVGC 1IKFL 2X44D 2XXCB 1T3FB 5D5MF 4FQIH 4XTRD 5I1GH 2VAJA 1G6RA 1G7LB 3B9KB 5EOCH 4GJTB 5D5ME 4BUHA 3CSYA 2JIXD 4ODVL 3HZVB 1CL7H 2CR6A 3FTGA 1PQZB 2F54E 1LEIB 3IETA 1CI5A 5IHUH 4DJMA 1CDBA 4HXAH 1EO7A 3AUVA 4YGVA 4LHUG 3C09B 1DQLL 4L3EB 5IVXF 4MQ7A 2BVQA 1IGTA 3T0XA 1T0MB 2C1PB 2D31B 2E9BA 5CEZH 1I9IH 3IFLL 4JDTH 3ZKND 1GCFA 3I9GL 4GKSB 1U8LA 3HNSH 3PWNA 2HFEA 3STZB 4K9EC 1YYMH 3V0VB 3T0WA 1INEH 1VPOL 4J6RH 4PY8I 3QUMB 2FH8A 5IQ9B 4OF7A 4UTBL 3BHBB 3NA4A 5BQ7A 5GRVL 1KGCE 3SJVB 4N0CC 3TH2T 5D7JB 4PREB 4WI4A 5DEGA 1KIPB 3MRIB 3UTOA 1JNLH 4GG6E 2I25N 5EB9A 1AQKH 1FLTX 3CFJB 4Z7QE 4P3DA 2W92A 5GSRA 3WNKA 1RZ8B 1NAMH 4F7TB 1ZLVH 1NLDL 4G6MH 2VL5A 1EJOH 4QRSA 2XA8H 2I07A 2OP4L 3S98A 1NC2B 4GRMB 4O2FA 1WZ1L 1FNSL 1C5CL 4PGCA 3ULUE 2WLZA 1FIGH 2VQ1A 3VXNB 5I66B 3TJHC 1ZWIB 1CVSC 4BUGA 4LLYA 2VITB 3OKKB 3ZKMD 3T3PE 1S7VA 2VUOA 3FFCA 3CNKA 4UNUA 5DJXA 5FF6B 4GBXB 5H37H 4KV5E 3TFKC 5HJ3A 4PJIF 43CAB 3CC5A 2GQHA 1XIWD 2R0LH 1RIVH 4RGOH 4NO5B 4HWEH 5E4EC 4V1DE 5I1HH 4Q2ZA 4X99A 2R0KH 3S35L 4HIHB 1S9WA 5HVHC 1WAAF 5IM7A 3FB6A 4JY6B 3INUL 1J1XH 3MJ9L 2XZZA 1Y6MR 5D7SL 2OYPA 5FHBL 1R5IB 1MWAB 5F6IC 2FWOB 3BXNA 1A14H 3FRUA 1N6QH 3O41B 4X7TA 4JPIB 5GGQL 1S8DB 3Q6GH 1JTTA 3VG9B 4DVBB 5J1SC 3O3AA 1DBJH 2L0DA 3GMPA 2CD0A 1M6OB 5EBWA 1IGYA 3KNBB 3QXTA 4HS8L 1RUQL 2HJLA 4P4KA 2PTTB 1AGBB 4CKVX 1CFBA 2ICWB 5IBTL 2EXWC 4TOYH 3B9KC 1K5NA 1VFMA 3SGJC 5FO9A 3U0WH 5J56B 4X98B 3SY0B 2ADFH 5IMLB 3BISA 3VRLE 2W65B 5KJRL 3NFSH 1SYVB 2X4PB 3LQZB 4R90H 1PX4A 4JFEE 3RNQB 1FO0L 4FS0A 1BX2A 3EYQC 3RVWD 3WFBL 2YPKA 3HUJE 3A6CH 4MJ5B 2E3VA 4DKEH 3VG9C 1HIML 2PO6B 2FHFA 4X6DB 1W0VA 4ZOCA 4WHCA 3QFJE 1TENA 3QIWA 3WN5A 3MRBB 1KXVC 1SM3L 5KN5B 4ZO7A 1KPRB 3H9SE 2ADJA 1HCFX 5MI0C 3L5WB 4KU1A 4TNWF 2VOTA 4RNRB 5EU4B 1N6VA 1U92A 1YEIH 1CGYA 3L6FB 3RI5F 4PG9A 3FT3B 5D1QC 5GJTL 4PJGF 4P23D 3I02B 3GO1H 2QJDA 4QRPB 2X4RB 3GSXB 4E41B 2CLZB 4FQXD 2AV7B 1GGBH 4L1HA 5IESH 1AGEB 5TPWH 4JFXA 4JGUA 2ZUSA 4GBXC 4OFPA 4X99B 1IC7L 2EDRA 2AI0L 1IEAA 5IHBA 1R3HB 3ESUF 4FMFA 1RURH 2GSGB 5KS9B 4J7RA 4LSPL 4PJ8D 2GTZA 4PRDB 3JTSB 4ALAL 1DBBL 2DWEA 1LDPH 4XCCL 1WIOA 3EFFB 4JQVC 3T2NH 2Y1VA 2NY7H 2QR0B 4NQXA 4HXBH 3D39A 4PBXA 3HS0A 4NYLA 5T3XD 5L2KE 2FO1A 4NRZA 3RKDC 2BVOB 3G6DH 3BJ91 4LCCB 4YPGA 1Y6KR 1RZKL 1LP9A 4ENED 4NRXB 4I3SH 1NUNB 25C8H 2ZNXA 3K81A 3STLA 3FOMB 4M7LH 1J88A 4YJZL 3KLHD 1F2QA 2DQHL 4G3YH 4KK8C 3AM8C 3UTQA 1IMHC 3O6FC 1HSAA 5TF1L 4RDQG 2ICEB 3TNMB 3QIBB 4J3WA 1HILA 2XWTA 3PXJA 3ALPA 3QULB 1JUFB 4K8RD 3AS2A 4JKKA 4M6ML 4UQ2A 4PJHA 3I3DA 1D6EB 1HH6B 2A6JB 2K7QA 4MS8D 3H9HA 3ZKXB 3QISA 3VRJA 2W0KA 4E0RA 2AEQL 5ADPL 4ODXB 1D3CA 3TA3B 4HHAA 4U1NA 4F2MB 1BBDH 5FEBA 3CIQA 2FEDD 4O5LL 4XHQA 2OK0L 4NBXB 2N7AA 2YXFA 4PJXF 1UM4H 4OD1L 1AHWB 5CJ5A 2Y07H 2CIKA 3N9GL 2FGWL 3BW9A 3RWCB 2OMNA 5H2BB 3QDGE 4W81A 2VDNH 1KC5H 2OI9C 4FQPA 1F2XK 4HKXB 4ZFFB 3NFSL 2OXGA 4JRXA 2CIIB 3DX6B 4M93C 1MQKH 1BQLL 3S88H 2UV3A 4R4FH 2C1OA 5D2NB 2X41A 1WZ1H 3RFZC 4IHOB 3IETB 4OF6A 4JPVH 2R9HD 1ZHLA 3BP5A 4CVUA 4Y16B 2HRPL 5BQ7B 2QQNH 4Y4HC 4H0GA 4HS8H 1JNHB 5EZLB 2ITCB 1A6TA 4DAGH 4ZXBD 3RTQC