1S79A

Solution structure of the central rrm of human la protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
GRWILKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lupus La protein
publication title Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, translation
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s79A00
1YWXA 2OSQA 3TP2A 1HD0A 4W92B 2EVZA 2ADCA 1U1KA 1VQMS 2GHPA 5DM6Q 3P49B 3CC4S 5JVHQ 2OIHA 2DGVA 1SJRA 2M88A 3S8SA 2X1GA 2CQ2A 2MKSA 3DLLQ 1JJ4A 3CPWR 2CPFA 3FEYB 1OPIA 2G4BA 3UWTA 3VAJA 2DNYA 4F25A 3CCJS 2LCWA 3P3DA 2WBRA 3UCUP 3VAFA 2F3JA 1RK8A 5LSOA 1X4FA 2DNHA 3BO2A 2DNOA 4Z2XA 3NNAA 1M5VC 1G2EA 1L3KA 3G71S 3TYTA 2VOPA 1FNXH 2CPXA 2XB2D 3RW7A 1SXLA 2CPZA 3CC2S 2DH9A 3OW2R 2DIUA 1U1LA 5DDOC 1WEXA 1VC5A 2LMIA 2KH9A 4CH1A 4OZ0A 2LXIA 3THTA 2CQ3A 2DNZA 1BY9A 2JWNA 3THPA 4FXVA 3VAKA 2QEXS 2MZSA 2MZ1A 1VQLS 5IQQA 2MYFA 5CYJA 2EK6A 2MJNA 3BEGB 5GADU 1FXLA 3MD3A 3MOJB 1M1KT 4F26A 1WHXA 2SXLA 4IUFA 2N3OA 5GAEU 3B4MA 2J8AA 4EGLA 1KQSR 3J7ZT 4J5OA 4UQTA 1N8RT 3G8SA 2DNNA 3UD4P 4UY8T 3R1LA 5BJRA 2FC8A 5D78A 2HYIB 2YTCA 1VBZA 1VQOS 2M9KA 1VC6A 3MDFA 2HVZA 3DXBA 3FEXB 1X4DA 1WG5A 1WI6A 2MQLA 3G4SS 3K0JA 2RQCA 4YOEA 5DDQC 2RUGA 3CD6S 2KHCA 3BO3A 2RVJA 2X1BA 1H6KX 2LEAA 5LXRA 2V94A 3S7RA 2N7CA 1YIJS 1DZ5A 2XS5A 1HD1A 2DGQA 5HO4A 1M5PC 3MI7X 5GVQA 2RNEA 3HI9A 2HGNA 4M5DB 5GAGU 2KG0A 2DGTA 2M4MA 1NO8A 2A3JA 1UP1A 1WHWA 2KM8B 3G9CA 2B0GA 3BS9A 2MZJA 3MUTP 3CMAS 5JVGQ 2EK1A 2CQ1A 2D9PA 4WKRA 1U1QA 2M0GB 2L9WA 4C4WA 5FJ4A 1FJCA 1X4GA 1H2VZ 3U1LA 1H2UX 2MQOA 1VQPS 1ZZNA 3CXCR 2LYVA 1JMTA 1RKJA 3G8TA 2BOPA 2RT3A 5CA5A 2E5JA 1FHTA 4V19X 3H2VE 2MZTA 3MD1A 1VQ9S 2DHAA 4ZKAA 3J7YU 1KC8T 2MB0B 3NNHA 2MKKA 4PKDB 1S72S 4QU7A 1P27B 2XS7A 2F9JA 1WG4A 2MQNA 3R27A 1VQ7S 1WWHA 5LJ3Y 2MKJA 2DO4A 3Q2TC 3JB9k 2BZ2A 5DDPC 3IRWP 1F9FA 3BO4A 1VQ5S 4U67Q 5CXTA 2FY1A 2AYMA 4BS2A 3CCMS 3VAHA 4TU9A 3EGNA 1YI2S 1A9NB 1D8ZA 2G0CA 3UE2A 1YJWS 2DHSA 4LIRA 4IO9Q 2MJUA 3MXHP 1VQ4S 1KOHA 1S79A 1U6BA 5GMKa 3SXLA 1QVFR 2CQPA 1WHYA 3CCES 3SDEB 3L3CA 4QPTA 2HGLA 1X4CA 4LMZA 1U1MA 1VBYA 1M90T 2MY7A 2AYEA 2HGMA 1QVGR 1ZH5A 3SMZA 2M70A 3TO8A 2DIVA 2XNQA 2CQDA 3SDEA 3CTRA 1OO0B 2JVRA 3Q2SC 3PIOQ 3RW6A 1IQTA 1O0PA 2NZ4A 1FJ7A 1N88A 5MLCV 1K8AT 1PO6A 1N52B 1B7FA 2DGOA 4YUDA 2J0SD 1WELA 2DH7A 2KFYA 2ZJPQ 3VALA 1WTBA 2MZRA 2AD9A 1WI8A 2RQ4A 2L08A 2OTJS 1K73T 4WFNQ 4Y0FA 3HHNB 3N9UC 3NMRA 2CQHA 3ULHA 3CC7S 3CULA 2CPEA 2AYGA 1X4EA 1WF2A 2KRBA 2DNMA 2DGUA 2CPDA 4PRFA 2JRSA 2NLWA 2YH1A 3P6YC 3CMES 2OSRA 2KYXA 1JJHA 2LA6A 4PR6A 1P1TA 3G96A 1X5OA 3CUNA 2CJKA 2U2FA 1ZZFA 2MQPA 2LA4A 2QFJA 1VBXA 3CF5Q 2OTLS 1DRZA 1WHVA 2ZJQQ 2KXFA 4WFBQ 2CPHA 3NS5A 4OZ1A 3H2UB 4P6QA 4TU8A 1Q7YT 2CPYA 2DB1A 2CQCA 2VODA 2DHGA 1OIAA 2KVIA 4CQ1A 2DNLA 2LECA 5DM7Q 1YITS 2XS2A 2D9OA 2JVOA 2DGSA 3IWNC 2MGZB 2KXHA 1U1RA 1K9MT 3CCRS 1SJQA 2DGWA 3I55S 1U2FA 2RRBA 2RRAA 3B4DA 1KOOA 2MSTA 2DISA 4CH0S 2J76E 1UW4A 2CQ0A 2MGZA 3NS6A 2RS2A 1YHQS 2FC9A 3VF0B 5D77A 1H2TZ 2MKHA 2U1AA 5DDRC 3S01A 2DNQA 1VQNS 2M52A 2X1FA 4W90B 1FT8A 3U1MA 5LJ5Y 1M5KC 1KD1T 2CPIA 1FO1A 2M8HA 2FPHX 3PIPQ 1X5PA 1XN9A 3G6ES 3R1HA 2I2YA 3D2WA 3ZZYA 1U1NA 1WG1A 1VC0A 1R8HA 2KN4A 2YKAA 3ZZZA 4F02A 2N82B 2ADBA 1X4AA 1Q82T 5EN1A 1R8PA 2M2BA 2MY8A 2GO9A 2ERRA 1Q81T 2QA4S 2CQBA 3MUVP 3UD3P 2DITA 2ZJRQ 1VQ6S 3UCGA 1NJIT 2MPUA 1UAWA 1JJ2R 2DO0A 1Q86T 2DNPA 4WF9Q 1X4BA 2K3KA 2DNRA 2MZQA 2CQ4A 1CVJA 2E5IA 3LPYA 3US5A 4TU7A 1U6FA 2E5HA 3NNCA 2DK2A 2M7SA 2D3OR 2KT5A 2MSSA 2XNRA 1W2BR 1UFWA 3VAIA 3LQVA 2JX2A 3I56S 3UCZP 2HZCA 2PE8A 2YWKA 1VQKS 4ERDA 1URNA 4ED5A 2LQ5A 2MKIA 1NU4A 1DBDA 1WF1A 2LEBA 2MKCA 4TLQA 4IOAQ 1X5TA 4QQBA 2AYBA 1WEZA 3VAMA 1WF0A 5DETA 3MUMP 2KRRA 1X4HA 2MMYA 1U1PA 1PGZA 1QM9A 3CCUS 1YJ9S 4QU6A 5IFMA 5LXYA 3EGZA 2MQMA 5ITHA 2O3DA 2CQIA 2VONA 4CIOA 2F9DA 2N3LA 1D9AA 2DNGA 1WEYA 1SJFA 1VQ8S 2PEHA 3CCLS 3CCVS 5IM0B 2MQQA 2YH0A 4WCEQ 2UP1A 4RU2A 2LKZA 3P5TL 2CPJA 5H1SV 2KXNB 2CQGA 3S6EA 4A8XA 2X1AA 2RS8A 2I38A 3CCQS 3VAGA 2LXUA 5IM0A 1A7GE 4WFAQ 5LSLA 2KG1A 4Y00A 1X5SA 2VOOA 2DHXA 5HL7Q 1YJNS 1DHMA 2E44A 3V4MA 2OJ3A 2Q79A 1OWXA 2DNKA 1M5OC 1X0FA 2KM8C 2KI2A 4C0OC 3EX7B 1N54B 5GAHU 2G1DA 3CCSS 2E5GA 4FXWA 1YTYA 2RU3A 4IOCQ 2K8GA 4WIIA 2KU7A 2MHNA 2FHOB 4LJMA 4YB1P 1SJ4P 4C7QA 2J0QD 2DGXA 2L41A 1HA1A 2XSFA 1AUDA 3MURP 1FJEB 1HL6A 2DH8A 2M8DB 2MXYA 1U1OA 1SJ3P
chains in the Genus database with same CATH superfamily
3NGUA 4RX6A 4W92B 1RBLA 3CJ8A 3FBEA 4OLPA 3PJWA 3DOKA 4YR0A 1OPZA 2PI4A 1FFGB 2P9CA 4MH8A 1FDDA 3PFOA 2XLIA 2C2EA 3R3TA 5HANA 1N5VA 2ZITA 3S8SA 1X9MA 5HVGA 1Y0HA 3U27A 2LCWA 1AT1B 4B08A 3FSYA 1F5AA 4X66F 3M9NB 1HNXF 4MIAA 5IV4A 4QR1A 4JI6J 2VOPA 2IJNA 1KS2A 5B08A 2XQCA 3FC9A 2ZH9A 5EWGA 2LXIA 3CJTA 2BJ7A 4JI2F 1CQMA 2K1RA 4H4KA 3KUEA 3CO9A 2FVCA 1TV6A 1VK8A 3H7HB 5D0RA 4HACB 3F73A 3B4MA 4EGLA 4LF6F 1S48A 2MTLA 3R1LA 1S6PB 2W2MP 2RHQB 3KLEA 2M9KA 2XTJP 1SV5A 2Q3PA 4KGXB 5T7LB 2HMIB 3EXCX 2BJ1A 4B3TF 3MM9A 2V94A 1DZ5A 2YBVA 4WFYA 2RNEA 2W4DA 3HI9A 1ITPA 2M4MA 2LDYA 1WHWA 3DRRA 3QT7A 5GADI 3EZ5A 1Q1KA 3FBCA 3KJVA 1FJCA 3B82A 4P7TA 2R7TA 1IKVA 4J9KA 4RW7B 1VQPS 2RMLA 2JHEA 2JOQA 1UJ6A 4PYDA 4KGZB 1MMDA 1LW2A 2E5JA 1EHWA 1CC8A 1KC8T 2IRXA 1SL0A 1XMQF 2FQQB 2VUGA 1G1XA 1RYRA 4A8QA 1HHTP 3BO4A 2G2YA 4NRTA 2B9WA 2AMCB 3OSPA 2WONA 2DJWA 3T1HF 4OHZA 3DRYA 4YHHF 3MXHP 3Q89A 1SC1B 1KOHA 1TL1B 2B56A 1XR7A 5D8HB 2YX7A 3QGPA 3ISNC 4OL8A 4KY3A 3OJUA 1ZTTA 4OYOA 3GJSB 1QVGR 4WU2A 2CWXA 4ZVEA 2XHWA 1KTVA 1MROA 2Y0SD 3AXMA 2LP4A 1F1BB 5MLCV 2YKMB 2V0NA 2HHVA 1TR0A 3ADAC 3VALA 4DR5F 3ILLA 4OX9J 2IMOA 3PX6A 8AT1B 3PG9A 9RUBA 3SCLE 3Q23A 2JRSA 1S1WB 2W9BB 2GVZB 1IBKJ 1P1TA 5AXMA 3QLHA 2RAQA 1SKRA 1U09A 1VDHA 3MTKA 3CF5Q 3L4BC 4JBCA 1NAQA 4PXBA 4I56A 1FD8A 1U2CA 2QMWA 4K4WA 2VODA 5D4NA 3I96A 1KHWA 1TQLA 4C0HA 2KJVA 4BC9A 1U1RA 1N33F 1R27B 1U24A 3VR1A 1B4SA 1BQXA 2C2OB 3B4DA 1RT4A 2HVHA 2J76E 3FSIA 2GVDA 3H4BA 5ETLA 3HHLA 2EFNA 4P75A 4QJVA 1Y4ZB 5LJ5Y 1IKXB 5KG5A 1JXLA 2HBYB 1NKCA 2QN6B 1HQEA 3ZZYA 1QSSA 4IFVB 1T11A 4NX9A 2D41A 1UA1A 4OFZA 1O6XA 2P5VA 1HMVB 1FFSB 1N32J 1CVJA 3BPSP 2W24A 2AIRB 5A8RB 4DF8A 2XNRA 4TKTA 5KFFA 3ZFVA 3N5BA 3I56S 2NZCA 4EYHB 5HSPA 4PYAA 2V8HA 2KVQE 2PT0A 4NWBA 2IYIA 2JFKA 2AYBA 2QV6A 5AE2A 2ZKUA 2RH3A 1X4HA 1BQMA 2O3DA 4F0KA 1T94A 4L6V3 3QO9B 4CIOA 2QC3A 1TKDA 3OHBA 2CJAA 3FGVA 4L76A 4WCEQ 1CLFA 3S6EA 2PN6A 2BQ3A 3LGNA 3IC1A 3RG6A 1S1VA 2KG1A 1SL1A 1XQIA 4Y2IA 3CMQA 4DS4A 3DRPA 1NK0A 1BQNA 1YTYA 3D0HE 2FZCB 1B0PA 3OFEA 4KH1B 2L41A 2WSEC 3ZTRA 2KZMA 4ECVA 3E51A 3OLAA 4ED4A 3CW2C 4NLDA 4ZVFA 4ILLA 2W4CA 4DSFA 5EX3A 5E0OA 2V8PA 4X65J 3KK2A 3MCOA 2GMJA 1NJXA 4A46A 1YX2A 2WBRA 2F4VJ 2KHDA 4ETZA 1FESA 1NXIA 3M8YA 3OHAA 2O67A 4UZBA 2EC2A 2RRNA 2LMIA 3R9LA 3UN3A 2C1EB 3QPIA 2XZWA 4IR9A 2GIRA 1S59A 2VHGA 1YSJA 3ZZUA 2R8KA 3THPA 5AXNA 3B78A 2FHMA 2QSWA 4M5HA 1F3VA 4C3KA 3DYAB 4RBVA 2BQUA 3AQPA 3PKMA 1UEUA 5C25B 3MDFA 3AB4B 3KNGA 3PO5A 1FERA 3J7AN 4K4VA 5AJ3F 4KHPJ 1H6KX 1YIJS 1ZM4A 1Y3JA 1V5IB 3FFIB 1BGXT 4M5DB 2UUBF 1RTIA 2HRTA 4DPUA 3W8GA 3CCZA 3MMJA 1XNQJ 4ZCLA 3AOAA 3CB4A 4DUZJ 2M0GB 5GAEI 1X4GA 1ACMB 1KN6A 2XLKA 5F0UA 3DLGB 5JXSA 1NK4A 1RAGB 1YJVA 2ATCB 4LR9A 5A6PA 4BBYA 4KFBA 5L1JA 4C98A 4J9VA 3D66A 2ASDA 1IBCB 3GJQB 4F4KA 5THWA 4CNYA 2PGCA 1JKHB 3JB9k 2ZWOA 4X62F 5D6GA 5CXTA 2OKQA 2EG2A 3VAHA 1L3SA 2LEPA 1RAFB 4EBEA 2VV5A 4B9NA 2DEJA 2BX6A 3M6XA 4QPTA 2HGLA 2WSCC 4H4MA 4CLUA 1ZH5A 3SMZA 2GX8A 3FK4A 3Q8RB 2XGQA 3FQLA 3R97A 4DR6F 4O3QA 1PYOB 2ZHBA 2AJ1A 2PFFB 3QT8A 5DG9A 3MMBB 1BHNA 4KE5A 5DQIA 3LW5C 4AT1B 5AE3A 2OFGX 2L3MA 2HURA 3O3LA 1VI7A 1JJHA 2WZ1A 2KXFA 2CPHA 3MAAA 2A2DA 6AT1B 1EP4B 2DB1A 1I94J 4B02A 3D1HA 4DV1J 4IG0B 5FIIA 3HJVA 4KGMA 4AD6A 3K5PA 2DGSA 4DL6A 2C28A 3IWNC 2VPZB 1CJKA 3MM6B 3PCOB 3TX0A 5D77A 2R7OA 1D9DA 4ZP6A 4IRCA 1U0HB 3DGPB 1KD1T 3DU6A 3IS9B 2WOMB 3SI8A 3NL0A 3MM7A 3D1OA 4QWDA 1X8DA 4FPRA 2DCLA 5EN1A 3D54A 3QIPB 4JV5J 4FVMA 4NOHA 3GYGA 5KAKA 2C2ZB 4OYZA 1Q86T 4LFCF 4DCPB 4ED2A 3OFFA 1B99A 1C0TA 3AD8C 2CADA 2WVBA 4NLUA 4ZCKA 3UCZP 4H4KC 2VG6A 3ETMA 2VBWA 2J7UA 3IXQA 4QWEA 3M8QA 2B4OA 4QQBA 4NPOA 7FD1A 3X1LB 5IFMA 1TU0B 5KG0A 5J2PA 1R43A 4N8NA 3JYTA 2VJUA 4Z7CA 1FRIA 5T14A 3CJRA 2ZKTA 3LP0A 1ZAWA 4KO0A 1UJ4A 2OJ3A 4EEYA 1IKYA 4AQYF 4NE9C 1QD1A 3V6HA 1VIOA 4HYKA 2OELA 3MMCB 1YDLA 4UW2A 2D74B 4HTIA 3IM8A 5A2QU 2J5AA 1KSPA 1NZAA 3D6TB 4DG1A 4NLOA 3ENQA 3PZPA 1MWYA 3KTQA 2DR6A 2B6AA 3GZ7A 2OP5A 1RT5A 4LF1A 3OT9A 3HMJG 3I5AA 4ECZA 1RTDB 5K9FA 2VQEF 1R6VA 2HWIA 4N7TA 1S1TB 3NMAA 2WW4A 2V69A 4FF4A 4PEOA 3MEEB 2DNHA 1PC5A 2IHR1 4EZ6A 4KBIA 3BQ2A 1HNWJ 3PXGa 1VC5A 4JYAJ 3NBPB 3BBCA 2BUNA 3H2LA 3W62A 1W25A 2ZH6A 5GADU 2W9CA 3IR7B 1UFKA 3PW5A 4ANDA 4JI4F 4UQTA 2E9RX 4ZMMA 3TAPA 4WYLA 4USMA 2DYAA 2JSXA 1WG5A 2HLUA 4UQGA 5CCLA 4YOEA 2KHCA 4L75A 1IBMJ 2CJXB 4USTA 2Z30B 3QYYA 3DMJB 5CQGA 1HD1A 2N7YA 3K89A 3RB4A 2DGTA 4WYWA 3BS9A 3QJLA 3HHLC 4HT7A 3SCIE 5DRKA 2CIMA 4DMZA 3U1LA 1RP5A 3BGRA 4I7FA 4DOZA 2C2KB 1NJYA 2E7XA 4O4RA 3N01A 2MZTA 1RTHB 4KYZA 1U45A 4IQXA 3M30B 5KFWA 4ZN3A 2WVEA 3NXZA 2MQNA 2AHOB 2OUGA 1S1UA 2BZ2A 3IRWP 1LWCA 2OEKA 2JEIA 1CULB 4TU9A 2G0CA 2IIHA 4LIRA 1XR5A 4MT1A 4ELVA 2BJEA 1RUSA 1OYDA 2CDQA 4RU9A 2HVIA 3DRSB 2AJQA 4RW9B 1GMUA 2CQDA 1W26A 4WU3A 4DPTA 1S9EA 4L3KA 4GC7A 2XC9A 1PJ7A 1T03A 1B0VA 4FS2A 4AL5A 4FPIA 4MMOA 4I2QB 2QLWA 1K73T 4CLSA 4NLPA 2DGUA 1R0BG 2FJXA 2GQCA 3R2CJ 2LQ9A 4DR7J 3DC2A 3W63A 4WJBA 4I6AA 4BC7A 2ZE2B 1IR1A 1DRZA 1H0HB 4NXMJ 4A8KA 5EGYA 3H2UB 3D5MA 4U6PA 2FJAB 4ANEA 4PWDA 2BABA 1U7LA 1AFIA 1KHVA 3R5JB 2DISA 4MFBB 4FNIA 2BKNA 3M1VB 2J9EA 3UPFA 4WK1A 4WIQA 1SIWB 2YQ0A 2M52A 5I42B 1MG7A 1M5KC 3TA2A 4MIBA 2C2DA 1VFJA 1KQKA 1RT7B 2QLFB 2I2YA 4UUWA 2HNYB 2FHJA 3DGVA 4ES1A 4ZCIA 4M5IA 1Q82T 1R8PA 3MR2A 1KVKA 1Q8KA 3W64A 3UCGA 1REVB 2OEMA 3KNAA 2BOAA 5EX0A 3KHHA 4WFXA 1U2RA 1RISA 5B0EA 3OTEA 4MKVA 2UVWA 1R7IA 3PYEA 3HF5A 1FXDA 1QAYA 2G13A 3VAIA 1FRMA 1UWBB 4CM0A 4KKOB 1RKIA 2VASA 3K5NA 5LMNJ 5L8RC 1E6VB 3M8PA 1X5TA 1RCXB 4ZPDA 1Y00A 1WF0A 2BE2B 4ZVSB 2Q6CA 1QM9A 1YJ9S 2CZ9A 2EKYA 5ETOA 2B5JB 4JI3F 3ZNUA 3OL9A 3ZZRA 3M32B 1I1GA 1CJTA 4RJVA 4QIFA 3VV2B 1NNDA 3CT9A 4J9QA 1U6ZA 3T3FA 3M6WA 2H5EA 1UVLA 3TAQA 2HS0A 1X0FA 1KONA 2F8EX 2UXDF 2HS3A 2NUHA 3EX7B 1N54B 4J91A 1YRUA 4JI0F 4ZJQA 3PRVA 4R8UA 3RRHA 1RT3A 4CZCA 2VC1A 2ZZMA 4RW8B 3EICA 5HVFA 1TP7A 4TLRA 2VG5B 1H73A 4ED0A 1LKZA 4K8RA 3O8WA 3P49B 1WKLA 3CVKA 1GXUA 3PO4A 4URSA 2V4JB 2XY5A 4Q2MA 2RDDA 2B9YA 2QIFA 1F9HA 4PQUA 1AZSA 4EZ9A 5LSOA 3BO2A 3IRXB 2GAHC 2VICA 4PPDA 4M63A 1NM2A 2XB2D 3UO0A 4NL5A 5DDOC 2RSQA 4HR2A 3THTA 2RIJA 1EARA 4DN9A 1IBLF 4Y2CA 1NPPA 2FZGB 1HBMB 4N47A 4WE1B 2EFVA 2G2ZA 3QT6A 5GAEU 2XSJB 5L9NA 3NCPA 3OTOJ 4DV2J 2CVEA 4RR5A 5D78A 4O23A 5FLXY 2RF2B 2YY3A 3G4SS 2HHUA 5IC4B 3MHYA 1RTJB 3I5BA 2FY8A 2VB6A 3HVTB 4K5SA 5JUMA 5J1NA 2WVCA 5IS2A 4FBUA 5IC6B 3C46A 1U0SA 1Q16B 2I5JA 4JUZA 4NLXA 2Q43A 3J81Y 1GAOA 2BJ8A 4KAIA 3JAMY 1PBUA 4XK8C 2COLA 2FYXA 3UI3A 3W2VA 3L7UA 3WIUA 4NA2A 3LP1B 3FZ2A 4USKA 2NUUG 5E7OB 1YI2S 1T9YA 3FJ2A 3C15A 3DHWC 4DLGA 1QVFR 1IN0A 1SC3B 4E2FB 1SQFA 1EJ7L 3IBWA 1X4CA 2MY7A 1H7WA 3VTIA 3I0RA 3E3XA 1G3OA 3IWLA 4DFKA 1WTFA 1P1LA 1ZETA 2BJDA 3Q2SC 1DQ8A 2GS8A 2DEIA 2RKIA 3TQEA 4MYUA 1T02A 2PC6A 2ROGA 4F3QA 4Y3CA 4EUVA 4FVCA 3QT5A 2VBXA 4DFPA 3MPYA 3SV4A 1ZM2A 2QL5B 5KFEA 2FVRA 3K59A 4O4GA 4JV0A 4B3OB 2HNDB 3NRBA 3UVJB 4F4ZA 2OTLS 5IT9Y 1WHVA 3PW0A 1FVQA 4DXLA 1Y5LB 3C66A 3H40A 4P6QA 4CYUB 1Y5IB 5F8HA 5E2QA 2QTWA 5F8JA 3RRKA 4DS5A 5A0YA 2YPYA 2QX0A 1NRKA 4C11A 3D68A 2EKNA 3KJNB 4DDFA 3T9ZA 4HDHA 3M2UA 4C8OA 3S01A 4P10A 4K59A 4LSLA 3SZ2A 1B0TA 3GFHA 1FDNA 1NDCA 1YJ7A 5E41A 4B3SF 2B4UA 5K14B 1P9YA 3OBIA 2KN4A 4X4RA 1UZDA 4XTTA 2M2BA 5SUHA 4NRUA 2OPPA 1RYSA 4NI2B 4M5GA 2I9SA 3QIDA 4TXSA 3H5XA 1Q4RA 1JJ2R 1X4BA 2ZBRA 4CLTA 4X4NA 3OQ2A 2R8GA 1U6FA 4OZ5A 4IQMA 5F9LA 1RWNB 3KK3B 3UDCA 4ZCMA 3R5DA 4UZCA 3L09A 2HHHJ 3OV7A 1U48A 3KOAA 3CJKA 3D3BJ 3W5YA 1QE1A 4JI7J 3BREA 3FQKA 2F65A 1Q95G 5ETPA 3N79A 1N0UA 1PGZA 2UZAA 5ITHA 5G0RB 2VONA 1T7PA 1FK9A 2H4YB 3CJSA 1FWPA 1EQ0A 2L9DA 4OYMA 4LF7J 4F4WA 5IM0A 4WFAQ 3NKYA 2DHXA 3DDKA 1NLKL 2J7KA 2VA3A 1BD6A 2GQ2A 4XAKA 3ENWA 2CAJA 4KC5A 1SUQB 4YDXA 2R9LA 2Z56B 2HPUA 4WIIA 3MEDB 2FHOB 1X31C 2XMJA 4WFZA 2UUWA 2QRRA 1HL6A 1HKAA 4CLLA 4DX7A 3J81j 1HHQA 2BW2A 5JVHQ 4DZDA 5KFUA 4LF8J 2D69A 1T0TV 3TA0A 2MKSA 4NLWA 3CPWR 1UA0A 1Y7PA 2G4BA 4L72B 3HHKA 2X51A 1SB6A 3JQJA 1D8YA 3X3UA 4B3RF 3DU5A 3PHTA 2FJBB 1S99A 3PYGA 2K2PA 3BDEA 4NASA 1TK8A 1U1LA 3UNYA 4X66J 1JLEB 1HNXJ 4PUOA 4MAKA 4W98A 1D0EA 3I87A 2KT3A 1WC6A 2EK6A 1TVRA 2FLNA 2PMZD 4JI2J 2YKNB 1Q53A 4F26A 4CDIA 1N8RT 3RU0A 4OI3A 5BJRA 3MM5B 3OUYA 3VQSA 4CH7A 1H72C 1RI7A 3NOGA 5CHCB 1LXNA 4LF6J 1C1BA 2ZH1A 3R5CA 1S6OA 4O3RA 3V6DB 1RHMB 3A3OB 4MK7A 2R7RA 4YN3B 1RWVB 2NPFA 4HI1A 3H25A 5L1LA 2HGNA 4B3TJ 2NPIA 3U7JA 4UF4A 5KT3A 1XTZA 1RAHB 2GIQA 2PD1A 1H2VZ 4PWUA 4DEZA 1S97A 3EMTA 5DQHA 2DPJA 1ZPVA 3V4IA 4H4OA 1P27B 1MMLA 4DV6J 3EGVA 1BWVA 3BF4A 2ZBQA 4U67Q 3UN2A 3I6PA 1EETB 1S9GB 2DHSA 2YWWA 1VQ4S 2H1YA 4HLBA 5KFZA 2EBEA 3T1HJ 4NLTA 3BQ1A 4YHHJ 4ES2A 1NJZA 2HW3A 1O0PA 2ALYB 1KFDA 4ECTA 1JLBB 1K44A 2YNGA 5KFDA 4WWSA 1WF2A 2KRBA 3A3PB 2CPDA 1TELA 5J2MB 5D4OA 4DQRA 4DR5J 4JI1J 2BBEA 1MLAA 4PR6A 2ALZA 1ZTWA 4ECQA 1VBXA 1FD2A 3RR7A 5KFYA 3AT1B 1UEVA 2UU9F 4NCGA 4Q0BA 4KIAA 4TU8A 1FF2A 2RD5C 3ET6B 1YITS 5IWAF 2DGWA 1HWIA 4CH0S 3NS6A 2RS2A 2FB0A 4LF4F 2FC9A 1N33J 1HNVB 1VRTB 2MKHA 1UVJA 1RSCA 1RB0A 2DNQA 3D6MB 1DTTA 4DQQA 2ZZTA 4YR2A 1FT8A 4RWWA 2CPIA 2GFFA 2YWHA 4KQZA 2PDAA 1FE0A 4X4UA 2YKAA 2XMAA 3K8WA 2BM1A 1J5OB 2BANB 5LM7E 1NK6A 4AFFA 3CDEA 4DR4F 2JZ5A 1RT6B 4P2FA 3EVWA 2DO0A 4LF9J 2QYGA 1P9QC 2GCFA 2LDIA 3D3CJ 2DRAA 1HQUA 1KQFB 3JSMB 1S4EA 1B3TA 1DY3A 1F0XA 1P8GA 5AT1B 3MECA 2GJ2A 3HKZD 4C8KA 3GIJA 4DX5A 1NJWA 1KR4A 2NYHA 2PSZA 3HSJA 5KFPA 1XWLA 2CDRB 3KLFB 1U1PA 2CJ9A 2IVFB 2QL7B 1F60B 3EGZA 2XBPA 2JEFA 4YB7A 3O44A 2IY5B 3PHEA 4HL9A 1T9WA 1D9AA 4ID8A 5ETNA 4RUCA 4G1QA 1HBNB 1TKTA 3PKYA 2CPJA 2B4VA 1NMEB 4M1KA 1FRJA 1DURA 3RGIA 2LXUA 3M8RA 4DL4A 3SCJE 2YNIB 2HBZB 3ISND 1CJVA 3BYRA 3QGIA 4U96A 3Q8SB 3JTNA 4ZP7A 2YPZA 1ZPWX 2W2QP 2XSFA 4X64J 3DOKB 5KFVA 5DGAA 4WXWA 2R7WA 1IKWA 1TAQA 3FZBA 4CLKA 3BN4A 3HCXA 3R2DJ 3ZZOA 2E1CA 3EPIA 3VAJA 1HW8A 1FKOA 1LWEA 2V4RA 1T9VA 3RAXA 4Z2XA 5E5NA 4DX6A 1AXQA 2IRUA 1KEKA 4F4YA 3TYTA 1XNRF 1WC1A 1I51B 1SXLA 1KWMA 5CH7B 1O8BA 2K1RB 5C2CA 3KG1A 2UXCF 4ZVRB 3MEGA 2GV1A 1TV6B 3OD2A 1C2PA 3AB2B 2HHWA 5AXKA 1TUGB 3Q8VA 5KG7A 1UVIA 5IQQA 3M9OB 1WC5A 3GYXB 1J27A 1YKWA 3QWPA 3KLEB 2AZ3A 1M1KT 2MQ8A 2K7JA 4USVA 3KLHA 1F5CA 4J5OA 2GJFA 1SV5B 1NSAA 1GX6A 4OV6A 4CLYA 1X4DA 2UVUA 3MM9B 1O5JA 4JI8F 2AX1A 2BRKA 2ZD1A 3LO3A 3DRRB 2OFHX 1F9EB 3KJVB 1IKVB 2FZKB 5KT7A 1XMOF 3TX8A 2D9PA 3CDUA 1LW2B 4OZ2A 1F3FA 5J2NA 3TW0A 2UUBJ 4OHWA 2YNHA 1TL3A 4I1TA 3EDQB 2E5LF 3P45B 2VKZG 4F2SA 3NNHA 1N6QA 5CABA 3PJ9A 2HHSA 2WONB 3Q2TC 3PVXA 4K0KF 4DFMA 5B0BA 4HHJA 4RUAA 2V6AA 4X62J 3PEHA 3T5KA 1MROB 1FRKA 2QA2A 2XEXA 1UVMA 2AYEA 1X60A 3HT3A 5EWFA 2D3UA 4DL7A 2JVRA 2IC3A 3UR0A 3RW6A 2MKYA 5D0GA 2DKOB 3BQ0A 4B9MA 3QAUA 1WELA 4EYIB 1QUVA 2UV8G 2AD9A 2XCAA 2NSCA 5M2UA 3N9UC 4DR6J 3CO0P 3QLHB 3ULHA 3GG1A 3CULA 2AKWB 2OSRA 4CLZA 4ECSA 2CUYA 3ICLA 4CT8A 3DRXA 3DYAA 2LA6A 3D1QA 4RL1A 4ELTA 2DXDA 2LVWA 1WSRA 3GPAA 1Y5NB 1RT4B 4IR1A 4DV5F 3BR9A 1K9MT 2GVDB 3I55S 3HHLB 2MSTA 2RDJA 3P8BB 4A8SA 1YBUA 1VQNS 1HQEB 2FLOA 3TAMA 1X5PA 1Q5YA 3L9ZA 2QLBB 1IUJA 2ADBA 3FVYA 1QAIA 3POTA 2Z8QA 5ETSA 2JL9A 2ERRA 1N56A 2B8PA 3FCWA 1URRA 1HYSA 3OR1A 4HH1A 1UAWA 1R0AA 2CQ4A 4YY3J 3HVAA 5ETMA 3QMQA 1M0SA 2E5HA 4EO8A 3NNCA 5CYQA 3N6LA 3OL7A 4LFCJ 1R3NA 4NMXA 1NH7A 1VQKS 4IKAA 2MKIA 1NU4A 1DBDA 2C3YA 3OSNA 1BQMB 4IOAQ 1R8BA 2GIFA 1CS4A 3KFWX 1X9WA 5CZXA 4NLYA 1A0OB 2R4FA 2CXEA 3OXFA 2CNKB 4LFAF 1S1VB 3K5LA 2WAQD 4HDGA 2QL9B 4USWA 3I9V9 2RS8A 5KT6A 5BR8F 3BYPA 3VAGA 4IDKA 4ANCA 3BGOP 3DRPB 1BQNB 1X5SA 2BA9A 3THVA 2ZOMA 4ATNA 3DOLA 2G1DA 2GO8A 4RW6A 2B51A 2DGXA 3HPOA 4AQYJ 1AUDA 1KDNA 3A8IA 2H5JB 1YG0A 1SJ3P 2OSQA 4X2BA 4EFAC 3KK2B 1VQMS 1IVZA 3LALA 2E1AA 1N32F 1ICEB 2Z2ZA 1R8CA 2FLLA 2QLJB 2X1GA 2NQPA 3T5LA 3WX4A 1R8AA 3GJRB 1EZZB 1HPZA 1NK8A 3UCUP 4B9TA 4FBTA 1DJ0A 3UN5A 2VQEJ 2HHTA 1RHUB 4PG6A 3WZ0A 1TL7A 2CPZA 2IJFA 4HEA9 2A6OA 1T9XA 3SQGA 2QA1A 4KGVB 1SQGA 2DNZA 1Z1ZA 4GO7X 1UPMB 2AV5A 2MDAA 4LSNA 1K1QA 3CDAA 1JJCB 4HVZA 1NK5A 4F3OA 1DARA 4O44A 3AY0A 4JV1A 3UD4P 4DL3A 4ECWA 5B0FA 5HBMA 1U26A 3DDNA 3T41A 3VGVA 1NH8A 4JI4J 2MQLA 3KUGA 2RQCA 5DDQC 5K8OA 2CVIA 1RTIB 1HR0F 1KLMA 3N28A 2KG0A 1EAYC 3MUTP 3CMAS 1LK7A 2YWGA 2EK1A 4NMLA 5JVGQ 2CQ1A 2VPYB 3KHGA 1U1QA 5MAOA 3OVBA 3CWJA 3R7BB 4KFBB 4I6WA 1AA1B 1RWUA 3Q22A 1HQ2A 1N5SA 2YXLA 3N6NA 2F9JA 5HROA 3OVAA 1WWHA 4LT6A 1VQ5S 3BH6B 4OMFG 3HZGA 4MJKA 3IBFB 2WRMA 1T9TA 1RAAB 4H4MB 1RTZA 4IFYA 3PY8A 3W7BA 3NP5A 4EMDA 1U02A 1B70B 2R8JA 3VVUA 2E29A 1LXJA 3EYZA 1HI0P 3K5OA 3DXSX 2NCKL 3TZZA 1B7FA 2DGOA 2HFOA 2J0SD 3KLGA 4WP3A 3DCAA 1BC6A 1PG5B 1HI1A 4ZLPA 1X4EA 4RBUA 5G4DA 1A6LA 2PMWA 3QFWA 3MAAB 1QTMA 2GGPA 4ED1A 3KDNA 1JLAA 3WDOA 2ZJQQ 1XNQF 3BM7A 2NXJA 3E8OA 1CJKB 4DUZF 2DNLA 4DN0A 2IDEA 2JVOA 3DDIA 1I5OB 2O5DA 4XIUA 2XI3A 5J1EA 1G4CA 3KJFB 2CQ0A 1YZ6A 4DUTA 1SH2A 2VDIA 1RBAA 1H2TZ 1FJGJ 5IQ6A 3R6LB 1IJEB 3MM7B 4J9MA 3GR1A 3TJ8A 4LVNP 3ZZZA 1LFPA 3CCWA 3CD5A 1JLFA 2GHVC 4K50A 2R7XA 1S77D 4PAAA 3GFZA 3TZWA 4OYWA 3FBFA 3M6VA 1C0TB 1CULA 4IG3A 3OFGA 3DM2A 3LWMA 4PABA 4PWWA 3LPYA 2VG6B 3D6FB 2JEJA 4DPWA 2W9AA 1VQSA 3DRSA 2IFXA 2IM0A 3M8QB 2E1RA 3GLJA 3HHLD 3Q86A 4RNFA 1KTQA 2QE5A 2A1BA 5KFJA 3Q8PB 3VAMA 5J2PB 4JB8B 5ADZA 4FYDA 2MMYA 1Y3KA 4DV3F 3JYTB 3LANA 2HFVA 3IO1A 1GTEA 4OJGA 4C97A 3H5SA 5HVHA 1I3OB 1GEHA 1VQ8S 2O66A 2DR8A 2J8SA 2FHKA 4FYWB 3FNNA 2C2RA 2XYPB 4GKJJ 4JI3J 4KO0B 1HW9A 3P5TL 2OPQA 1B7YB 4UOHA 4YS2A 3ZTSA 2VL1A 1IKYB 3D4JA 3DKDA 3CCQS 4Y00A 1GXTA 5HL7Q 3HLUA 1YJNS 1RWMB 5KT4A 3OL8A 3CCSS 4ALZA 4DG1B 1RT2A 3Q8QB 2G1HA 2D7SA 2EFQA 2ZBPA 4KSEB 3ZTOA 1HA1A 2UXDJ 2B6AB 2I1RA 5CD4H 1RT5B 4JI0J 5L1IA 2VDHA 5KFLA 2DXFA 1S1XA 3UW1A 3GJTB 2WB4A 2VIHA 1U47A 3I32A 3WBZA 5F3ZA 1WC3A 2DGVA 4B9LA 1QUPA 2CPFA 3M8ZA 5KOWA 4TYBA 3CCJS 2OLWA 1PIEA 1RK8A 3EZOA 2ZVIA 3NEKA 4CRJA 3NNAA 1M5VC 2XG8A 1ULRA 1LEOA 3PR5B 3RW7A 4DZ6A 2F8MA 2DIUA 4CLWA 2XMKA 3NCRA 3TJAA 4BLGA 4B17A 1RHRB 1BY9A 1FFWB 3DOMA 2W9CB 3PACA 2QEXS 2MZSA 3FEZA 3HDSA 1LNQA 1RHQB 1KVIA 1RACB 4QBUA 4WPAA 1OY6A 3MD3A 4ZVHA 3H0PA 3I4HX 3RZAA 5EWEA 1KQGB 1FDBA 1SBRA 4UT4A 1CEZA 4I2PA 4P2SA 3DI6A 5K8PA 4DSEA 1NSQA 4YR3A 1RDRA 2QJ3A 4M5JA 1VIXA 3Q24A 2XY7A 3S7RA 2LQ8A 4CO0A 3MI7X 3WX8A 5I3UA 2OH2A 5U47A 2EFOA 1Z2ZA 3BGRB 4I7FB 2AEMA 4Q45A 2YNFA 4WTYA 3BZQA 1LW0A 2VQFF 1ZAVA 3K8VA 4P2XA 4R5PA 3ZXWA 1WOSA 4CTAA 1MMNA 3BV8A 4JOUA 1BXNA 1IQZA 1S1UB 2ROPA 3GTYX 3KJQB 1LWCB 1J2VA 1S57A 2NXUA 1LOUA 3EUNA 4OI2A 3EJMA 2HQGA 3DLHA 3W8PA 1JLQA 5GAGI 1HNWF 3CCMS 3EM1A 3CJ3A 2AGOA 1YJWS 1Q7LB 1U6BA 4Q8EA 3GMGA 4UOFA 3SXLA 1FTRA 3W9JA 2WK4A 4Y2MA 4MKAA 4FKYA 2R8IA 1S9EB 4LMZA 3GCWP 3IA0A 3J80Y 4ECRA 2G9OA 3TO8A 1T03B 2Y9HA 3PW2A 3LPEA 2L9NA 2ZJPQ 1XR6A 4LRFA 1CG2A 2RQ4A 1DLOA 4CI0B 3KK1A 2CJBA 2P9GA 4FF2A 5HI7A 2ASLA 2CJQA 1XJWB 5KG6A 4RBTA 2QT7A 2QZ8A 4C8ZA 5HAOA 1MW7A 3ZC4A 4PWDB 2ZDPA 4N77A 4LQ9A 4H54A 4UOGA 3NOCA 2OI2A 2RB7A 2JJ4D 5KFIA 4ID5A 3WC0A 4Y2AA 3OFHA 4LSZB 1NDKA 3CEDA 3ELHA 3B8HA 1TTHB 4N56A 4P52A 3ILOA 1D9FA 4G1IA 2JH3A 5A6WA 2CNOB 3QNWB 4IYQA 3ZZ0A 1N48A 2EI5A 4FS1A 2XMTA 3GE9A 3G6ES 4USUA 2Q66A 1Q8LA 3IGVA 3LP2A 2BV3A 2A0FB 1XIQA 1JK9B 2N82B 4C8MA 2IVMA 2YVSA 1VJQA 4B3SJ 3MUVP 3W65A 1VQ6S 3TA1A 3NAHA 2MZQA 4NZ7A 3MFIA 5D4PA 5F8LA 3AHPA 1ZBTA 2P6TA 2MSSA 2JLGA 3LQVA 3M8PB 2PE8A 3I0SA 3TZYA 2IM3A 2OEJA 2X3DA 4DR7F 2HHQA 2XI2A 2MKCA 3T6JA 3BKTA 5IV3A 3GFXA 4X84A 3D6HB 4O0IA 3IWXA 3FBBA 1WEZA 2M5YA 3C14A 2IMWP 2KRRA 1CJTB 4C0BA 2MQMA 4NA3A 2A18A 1XC9A 1T95A 4KPYA 4OQJA 2PEHA 2F7VA 4EBCA 4RW4A 5L9XA 2LKZA 4ZLNA 1LQ9A 1QDUB 3K5MA 2HKEA 3JSBA 5A8KA 3AD7C 3FRYA 5LSLA 4DSLA 3SCKE 2JNJA 2NXNA 1OWXA 4R8UB 4QYZJ 1RA6A 1WNEA 4EK2A 1RT3B 5IZHA 3G87A 1C1CA 1WDTA 1CJUB 2K8GA 1UZHA 1RQ0A 1SPBP 4HHUA 4FYYB 1S0MA 1SIZA 2XLJA 1E6YA 5KT5A 1U1OA 3KHRA 2YX1A 1WSVA 1SCJB 2XWYA 2X7IA 3OXLA 3G82A 2HAFA 3BBFA 1G7CB 3CC4S 1RHJB 4ITSA 3SIPB 4PQUB 1AZSB 5D3GA 2DNYA 3A8JA 2G2OA 2D1CA 3H90A 4XDCA 1X4FA 4OYIA 1F6TA 2DPIA 4CO4A 5BXIA 5LMNF 1HWKA 4QR0A 4J9SA 2RJZA 4B3RJ 3SSQA 1CQNA 2ZH5A 2B7BB 3KLIA 1LWFA 4ZVGA 1HIYA 2BE7D 5HK4A 4BCAA 2VFVA 3DLKA 2DHHA 3G2XA 3ITHA 1VQLS 2ASYA 3M9MB 5CYJA 2LQJA 3GIRA 1V3RA 2YWFA 3M2RA 1RU1A 1NUEA 2HZVA 2N4CA 3AJDA 3G8SA 4QCLA 1JNZB 3DXBA 4J9NA 3TEHB 1FEEA 5ETRA 2RUGA 2HK2A 4QWBA 1FWLA 3HFZB 4U95A 1ZM3A 4G1PA 2N7CA 1DAXA 2FGCA 4Y2KA 3VZIA 4ZITA 1X9SA 2HAIA 3HD2A 4B9UA 3D28A 1D3WA 3FMWA 4DU8A 1RZMA 2XM3A 3HK2A 2AZ1A 4OHYA 6FDRA 1OY9A 3OR2A 1IXKA 2I5JB 2E1MC 3D67A 1ZOTA 4MYTA 3QSIA 4DLEA 1Q8IA 1ZA2B 2B8QA 4GVBA 1S49A 1Z4UA 3W2VB 2HQFA 4R0EA 4X4OA 4PKDB 1FKPA 2VG7A 3GFYA 1VR6A 4K4TA 5LJ3Y 3R5BA 1T3OA 3C15B 3EGWB 5DDPC 3ISZA 4KB7A 4XPEA 1WOPA 2YQ1A 5D0HA 2ZNYA 4P7VA 4Z37A 2J9DA 4P74A 5KFOA 1U25A 1S79A 3CJ2A 3JXOA 5LSRA 3I0RB 4DUYF 3F0NA 2RKIB 1M90T 2NS1B 3FCHA 3CTRA 3J7YI 1OO0B 1K8AT 3QJJA 1PO6A 1R89A 5HN0A 4DR2F 2VFUA 1NBEB 2BQRA 4K2JA 4MIWA 1S10A 3RJMB 4O4GB 1TFWA 3G6VA 3RYLA 5KOXA 1TL4A 4WXOA 3MM8A 2AF6A 1MNEA 2CJKA 5GMEA 2Y3YA 2AEFA 1KRPA 2O1PA 3P4UB 1IR0A 2AJFE 5A0YB 2QGFB 1Q7YT 4OZ3A 2CQCA 5KFXA 1RWWB 4C11B 1UVKA 1UKUA 4RZRA 1GQEA 2AU0A 1JNRB 2UU9J 1JQGA 5E3RA 2FUG9 2GMLA 2GQQA 3M2UB 4B9SA 1KOOA 3EE3A 4FDFA 3H20A 1QY7A 4LSLB 5DDRC 4M8LA 3HP6A 1TKXA 4LF4J 4DR3F 5BYSA 4U8YA 3FUYA 1C0UA 3CD7A 2YKOA 3PX4A 2OPPB 2MY8A 2KTQA 2R2RA 1NK7A 1S12A 4GKKF 1G6BA 4FF3A 3J7A1 1XERA 3D0GE 5AXLA 4RPFA 2HNZA 2AQ4A 4FZVA 3VCDA 3CJKB 4RNNA 1QE1B 2P6SA 4K4YA 4ERDA 2HG4A 1WF1A 3GIIA 1FK9B 1S76D 2F4FA 3ZZPA 5DETA 3MMAA 1DQAA 3GWCA 4F67A 4M5NA 3IP0A 3UD5A 2EW9A 3MR3A 2N3LA 4FP9A 3C6TA 4P9SA 1WEYA 2BM0A 1HWJA 1Z2LA 5HP1A 2W1BA 5IM0B 4WBFA 5H1SV 2KXNB 3QSYB 3TJ9A 5F41A 3H42A 2HRYA 4MTPA 3GU0A 2UUAF 2PIIA 2CJYB 2QO3A 3RBDA 2E5GA 4QWCA 2RU3A 4LJMA 4HTJA 3MURP 2AP6A 3WC2A 3B54A 4BDPA 3PNIA 1OQ6A 1HD0A 3GSDA 3MPDA 2HVDA 3D9BA 1JLGA 3O5TB 3RBZA 2WBMA 2LLZA 1EKSA 2IRYA 3VAFA 1HI8A 2NXCA 5FD1A 2BJ3A 4IRKA 2ZNZA 4HT5A 3KG0A 2V68A 1MWZA 4PUOB 4FF1A 3OW2R 3Q0AA 4QW8A 3M8WA 4K5RA 3W9HA 3PW7A 1XNRJ 1TVRB 3TEGA 2RHSB 2QYCA 1WC4A 4I68A 4ZLJA 2BE9B 2MYFA 2UXCJ 4Q8FA 4NLRA 2EFPA 3ZNJ1 2MJNA 3BEGB 3GV5B 3OUYB 3MOJB 1LK5A 4EU0A 1WORA 3AXKA 1KQSR 5J1PA 4LF7F 1C1BB 5IT4A 1QJHA 1TKZA 4ZIVA 1P6TA 4WKYA 1VBZA 1VQOS 3KG4A 3FEXB 3GYNA 3GONA 1KKHA 1WI6A 2B4PA 3C6UA 1O51A 3UDLA 2X1BA 4MK9A 3FKBA 5HO4A 5GAGU 5HQMA 4DQIA 3JTOA 4I67A 2B0GA 1JWWA 3TR5A 2ZVSA 1IWAA 1YJTA 1NHVA 4OIXA 4CCHA 4JV2A 4P2MA 4C4WA 1UL3A 5FJ4A 5HLFA 1UPPA 2LYVA 1XMOJ 4LF8F 2HLTA 2YKQA 3V4IB 4H4OB 4AUKA 1L3TA 2DHAA 4PXCA 2ZOGA 2FVSA 4KJIA 1ZA1B 2QA4G 4USHA 1HBUA 2YWEA 5K5MA 3GIMA 2E5LJ 5KFNA 3NCQA 2P9EA 4Q44A 1HBOA 1T05A 3MAHA 3ZZTA 2MJUA 3HVWA 4NXNF 1OS5A 4K0KJ 2CQPA 3AFGA 2DCUB 5L1KA 1T9UA 2PO4A 2UVRA 4ZPVR 3MCMA 3HVRA 2VKRA 4ENOA 4I0WA 2EXUA 1N88A 4QIEA 1N52B 4ZP9A 2YNGB 1VRUA 4NEZA 4YUDA 1MU2A 2ZH2A 3EPGA 2J6SA 4B3MJ 2OPRA 4TY8A 5B7WA 1FXRA 3M05A 2AYGA 2J9DE 4F36A 4ILRA 1Y9OA 4URQU 4I64A 4ZVOB 3AJ1A 4NCGB 4Q0BB 2GMHA 3I9ZA 2MQPA 2QFJA 1SC4B 2IJRA 3LAKA 2E9ZA 5D0EA 4DR1F 1SI9A 4DV4F 3DNCA 3A13A 2J9CA 5DM7Q 2OMLA 4KH0B 4I6YA 3O6QA 1GK8A 1U8SA 2KXHA 5FDLA 2YX4A 5KFHA 2RRBA 1DTTB 2MGZA 4LBIA 1NZ8A 4DV5J 2ZWPA 1RCOB 3VF0B 3R5GA 3WQPA 4DV6F 4WZMA 1IM6A 3LOUA 1N4LA 2FGOA 2R2TA 3V2UC 2JDJA 1XN9A 3TRGA 1N34F 3CDBA 2JLEA 3IAS9 4A48A 2WTFA 1N5YA 4C48A 2H48B 2QA4S 4PG8A 5KG4A 2WVFA 2J0WA 1WKKA 1HQUB 1YRTA 4X4VA 2DNPA 4GRSA 1V5VA 2B9EA 4LF5F 3MECB 2FDNA 3AAWB 1PBAA 2M7SA 1S6QA 4UTGA 3TZXA 1T8EA 4ED5A 4JI1F 4A4JA 5A2QY 2WCXA 4LUBA 1H7XA 3OL6A 1AFJA 1Q8BA 2AJ0A 4FN5A 2BJ9A 4G1QB 1TKTB 2XCPA 2HEKA 2PA3A 2F9DA 1OJ4A 1RT1A 2MQQA 2YH0A 3QJPA 5DZ7A 3VZHA 4PQAA 1BLUA 1CJVB 1EB0A 4LFAJ 1SJ1A 2ZM6J 2VOOA 2CZ4A 3SV3A 5E3QA 5C42A 3QGGA 1AYEA 2H51B 2WW8A 5BR8J 2KM8C 1FVSA 2LFVA 3F56A 4LBHA 5B0CA 1CSJA 1IKWB 2IA0A 4DWIA 3PW4A 3RR8A 2DY1A 1NKEA 3UDEA 3A12A 5SZTA 1S9FA 3RBEA 4LF9F 4OI0A 4J9PA 1CBKA 4K4UA 1NDPA 2Q6BA 1FKOB 1LWEB 3C3LA 5J2QA 2W7AA 4OI4A 3OTDA 2JLFA 2BKOA 2W2OP 4Z7YA 3T6BA 1L3KA 2H9ZA 3VGTA 3MEGB 2HBRB 3ZO7A 4YB6A 5B0AA 1NEEA 2KL8A 2KH9A 5EDWA 3VGSA 3V6JA 1TZ0A 1SKWA 3HHDA 3KLHB 4OJHA 4OI6A 1MN7A 1WHXA 1DTQA 4CLFA 4QPXA 3DHXA 4NLSA 1YLXA 2FC8A 2E7VA 4ZDNA 2ZD1B 1H98A 2D3ZA 4L73A 1RU2A 3CD6S 2HK3A 3BO3A 1HNIA 3M2VA 3QRRA 4Q5VA 2DVIA 5LXRA 2OAUA 3MCNA 4X64F 3QFHA 5J2NB 1H38A 1NO8A 2A3JA 2YNHB 3G9CA 1NK9A 1HR0J 1TL3B 2E1PA 3BKFA 4KRWA 1VQYA 2VBZA 2IVYA 1K1SA 1UJ5A 1H2UX 1ZZNA 2MLYA 5IXUA 1FHTA 1N6QB 3AJ2A 3DLEA 4PXEA 2IA6A 4ZJLA 2I8EA 4KT0C 3J7YU 3DN9A 2W2NP 3IG1A 3SBMA 1VQ7S 2MKJA 2PMHA 5HQ8A 3JSYA 4IO9Q 3WIVA 2AJ2A 4OYBA 3NGKA 3MGJA 2V8GA 5JJBA 2IC3B 1QSLA 1OYEA 2XYHB 1U1MA 2LXFA 2Y1IA 5C24A 4A47A 3SDEA 5A8WA 2RDIA 5KFMA 3R7NB 1C4CA 1XMBA 4R25A 4PXDA 2DH7A 4YP3A 1YJUA 3A8EA 4KPCA 1RE1B 4AL6A 4LR7A 4Y0FA 4DU7A 3W2WA 2CQHA 4DL0C 3AH6A 3GB0A 3GIKA 4L3NA 4WZQA 5BYQA 4OJ1A 3AD9C 5LMUJ 5HATA 5IOLA 4XDDA 3QQCD 3NLCA 3H5YA 2V34A 3N5FA 5ETTA 2IAJA 1FE4A 2E7WA 1RAJA 3TAMB 3T5HA 1RA7A 2KT2A 5RUBA 2EFGA 2ATLA 1PCAA 5KFCA 1VLOA 3NY0A 2NREA 2X1FA 4L74A 2AGQA 5KG2A 5KG3A 2KZZA 3POTB 1NPRA 1JLCA 4ED8A 2OPSA 4W4MA 2PI5A 1VLYA 4DSIA 1HYSB 3OR1B 1YZ7A 3LTOA 1F5BA 2MHEA 1R0AB 2HS4A 3LUYA 3CD0A 3SSRA 5CYQB 4WF9Q 3KYLA 2GNKA 1FDAA 3C16A 4OYPA 4DQPA 4YMEA 5K20B 3TUZC 2HHXA 2F8HA 1MWQA 4OYAA 1JXEA 1XK8A 2ZEJA 3HSGA 5CYMA 1CS4B 2LQ5A 4NZ0A 2LEBA 4AE5A 3E01A 2B3TB 1UEKA 1BE4A 1QAJA 1PJ5A 3W1YC 3BKUA 5CD4A 2LU1A 4ICLA 2KKHA 2IBKA 3IAM9 2DD8S 2HQIA 4DV3J 4IDKB 5KFSA 3G8QA 3ZTPA 3GQCA 4RU2A 4C3MA 2CQGA 3BJYA 3BSNA 3GV8B 3IFEA 1ZAXA 3DOLB 3T1YF 4RW6B 1YRXA 2GZOA 2VU5A 4CNZA 2Q79A 1N36F 5E3PA 2FJDB 4Y65A 4ZHRA 5DLGA 1S0VA 4QIWD 4RO0A 4DV0F 4C7QA 3KMQA 3V81A 4AXJA 2EG1A 3PDNA 2CRLA 1QLNA 4G3IA 2Z58B 4DV7F 4KV8A 5F8MA 2DY9A 2GHPA 3GCXP 1HFEL 4YY3F 3SSSA 1UTAA 4YDDB 4CO5A 2OIHA 1HPZB 1SKSA 2CNLB 3FEYB 1OPIA 3UWTA 3FSXA 3JSRA 4F4XA 4BWJA 3N4WA 3LH2S 5DQGA 2DR9A 1TL7B 1Q79A 1XMQJ 2KFNA 4IRDA 4ZPBA 4QYZK 4P72A 3SQGB 2QLXA 3NGSA 1D1UA 4LR8A 4LSNB 2JWNA 4FXVA 4A8WA 3MOZA 3FCVA 5H9FJ 4O44B 2B9XA 1HARA 5L39A 2QMUB 5HBMB 4PCQA 4IUFA 2N3OA 4I4BA 4HACA 1GMWD 1KLMB 4Y6IA 4ZPTR 4U9RA 4GMKA 2FVPA 1ELOA 1S6PA 2L48A 4E98A 4C9DA 3V5RA 4CM2A 3OPKA 3PJXA 2LEAA 5T7LA 4ZN1A 2MEWA 2HMIA 5GVQA 2DT9A 2WB1D 3ONQA 4N5SA 1RWXB 3KHLA 8ATCB 3ENAA 5KT2A 2NYIA 3LGMA 4ECUA 4HKQA 1JMTA 1SVDA 4M95A 4OHVA 4LBPA 1S0NA 5HROB 4V19X 4RW7A 2IDLA 4OLOA 3SEOA 5HJXA 2VQFJ 1PYSB 2DBBA 5I3QA 4G6VB 3PTWA 2V2KA 5FLXU 4IFYB 4RWXA 3LAMA 5C5JA 3N0VA 5D15A 4QWAA 1TMMA 5C2GA 2RUSA 5DLFA 3CCES 2HFUA 3L3CA 2HRUA 1TL1A 2ZFHA 3CGIA 3CDWA 1VHIA 4A8YA 1M1GA 3KLGB 2KYZA 3MPUB 3A8KA 1TK0A 3SFGA 3CIMA 2C2MB 4C3LA 3J81U 2YKMA 2QG9B 2YQ3A 2GW8A 3I4PA 2GGPB 4Q43A 3JAMU 2DNMA 1JLAB 3I82A 4C8LA 1W2IA 2YH1A 5EHHA 3LF0A 3ILIA 4X4QA 5HMYA 3G96A 3TUPA 3BR8A 3BB5A 3CIZA 2LA4A 2VPXB 1S1WA 2W9BA 2BRLA 2GVZA 3VGUA 1J5EF 5J1EB 4E0DA 4J9UE 1FX2A 2MLZA 2W01A 2XMUA 1S7IA 5B0GA 4TNOA 1N5TA 2VFRA 5DZ6A 3PV8A 3CJ5A 2UXBF 4DL5A 1Y11A 4FYVB 4DSKA 1U4BA 1JLFB 3R1HA 3NG8A 4MKYA 1HWUA 1HNZF 1GX5A 1IKXA 4CO3A 4KHMA 4IG3B 3HSZA 2C2NA 2IPOB 3DM2B 5IT9U 2A10A 2ZJRQ 4IFVA 4R0JA 3OLBA 2DNRA 3SFUA 1NHUA 4C8YA 3UR3C 1HMVA 1RABB 1W2BR 1UFWA 3B6BA 1BMQB 4GC6A 5A8RA 5GMDA 2ZHAA 3T5JA 3IN5A 3HZEA 2CG8A 4QW9A 4NLQA 4LFBF 4V19J 2C42A 4PG4A 2FJWA 3MZIA 1CPZA 5I3PA 2E66A 4PPZA 4QU6A 2UUCF 3RRGA 1EQMA 2GJIA 2OPQB 3QGHA 4NCAA 3CCLS 2CG4A 2RE1A 3QO9A 5L38A 2V4QA 4JI5F 1IM4A 4A8XA 5H9EJ 4ZIWA 3HSDA 1FJGF 3OTBA 5HMXA 2I6WA 1RT2B 3V4MA 4U7CA 2AEJA 3Q83A 4IO1A 4EBDA 3CSKA 1V6HA 4DI6A 4HHHA 5AJ3J 2MHNA 2IM1A 1SJ4P 1S1XB 5DO2A 2DH8A 4ZJOA 4CO1A 3HFKA 2VA2A 2EWHA 1ZYQA 4JP8A 3RB6A 2ADCA 1U1KA 3QWUA 1WC0A 5DM6Q 2FJEB 2NR0A 1SJRA 4E8UA 2M88A 2V67A 3DLLQ 1JJ4A 3KLVA 3P96A 3VHQA 5K8MA 4F25A 4RUBA 5E33A 2EEYA 2ILZA 3EWGA 1PYTA 4FYXB 4JI6F 3LGHA 5KFTA 2DNOA 1G2EA 3AA8A 1PJ6A 2R3VA 5F8NA 5M2RA 2ZDOA 2CPXA 2CKWA 2Y8WA 2ZHOA 3DOMB 3MCSA 1S6UA 2AT1B 2MZ1A 4DCOB 4YQWA 3RB0A 1GXLA 3SYZA 4GKJF 4I2PB 3DI6B 3RB3A 3PX0A 1R31A 3MR6A 2HFNA 3MPWA 3MEKA 1AB8A 3MPVA 4NEYA 4PZVA 1KBRA 4MK8A 2CWKA 4CWBA 2F1FA 2V2ZA 4USJC 3C2PA 5DGBA 5C25A 1YJRA 5I3UB 1FRHA 4ES3A 2VH7A 1UP1A 2YNFB 1QSYA 1LW0B 4J90A 3FFIA 4R5PB 4CTAB 4M5DA 1FKAF 4ZVUB 1CJUA 2Y1LB 3K2YA 4J9LA 3RUBL 1RKJA 1R6YA 3G8TA 4WP8A 2EPIA 2RT3A 4WK3A 1REGX 3MD1A 3KMSA 1VQ9S 4M5KA 4ZKAA 2MKKA 1JLQB 3DLGA 2XS7A 1UCNA 3R27A 1W7WA 2H65B 2OO4A 1F9FA 1FTCA 2ZC3A 1CC7A 2PFDA 3A4TA 1JKHA 2I0XA 3VQTA 4FNHA 5GMKa 4OI1A 4Y34A 3CJQA 2ABYA 1S0OA 2XO7A 2M70A 4ZS6A 2XNQA 2CFXA 1XBWA 2N4DA 4DUYJ 5B09A 1IQTA 4OX9F 1JIHA 2XHCA 1DLOB 2E9TA 3KK1B 2KFZA 3MFHA 2VJVA 1RAEB 1WUUA 1YBAA 3BDPA 4M5LA 2L08A 2DRBA 3D0IE 2W7OA 1APSA 1IBKF 5HQLA 4DR2J 1I6JA 2BEFA 3MMBA 1HLWA 2NLWA 2XWXA 3P6YC 1ZS6A 2OD6A 2U2FA 2VC0A 2HIYA 3AQOA 4WFBQ 1PC4A 3NS5A 4OZ1A 3JTPA 4ID5B 1RWPB 4J9OA 5LL6d 2DHGA 3HO1A 5KFKA 3H98A 1MN9A 2K3IA 2VZ9A 1PSDA 3CCRS 1EP4A 8RUCA 3QATA 1U2FA 4IG0A 4YFUA 2RRAA 2H54B 4IH5A 1PAUB 3H4DA 7FDRA 2DR7A 1KLNA 3MM6A 3LP2B 2AJ4A 1KNZA 4F0MA 1M5HA 1U0HA 3FDSA 1IWGA 3DGPA 4F02A 3IS9A 3RTVA 2WOMA 4DR3J 2QMXA 1Q81T 1OSDA 1NB7A 4F2RA 1SC6A 1GFWB 1VOMA 2JC1A 3QIPA 2K3KA 4TYAA 2E5IA 2Z0GA 3US5A 1RLCL 1B64A 4GKKJ 2HQDA 3I0SB 3GP9A 2KT5A 2A2CA 3K7RA 5A76A 3LA0A 2P8IA 3C14B 2Q1LA 3AOCA 2DRDA 4KR0B 4OJ3A 4DJBA 5DG8A 2BVZA 2XY6A 1K0VA 2XYGB 2VBYA 5DG7A 4K7QA 3V6KA 3NGRA 4RW4B 3W5XA 2FD2A 1X7VA 2JEGA 2DNGA 2ZH8A 3I5CA 3P5BP 1LV5A 5A8KB 4ZP8A 4QR2A 1WD6A 3TNVA 2HZAA 2I38A 2J7WA 1V3ZA 1A7GE 4AL7A 3H59A 1C1CB 3KDOA 1DHMA 2PA8D 1KFSA 2XO6A 2EBGA 1OY8A 1IR2A 1EIYB 3W9IA 3HT0A 3WHIA 1E6YB 4FXWA 2UUAJ 1FNMA 3D7SB 4IOCQ 4O3PA 4YB1P 1RWKB 2CA9A 2Y1RI 3W61A 3G82B 1XEZA 1FJEB 3MMCA 3MTJA 1ZM9A 4ER8A 4O0NA 1FA0A 4X65F 1HWLA 5D3GB 1NDLA 2ZC4A 2F4VF 3E2EA 1JX4A 3AA9A 1FRLA 2FTRA 4ZPWR 4G65A 1VJWA 3GR0A 4Q7AA 5GAHI 1RTDA 1DFDA 4OHXA 2VPWB 2LU2A 5K8NA 3GSIA 1JXVA 4LRCA 1S1TA 2H4WB 3KLIB 1LWFB 5B0DA 2V5HG 5DS7A 1FNXH 3MEEA 5KFQA 1TL5A 5CCMA 4X4TA 2V9KA 2XMWA 3DLKB 3ITHB 1SL2A 4OZ0A 3ENVA 4AXIA 2CQ3A 2HSEB 3M2RB 3R8YA 2W25A 3NBPA 2V8VA 1DQ9A 5EUHA 2DXEA 2JC0A 4CP5A 4OV1A 1U49A 2SXLA 3BGFA 2ZOFA 3TUJC 2CZVC 3NAIA 2DNNA 5HMZA 1LFWA 2WHOA 3K17A 2HYIB 1M5SA 4BWMA 3L7PA 1VC6A 4KHPF 4LF2A 4K4ZA 1KVJA 4A8FA 1V3SA 2C22A 2XS5A 3W3SA 3FMBA 3OR2B 1WDDA 3IBCB 3HULA 2KM8B 3DMJA 2P2CB 3MAQA 2Z4PA 4GVBB 2ZBIA 1GMVA 1OMSA 2RILA 1NB2A 2GAGC 2ZH3A 3EXYA 1FKPB 2VG7B 4NLVA 1RAOA 2BKPA 1WJ9A 4OZLA 5F3TA 4EI2A 4ED3A 4QU7A 1WG4A 2V8DA 2DO4A 1RTHA 4NLGA 4N76A 3C8YA 3M30A 4IH7A 2VD3A 4NYPA 2W8LA 3UFCX 1D8ZA 9ATCB 4UOCA 4B9VA 5BYRA 3NWGA 1NPKA 3W5ZA 1EKRA 2V9WA 3TVYA 3QRQA 4NXNJ 2HGMA 4TQRA 2XGPA 1NSPA 2NZ4A 4RW9A 4ED7A 4ECYA 1TK5A 5F0WA 1SKUB 2BR0A 1WTBA 2Y1JA 1WI8A 2OTJS 3MM8B 1M1HA 1RWOB 1JB0C 2R42A 4PRFA 4I2QA 4A8MP 4XPCA 5ETKA 2BACA 2Y8YA 1I94F 3CUNA 1QTNB 4DV1F 1F2GA 3DLBA 2J0XA 3LP0B 2R8HA 3TVKA 3FRZA 2CPYA 2ZE2A 2KVIA 2LECA 2D9OA 1L3UA 1AROP 4M5MA 3HD1A 2KDOA 2J6UA 3ETOA 4DR1J 4DV4J 5ETVA 1TKXB 1TAUA 2AW0A 1C0UB 4MFBA 4ZVQB 3M1VA 1H74A 4DCJB 3PIPQ 2R7UA 1R0CB 3IGNA 3D2WA 2FLPA 4JV5F 1U1NA 5I42A 2W2PP 2GO9A 1RT7A 5KFBA 4PG7A 4MKBA 2HNYA 2CQBA 3OJSA 2DITA 3ZTQA 4HI2A 2XULA 4O3NA 1N34J 2RQKA 5D4LA 2HNZB 2VFSA 3T19A 1FX4A 1REVA 1SQEA 2F5GA 1RJJA 3OTCA 2OHDA 1VRQC 3LWLA 4NZ6A 2JX2A 4LF5J 1VK3A 4YB5A 4CO2A 4CLPA 3MMAB 2V2VA 1UWBA 4KKOA 4KHRA 3VVTA 1VYAA 2Z2YB 4RUHA 4WP9A 1NHKL 4QZVB 3N6MA 3MUMP 5LT5A 3C6TB 2OD4A 1E6VA 1L3VA 5LXYA 5IT0A 2CQIA 3AODA 5HP1B 3M6UA 5KFGA 1IBLJ 3M4XA 2BE2A 1SJFA 3CCVS 2B5JA 2UP1A 4OZNA 3HJFA 1WOOA 2VF3A 3M32A 2X1AA 1TFYA 2V63A 3HXMA 4F04B 3GG0A 2E44A 2GC8A 4LVOP 2WVDA 1ROFA 1NKBA 5CAAA 1NCLA 5KFRA 3U1NA 1D09B 2M8DB 4DPYA 2MXYA 3PYDA 5KG1A 1YWXA 1WKJA 2EVZA 1JLGB 2UUTA 4RW8A 4N8OA 3A1YG 2VG5A 3UQSA 1UFLA 4DPXA 4QOTA 2CQ2A 1VMBA 3R6GB 4ETXA 2BXJA 1PILA 3L7OA 3P3DA 3KXDA 4U7UK 1RLDA 2H5IB 2Z2LA 4RLEA 2V4JA 3PR4A 4JYAF 3I31A 2G0IA 1RHKB 2DH9A 3IRXA 4XO0A 1WEXA 4DBQA 4Q2LA 4CH1A 2F40A 1Q5VA 2R2SA 4RNHA 2KB2A 1C4AA 1TKZB 3F41A 1VISA 2ROEA 2ZH7A 2IBOA 4GVLA 5AE1A 4DPOA 3J7ZT 3W60A 1HBMA 4KGKA 4UY8T 2LQBA 5ETQA 3C6UB 4CT9A 1IBMF 1GT8A 2YTCA 4J37A 4WE1A 3ILJA 2HVZA 2XSJA 1RBOB 1TUWA 1S4FA 3IMQJ 4IH6A 2C3MA 4OX8A 4U7UD 1WACA 1MSWD 2KO1A 4DFJA 2WSFC 4RNMA 3AOBA 4F0HA 2RF2A 3BGLA 1K0TA 5T41A 1RTJA 1M5PC 3CJ4A 4DSJA 5HLFB 4WKRA 2L9WA 5C7PA 2B43A 3G6YA 3HVTA 5H9FK 2HWHA 2BOPA 4HH0A 1HBUB 1VS3A 3TARA 1YVFA 2G0JA 4LIWA 2BYCA 1EX8A 1HBOB 4F8RA 1T05B 1GMWA 3TWZA 1GH8A 2FY1A 4TVAB 2AYMA 2HFZA 1YK9A 3EGNA 4A8OA 3LP1A 2R7SA 1Q78A 1WHYA 3TQ1A 1YGYA 3JS9A 4ZOSA 4F7VA 3R5AA 1UMJA 3HHEA 2O01C 3TOQA 1VRUB 2HQ3A 2DIVA 4V1Ak 1MU2B 3EVMA 4LRBA 5JMNA 3PIOQ 4LREA 3BBBA 1FJ7A 2OPRB 2GA7A 4TY8B 4ED6A 2AGPA 3G6XA 3PRDA 2KFYA 4ZK7M 1QAXA 4WFNQ 3HHNB 1GTHA 3CC7S 3HM9A 4QIGA 4NXMF 2F63A 2EC0A 2KYXA 1X5OA 4DL2A 1PKUA 3T9NA 1ZZFA 4B3OA 2HNDA 2HVEA 1FRXA 3UVJA 5FDLB 2BMBA 4ECXA 1OIAA 3G86A 2XS2A 4OX6A 3UNGC 2MGZB 3MF5A 2CYYA 5L46A 1SJQA 4CYUA 3O2IA 1Q0NA 4EWTA 5CZVA 3TUIC 4QYRA 3GV7B 1UW4A 1YHQS 2U1AA 1FEHA 1H3DA 1VCTA 3M7VA 4TQSA 3OXGA 1GNKA 1N5YB 3QZ8A 2Y0BB 2C3OA 1VC0A 1R8HA 2QSFA 4TN2A 1K47A 3MWBA 4F3MA 1IJFB 1UVNA 3NS7B 5K14A 4OX7A 1HHSA 2GHWA 1PAEX 2MPUA 2W4PA 4KTQA 1S6QB 3EVOA 3L95X 4NI2A 2IM2A 3BH7B 3SQOP 2R7VA 2ZUGA 2DK2A 3NGDA 1FCAA 4B3MF 4EO6A 4RNOA 5F8GA 1TUVA 2DTJA 3RBXA 2OGUA 1URNA 3KK3A 3JQKA 3M8SA 3NGTA 2HBQB 4F4AA 1RXOB 2BDPA 1RT1B 2PEBA 2ZH4A 4O3SA 5I4MA 2VFTA 2MLXA 2CNNB 5G0RA 1OSCA 5KTQA 4Y28C 2Z57B 3A3NB 5C42B 3F44A 2H3EB 3QAEA 3IR5B 4FKXA 2DNKA 4ZVPB 4DF4A 3EZUA 2KI2A 5F8IA 4C0OC 5GAHU 3T1YJ 3BGUA 4X4PA 3PFEA 2J0QD 1N36J 1VHFA 2ZBCA 4P73A 2J6TA 1SUQA 3MEDA 3BPDA 3TP2A 3QRPA 4DV0J 2ZZNA 3VWSA 2APOA 3CCTA 4QIVA 1BUXA 2XMMA 3EDRB 1NSKL 5J2QB 3C19A 4U8VA 4DV7J 4IOBA 3Q8UA 1N0VC 5H9EK 4URGA 2F3JA 4ZVTB 2RU9A 4ZLLA 4AYBD 3G71S 2FVQA 5F9NA 3HKWA 3CC2S 4NA1A 4ZPAA 2XMVA 3VAKA 1RGVA 1JLEA 1DTQB 1LWXA 4DV2F 1AUSL 2X3GA 4ZPCA 3OTOF 1FXLA 2ASJA 3IM9A 1FNOA 4ZA1A 2J8AA 4DX8H 2YKNA 2ZM6F 3RAQA 1HNIB 2V50A 3M2VB 4DHVA 4N41A 3K0JA 1SH3A 3MM5A 2RVJA 1OQ3A 3R7SB 3BSAA 2DGQA 4K4XA 2B7CB 3V6DA 2ILYA 2MZJA 3TI0A 3CJ0A 4OZJA 4USIA 2C3UA 3DLEB 1FI4A 2HQCA 2POKA 2D3O1 2MQOA 3CXCR 1S5ZA 5CA5A 5IWAJ 3IG1B 3H2VE 5M2PA 3QBCA 4X4SA 4LQ3A 2MB0B 5HJYA 2FIUA 1S72S 2A6MA 2KJWA 3MR7A 3CE8A 1Y10A 4BS2A 3W66A 4NYOA 1A9NB 3UE2A 3RAMA 3GILA 5C24B 1YBTA 1EETA 4UUXA 1VGYA 2K7KA 3PEJA 5LOQA 3SDEB 4RKUC 5A8WB 3DFEA 4D3HA 1S9GA 3NWRA 1VBYA 4DR4J 1V9OA 4C6AA 3PM9A 1TMJA 1KP6A 2W8KA 1L5UA 3W2WB 4J9RA 2MZRA 1JLBA 4P71A 3NMRA 4NCBA 4YEAA 2CPEA 3TVZA 5DJBA 4TY9A 4O3OA 2FHJD 2BW7A 3CMES 3MR5A 2UVVA 2AWZA 1VBKA 1UETA 5J2MA 4J7CA 3HX9A 2JFDA 4M94A 3U02A 1T3NA 4CQ1A 2IAJB 3H8YA 1BWEA 4FXDA 3J80U 2XZDB 2XZTB 4PG5A 5E3AA 1J5EJ 3ET6A 4I69A 1S7HA 1AW0A 1FWKA 4K2XA 3J7Z5 4UY85 2HIQA 4BHQA 4GO5X 1RADB 3BSOA 1JLCB 3TANA 3QZ7A 2OPSB 2NXEA 4W90B 4F50A 3U1MA 1X0PA 4DQSA 4OYXA 1FO1A 2M8HA 2FPHX 1HNVA 2YKPA 2UXBJ 1VRTA 3H5UA 2AX0A 1WG1A 1X4AA 2QFIA 2Z2MA 3KWMA 4D3GA 3UD3P 1HNZJ 3C16B 1NJIT 2FJVA 2HFSA 1J5OA 2BANA 2UV8A 2HWTA 6FD1A 3Q8YA 4NYZA 4C8NA 4C2MA 1RT6A 2C3PA 3S1TA 5CYMB 4TU7A 2HHHF 3K57A 3PRBA 2D3OR 3BSCA 3K58A 3O1LA 1UWAA 3JQMA 4JI7F 2ZUAA 3JSMA 2HZCA 2YWKA 3E01B 1SH0A 2V2QA 2HHPA 1RAIB 4TLQA 1U8WA 4WTOB 1YQHA 4ICLB 7AT1B 2IYGA 3CCUS 4LFBJ 5LMUF 4K4SA 5KFAA 1UW9A 4ILMA 3KLFA 4ELUA 1N5QA 2K06A 5E3CA 2ACYA 2ACMA 2UUCJ 3HFVA 2OMOA 3BN7A 2RQMA 3DLJA 1HBNA 3KKFA 3KUHA 2R2UA 4ZHRB 4JI5J 2W7PA 4LRAA 1M5OC 2DR5A 3IR6B 3V81B 2NSBA 3PYFA 1F2HA 4JI8J 3UDVA 3T1AA 5HMWA 3CNQP 2YNIA 2KU7A 4LRDA 4S0MA 4KV8B 2R7QA 2M3DA 3OVSA
chains in the Genus database with same CATH topology
4RX6A 3HFKA 2XWYA 2VA2A 4W92B 2EWHA 1ZYQA 3OXLA 3PJWA 4OLPA 3RB6A 3DOKA 2ADCA 4YR0A 1U1KA 1OPZA 2PI4A 3QWUA 2P9CA 4MH8A 2BW2A 1FDDA 2FJEB 3PFOA 5DM6Q 1G7CB 2XLIA 3CC4S 5JVHQ 2NR0A 4ITSA 2C2EA 3R3TA 1SJRA 1N5VA 4E8UA 2ZITA 2M88A 5KFUA 3S8SA 3TA0A 1X9MA 4PQUB 2MKSA 3DLLQ 4NLWA 1JJ4A 3CPWR 3KLVA 1UA0A 3P96A 5D3GA 1Y7PA 2G4BA 1Y0HA 5K8MA 2DNYA 4L72B 3U27A 3HHKA 5E33A 4F25A 2LCWA 2X51A 2D1CA 2ILZA 4JI6F 1SB6A 4B08A 1D8YA 3FSYA 3X3UA 4XDCA 5KFTA 4B3RF 1X4FA 1F5AA 2DNOA 4X66F 1G2EA 3DU5A 2DPIA 4CO4A 3AA8A 5LMNF 3M9NB 1HWKA 2FJBB 1S99A 1HNXF 4QR0A 4MIAA 5F8NA 4QR1A 4J9SA 2VOPA 2K2PA 3BDEA 2RJZA 5M2RA 2ZDOA 2CPXA 1TK8A 2IJNA 2CKWA 1KS2A 3SSQA 1CQNA 2ZHOA 3MCSA 5B08A 1U1LA 2ZH5A 1JLEB 2B7BB 3KLIA 2ZH9A 5EWGA 1LWFA 1S6UA 2LXIA 4JI2F 4ZVGA 4PUOA 4MAKA 1D0EA 1CQMA 2K1RA 4BCAA 2MZ1A 4H4KA 2VFVA 3DLKA 1VQLS 3ITHA 2ASYA 2KT3A 3CO9A 3I87A 2FVCA 5CYJA 4YQWA 3M9MB 1TV6A 2LQJA 2EK6A 3RB0A 1TVRA 1VK8A 2FLNA 2PMZD 1GXLA 1V3RA 2YWFA 3M2RA 3SYZA 3F73A 4GKJF 2YKNB 1Q53A 4F26A 4I2PB 3B4MA 3DI6B 3RB3A 4EGLA 3PX0A 1R31A 2N4CA 3MR6A 2HFNA 4LF6F 1S48A 3MPWA 1N8RT 3G8SA 3RU0A 3R1LA 4OI3A 4QCLA 5BJRA 1S6PB 3MEKA 3MM5B 3KLEA 3OUYA 1JNZB 2M9KA 3MPVA 3DXBA 3VQSA 4J9NA 4CH7A 1RI7A 5CHCB 4MK8A 1LXNA 2F1FA 1C1BA 1SV5A 2Q3PA 5T7LB 1FEEA 2ZH1A 2HMIB 2RUGA 3EXCX 3R5CA 4QWBA 4B3TF 4USJC 3C2PA 5DGBA 5C25A 1S6OA 1YJRA 4O3RA 3V6DB 1ZM3A 1FRHA 4G1PA 4MK7A 5I3UB 2R7RA 4ES3A 3MM9A 2N7CA 2V94A 1DZ5A 2NPFA 2VH7A 4HI1A 1DAXA 4WFYA 2FGCA 3H25A 5L1LA 2RNEA 2W4DA 2HGNA 3HI9A 4Y2KA 3VZIA 2M4MA 1X9SA 2LDYA 2HAIA 1UP1A 1WHWA 2YNFB 2NPIA 1QSYA 4B9UA 3D28A 1D3WA 3FMWA 1LW0B 3DRRA 3U7JA 3HK2A 5GADI 4OHYA 6FDRA 3EZ5A 3FFIA 1Q1KA 4R5PB 3OR2A 4CTAB 4M5DA 1IXKA 2I5JB 1FKAF 5KT3A 3KJVA 1XTZA 2E1MC 3B82A 4P7TA 1FJCA 1ZOTA 2GIQA 1IKVA 2PD1A 1H2VZ 3K2YA 4MYTA 4PWUA 4RW7B 4J9KA 4DLEA 4J9LA 2RMLA 1VQPS 2JHEA 2JOQA 1UJ6A 1RKJA 1Q8IA 1R6YA 3G8TA 2EPIA 1MMDA 1LW2A 2RT3A 1S49A 4WK3A 4DEZA 1S97A 2E5JA 1Z4UA 3MD1A 3KMSA 1VQ9S 3W2VB 4ZKAA 5DQHA 1CC8A 1KC8T 4R0EA 2DPJA 4X4OA 2MKKA 1JLQB 1FKPA 1ZPVA 2VG7A 3DLGA 3GFYA 4PKDB 4H4OA 2IRXA 1P27B 3V4IA 1MMLA 2XS7A 1SL0A 1XMQF 3R27A 4K4TA 5LJ3Y 2VUGA 3R5BA 2OO4A 3BF4A 1T3OA 1G1XA 3EGWB 5DDPC 3ISZA 4KB7A 1F9FA 3BO4A 4A8QA 1RYRA 1HHTP 4XPEA 1FTCA 4U67Q 2ZC3A 4NRTA 2B9WA 3I6PA 1EETB 3OSPA 2ZNYA 1CC7A 4P7VA 2WONA 2DJWA 4Z37A 3T1HF 4OHZA 1S9GB 1JKHA 2DHSA 2J9DA 3DRYA 4YHHF 2I0XA 1VQ4S 5KFOA 3MXHP 1U25A 1KOHA 1S79A 3CJ2A 4HLBA 5KFZA 3VQTA 1TL1B 4FNHA 2B56A 1XR7A 2EBEA 5GMKa 4OI1A 5D8HB 2YX7A 5LSRA 3I0RB 4Y34A 3QGPA 3ISNC 4DUYF 4OL8A 2ABYA 2RKIB 4NLTA 3BQ1A 3OJUA 1ZTTA 1M90T 1S0OA 1QVGR 4WU2A 2XO7A 2M70A 4ZS6A 4ZVEA 2NS1B 2XNQA 2XHWA 2CFXA 4ES2A 3FCHA 1KTVA 1MROA 1XBWA 2N4DA 3CTRA 2Y0SD 3J7YI 1OO0B 5B09A 1NJZA 1IQTA 4OX9F 2HW3A 1O0PA 5MLCV 1KFDA 1K8AT 1PO6A 1R89A 3QJJA 4ECTA 1JLBB 1JIHA 5HN0A 2YKMB 2V0NA 2HHVA 4DR2F 1DLOB 2VFUA 1TR0A 2E9TA 3KK1B 2KFZA 2BQRA 3VALA 3MFHA 1YBAA 4MIWA 4DR5F 3BDPA 1S10A 4O4GB 2IMOA 2L08A 2DRBA 1TFWA 3D0IE 2YNGA 2W7OA 3PX6A 1APSA 1IBKF 3G6VA 3RYLA 5KFDA 1WF2A 2KRBA 3SCLE 1I6JA 2CPDA 5J2MB 5D4OA 3MMBA 5KOXA 3Q23A 2JRSA 4DQRA 2NLWA 4RBVA 2XWXA 3P6YC 1TL4A 1S1WB 2BBEA 2W9BB 4WXOA 3MM8A 4PR6A 2AF6A 2OD6A 1MNEA 1P1TA 5AXMA 3QLHA 2CJKA 2ALZA 2U2FA 1SKRA 1U09A 1ZTWA 4ECQA 3MTKA 1KRPA 2O1PA 2VC0A 3CF5Q 1VBXA 4JBCA 1IR0A 1NAQA 1FD2A 3AQOA 5KFYA 4WFBQ 3RR7A 2R7TA 1PC4A 2AJFE 1UEVA 3NS5A 4OZ1A 4PXBA 4I56A 2UU9F 3JTPA 4NCGA 5A0YB 4Q0BA 4ID5B 1FD8A 4KIAA 4TU8A 2QMWA 4K4WA 1FF2A 2CQCA 5LL6d 2RD5C 4J9OA 5KFXA 2VODA 2DHGA 5D4NA 4C11B 3I96A 3HO1A 1KHWA 5KFKA 1UVKA 1YITS 1UKUA 1TQLA 3H98A 4C0HA 4RZRA 2K3IA 2VZ9A 2KJVA 4BC9A 1GQEA 1PSDA 2AU0A 1U1RA 1N33F 1JNRB 3CCRS 1R27B 1EP4A 1U24A 5IWAF 5E3RA 3VR1A 2DGWA 1HWIA 1U2FA 2FUG9 1BQXA 2GMLA 2GQQA 3M2UB 4IG0A 3B4DA 4YFUA 1RT4A 2RRAA 4B9SA 1KOOA 2HVHA 4CH0S 2J76E 3FSIA 3NS6A 4IH5A 2RS2A 3H20A 1QY7A 3H4DA 2FB0A 4LSLB 4LF4F 2FC9A 1HNVB 3H4BA 7FDRA 2DR7A 1VRTB 2MKHA 1KLNA 5DDRC 1UVJA 3HHLA 2EFNA 3MM6A 2DNQA 1DTTA 4DQQA 4QJVA 4YR2A 3LP2B 1FT8A 2AJ4A 4M8LA 1Y4ZB 4RWWA 3HP6A 5LJ5Y 1IKXB 5KG5A 2CPIA 1KNZA 1TKXA 2GFFA 1JXLA 4DR3F 5BYSA 2YWHA 1NKCA 1M5HA 4KQZA 1C0UA 1HQEA 3CD7A 2PDAA 1FE0A 3FDSA 3ZZYA 4X4UA 2YKOA 3PX4A 3DGPA 2OPPB 2YKAA 1QSSA 4F02A 3K8WA 3IS9A 2BM1A 3RTVA 2WOMA 4IFVB 2MY8A 2BANB 2D41A 4NX9A 1J5OB 2QMXA 1Q81T 1NK6A 4AFFA 1UA1A 1OSDA 3CDEA 1NB7A 4F2RA 1SC6A 4DR4F 2KTQA 2JZ5A 2R2RA 1NK7A 1RT6B 4GKKF 1VOMA 4OFZA 2DO0A 1G6BA 2JC1A 2P5VA 1HMVB 4FF3A 1P9QC 3J7A1 3QIPA 2K3KA 4TYAA 2GCFA 2LDIA 1CVJA 2DRAA 2E5IA 1HQUA 2Z0GA 1XERA 3D0GE 1KQFB 3US5A 3JSMB 2W24A 5AXLA 5A8RB 1B64A 2HNZA 3I0SB 4FZVA 1F0XA 2AQ4A 4DF8A 2KT5A 2XNRA 1P8GA 2A2CA 3K7RA 4TKTA 3VCDA 5KFFA 3ZFVA 3CJKB 3N5BA 3I56S 3MECA 4RNNA 2GJ2A 3HKZD 4EYHB 1QE1B 4C8KA 2V8HA 2P6SA 3GIJA