1S79A

Solution structure of the central rrm of human la protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
GRWILKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, translation
molecule keywords Lupus La protein
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s79A00
4WFNQ 3CCVS 5GAHU 3VAHA 2DGOA 3NNAA 2LA4A 3MUVP 3G8TA 2M9KA 2DNMA 3UWTA 5DDPC 1JJHA 1YIJS 1OWXA 2M4MA 1NJIT 3R1HA 3IWNC 2CQHA 1X5SA 5BJRA 2MQLA 1SJQA 5JVHQ 2RU3A 2ZJQQ 2ZJPQ 3MI7X 2D9PA 1VC0A 1FJEB 3CC4S 1QVGR 1G2EA 4OZ0A 3G71S 1U6FA 1DBDA 2LQ5A 2X1GA 4C4WA 3MD3A 1Q82T 2V94A 3HHNB 2UP1A 2KG0A 3NS6A 3CC7S 3J7ZT 2CPXA 3V4MA 2CPJA 3G96A 2QA4S 1VQ6S 1OIAA 2YTCA 5IM0B 2E5IA 2LXIA 5DM6Q 1ZH5A 1VC5A 2AD9A 3CULA 1B7FA 2RT3A 2CPYA 3G8SA 4WF9Q 2I2YA 1VQ9S 2RNEA 1YTYA 2DGVA 3G6ES 2A3JA 2RS2A 5JVGQ 4CH0S 2JWNA 1U1KA 2J0SD 2MSTA 2GO9A 2E44A 3K0JA 1WTBA 4YUDA 5DM7Q 3SXLA 2MKKA 2U2FA 2M2BA 2OIHA 1WWHA 2BZ2A 3CCSS 4WFBQ 5CYJA 1X4AA 3CTRA 2DISA 3CUNA 4U67Q 5LSLA 1WHYA 3VALA 1VQLS 3P49B 1HA1A 5CXTA 2MQNA 1QVFR 1N52B 3MDFA 4IUFA 1A7GE 5FJ4A 2KYXA 2QEXS 2Q79A 1X4HA 2G4BA 2VODA 1HD0A 1WEZA 4FXVA 1URNA 2MY7A 3N9UC 1YJNS 2OJ3A 5LJ3Y 2DNPA 2J76E 2RRBA 4WCEQ 2AYGA 2J0QD 3MUMP 1VBZA 3UD3P 4IOAQ 5HL7Q 3UCUP 1R8PA 4W90B 3CD6S 5DDOC 3SMZA 2MYFA 2FC9A 2KU7A 5EN1A 1U6BA 1OPIA 3US5A 2G0CA 1RK8A 2X1AA 1P1TA 5D77A 2DHSA 2RQ4A 3CCJS 3B4DA 3I55S 2KH9A 3CC2S 2F9JA 1UP1A 2F3JA 4ERDA 1N54B 1SJ3P 1DZ5A 1X5PA 2XS7A 2B0GA 2FPHX 4A8XA 3D2WA 3S6EA 1FXLA 1S79A 3UE2A 4V19X 2MZJA 1ZZNA 2MY8A 1Q81T 3TO8A 1W2BR 2RS8A 1N8RT 2CQ4A 1HD1A 1KOOA 4TU8A 4UY8T 3R27A 2YWKA 2MJNA 2I38A 3UCGA 5GAGU 5IQQA 3L3CA 1X5TA 4TU7A 4M5DB 3P5TL 1S72S 1X4FA 5DDQC 2DNNA 4YB1P 1JMTA 1N88A 1WF0A 4Z2XA 1X0FA 2CQ0A 2KXFA 1YJ9S 3THPA 2MKSA 2DH9A 1JJ2R 3H2VE 3PIPQ 3CMES 2HGMA 3I56S 1WF1A 2JVOA 5GAEU 2CQCA 2M88A 4Y00A 2DNGA 5ITHA 5LJ5Y 1H2TZ 1K73T 4BS2A 1FHTA 2MQQA 2DIUA 2MMYA 2OSQA 1PO6A 2MKHA 1U1QA 2PEHA 2DB1A 2NLWA 3DXBA 4J5OA 3CCLS 2YKAA 4CQ1A 2K3KA 1VQ8S 1YHQS 2XNRA 4PKDB 3TYTA 3CCRS 3CCMS 2VOPA 2DNKA 3SDEB 2CQDA 1VQ5S 3MOJB 2CQBA 3CCQS 4F26A 2G1DA 1M5KC 4W92B 4WIIA 2MHNA 3MURP 2XB2D 2LMIA 2LA6A 2CQGA 3BO4A 3FEXB 2ADCA 1M5VC 2XS2A 1NO8A 2XSFA 3VAJA 4LJMA 3EGNA 3H2UB 2JRSA 3PIOQ 2VOOA 1P27B 2JX2A 2MZSA 3CF5Q 1WG1A 2N3OA 5LXRA 2N7CA 3EX7B 2X1FA 2L08A 2XNQA 5HO4A 1M5PC 1U1RA 1SJ4P 2RRAA 1Q86T 4RU2A 1VQ4S 2N82B 5GMKa 1X5OA 2MZ1A 3SDEA 1U1OA 1FO1A 2LCWA 2D9OA 4QPTA 2EK6A 2L9WA 1K9MT 1WG4A 3NNHA 1Q7YT 2DHXA 3RW6A 3VAGA 1R8HA 2XS5A 3Q2TC 2RVJA 4P6QA 4WFAQ 2FC8A 2DNZA 1UW4A 4QU7A 1KQSR 1X4DA 2HZCA 2X1BA 5DETA 1X4GA 1UAWA 5D78A 3NS5A 2RQCA 1WHXA 1YI2S 4CH1A 2RUGA 3BEGB 2QFJA 1VBYA 3ULHA 3ZZYA 1WG5A 1VQPS 1U1LA 2O3DA 3CXCR 1CVJA 2OTJS 4C0OC 1KD1T 2E5JA 1WEYA 4ED5A 1H2UX 3VAMA 2DNHA 1FNXH 2CQ1A 3VAIA 2DGWA 2CPDA 3R1LA 1M90T 1DRZA 4LIRA 2DGUA 3S8SA 1KC8T 3MD1A 2KRBA 2MKIA 2FY1A 2AYEA 2CPIA 4QQBA 4PR6A 2J8AA 1BY9A 2E5HA 2ADBA 2OTLS 2KT5A 2D3OR 2MZRA 2K8GA 3U1LA 4Y0FA 1YJWS 1WHWA 3THTA 3S01A 1M5OC 2LYVA 1U1MA 1M1KT 1VBXA 2CQ2A 2DGQA 2ZJRQ 1IQTA 2KFYA 1F9FA 2MB0B 2AYBA 1XN9A 2DNOA 4YOEA 3LPYA 3TP2A 2MZQA 2LEBA 2M8DB 2KN4A 2HGNA 1U1PA 3S7RA 4TU9A 2BOPA 4IO9Q 1NU4A 2HVZA 1D9AA 2U1AA 5H1SV 2CPHA 5IFMA 3G4SS 3FEYB 3CCES 1U1NA 2MKJA 1H2VZ 1X4BA 2EVZA 2M8HA 2M52A 3NNCA 4LMZA 2DNLA 2GHPA 1VQNS 2VONA 1FJCA 2KM8B 2DH7A 1D8ZA 2LEAA 3DLLQ 1FT8A 3CMAS 3VAFA 2DITA 2LKZA 2ERRA 2KXHA 5GADU 1ZZFA 2KXNB 4TLQA 4ZKAA 2KRRA 2MKCA 4EGLA 4QU6A 5MLCV 2KVIA 2CPEA 1WHVA 5CA5A 2MZTA 2N3LA 3P3DA 1PGZA 1VQ7S 2CQ3A 2CPZA 4FXWA 5IM0A 2LXUA 1SJRA 1UFWA 4IOCQ 3VF0B 2MSSA 3ZZZA 2DH8A 2AYMA 1QM9A 2DHGA 2WBRA 2DNRA 2HYIB 2DNQA 4C7QA 2DGSA 2NZ4A 2KM8C 1WF2A 2DNYA 2CJKA 2M0GB 2YH1A 3OW2R 4UQTA 2JVRA 1H6KX 1YITS 3RW7A 3CPWR 2CQIA 1VC6A 5GVQA 3UCZP 3G9CA 4PRFA 4F25A 2KI2A 1SXLA 1U2FA 2M7SA 4OZ1A 3U1MA 3CCUS 1WI6A 3J7YU 2DGXA 1K8AT 1X4EA 2DGTA 2MGZA 3JB9k 2MGZB 3BO2A 3IRWP 5LXYA 2EK1A 2PE8A 4F02A 1VQKS 3VAKA 1OO0B 2DIVA 2L41A 2FHOB 2CPFA 3P6YC 3Q2SC 3HI9A 5DDRC 2MQPA 1DHMA 2SXLA 2KHCA 3BS9A 1X4CA 2HGLA 3MUTP 1VQMS 2CQPA 2MQOA 3LQVA 1AUDA 1O0PA 5LSOA 3MXHP 2MPUA 1JJ4A 2DHAA 2MQMA 3B4MA 2E5GA 3NMRA 2OSRA 1SJFA 1HL6A 1VQOS 1WI8A 1WELA 2MXYA 1KOHA 3UD4P 2MJUA 1YWXA 4WKRA 3EGZA 1FJ7A 2M70A 1WEXA 4CIOA 2KG1A 2DK2A 2F9DA 2DO4A 1RKJA 2LECA 2YH0A 1L3KA 3BO3A 2DO0A 1A9NB
chains in the Genus database with same CATH superfamily
1C1CA 1RI7A 3SCLE 4WFNQ 3JQKA 1CS4A 2AEJA 4ILMA 1S7IA 2AJ0A 1OSDA 5HVGA 3G86A 2ZH6A 3VAHA 4BWJA 1FEHA 1T9YA 2UUWA 2HBQB 1M1HA 1Q4RA 1LWEA 2LA4A 3BDEA 3MUVP 1NK8A 2QA1A 2DNMA 3LF0A 2AQ4A 1JJHA 1UEVA 3M8PB 3O3LA 1XC9A 4KGKA 3R1HA 4K4XA 4ITSA 3KYLA 1QE1B 4P2FA 1KONA 1I51B 1RT5B 3RB6A 2CA9A 2J6TA 3NMAA 4C0HA 1V6HA 1RTJA 2XWYA 3FFIA 3SV3A 4DV4J 2RU3A 4PUOA 1GTHA 1TL3B 3CC4S 4XDDA 2YNIA 2FIUA 4M5IA 2HHHJ 3IN5A 4JI8J 1AZSA 1G2EA 2QA2A 4Y34A 3HJFA 4CYUB 4KHMA 3F0NA 1SL0A 1TMMA 1CJKB 1DBDA 2PI4A 4OJGA 4DQRA 2QLJB 2LQ5A 4WP8A 4K4UA 2VPXB 3MEEB 4F2SA 1DTTA 2XBPA 3PM9A 2PC6A 2OFHX 4C4WA 4DUZJ 2XTJP 3CCZA 2ZZNA 2Y1RI 2W9AA 3TANA 1QAYA 1HHSA 3B78A 3D3CJ 1MG7A 5IV4A 1LW0A 2ATCB 3TZYA 3NCPA 4A48A 4PXEA 5E41A 4A8SA 3R3TA 1U48A 2UP1A 3NS6A 1B7YB 2D41A 2CPXA 4LSLB 4X62J 1TUGB 2B5JB 1PCAA 2E7WA 1HHTP 4LVNP 2UUAJ 4F0HA 5A8KB 1WNEA 5F8NA 3D6FB 3DGPB 2HZAA 3MR5A 1Q8KA 3S1TA 2QA4S 4F3OA 1Y5LB 2YTCA 2ZBPA 3JTOA 4CO4A 1UA1A 2DCLA 2GAHC 3PFOA 5BYRA 4R25A 1B99A 1RU2A 4LQ3A 3PACA 4C8KA 1NMEB 1RT1A 2DR8A 3GJTB 1TKDA 3G8SA 1LW0B 4NRTA 2DBBA 2I2YA 4FP9A 3AJDA 3MOZA 4ZA1A 1SC4B 2QGFB 1VIOA 3MM9A 3HHLA 5BYSA 3O1LA 3OT9A 5JVGQ 2JWNA 2B9WA 3QYYA 5DGBA 2MSTA 4H54A 3OVSA 2J0SD 2GIFA 2GO9A 2E44A 5GAEI 3MFHA 1K0TA 4F3MA 4CLZA 1Y9OA 1UJ6A 3PTWA 1SKSA 4M5DA 1Y11A 5DG7A 2AT1B 2JEFA 1IKVB 2GFFA 1M1GA 1WWHA 3OXFA 2VIHA 3NLCA 2B8PA 1UW9A 3RU0A 3R5AA 2IJRA 5CYJA 2FHJA 4KV8B 4C8ZA 1D3WA 1TUWA 1F3FA 4ZP8A 2ZH8A 2BANB 2GW8A 2YWEA 1VQLS 1WHYA 1I3OB 1T03B 2ACYA 3GR1A 1HA1A 3EZOA 4LF2A 1RTDB 7AT1B 1N52B 1A7GE 3M9MB 2WW8A 3MMJA 4BWMA 1FFGB 4PWUA 3LPEA 2JLFA 4HTJA 5EX0A 3ENVA 3P45B 2Y8WA 3ENQA 1URNA 2MY7A 3N9UC 3NWRA 2FLLA 1XR7A 1SL1A 1SUQB 3RAQA 1XK8A 1U0SA 4DL3A 4FNIA 4MH8A 4OJHA 1S1UA 4B9UA 2IAJB 5LJ3Y 2JFKA 2RRBA 4WCEQ 2VFUA 2WONA 3NGKA 3GMGA 4OI2A 5AXNA 1HR0F 1CEZA 2VC1A 3DU6A 4K4ZA 1RAFB 4OYZA 4W90B 5DDOC 1K1QA 3LO3A 3N6NA 4YR2A 4FPRA 2IIHA 1KFDA 3OR1B 1OPIA 1RK8A 1P1TA 1RE1B 4WZQA 1N5YA 2DHSA 2RQ4A 3BH7B 1TR0A 3ETOA 4EI2A 2WTFA 4HI1A 4D3GA 1SBRA 4CWBA 3NAHA 4GVBB 2KH9A 3PW7A 3SFUA 4DX8H 1EAYC 4J9RA 1N54B 1FERA 1IUJA 1FX2A 4K2JA 3DGVA 5C7PA 1VQ4S 5EWGA 4KH0B 2HVIA 1X9WA 4A8XA 1S12A 3MM8A 1NPPA 1RT2B 1FXLA 4OYOA 5DS7A 2ZBRA 3NCQA 2MZJA 1Q81T 1LWFB 4IR9A 1I1GA 4FN5A 1BMQB 2RS8A 2C2OB 3ZC4A 4CLPA 1RWVB 2HPUA 1F9HA 3W2VA 2DR6A 1IJFB 2B4VA 2QRRA 1XQIA 4HR2A 4N7TA 3ZZUA 4TU8A 4CNYA 3ZZ0A 3R27A 4B9VA 1ULRA 1UJ5A 2MJNA 3LALA 1FXDA 1GMWD 1M5SA 4FBTA 5IQQA 4WE1B 3HHEA 3N0VA 4ED0A 3THVA 1S72S 4DX6A 3PW2A 2QIFA 1X4FA 1FRIA 2BRKA 3FZ2A 2GJIA 4C8OA 4Z2XA 1X31C 2ZHOA 5DGAA 2RD5C 1C2PA 4ATNA 2ZWOA 3M30B 1VI7A 1RB0A 3M8QA 4X65F 1KFSA 1YJ9S 2MKSA 2DH9A 2I5JA 1REVA 3DYAA 3RRHA 2HGMA 3CMES 1LW2A 2Y1LB 2N4CA 5KOWA 3I56S 4KGXB 4FS2A 2D74B 3IAS9 1DFDA 4ZPBA 3IC1A 4HHUA 4B9TA 1BQXA 3E8OA 1R6YA 2WVEA 1B3TA 5ITHA 1JLFB 2V5HG 2WVCA 2WOMA 1H2TZ 4N76A 1HYSB 4H4OB 5ETKA 2ZKTA 1K73T 4BS2A 1WC4A 5D0EA 4ECUA 2BJ7A 5HAOA 1IKXB 2OKQA 1S7HA 3A3NB 2V8VA 3HFZB 3RTVA 4IQXA 1ICEB 2PEHA 2NLWA 3AFGA 4I2PA 4BLGA 4DR5J 4WTOB 4RW9A 1IBLJ 2VZ9A 2JFDA 4OJ1A 4CQ1A 1Q79A 1Q53A 1CSJA 2IDLA 3AXKA 4OI3A 4PKDB 3TYTA 4YHHJ 3CCRS 2DPJA 1D0EA 1RU1A 3EYZA 3MOJB 4IRKA 1I5OB 2CQBA 4I4BA 3T5LA 2C2KB 2CWXA 2MHNA 1RTZA 3DRYA 3K8WA 3TZXA 1V9OA 2XLKA 3F56A 4O3SA 1S9GB 2JJ4D 2LA6A 2RQKA 4LRBA 1XJWB 4A8OA 2OO4A 6FD1A 2XC9A 3BO4A 3MAHA 2ADCA 1JKHB 1T9UA 4NLTA 3BGLA 1T3NA 2XSFA 4JB8B 2XI2A 3LP1A 3BN4A 3SI8A 2AHOB 4K2XA 2NSBA 3TAQA 3ELHA 3H4DA 1S9FA 3BR9A 1LXNA 1VS3A 4J91A 4ALZA 1GFWB 1TK5A 4ED4A 1P27B 4OYBA 2R2RA 1WG1A 2E5LJ 3MF5A 3OVBA 3HSJA 3MPDA 3UNGC 1KTVA 4R5PA 2HW3A 3MTJA 1IR2A 3TAMA 3OSNA 2ZOMA 4KAIA 3MR3A 2BVZA 3CW2C 3UN2A 5C2CA 5HO4A 4RNNA 5ETNA 3MM7A 3D5MA 5KTQA 1BQNA 5T7LA 1W26A 3HSGA 2ZZMA 1FNOA 1TL7A 4OI0A 1EP4A 1SJ4P 4J90A 2B9EA 3MMCB 4RU2A 4JP8A 3R2CJ 5KG7A 3R7SB 3VVUA 2UXDJ 2HIYA 2N82B 3KDOA 2H54B 3FCVA 4PQAA 5B0AA 3SDEA 4D3HA 1RACB 2AW0A 3KHRA 2ZFHA 1CQMA 3MCMA 3KMQA 4QPTA 1MWYA 2L9WA 2L9NA 4MKAA 5DJBA 1K9MT 1WG4A 4FDFA 4ES2A 4DR2F 1Q7YT 4Q8EA 2OAUA 5A8WB 1XTZA 4YS2A 1FRJA 4LR8A 1S48A 2DHXA 1Z2ZA 3NEKA 4Z7YA 3J81j 4EZ6A 5E3CA 1JLGB 2BJDA 2W24A 2Q43A 2Z2YB 1TZ0A 4K4WA 2ILYA 3W2WA 3HVWA 3BB5A 4DR5F 2HHSA 5CYQA 1PBAA 4KC5A 4F04B 2LEPA 1YRTA 2JSXA 5HATA 5HK4A 1YJUA 1YVFA 2W9BA 4DS5A 3I9V9 1UW4A 2QC3A 4ZJOA 2R2UA 1RWWB 4KPCA 5ETMA 4DWIA 1RHRB 1ELOA 2CWKA 3DNCA 1NSAA 1OS5A 4OZ2A 1UFKA 4Y2IA 4ZOSA 1WJ9A 3PJ9A 4JI4F 4OZLA 5KFOA 1RBAA 2BE9B 4FYYB 4DUZF 2R7TA 3H40A 3Q8SB 1U2RA 5A8RA 2XZTB 3Q23A 2F4FA 4FVMA 5LT5A 4USJC 2RUSA 4CO5A 1HBUB 3BEGB 2H48B 1VBYA 3LAKA 2BW2A 1L3TA 1QAJA 2CFXA 1RDRA 2FD2A 2DHHA 2O3DA 1H0HB 1YX2A 2OGUA 4JI8F 3IFEA 2V4RA 3R5DA 2HQFA 4F4ZA 3TX0A 4LF7J 1HNVA 2CNKB 3GR0A 4C0OC 1WACA 1UWAA 3A3PB 3AOBA 1WEYA 4QR2A 5KFVA 1RQ0A 3VAMA 1MMNA 2DY1A 1Q16B 1RAHB 1PAUB 5CZVA 5DG9A 5LM7E 4N47A 1LK5A 1LWCA 2CPDA 2Z56B 3K89A 1M90T 3D1QA 2B43A 1DRZA 4Q8FA 2HNZA 4DPTA 3TW0A 2CJYB 4NCGB 2Z4PA 4O23A 3KHGA 1S77D 5AXLA 2FJAB 2HFSA 2VFTA 2XCAA 4JV2A 2AYEA 4PR6A 3W63A 4JI3F 1RLDA 1VRUB 1HNVB 2CDRB 2HQCA 4ZPTR 5DZ7A 2F4VJ 4K0KJ 2OPRA 3NS7B 2A2CA 2XO6A 1RAJA 3U1LA 2ZH2A 4X4QA 3WC2A 2H4YB 3SSQA 2HFZA 5L38A 3CD7A 4DR4J 3KLIA 1G6BA 3D28A 4ZDNA 2W4DA 2ALYB 3O44A 2B3TB 5KFIA 4ECWA 2LYVA 3JTNA 3HHDA 1UEKA 4DR4F 2DGQA 3MM5B 4JI6F 1UL3A 4YR3A 4OHWA 1XN9A 2ZM6J 2PMWA 3UD5A 3T1AA 2KZZA 4YOEA 4M8LA 2MZQA 1O6XA 2M8DB 3V6DA 2GVDB 1NDKA 1GXUA 3EMTA 2OEKA 2W2NP 3M2VA 2VG7B 4PG5A 4J9VA 4JI0F 2ASYA 2E66A 2U1AA 1CG2A 1D9AA 1IM6A 3I5BA 4JI2J 2FJBB 1UTAA 1UWBA 3M1VB 4RBVA 4O3PA 4G1PA 5IFMA 5KT6A 3DDNA 4JI2F 3NBPA 1JLBB 5KFFA 3LWLA 3G4SS 2GVZB 3NGUA 5KFAA 2MLXA 3M8ZA 4B9NA 3A8KA 4ELUA 1WC0A 3OR2B 1KVJA 5IC4B 4LFCJ 2PMHA 2J5AA 4UUXA 1X4BA 2HLUA 1DAXA 3OTEA 4HH0A 4TLRA 4OX6A 2LDIA 3M8YA 4HTIA 2FB0A 1VQNS 4RUAA 4DPYA 5LOQA 2WSEC 4IFVB 4XPEA 1S97A 4ZPDA 3BDPA 1FEEA 2C3YA 4XPCA 4L72B 2ZWPA 2H5IB 2FJDB 1T05A 1SH0A 2Q66A 1UETA 2JEIA 3BKTA 3ISZA 4EU0A 3CMAS 2F7VA 2Q1LA 3GFZA 5F8GA 4YQWA 4WPAA 3VAFA 1TAUA 2YNHA 4XK8C 1C1BB 2LKZA 4RZRA 1NJXA 4DZ6A 2YNHB 2KXHA 4JI3J 3BV8A 4C8YA 5F8IA 4IQMA 3BQ2A 1HNZF 4FF3A 4DR1J 2OHDA 2KXNB 1TUVA 2NR0A 4JYAF 4IDKB 4EGLA 3CWJA 4AE5A 2XM3A 1NH7A 4ZP9A 2RHQB 2KVIA 2CPEA 1WHVA 3ZNUA 5CA5A 1PGZA 4UY85 2PGCA 2YQ3A 3JSRA 2R2SA 4F4XA 1VQ7S 4B3SF 1OY6A 5CYMB 1U8SA 4Q7AA 4ICLB 2LXUA 3I5CA 4OHZA 3TRGA 5IT4A 5IM0A 4ANEA 5B0BA 2MSSA 3ZZZA 1LFPA 2K3IA 2RDDA 3SIPB 4IOCQ 1RWNB 1QM9A 4NI2A 2IMWP 5I42B 3K5NA 1N6QA 3MMAB 1NDLA 2YKMA 4AL7A 3QRQA 1AB8A 1RAGB 3FVYA 5ADZA 2DNYA 4O4GB 3B8HA 2DT9A 3TAMB 2A6MA 1WKKA 4Y2MA 1JK9B 3DOLA 2F40A 1FXRA 1D09B 3K5PA 2CJBA 4ELTA 2KHDA 3OW2R 2OELA 2UXBJ 3C15B 4TY8A 2IM2A 1H6KX 1HWIA 2OI2A 3FRYA 4Z7CA 5FDLB 4UQGA 1N5YB 1DY3A 3RW7A 3KOAA 3KHLA 5SUHA 4DDFA 1VC6A 2VG5B 2AIRB 5GVQA 3PKMA 4DJBA 4I7FA 2LLZA 4C48A 1U45A 3H42A 2HHHF 4PRFA 1FA0A 1U0HB 4PXBA 3NG8A 4DR3F 4OI6A 4USIA 1FDAA 3D67A 3QSYB 2YNGB 1FRLA 1WI6A 3GYXB 3UVJB 3VGUA 1WUUA 4NASA 4NLOA 1X4EA 2DGTA 3VHQA 5J2PA 4A8MP 3H5UA 4KTQA 4QYRA 1SH2A 2W25A 2WAQD 1NKEA 4HT7A 1R8BA 5KG2A 1CJVA 5LXYA 1HNXF 3RRGA 4NXMF 2HRYA 3JAMU 2XSJA 2DEIA 2Y8YA 3KMSA 2VJVA 3DFEA 1CJTA 2YNFA 3BF4A 4QJVA 1ZETA 3D0HE 2DIVA 3HVAA 3TQ1A 4KSEB 3JQJA 1F60B 3P6YC 1WOPA 1YJ7A 2V67A 4DX7A 2SXLA 2QLFB 2KHCA 2LU2A 2MQPA 3V6DB 2G2ZA 3BGRA 2DXDA 4LF9J 3D66A 3H8YA 1PJ6A 3KDNA 3LQVA 1LWFA 1O0PA 2G2OA 2C1EB 2KKHA 4PEOA 5B0EA 5KFSA 4DCOB 5LSOA 1HI0P 2MPUA 1HNWJ 2KJVA 3I31A 3LP0A 3O2IA 2GQ2A 1IR1A 4HACB 2DHAA 4B3TF 4G3IA 1AUSL 2IJNA 1UPMB 1RWUA 2IC3A 5LMNF 2E5GA 3EGVA 5K9FA 4NXNJ 4I67A 1SJFA 3ZTOA 1QTMA 2RILA 4OYAA 4B3OA 3R5JB 3FKBA 4NWBA 5F41A 3EGZA 3ZZRA 1XWLA 1ZOTA 2M70A 4J9SA 2YKMB 4M5MA 3IR5B 3K5LA 2YX1A 4LF4F 1E6VA 2F9DA 1CJUB 3QGGA 1RKJA 3EE3A 1RT1B 4DV5J 1PJ7A 1S1WA 4LF9F 4Q43A 4LF7F 1JLQA 4W4MA 1MROA 4C3MA 3CCVS 2R9LA 5LL6d 1JLGA 3GJSB 4ID8A 2ZNYA 2WVFA 3K17A 4IDKA 5AE2A 3NNAA 3L4BC 1FKPA 2OD6A 3AQOA 1U09A 2M9KA 5I3UA 4OHXA 3UWTA 3QAUA 1NDPA 2YKNB 1OWXA 1KEKA 5DDPC 1ZM9A 1NJIT 3ICLA 3TUJC 4UOGA 3DOKA 3H5XA 5B0DA 5BJRA 1S1WB 2PFFB 3K8VA 4I2QA 2MQLA 3RG6A 5G0RB 4ED6A 3GCXP 1JXLA 3E01B 3MEKA 3MI7X 5IT9U 5KG6A 1FJEB 1F5BA 1TKZA 2EBGA 4NZ6A 1TKTB 2X51A 3TA1A 1QVGR 1FVQA 4OZ0A 3J81U 2ZC3A 3G71S 2BKPA 1NXIA 3U27A 4L3KA 2E29A 3KJNB 1MMDA 5JMNA 1NJWA 2FVQA 2ZH7A 2QZ8A 1REGX 3PRVA 1KR4A 1WOSA 1S6QA 5F0UA 1NBEB 4RX6A 4OYMA 2R8JA 2GO8A 1RHMB 2V94A 4HDHA 4PXDA 3JSMB 1NEEA 4F0KA 4ZCKA 5KFJA 2QSWA 1XMBA 2CPJA 1JKHA 4OV6A 5DLGA 3IO1A 4ER8A 2XMMA 3TJ9A 1VQ6S 2HNDB 3NP5A 4KGMA 2WBMA 2B4UA 5L9XA 1S59A 4GMKA 4DZDA 2E5IA 3FBEA 5E5NA 1N5TA 4H4OA 5IM0B 2FQQB 1CQNA 4WIQA 4IG3A 3T41A 4DPUA 5DM6Q 1TL7B 5CH7B 1VC5A 2AD9A 1QSSA 3KTQA 3I0RA 3JYTA 1KQGB 2CPYA 2VDHA 1EQ0A 3MM8B 4X4OA 4QR1A 5CCLA 4B3SJ 1VQ9S 2HVHA 2RNEA 3B82A 3PYDA 4HKQA 3WBZA 2A3JA 4CLYA 2Z2MA 2BKNA 4WFXA 1HQUA 4YDXA 4J9MA 1S49A 4ZLLA 1Z1ZA 3I9ZA 5C5JA 2DPIA 2YNGA 4PG6A 4KFBB 1NSQA 4EBCA 3TNVA 4EEYA 2ASLA 2CG8A 1S1XA 5L1LA 5A8RB 4WXOA 5HMYA 2QG9B 5DM7Q 5I3QA 1NHVA 2GVDA 5C24A 2GQCA 2M2BA 4C8MA 1HW8A 1RWPB 2BZ2A 2DKOB 3B6BA 3CCSS 4B08A 3W9IA 5G4DA 4ZVRB 4C6AA 4WFBQ 3QAEA 1J27A 4DV1J 3T5HA 1X4AA 2FUG9 3CTRA 3HVTB 5JJBA 3CJTA 4DL4A 3LANA 4U67Q 1AROP 3TEHB 1REVB 2IA0A 2YX7A 3C66A 3DYAB 5LSLA 4LFCF 2P9CA 3HCXA 3W2WB 5J2MA 1B64A 4F8RA 4H4MB 2MQNA 4DL7A 3MDFA 1ROFA 4EK2A 2H1YA 4NA3A 4OZJA 2O5DA 2KYXA 2VUGA 3CDBA 4F4YA 2QEXS 2MEWA 3LP2B 4PWDA 4YMEA 2W7PA 1IBMJ 3CJ4A 4F36A 4J9NA 1Y3KA 1V3SA 2VPWB 2W2QP 2X7IA 2DR9A 4CLUA 1TP7A 4DV1F 2AYGA 3FZBA 1GQEA 3RRKA 3PR4A 1RAIB 1JX4A 1HYSA 1S6UA 1RGVA 2J7WA 1D8YA 3G96A 2HQIA 5A6WA 3EICA 2AWZA 5C25B 3NNCA 3GSIA 5SZTA 2MYFA 3US5A 1YRUA 1ZAWA 3WIVA 2I5JB 4ZPWR 4C11B 2X1AA 2BJ9A 3D6HB 4N41A 5J2QA 4LFBJ 3W5XA 2DRDA 4P7TA 3K58A 5KT3A 3CCJS 5KG3A 1QE1A 3IGNA 5KFHA 2D69A 2JC0A 3GQCA 3SEOA 3I55S 3OFGA 2H9ZA 3CC2S 1UP1A 2F3JA 3OPKA 2HQDA 4ERDA 2OPSA 3OFFA 1HNWF 1WOOA 2EFQA 2F63A 1X5PA 3JYTB 1ZTTA 2B0GA 1VCTA 4LR7A 2WZ1A 2OPQB 2ZKUA 3BBCA 5F9LA 3CJ2A 4F67A 1NPRA 3BGRB 3D2WA 2VJUA 1IBCB 4ZN3A 1S9GA 1VK8A 1W2BR 4RLEA 4YP3A 2CQ4A 4ILLA 1Q0NA 4MKYA 3ITHA 5THWA 2EG2A 4EFAC 2H5EA 1KOOA 1OQ3A 1W7WA 3DOMA 5DRKA 4AQYJ 4FYVB 3D7SB 5E3AA 1R0AB 2EPIA 2I38A 3QBCA 3UCGA 3GJRB 4L75A 1DJ0A 4PYDA 1X5TA 4UW2A 3L3CA 3P5TL 5KFWA 5L1JA 5D3GA 2ZH3A 2V8DA 1WSVA 3N6MA 2QLWA 4ENOA 1FNMA 2QL7B 3FBBA 1C0UA 3I96A 1X0FA 3SBMA 1IKXA 4DV2F 1U4BA 1DTTB 1GNKA 1XMQF 1SL2A 3NY0A 1WC3A 3KG0A 1V5IB 2VA2A 3DLBA 3PRDA 5L39A 5LMUJ 1RYSA 4Y2AA 3ISNC 2KB2A 4L76A 1WF1A 1RLCL 3N28A 1C4AA 3BN7A 2JVOA 4BC7A 3D0IE 3ET6B 1MLAA 4KV8A 2RB7A 3QJPA 4P73A 2DY9A 4Y00A 2GMLA 1MN7A 3NXZA 4MFBA 5KFNA 4DSFA 1XMOJ 1AT1B 1EQMA 1S1TA 4L6V3 4M1KA 1UVIA 1K1SA 2G0JA 4JV5F 2UXBF 4RNOA 1Z2LA 3EXCX 1R7IA 2DIUA 2VFVA 2XCPA 2J9EA 2F4VF 3N5FA 1PO6A 2MKHA 1VGYA 2GS8A 2VASA 1OYEA 3WQPA 2ATLA 4J5OA 2DB1A 1U1QA 5E33A 4WP9A 4JUZA 5K8MA 1YLXA 1YK9A 2FHMA 2OP5A 3JTPA 2K3KA 5B08A 3MMAA 2XNRA 4PG7A 3IRXB 1WSRA 3UNYA 5I42A 1N6QB 3MAAB 1SPBP 4QW9A 2DNKA 3SDEB 4CZCA 1HQEA 2VC0A 2OFGX 2XMUA 1ZM3A 2E9ZA 4DV3F 4AL5A 2GX8A 3CO0P 4ELVA 3UN3A 4O3QA 2AEFA 1GXLA 3TVZA 3CSKA 3NGRA 2HSEB 4LR9A 1TL3A 3FEXB 5J1EB 2PN6A 4CT8A 2DR5A 3Q8UA 2HK3A 4DBQA 3KLIB 1RT6B 4WJBA 4DXLA 2IYIA 4P75A 4R5PB 3EGNA 3BR8A 3HXMA 5FLXU 1NB7A 3RYLA 4ES1A 4NCAA 2MZSA 3FCHA 5D0HA 4M95A 5KFYA 1QAIA 3JS9A 2ZEJA 1XNQJ 2C2NA 3C14B 1ZPWX 2L08A 2VFSA 1XNRJ 3CD5A 2OEJA 4IKAA 2HHTA 4CH7A 2GMHA 2PI5A 2V6AA 3P96A 1FRKA 2XY7A 1W2IA 2ASJA 1VBKA 1UFLA 3DRPA 1U1RA 4F7VA 4ED8A 2FDNA 4ILRA 1RISA 1SKUB 1F6TA 2FZGB 3FMBA 5CYQB 1NPKA 1RTJB 2HQGA 2XSJB 3F41A 1L3VA 1U1OA 3CB4A 2LCWA 2CIMA 3W7BA 2I0XA 4M5KA 3WZ0A 3SCJE 2NXUA 4ZCLA 3NNHA 1RJJA 3X3UA 3AD7C 1L3SA 4CCHA 1KNZA 5A2QU 2NXEA 3AT1B 4PWWA 4WBFA 5HP1B 1APSA 4ECTA 3RW6A 3VAGA 1NK0A 3G82A 1VISA 2FHJD 4S0MA 1NK6A 1S1VB 3MEEA 4CLLA 4TQSA 2YQ0A 1F0XA 2UU9J 3ONQA 3VQTA 3W2VB 3HPOA 4USWA 2ZH9A 3Q8QB 1SQGA 3X1LB 2J9CA 2V68A 1N5QA 2DNZA 2WSCC 3TQEA 4OL8A 3V4IA 2A0FB 3CCTA 1X4DA 5DETA 4ED7A 4G1IA 3HHLD 3GE9A 2Y0SD 1HMVA 4RL1A 4RO0A 2MLYA 4TKTA 2F65A 2VBWA 2Z0GA 1YZ7A 2BBEA 3A8IA 1N0VC 3AQPA 3DLJA 3M2RA 3VCDA 4NZ7A 3IBCB 1YJRA 4CH1A 3PR5B 3OL9A 1Q7LB 2IRUA 3AAWB 3HT0A 3WX4A 1AYEA 3SCKE 4QPXA 2XEXA 3DMJB 1HFEL 3PFEA 4DSIA 2HFUA 2HS3A 2F1FA 2VB6A 3I0SB 5F9NA 2BXJA 4P7VA 4DF8A 2K1RA 2JHEA 3MECB 4FS1A 3PZPA 4DR2J 5KFQA 3MZIA 2IYGA 4A8FA 3VAIA 2XMTA 3KFWX 1SVDA 1GX6A 2G9OA 2FLPA 4IYQA 2YWWA 3V6JA 1Y5IB 1RT4B 4LIRA 2DGUA 3J7Z5 3ITHB 2RKIB 1HWUA 3MD1A 2KRBA 4OYPA 1DURA 2R8IA 2MKIA 2PT0A 4DV0F 2CPIA 1N56A 1IBLF 3KHHA 1BY9A 3EPIA 3MCSA 1J5EF 2GQQA 4ECQA 1HBUA 1Q78A 2PO4A 4QWBA 4L74A 2LQ9A 2Q3PA 3WC0A 4I64A 4U8YA 2P8IA 1N4LA 4Y6IA 1DTQB 3C46A 3THTA 2IRYA 3Q0AA 1JLCB 1YBAA 2YKOA 1U26A 1T05B 1N0UA 2OPPA 2GMJA 3MCOA 3KK1A 1U1MA 1IQTA 1VJWA 2ZJRQ 3LH2S 2VHGA 4RNHA 4PZVA 4K4YA 2AYBA 5HMZA 4YR0A 2R3VA 5K8NA 2HNYB 2RE1A 4C0BA 1Z4UA 5C25A 4U7UK 2EC2A 1RTHA 4X4PA 4GKKJ 2ZD1A 4YY3F 4FZVA 5ETPA 3S7RA 4TU9A 2DD8S 3FGVA 5A8KA 3OTOJ 2GZOA 2BOPA 1QSYA 1HI1A 1NU4A 2HVZA 3N6LA 5H1SV 3QLHB 3FSXA 2V4JB 1TELA 3I0SA 3J7YI 3RR7A 2XMVA 3TI0A 4H4KA 2L48A 3RBZA 3W5ZA 5KFPA 1GH8A 2HK2A 1U1NA 3G87A 3GIRA 4OIXA 1LV5A 4E98A 2QLXA 2XMJA 4AQYF 1TK0A 2R7UA 5D6GA 2ZHAA 3Q22A 1IXKA 2ZDOA 2FJWA 5RUBA 2OMLA 4LMZA 3RR8A 1NJYA 1Q5VA 2B4PA 2LQBA 3IG1A 3NRBA 1FJCA 4J9LA 1D8ZA 2LEAA 3NOGA 5HROA 1PYTA 2B6AA 4DG1A 2HHWA 1KLNA 4P72A 4HI2A 4Y3CA 3EJMA 1IVZA 2GAGC 2V8PA 2E7VA 2X3DA 1EB0A 4NA1A 2ZVSA 4NLVA 1H72C 1FFSB 5F0WA 1DTQA 2IM0A 1YZ6A 4FKXA 5CHCB 2ERRA 3GCWP 1TFWA 1R31A 3PV8A 1VHIA 4WFZA 3W5YA 1CJKA 3KK2B 1NCLA 3HHKA 1RWMB 4TLQA 3EPGA 2KRRA 2VFRA 3OL7A 1R0BG 2BW7A 2QO3A 2YVSA 3K59A 3QLHA 2PD1A 2MZTA 2B6AB 3OHAA 1P9QC 1RTIB 4CTAB 3T5KA 3KG1A 3IBFB 3T1YF 1FRXA 4X4RA 4C9DA 4CM2A 2MDAA 3DKDA 3SQGA 3UW1A 1SJRA 2ZD1B 4DFMA 3RB3A 4P9SA 3W61A 1SI9A 1GAOA 4G1QB 1HBNA 3A13A 3NCRA 2DH8A 3IS9A 1BHNA 4R8UB 2HWTA 4J9KA 1ZTWA 2C42A 2HNDA 3GZ7A 3M8PA 4C7QA 3G6VA 3LA0A 2YKQA 2W8KA 2NZ4A 3OL6A 1WF2A 4ZVFA 2W8LA 2M0GB 3V81A 4FYDA 4YB6A 3TEGA 1NKBA 4JV5J 1NH8A 3CO9A 1FRMA 3T1HF 3CMQA 1Q8IA 2HAFA 3AD8C 3QT8A 4LRFA 3N79A 4OFZA 4LFAJ 2AU0A 2L9DA 1S6PB 4I1TA 2BKOA 1H38A 5HVHA 3I4PA 3M2UB 3KLEB 4O3RA 2J7UA 1VR6A 2P6SA 4IH6A 6FDRA 3T1YJ 3E51A 3TOQA 2JEGA 2QV6A 3AOAA 1FX4A 2YY3A 2W9BB 3UCZP 3DI6B 2BX6A 3MWBA 4DR1F 4JYAJ 2FLOA 4ANDA 3G9CA 1O51A 2G0IA 4MJKA 5CD4A 9ATCB 4O3NA 1HR0J 2M7SA 3V6HA 4LF5J 2UXCF 1SKRA 1FCAA 1Y00A 4G65A 3CCUS 2BRLA 1QSLA 4LF6F 2B8QA 2NPIA 3PXGa 4HEA9 5HVFA 5EGYA 6AT1B 4ZK7M 5F8LA 4DSJA 2DGXA 3R7BB 2NPFA 3HZGA 3JB9k 1X0PA 1UEUA 2NS1B 3T1HJ 1RTDA 2GHVC 5CZXA 1F1BB 4TXSA 1Y10A 3QIPA 3ILLA 3IBWA 3KK3B 1NK9A 4DQIA 1FD8A 3DLKB 3MPYA 3GV8B 1FFWB 3BGFA 3G8QA 4ZVQB 4G1QA 4GKJF 3HI9A 3U1NA 3QO9A 4ZP7A 3BS9A 1HMVB 2YBVA 4IFYB 3KJFB 3UN5A 1B70B 1EETA 1ZM2A 2P2CB 2W2OP 1FWPA 4AFFA 5EWEA 1AUDA 1NHKL 4ED3A 3GV5B 1N48A 4QWDA 4KH1B 5AE3A 4USHA 2K1RB 3V4IB 2UUBJ 4B9LA 1JJ4A 4KQZA 1VJQA 2QMUB 5DQIA 1GMUA 4CNZA 4DL0C 3B4MA 2DEJA 2G13A 3PKYA 3QSIA 1Y5NB 2RDJA 1XR6A 3IM9A 2XLJA 2EFGA 3OTOF 3NMRA 4X65J 2CG4A 2OSRA 4ZVOB 2FJXA 4B3OB 3BREA 4M5HA 4PQUB 1WELA 4KIAA 2EFPA 1Q95G 4AYBD 4CO2A 1YWXA 2ZDPA 4U9RA 5F8MA 4MYUA 2NZCA 3UQSA 5J2QB 1EX8A 2LDYA 1KSPA 4GRSA 4N8OA 2IFXA 4CIOA 1RSCA 5HROB 3AA8A 1RWKB 2VKZG 1IN0A 2K2PA 1XR5A 2DO4A 3ISND 1HARA 3I0RB 3OBIA 2ZUAA 2YH0A 4MKVA 4OHVA 5DO2A 2BQ3A 2ALZA 2FGOA 3HDSA 2DO0A 4NYOA 3LGNA 3OUYA 1OMSA 3GYGA 2GCFA 3TUPA 1C0TB 3KK3A 2GGPA 1RA6A 1YJVA 1S0NA 5I3PA 1HQEB 5GAHU 3POTA 4USKA 3MECA 4WKYA 2DGOA 4USUA 2XMKA 5HQMA 1BXNA 3NS5A 2R7VA 1BWVA 2JNJA 3KNAA 2KL8A 3G8TA 3DMJA 5D4OA 3FRZA 5KFLA 2E1CA 3BPDA 1YIJS 4OX7A 3A12A 5GAHI 3W9JA 4QIWD 3IWNC 1UZDA 3M6VA 2CQHA 3BKUA 4K50A 4H4MA 2VBZA 4AT1B 1HIYA 3OUYB 1HBNB 3OJSA 5D0GA 3QT6A 1TFYA 1NSPA 4XTTA 1X8DA 3DRRA 3FDSA 5HMWA 4GO5X 1TK8A 1G7CB 3C6UA 2D9PA 5K14B 2CNLB 3MEGB 4RW6A 2W2PP 2DTJA 4OJ3A 1IKVA 3IG1B 3IR6B 3W65A 4A8QA 4DR7J 2RF2B 4URGA 1V5VA 1PILA 3HFKA 1U6FA 5J2NA 4ZVEA 1BGXT 1YBTA 1FTRA 4DFKA 3BGUA 2M3DA 4B9MA 4RW7A 1RUSA 2RRNA 4TN2A 4ZVSB 2X1GA 3C15A 4RR5A 4TY8B 3RUBL 2FJVA 3BKFA 2PMZD 3VQSA 3VGTA 2HBRB 1U02A 1Q82T 2A10A 4YHHF 4ZVGA 2KG0A 1G4CA 3POTB 1J2VA 2V2ZA 3TVKA 3J7ZT 3CC7S 1R8CA 3V4MA 3KUHA 3UDLA 3VZHA 1VHFA 3D9BA 3OSPA 3T6JA 1F9EB 1O8BA 5J2MB 2Z30B 3PCOB 2ZNZA 1RADB 3ENWA 3G6YA 2FGCA 4K4TA 4Q0BB 1RHJB 3IP0A 3M6UA 1FJGJ 3RBXA 2DVIA 3OD2A 1VRTA 1ZH5A 4MFBB 4Z37A 4NEZA 4LF1A 2RT3A 3G2XA 4KKOB 4JI4J 4KJIA 4WF9Q 3GIMA 1XBWA 1TAQA 2AX1A 4GVBA 4LUBA 3OV7A 2QJ3A 2DGVA 3G6ES 4QBUA 4LF5F 1U1KA 4LF4J 4LSNA 4YY3J 4LF6J 3EDQB 1HNIA 2MHEA 1PBUA 1C1BA 2HBYB 4DR3J 1SQFA 4YUDA 1RT7A 2YPYA 1HBOA 2XHWA 1WTBA 2ZM6F 1SJ1A 2HRUA 4DR6F 3EXYA 4GC6A 2U2FA 2OIHA 4ID5A 5FD1A 1CC7A 1E6YA 1MU2B 2FTRA 1YDLA 3OJUA 3KXDA 1XNRF 4QIEA 4DCPB 4DI6A 1D1UA 4TYBA 3BPSP 4ETXA 4USVA 2DISA 4X4UA 3DLKA 5IOLA 3AB4B 2FLNA 4QIVA 3HD1A 4ZIVA 3JSYA 3WIUA 2EC0A 1IWGA 1Y0HA 2QE5A 3BYPA 1OYDA 2XULA 5FLXY 1QVFR 1ACMB 2NUHA 2OPQA 2RIJA 3H2LA 3CDEA 1XERA 3F44A 1U7LA 3O8WA 1PG5B 4LBIA 2Q79A 1FKOB 2GHWA 2APOA 4BHQA 1HD0A 1WEZA 4FXVA 5J1PA 2VODA 1TMJA 3JXOA 4WYWA 1S6QB 1YJNS 1S6OA 2RMLA 3W3SA 1R0AA 4NMLA 1TVRB 5K20B 3PYFA 3QJJA 2DNPA 2IVYA 1F2GA 5D15A 4C98A 1HPZB 2VG7A 3SQGB 2HRTA 5AE1A 3MUMP 1S1TB 1T0TV 3DM2B 1VBZA 2HHUA 1BD6A 2HFNA 3DRPB 3ILIA 2OD4A 5L46A 3HJVA 2IM3A 1IWAA 3ET6A 2XYHB 3CD6S 2RQMA 2FC9A 2XZWA 3D1HA 4J9UE 2OPPB 3AHPA 1S99A 5BR8F 3KK1B 3M2UA 1IKYA 2AX0A 3PX6A 1U6BA 3KK2A 3T6BA 2OPSB 4P10A 1C4CA 3PHEA 1FWLA 4ETZA 1EZZB 3M9NB 3CJRA 4P52A 2C2DA 3UO0A 4F3QA 2Q6BA 5HQLA 5L9NA 4QW8A 3RAMA 2F9JA 2BYCA 4DL5A 5HP1A 2KDOA 2PFDA 1VQPS 4IG0B 3R8YA 3RJMB 1GX5A 8ATCB 2W01A 1R0CB 1S10A 5D4NA 3HSZA 4IFYA 1FK9B 1H73A 1S79A 3UE2A 1TKXA 2A18A 2CVIA 2XMAA 2XLIA 3H98A 2MY8A 4WP3A 3M32B 4YB5A 3CDUA 3TO8A 1ZZNA 1ZBTA 2Q6CA 2XG8A 4A46A 5CAAA 4NZ0A 3KJQB 3OHBA 1RTIA 2CZVC 4CTAA 4RW8A 1FTCA 3OQ2A 4UY8T 2J0XA 1CLFA 2FZCB 4UTGA 2YWKA 4DUYJ 2C3OA 5GAGU 3KJVA 2J6UA 2YWGA 2D3ZA 5KFTA 1WC6A 1HWLA 4O44A 2JDJA 5C24B 3KLGB 3JSMA 3EZ5A 5AT1B 3SFGA 3UR3C 5DDQC 2DNNA 2HAIA 4NEYA 1V3ZA 5F3ZA 1JMTA 1WF0A 4KFBA 4XAKA 1SH3A 5J2NB 3BSNA 2LQJA 4KHPJ 2AP6A 2AKWB 1WDDA 3EGWB 4NLYA 2UUCF 2KFZA 3UVJA 2AZ3A 4TVAB 1JJ2R 1AZSB 3H2VE 3L7PA 3PIPQ 3PO4A 1KBRA 3O6QA 2FVCA 1WTFA 2QL9B 2DYAA 5GAEU 2CQCA 2M88A 3RB4A 3DLEB 1TKZB 1NM2A 4IRDA 2ZITA 3C6TB 3Q8RB 4DUYF 1J5OA 4LRCA 1FHTA 1KVIA 2WK4A 3EUNA 2MMYA 2OSQA 2VF3A 3H59A 2BJ3A 5KG0A 3MAQA 2KT3A 4CM0A 4KBIA 2BQUA 2XHCA 3IRXA 4OQJA 1PC4A 1N5SA 5EX3A 4DX5A 1X9MA 4K0KF 1HNXJ 4NXMJ 1RAEB 1BQMA 4OI4A 1Q1KA 4J9OA 3K7RA 1VQ8S 1YHQS 2UVVA 2VPZB 3NGTA 1NLKL 1XEZA 1S0OA 1SIZA 3R97A 2RKIA 5FIIA 4DMZA 8AT1B 1UJ4A 2LVWA 3H20A 5B0FA 2DXFA 3Q24A 4F26A 3CCQS 1IJEB 2G1DA 2VQFF 4MMOA 2QN6B 2Y0BB 1KVKA 3MMBB 4BDPA 3AY0A 4HHJA 3GG0A 4BBYA 2ROGA 3MM6A 4ZVPB 4GKKF 1JLAA 3AB2B 1TL1A 3MR2A 2WB4A 3HLUA 2XS2A 1YJTA 3AJ2A 5ETTA 4CDIA 2AMCB 1X9SA 4FXDA 2E9RX 2AEMA 2JEJA 4DPOA 4NXNF 2JZ5A 3SCIE 3H2UB 3N5BA 4UF4A 1AA1B 2VOOA 2BMBA 5E2QA 3GSDA 4OX8A 1WC5A 1T95A 2JX2A 4P2SA 2ZZTA 3CJ3A 5LXRA 3TJAA 3DN9A 2QMWA 2N7CA 4V19J 3DC2A 5CABA 2CJAA 2N7YA 4ZMMA 2QA4G 4B9SA 4ZHRB 2RAQA 4IOBA 1GT8A 1ZM4A 4FPIA 2HVDA 2YPZA 2B4OA 3BGOP 1S57A 3D54A 4NLXA 3MR6A 1RKIA 4NCGA 2CNNB 4DFJA 4UZBA 4X64J 1NK4A 3GTYX 1Q86T 5B7WA 5KFRA 4X4SA 1PC5A 4RU9A 4KGZB 4N5SA 2ZBQA 1AFIA 5GMKa 4I2QB 1X5OA 2EKNA 3QIPB 1H3DA 1YGYA 4F2RA 5IV3A 4F4KA 5KG5A 4X4NA 2D9OA 2XYGB 2EK6A 4BCAA 4RW4A 1M5HA 2BJ8A 2H51B 3MPVA 1CC8A 1N32F 5I3UB 2NREA 2YKPA 3GONA 5EHHA 3I32A 1UCNA 1FKPB 1UZHA 3DU5A 1R8HA 3V5RA 3UPFA 5HBMB 1VFJA 4KRWA 1FJGF 4ZVUB 3K5MA 4AL6A 2E1AA 2XGPA 4NX9A 4A8YA 1IM4A 4DU7A 3Q2TC 4MK7A 3GG1A 4JOUA 2MTLA 2G1HA 4XO0A 2FVPA 5CCMA 2FC8A 1EKRA 2VD3A 3E3XA 3PW5A 4RUHA 4LSZB 2W9CB 1HBMB 2PA3A 2YXLA 4TY9A 3W8GA 2X1BA 2HHXA 3MPWA 3FCWA 3G6XA 3BBFA 1UAWA 2KTQA 1JLCA 1JIHA 1B0PA 5D78A 3IMQJ 3T19A 2O67A 5IXUA 3IAM9 3DRSB 2MQ8A 1WHXA 3M8SA 2RQCA 3NGSA 5EDWA 4KO0A 1CJTB 2YNFB 4DR6J 2AF6A 2RUGA 4M5JA 2QFJA 3GFHA 3OR2A 3ULHA 3ZZYA 4TQRA 4GVLA 4UUWA 1U1LA 3L7OA 2B51A 2BJ1A 2IC3B 4ZITA 4DR7F 4PYAA 2FVSA 4OX9F 3BQ0A 1CVJA 2OTJS 4R0JA 2E5JA 2HLTA 1FE0A 3DLGA 4DV5F 1TV6A 2CQ1A 3IWXA 3QPIA 4A8KA 4DPXA 5T14A 4B3MF 4Y2KA 2UVRA 5B0GA 4G6VB 1FDBA 2DGWA 1R89A 1AFJA 3R1LA 1WDTA 2XWXA 4WXWA 3D1OA 3J81Y 2AGQA 3JAMY 3S8SA 4NCBA 1RAAB 2UXCJ 1QDUB 2HIQA 5KT7A 3MMCA 1EP4B 1F5AA 1NKCA 5A0YA 1VDHA 4HH1A 3VR1A 4CT9A 3ZZOA 4QWEA 2FY1A 4QQBA 1FK9A 1S4FA 1UVMA 2E5HA 3Q83A 1PYOB 1UA0A 1Q5YA 2OTLS 1KRPA 2H4WB 2D3OR 2IBKA 1QY7A 3CJSA 2GNKA 4P71A 3DXSX 4Y0FA 1HQUB 3T9ZA 4NLQA 1WHWA 3QGPA 4DPWA 4P74A 4FVCA 4C8LA 4PG4A 1XMOF 3S01A 5KFEA 4DL2A 1VLOA 3CJ5A 3QQCD 2ZH5A 1M1KT 1KDNA 2PIIA 3ZZTA 1S9EB 1U0HA 1OJ4A 4YFUA 2KFYA 1VBXA 2MB0B 5IT0A 3ENAA 5F8HA 2DNOA 4GO7X 1I94F 3C19A 1AW0A 3R6GB 3LPYA 3WDOA 3TP2A 4M5NA 2LEBA 3E01A 4OYWA 2KN4A 1UVNA 4ZPAA 1A6LA 1SIWB 1RYRA 4B3RF 4E2FB 2AJFE 2D1CA 2HGNA 4ICLA 3ZO7A 2NCKL 4P2MA 5AXKA 3RBDA 1U1PA 4YB7A 2IA6A 5KT5A 3DOKB 2J0WA 4NLRA 4IO9Q 2VL1A 1IBKF 1WD6A 3HD2A 3LP2A 1TL5A 4WYLA 1PJ5A 1IBKJ 3PW0A 4DV3J 5D3GB 1IBMF 2Z2ZA 4IRCA 4PPDA 2LXFA 3TA0A 3FEYB 4NRUA 5GAGI 4B17A 3H4BA 1Y4ZB 2HHQA 3GU0A 3L95X 2P5VA 2AGPA 4WZMA 1MWQA 3VTIA 2BEFA 4DV7J 2IY5B 1RXOB 1B0VA 2M8HA 2RU9A 2YQ1A 2HWHA 3W62A 2DNLA 4YEAA 4F4AA 2GHPA 4ECVA 2A6OA 2JLGA 1T03A 4JI1F 1S0VA 3FBFA 4MIAA 2VONA 1LXJA 4F0MA 2KM8B 2DH7A 1VRQC 2IVMA 3R5GA 4IO1A 2VG5A 5ETSA 3DLLQ 2VPYB 4X2BA 1HLWA 2NYHA 3QFHA 2I6WA 4DUTA 3MM5A 4UT4A 4HHHA 4PXCA 4R0EA 3TJ8A 4ID5B 2V34A 5GADI 2DITA 3CDAA 2R42A 1RWXB 3LOUA 1A0OB 2R7XA 3FUYA 5M2UA 1OSCA 2L3MA 4PPZA 5ETQA 1JLBA 3H0PA 1ZZFA 3ZTRA 1LKZA 4LSNB 3DCAA 4EWTA 4ZKAA 2MKCA 4ED2A 4QU6A 4FBUA 5MLCV 1BC6A 4I56A 5A2QY 1W25A 2O66A 2P6TA 1ZA1B 3P3DA 3RAXA 1F2HA 4FXWA 3NL0A 7FDRA 4AXJA 3GILA 3V2UC 5GMDA 1UFWA 5KFXA 4CLKA 4OMFG 2AGOA 3P4UB 2AJ1A 2OUGA 1GEHA 4I6WA 4QZVB 2J9DE 2WBRA 3MMBA 3Q89A 5CYMA 2HYIB 2OH2A 2DNQA 4C11A 3W60A 2YKNA 4B3RJ 4O4RA 4WWSA 1S9EA 4PWDB 4EYIB 2GVZA 1UKUA 1UVJA 1K47A 4LBHA 2E7XA 2GA7A 1P1LA 5J2PB 2ASDA 1BQMB 1YQHA 3SYZA 3QRPA 2ZOGA 1UWBB 3M1VA 1VOMA 3M2RB 4PABA 1WC1A 3U7JA 3ILJA 1R43A 1YKWA 2F5GA 2MLZA 3GFXA 3M6WA 3ZFVA 2QLBB 2JVRA 3QWPA 4WU2A 2IVFB 3K57A 4ECXA 2EG1A 2ZE2B 3IWLA 4NLWA 1KQKA 3DHXA 3AJ1A 1B4SA 2CQIA 3LP1B 5AXMA 3KLFB 3M6XA 2BE7D 3CPWR 3BSOA 3SSSA 1MW7A 3J80U 1FKAF 3CJQA 3IA0A 3PNIA 3O5TB 3PG9A 1WKJA 3FQKA 4KHPF 2YNIB 4F25A 4OLPA 2JOQA 1UPPA 2K7JA 2DRAA 2KI2A 1SXLA 4OZ1A 4O0NA 3GIIA 4F4WA 3KLHA 2C2RA 1C0UB 5KT4A 1NB2A 1TTHB 1OY9A 1Y3JA 3CIZA 3CJKB 1S1UB 4OV1A 3OTBA 4LRAA 4U6PA 3J7YU 1U49A 3L09A 3TZWA 4EZ9A 3A8JA 2MGZA 3SZ2A 1K8AT 3NBPB 2E1RA 4WFYA 2MGZB 1T9TA 3ZTSA 5HANA 2CJXB 1PYSB 4ZPCA 2AJQA 2EK1A 2VG6A 1HQ2A 1LWEB 2IBOA 3RBEA 3FC9A 4YN3B 5H9EJ 4ECSA 2PE8A 2KFNA 1OY8A 3KJVB 4F02A 4KO0B 3VAKA 2YX4A 3ZTPA 5DQHA 2V8HA 1VQYA 3C8YA 4I68A 2HVEA 3GFYA 1DHMA 1X4CA 2HGLA 5E0OA 5H9EK 5DLFA 5HLFA 1KQSR 4I7FB 4NMXA 1LEOA 4MAKA 1ZYQA 2D3O1 1DQ8A 2IHR1 1MN9A 2WVDA 4Y28C 5ETOA 3MM7B 2BE2B 3MXHP 2ZE2A 2Z58B 3I87A 4UOHA 5FDLA 3H7HB 3AA9A 3HZEA 4N8NA 4QR0A 4RWXA 2EWHA 4XIUA 4DSEA 3H25A 2CUYA 2NSCA 3M7VA 2VKRA 4X4TA 2BABA 1XMQJ 2RDIA 1VQOS 5HBMA 1WI8A 1K44A 2QFIA 3KUEA 4X84A 4O4GA 4DSKA 3W1YC 2ROEA 1TL4A 1FJ7A 2VU5A 5B0CA 1R3NA 3L7UA 4CRJA 2DK2A 1T7PA 2UV8G 5IWAJ 2FHKA 2HNZB 3PJWA 1FVSA 5A76A 3LAMA 3N01A 3MM6B 1S5ZA 1JWWA 4Q2MA 3QGHA 1A9NB 3MAAA 3PDNA 4RBTA 2WCXA 4DU8A 4OX9J 1S4EA 2EFNA 4ECZA 1NNDA 3GJQB 5AJ3J 3K2YA 1N33J 5D8HB 3E2EA 1FRHA 1FF2A 3IM8A 1SKWA 5A8WA 2V50A 4PAAA 1KHVA 2PDAA 2M4MA 3BJYA 3NAIA 4FYXB 4EO6A 3NWGA 4ZPVR 3C3LA 1X5SA 2V8GA 4DN9A 5IWAF 1ITPA 2R7OA 1LQ9A 1SJQA 3HVTA 5JVHQ 4DL6A 1Q8LA 4QWAA 4L73A 2ZJQQ 4DQSA 2ZJPQ 1CJUA 1FE4A 2XZDB 1VC0A 3OXLA 2XYPB 1DARA 2HMIA 3SV4A 3ZXWA 3ILOA 3TUIC 4J9QA 2BACA 2HWIA 5G0RA 3NGDA 2A1BA 5LSRA 2HEKA 4QYZJ 5HMXA 1S1XB 2CYYA 4WU3A 2H65B 4EYHB 3W66A 1HBOB 1FESA 3U02A 2J8SA 1U2CA 3M30A 3M8QB 2ZUGA 2MXYA 3KLEA 4QYZK 3MD3A 2O01C 2VV5A 3CDWA 1L3UA 2LFVA 2CZ4A 4LVOP 3HHNB 1JLQB 2E1MC 3BM7A 4IG3B 4WK1A 1T02A 2G2YA 2F8HA 3EZUA 3M2VB 1N5VA 4IFVA 4JBCA 4NI2B 2JLEA 2EBEA 2I9SA 3R6LB 1D9DA 3A4TA 2K06A 1OIAA 3AOCA 1EKSA 3OFEA 1C0TA 4OZ5A 5EWFA 1C1CB 2LXIA 4RNMA 3C6TA 1EHWA 5EUHA 4ZCIA 1E6VB 2EEYA 2J6SA 1RHKB 2C3PA 2NUUG 1QLNA 3CULA 4USMA 5KFMA 1NHUA 1B7FA 2I8EA 2R7QA 3CIMA 3D68A 2CADA 5CD4H 2HS0A 3PVXA 1YTYA 2M5YA 3MPUB 1RT7B 2RS2A 4CH0S 1MWZA 4NPOA 4DOZA 2IDEA 2V63A 4DSLA 1UVKA 3Q8YA 2CVEA 4UZCA 3CJ8A 3K0JA 1F3VA 5E3QA 2ZC4A 2UUCJ 4CO0A 4EO8A 3MM9B 4ZIWA 2KVQE 1I94J 3HSDA 3M05A 4U8VA 1IKYB 4WE1A 3SXLA 2R4FA 1TKTA 2MKKA 1FDDA 1J5OB 5E3RA 2HMIB 2W4CA 4A8WA 2RF2A 1MNEA 3QGIA 2UUBF 2LP4A 4QIFA 4RW8B 3PW4A 1GK8A 1VK3A 2QL5B 4FF2A 3H5YA 4QWCA 2E5LF 2OEMA 3CUNA 2EFVA 1HWJA 1QTNB 4HLBA 3VALA 3MGJA 1ZAVA 1QAXA 2PEBA 2CAJA 3DGPA 1EJ7L 3DLGB 3OLBA 1CJVB 1RT5A 3GIJA 5CXTA 3P49B 1KKHA 2OLWA 3DOLB 4IUFA 3GIKA 5FJ4A 5HJXA 3BSCA 1U47A 4NLPA 3CCWA 4M94A 3GB0A 4RW9B 1X4HA 1U25A 2UUAF 2G4BA 1MROB 2K7KA 5E3PA 1PKUA 2CNOB 1JJCB 1KTQA 5A0YB 2W7OA 1MSWD 3KLHB 2B7CB 2DJWA 4NYZA 2OJ3A 3LGMA 3WHIA 3HO1A 4B02A 2O1PA 3FNNA 1LWCB 5ETVA 1KHWA 2J76E 2J0QD 2C2EA 4OI1A 4OZ3A 2QSFA 4MYTA 3UD3P 4XDCA 4CP5A 1RCOB 1T9VA 1TV6B 3I82A 4IOAQ 3CVKA 2J7KA 5HL7Q 3R5CA 3KLFA 3H90A 3UCUP 1R8PA 2QT7A 2HURA 2UZAA 3D6TB 1DQAA 1SB6A 3Q8VA 4LT6A 5BYQA 2KU7A 3SMZA 2P9EA 1M5VC 2WONB 5MAOA 2ABYA 4P2XA 2H5JB 5EN1A 2G0CA 5IC6B 5H9FJ 4ZJQA 4N56A 2NXJA 2H3EB 1M0SA 3IR7B 5D77A 2R7RA 5KFDA 3HKWA 1YG0A 4O3OA 1NK5A 1SQEA 5LMNJ 5IZHA 4KGVB 4J9PA 2FYXA 3B4DA 4J7CA 5A6PA 3FSYA 4DV6J 2E1PA 5H9FK 3HHLB 2CJQA 4NLGA 2Z2LA 1SJ3P 2BE2A 4HT5A 2R2TA 4HVZA 2X3GA 4PG8A 4ZCMA 1B0TA 1DZ5A 2BM1A 2ILZA 2XS7A 3B54A 4NYPA 2FPHX 1FDNA 3T3FA 2IM1A 4ZVTB 3S6EA 1RT3B 4U7CA 1NZAA 4V19X 2NQPA 1JLAB 1YRXA 2VH7A 3DRXA 2E9TA 5D4PA 4I6YA 2YWFA 3DM2A 1QJHA 1R8AA 1H74A 1N8RT 1EIYB 3F73A 1DLOB 3VVTA 3OL8A 1T9WA 5HSPA 3QO9B 1BUXA 2CZ9A 4DEZA 7FD1A 5L8RC 1OQ6A 2VG6B 4ZHRA 1PSDA 2UVWA 3J80Y 4OHYA 3BSAA 3CNQP 1EARA 1H7WA 3M9OB 4TU7A 4M5DB 4LF8J 4PCQA 3TUZC 4ED1A 5KFGA 4YB1P 4LBPA 1N88A 2BDPA 1AXQA 2A2DA 2CQ0A 2KXFA 1Q8BA 3EM1A 3OVAA 1KS2A 4RW7B 1LWXA 1N34F 3UDVA 3THPA 3TWZA 3VV2B 2V69A 3I4HX 5C2GA 1RA7A 3GP9A 2Y1JA 4ANCA 4CYUA 4E0DA 3ETMA 3C16B 4LRDA 2C22A 4TNOA 4ES3A 3DDIA 3R5BA 1GMWA 2V9WA 4DG1B 1RHQB 2DNGA 3AD9C 3K5OA 3RZAA 4CLTA 9RUBA 5LJ5Y 2WW4A 4UOFA 5L1KA 5DG8A 1U8WA 3VGVA 1JLEA 1I6JA 2BV3A 4ZS6A 1JXVA 2MQQA 1WKLA 3LW5C 2AZ1A 5I4MA 1SUQA 2ZH4A 2ZOFA 4ZVHA 5KOXA 4CLSA 4M5GA 3M8WA 3DXBA 2F8MA 3HF5A 3CCLS 2FVRA 1FKOA 3QZ7A 2BUNA 1VLYA 2YKAA 3BBBA 2WB1D 5K8PA 1NSKL 2FZKB 4Y2CA 3CCMS 2VOPA 3GPAA 4OLOA 4QCLA 4IH5A 4JI7F 5JXSA 1VQ5S 1VMBA 2CQDA 1K0VA 3DLHA 1FD2A 4U95A 4JI7J 4RUBA 1M5KC 4W92B 1IQZA 1HWKA 3IS9B 1NDCA 4WIIA 4EBDA 3MURP 2BR0A 2XB2D 3M4XA 4NE9C 3OTDA 2VA3A 2LMIA 4JV1A 3J7A1 1TKXB 1HD1A 4U7UD 1U6ZA 2CQGA 2C3MA 3UDCA 2AJ4A 3MEGA 4RW6B 5KG1A 3C6UB 1X7VA 2B5JA 4K5SA 5K14A 1NO8A 1S0MA 1LW2B 2UV8A 3KG4A 2D3UA 3EVMA 2HHPA 3OTCA 4U96A 3VAJA 4LJMA 3HKZD 3CGIA 3KUGA 3FFIB 2B9YA 3LWMA 2HKEA 4URQU 4JI6J 3W8PA 2V2VA 2JRSA 3C14A 1WORA 5B09A 2Z8QA 3PIOQ 5HLFB 1S6PA 2OPRB 3AXMA 1R27B 4EUVA 2Y1IA 1DQ9A 3CF5Q 3KWMA 2XMWA 1NUEA 2B7BB 2N3OA 4Y65A 3EX7B 4EBEA 1F5CA 1VIXA 4K7QA 3BQ1A 2X1FA 2XNQA 1N36F 4JI1J 5C42A 2WHOA 1H7XA 3FMWA 1HHQA 2XGQA 3DLEA 1M5PC 3C2PA 4LFAF 3PJXA 4DS4A 2UXDF 3D3BJ 3TAPA 4CO1A 4FF1A 1CS4B 5U47A 4GKJJ 2DXEA 3P8BB 4Q45A 5L1IA 2RRAA 3BZQA 5IS2A 1NAQA 4YDDB 1NJZA 3W9HA 2MZ1A 3R9LA 4C8NA 3Q8PB 1FO1A 2Y3YA 4CLWA 2VBYA 5HI7A 4FNHA 4UOCA 3EVWA 4K8RA 4LSLA 4A47A 1TU0B 3P5BP 1BE4A 4KHRA 3HK2A 3CT9A 1SC6A 3PX0A 4C2MA 3CJKA 2R7WA 1SCJB 1T9XA 2YWHA 3KKFA 4Q5VA 4MIWA 2XS5A 3AODA 4V1Ak 3HT3A 2B56A 3T5JA 3HFVA 2IPOB 1HI8A 2BJEA 2RVJA 4P6QA 1PIEA 2COLA 3CJ0A 3DHWC 2KYZA 4X4VA 2WVBA 1FI4A 3T9NA 4WFAQ 4CO3A 2W9CA 3QIDA 5KG4A 3BYRA 3LGHA 4M5LA 4QU7A 2C3UA 5HQ8A 4RPFA 4MK9A 3W64A 2HQ3A 1E6YB 1MU2A 2HZCA 3PYGA 4LIWA 1X4GA 3V6KA 1LNQA 2XI3A 4PUOB 2NYIA 1CPZA 1LFWA 2IAJA 2HFVA 5ETLA 3R7NB 2UUTA 2R8HA 3FQLA 1YI2S 4PQUA 3LUYA 4IR1A 1GTEA 3HHLC 1P6TA 1WG5A 5KAKA 4NLSA 3KNGA 5J1NA 2CXEA 4TYAA 2AJ2A 4DV2J 3PX4A 3CXCR 1CULA 2ACMA 2EFOA 3G82B 2C28A 4O0IA 2V4JA 2IRXA 3MEDA 3UR0A 1KD1T 2W2MP 1Y7PA 2IMOA 3PEJA 4DN0A 4ED5A 1H2UX 4DCJB 2DNHA 1FNXH 4RJVA 1GXTA 3TR5A 4Q2LA 4JI0J 3ADAC 2BM0A 1JXEA 1RBLA 3OFHA 4KT0C 2V4QA 4DLEA 4J37A 3QMQA 1TVRA 1RTHB 1BQNB 1T3OA 5T7LB 4E8UA 1DLOA 3D4JA 4X66F 1KC8T 5K8OA 3NKYA 5KFUA 1SV5A 2VICA 1FWKA 5BXIA 5KFBA 1RT3A 2J8AA 2ADBA 1JNZB 3MEDB 4RKUC 1QUPA 4JV0A 1RZMA 2KT5A 3PEHA 2RJZA 2NXCA 5C42B 4X62F 1MMLA 4AD6A 2MZRA 2ZHBA 1HNIB 2K8GA 4DHVA 1ZS6A 1YBUA 4ZLNA 1O5JA 1UVLA 1YJWS 4B3TJ 3N4WA 1RBOB 2ZBCA 1T8EA 3FJ2A 3R2DJ 2R7SA 3EDRB 1BWEA 2WSFC 4LREA 4ZJLA 1M5OC 2QMXA 4CLFA 5CQGA 3OR1A 1CBKA 5T41A 2GIRA 2CQ2A 3Q86A 4F50A 1HBMA 2KJWA 2UVUA 1F9FA 1VQSA 3HM9A 1G3OA 4DF4A 3CE8A 1J5EJ 2Y9HA 4R8UA 3ZNJ1 4QOTA 4X66J 2KT2A 2XY5A 2GC8A 3DRRB 3PRBA 4JI5F 3HMJG 4K59A 5DZ6A 3UI3A 1KQFB 2EW9A 4HYKA 3MTKA 2B9XA 4I69A 2GV1A 4FYWB 3EWGA 2XQCA 4A4JA 4EMDA 3QATA 2CPHA 3MR7A 3SQOP 1RWOB 4ZLJA 1U24A 2QYGA 2BA9A 4O44B 3VWSA 2V2QA 3KLGA 2D7SA 3MFIA 2ZH1A 4DQPA 4K5RA 3TZZA 2BOAA 3H5SA 2HG4A 1QUVA 3CCES 1ZPVA 2MKJA 3GWCA 4MIBA 1H2VZ 3JQMA 1OPZA 1PAEX 2EVZA 4Q0BA 1KN6A 1UMJA 2M52A 3QNWB 2FY8A 2WOMB 1JLFA 3FEZA 4C3LA 5M2PA 3M8RA 8RUCA 4KPYA 3PO5A 2KO1A 5KFKA 2LQ8A 3ZZPA 1FT8A 2EI5A 1JNRB 1HW9A 3IGVA 2XO7A 3FBCA 1GMVA 1RP5A 2GIQA 2N4DA 3TA2A 4DV6F 2ZVIA 5HJYA 1SC1B 5DQGA 2RH3A 3I5AA 3UFCX 1D9FA 2VBXA 2CKWA 4LFBF 3WX8A 1VRUA 2PA8D 4ZLPA 5GADU 4ECRA 2R8GA 4KB7A 1RCXB 2UU9F 4USTA 2POKA 1HKAA 5HN0A 2CJ9A 1H98A 3PHTA 1RT6A 2JH3A 4C3KA 4W98A 4MKBA 4KKOA 4LF8F 3VGSA 2N3LA 2VQEJ 4I6AA 2GGPB 4NLUA 2CQ3A 2CPZA 4C97A 3GLJA 5D4LA 3SSRA 3KLVA 4AUKA 2DRBA 2R8KA 2V0NA 1N32J 2JL9A 1RT4A 3M32A 2V9KA 3DOMB 3FK4A 5F3TA 3VF0B 4BC9A 3EVOA 4HL9A 2QX0A 2AYMA 4ECYA 2DHGA 2DNRA 5JUMA 1NK7A 1YSJA 3NOCA 3VZIA 4DLGA 3IXQA 5D0RA 5KFCA 5AJ3F 4JI5J 1N33F 4IG0A 1KWMA 2DGSA 4HDGA 2KM8C 1NZ8A 1V3RA 1TQLA 2QTWA 4I2PB 3BH6B 2CJKA 4MT1A 4GC7A 1XNQF 4FKYA 4KR0B 1G1XA 5F8JA 2V2KA 4DFPA 3DRSA 4ZN1A 1RAOA 1VYAA 4OZNA 5GMEA 4AXIA 4MTPA 2YH1A 3JSBA 4FF4A 1QD1A 3QJLA 4UQTA 2MKYA 4LQ9A 2C2ZB 2I1RA 3HP6A 2HS4A 3QT7A 1YITS 2P9GA 2VQEF 1RABB 1L5UA 2BQRA 1JLEB 3J7AN 4MK8A 5LMUF 1SV5B 2F8EX 2GJ2A 2HNYA 3HX9A 5BR8J 3QZ8A 1IKWB 1KLMA 5IQ6A 3D0GE 1HPZA 4KYZA 4CI0B 3A1YG 4DV0J 2CRLA 2J9DA 4WTYA 4K4SA 2ROPA 2RSQA 3C16A 4RWWA 1N34J 4DQQA 1U2FA 1S76D 3L9ZA 4NL5A 3U1MA 4RNFA 4K4VA 2HBZB 1NRKA 3QFWA 2LU1A 2W1BA 1LK7A 2FJEB 2QYCA 2W7AA 4QIGA 2DR7A 3A3OB 3A8EA 1SC3B 1S1VA 4B3MJ 3CEDA 2RHSB 3V81B 3DDKA 4H4KC 1X60A 4RW4B 3MCNA 4I0WA 4RUCA 3TVYA 2NXNA 1T11A 3GV7B 2JC1A 2W4PA 4N77A 1JB0C 3IRWP 3BO2A 4X64F 3TX8A 4IH7A 1VRTB 3HULA 1VQKS 1EETB 1OO0B 2BANA 4NLDA 5KFZA 2FHOB 2CPFA 4M63A 5E7OB 2L41A 3TARA 3Q2SC 1T94A 4URSA 5DDRC 4Q44A 3RB0A 2KZMA 3OLAA 1KP6A 1LOUA 1ZA2B 1RT2A 3DI6A 2CQPA 3MUTP 3HVRA 1VQMS 2AV5A 2MQOA 1N36J 3PY8A 2CDQA 2PSZA 4RBUA 2DCUB 4ZP6A 2HHVA 3RGIA 1URRA 3PYEA 1IR0A 5KT2A 2MQMA 2HZVA 3D6MB 1CULB 2WRMA 3AH6A 2C2MB 1R6VA 3FSIA 5K5MA 3UDEA 1HL6A 4DV7F 1HNZJ 2EXUA 2HFOA 4NOHA 3QT5A 4KY3A 1ZAXA 1KOHA 1P8GA 1P9YA 1RHUB 2MJUA 4WK3A 3UD4P 4WKRA 1XIQA 1JQGA 3MHYA 1TL1B 1WEXA 3QWUA 4KE5A 4L3NA 3OXGA 2ZBIA 2KG1A 5IT9Y 1IKWA 1KLMB 2VDIA 5J1EA 2OMOA 3CD0A 3LP0B 4HACA 5ETRA 5M2RA 2IJFA 4OYIA 3I6PA 2VQFJ 4DV4F 4NA2A 4OYXA 3LTOA 2LECA 2XY6A 2Z57B 1L3KA 3BO3A 3QRRA 3ZTQA 2EKYA 2GJFA 3GYNA 1BLUA
chains in the Genus database with same CATH topology
1C1CA 1RI7A 3SCLE 4WFNQ 4ILMA 2AJ0A 1OSDA 3VAHA 3G86A 2ZH6A 4BWJA 1FEHA 2UUWA 1Q4RA 1LWEA 2LA4A 3BDEA 3MUVP 1NK8A 2QA1A 2DNMA 3LF0A 2AQ4A 1JJHA 1UEVA 3M8PB 3O3LA 1XC9A 4KGKA 3R1HA 4K4XA 4ITSA 3KYLA 1QE1B 3RB6A 1KONA 1RT5B 2J6TA 3NMAA 4C0HA 1V6HA 1RTJA 2XWYA 3FFIA 3SV3A 2RU3A 4PUOA 1GTHA 1TL3B 3CC4S 4XDDA 2YNIA 2FIUA 3IN5A 1G2EA 2QA2A 4Y34A 3HJFA 4KHMA 1SL0A 1DBDA 2PI4A 4OJGA 4DQRA 2LQ5A 4K4UA 2VPXB 3MEEB 4F2SA 1DTTA 2XBPA 3PM9A 2PC6A 2OFHX 4C4WA 2ZZNA 3CCZA 2Y1RI 2W9AA 3TANA 1QAYA 1HHSA 3B78A 1LW0A 5E41A 1U48A 3NCPA 4A48A 4PXEA 4A8SA 2UP1A 3R3TA 3NS6A 2D41A 2CPXA 4LSLB 2E7WA 2B5JB 1HHTP 4LVNP 5A8KB 1WNEA 3MR5A 2QA4S 3S1TA 4F3OA 1Y5LB 2YTCA 3JTOA 4CO4A 1UA1A 2DCLA 3PFOA 5BYRA 4R25A 4LQ3A 3PACA 4C8KA 1RT1A 2DR8A 1TKDA 3G8SA 1LW0B 4NRTA 2DBBA 2I2YA 4FP9A 3MOZA 4ZA1A 1VIOA 3MM9A 3HHLA 5BYSA 3O1LA 5JVGQ 2JWNA 2B9WA 3QYYA 5DGBA 2MSTA 4H54A 3OVSA 2J0SD 2GO9A 2E44A 5GAEI 3MFHA 1K0TA 4F3MA 1Y9OA 1UJ6A 1SKSA 4M5DA 5DG7A 2JEFA 1IKVB 2GFFA 1WWHA 3OXFA 3NLCA 3RU0A 3R5AA 5CYJA 2FHJA 4KV8B 4C8ZA 1D3WA 4ZP8A 2ZH8A 2BANB 2GW8A 2YWEA 1VQLS 1WHYA 1T03B 2ACYA 3GR1A 1HA1A 1RTDB 1N52B 1A7GE 3M9MB 2WW8A 3MMJA 4BWMA 4PWUA 2JLFA 4HTJA 5EX0A 3ENVA 3ENQA 1URNA 2MY7A 3N9UC 2FLLA 1XR7A 1SL1A 1SUQB 3RAQA 1XK8A 4B9UA 4DL3A 4FNIA 4MH8A 4OJHA 1S1UA 2IAJB 5LJ3Y 2JFKA 2RRBA 4WCEQ 2VFUA 2WONA 3NGKA 3GMGA 4OI2A 5AXNA 1HR0F 1CEZA 2VC1A 3DU6A 4K4ZA 4W90B 5DDOC 1K1QA 3LO3A 3N6NA 4YR2A 4FPRA 1KFDA 3OR1B 1OPIA 1RK8A 1P1TA 4WZQA 1N5YA 2DHSA 2RQ4A 2WTFA 1TR0A 3ETOA 4HI1A 4D3GA 1SBRA 3NAHA 2KH9A 3PW7A 3SFUA 4DX8H 4J9RA 1N54B 1FERA 1IUJA 5EWGA 2HVIA 1X9WA 4A8XA 3MM8A 1RT2B 1FXLA 5DS7A 3NCQA 2MZJA 1Q81T 1LWFB 4IR9A 1I1GA 4FN5A 2RS8A 3ZC4A 2HPUA 3W2VA 2QRRA 1IJFB 2B4VA 3ZZUA 4B9VA 4TU8A 4LFCF 1HD1A 4CNYA 3ZZ0A 3R27A 1ULRA 1UJ5A 2MJNA 3LALA 1FXDA 1M5SA 4FBTA 5IQQA 4WE1B 3HHEA 3N0VA 4ED0A 3THVA 1S72S 3PW2A 2QIFA 1X4FA 1FRIA 2BRKA 3FZ2A 2GJIA 4C8OA 4Z2XA 2ZHOA 5DGAA 2RD5C 1C2PA 4ATNA 3M30B 3M8QA 1VI7A 4X65F 1KFSA 1YJ9S 2MKSA 2DH9A 2I5JA 1REVA 3DYAA 3RRHA 2HGMA 3CMES 1LW2A 5KOWA 2N4CA 3I56S 4FS2A 2D74B 3IAS9 1DFDA 4ZPBA 3IC1A 1BQXA 3E8OA 1R6YA 5ITHA 1JLFB 2V5HG 2WOMA 1H2TZ 1HYSB 4H4OB 2ZKTA 1K73T 4BS2A 4ECUA 1IKXB 2OKQA 1S7HA 2V8VA 3RTVA 4IQXA 2PEHA 2NLWA 4I2PA 4RW9A 2VZ9A 2JFDA 4OJ1A 4CQ1A 1Q79A 1Q53A 1CSJA 4PKDB 4OI3A 3TYTA 3CCRS 2DPJA 1D0EA 3EYZA 3MOJB 4IRKA 2CQBA 4I4BA 3T5LA 2MHNA 3DRYA 3K8WA 2XLKA 1V9OA 3F56A 4O3SA 1S9GB 2JJ4D 2LA6A 2RQKA 4A8OA 2OO4A 6FD1A 2XC9A 3BO4A 3MAHA 2ADCA 1JKHB 4NLTA 3BGLA 1T3NA 2XSFA 2XI2A 3LP1A 3BN4A 3SI8A 4K2XA 2NSBA 3TAQA 3H4DA 1S9FA 3BR9A 1LXNA 1VS3A 4ALZA 1TK5A 1P27B 2R2RA 1WG1A 3OVBA 3MF5A 3UNGC 4R5PA 1KTVA 2HW3A 3MTJA 3TAMA 3OSNA 2ZOMA 4KAIA 3MR3A 2BVZA 4RNNA 5HO4A 3MM7A 3D5MA 5KTQA 1BQNA 5T7LA 2ZZMA 1FNOA 1EP4A 1SJ4P 3MMCB 4RU2A 5KG7A 2N82B 4PQAA 5B0AA 3SDEA 4D3HA 2AW0A 3KHRA 3KMQA 2ZFHA 1CQMA 4QPTA 1MWYA 2L9WA 2L9NA 4MKAA 5DJBA 1K9MT 1WG4A 4ES2A 4DR2F 1Q7YT 2OAUA 5A8WB 1XTZA 1FRJA 1S48A 2DHXA 1Z2ZA 4EZ6A 5E3CA 1JLGB 2BJDA 2W24A 2Q43A 1TZ0A 4K4WA 2ILYA 3W2WA 3HVWA 3BB5A 4DR5F 2HHSA 5CYQA 4KC5A 2LEPA 1YRTA 2JSXA 1YJUA 1YVFA 2W9BA 4DS5A 3I9V9 1UW4A 2R2UA 4DWIA 1KQSR 1ELOA 3DNCA 4Y2IA 1OS5A 4ZOSA 4JI4F 4OZLA 5KFOA 4DUZF 2R7TA 3H40A 3Q8SB 1U2RA 5A8RA 3Q23A 5LT5A 4FVMA 4USJC 4CO5A 1HBUB 3BEGB 1VBYA 3LAKA 2BW2A 1L3TA 1QAJA 2CFXA 1RDRA 2FD2A 2O3DA 1H0HB 4JI8F 2V4RA 3IFEA 3R5DA 4F4ZA 1HNVA 3GR0A 4C0OC 1WACA 1WEYA 4QR2A 5KFVA 1RQ0A 3VAMA 1MMNA 1Q16B 5CZVA 5DG9A 4N47A 1LK5A 1LWCA 2CPDA 1M90T 1DRZA 3D1QA 2B43A 4Q8FA 2HNZA 3TW0A 4NCGB 2Z4PA 4O23A 3KHGA 1S77D 5AXLA 2FJAB 2VFTA 2XCAA 4JV2A 2AYEA 4PR6A 4JI3F 1VRUB 1HNVB 4ZPTR 2OPRA 2A2CA 1RAJA 3U1LA 2ZH2A 4X4QA 3WC2A 3SSQA 2HFZA 5L38A 3CD7A 3KLIA 1G6BA 3D28A 4ZDNA 2W4DA 4ECWA 3O44A 2B3TB 5KFIA 2LYVA 3JTNA 3HHDA 4DR4F 2DGQA 3MM5B 4JI6F 1UL3A 4YR3A 4OHWA 1XN9A 3T1AA 2KZZA 4YOEA 4M8LA 2MZQA 2M8DB 3V6DA 1GXUA 3M2VA 2VG7B 4PG5A 4JI0F 2ASYA 2E66A 2U1AA 1CG2A 1D9AA 3I5BA 2FJBB 1UWBA 3M1VB 4RBVA 4O3PA 4G1PA 5IFMA 5KT6A 3DDNA 4JI2F 3NBPA 1JLBB 5KFFA 3LWLA 3G4SS 5KFAA 5F8JA 4ELUA 4B9NA 3OR2B 1KVJA 2PMHA 2J5AA 4UUXA 1X4BA 2HLUA 1DAXA 3OTEA 4HH0A 4TLRA 4OX6A 2LDIA 4HTIA 2FB0A 1VQNS 4RUAA 2WSEC 4IFVB 4XPEA 1S97A 4ZPDA 3BDPA 1FEEA 2C3YA 4XPCA 4L72B 2FJDB 1T05A 2Q66A 1SH0A 2JEIA 1UETA 3ISZA 4EU0A 3CMAS 2F7VA 2Q1LA 3GFZA 5F8GA 4YQWA 3VAFA 1TAUA 2YNHA 4XK8C 1C1BB 2LKZA 4RZRA 1NJXA 2YNHB 2KXHA 4C8YA 5F8IA 4IQMA 3BQ2A 1HNZF 4FF3A 4JYAF 2KXNB 1TUVA 2NR0A 4IDKB 4EGLA 3CWJA 4AE5A 1NH7A 4ZP9A 2KVIA 2CPEA 1WHVA 5CA5A 1PGZA 4UY85 5F8NA 2YQ3A 2PGCA 3JSRA 2R2SA 4F4XA 1VQ7S 4B3SF 5CYMB 1U8SA 4Q7AA 4ICLB 2LXUA 3I5CA 4OHZA 3TRGA 5IT4A 5IM0A 5B0BA 4IOCQ 2MSSA 3ZZZA 1LFPA 2K3IA 1M5VC 1QM9A 2IMWP 5I42B 3K5NA 1N6QA 3MMAB 2YKMA 4AL7A 3FVYA 5ADZA 2DNYA 4O4GB 3B8HA