1S79A

Solution structure of the central rrm of human la protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
b'GRWILKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lupus La protein
publication title Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, translation
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s79A00
4C0OC 5IM0B 2F9DA 4UY8T 3PIPQ 4PR6A 2E5GA 1SXLA 2DHGA 2OTJS 3G8TA 1WEZA 2HGMA 4UQTA 2D3OR 2M2BA 1UP1A 1K8AT 3UD3P 3CC7S 3CPWR 2KT5A 1X4CA 2CQ3A 2KU7A 4J5OA 2MKJA 1IQTA 4WIIA 2F9JA 2RT3A 1HD1A 4YOEA 3THPA 2DGUA 5MLCV 3OW2R 2CPFA 3Q2TC 2VONA 3ZZYA 4Y0FA 1JJ4A 1FJEB 4WFNQ 3N9UC 4TU9A 2HYIB 1WF1A 2FPHX 3MI7X 2YH1A 5EN1A 3H2VE 1WHXA 2CPEA 2AYMA 5JVHQ 5LJ5Y 2ZJPQ 1L3KA 2KH9A 2E5IA 1U1LA 1KQSR 4ERDA 2BOPA 2MZRA 3CCVS 1WF2A 3V4MA 3MD3A 2B0GA 2D9OA 1O0PA 1D8ZA 1HD0A 3B4MA 5CXTA 1YITS 5HO4A 4F26A 3CCLS 3G6ES 1U1KA 2M9KA 2ERRA 1UW4A 1FO1A 2CQGA 2J0QD 2AYBA 1DRZA 1XN9A 3DLLQ 1X4AA 4WCEQ 1X4BA 2M70A 2NZ4A 2A3JA 3EGNA 4OZ1A 2LEBA 2QA4S 3NNAA 2DISA 2K3KA 2DNYA 4FXWA 1OPIA 4IOCQ 3HI9A 3VAMA 2MMYA 1SJQA 2U2FA 3LPYA 3G71S 3TYTA 2HGNA 3L3CA 1OWXA 2N7CA 2JX2A 1WELA 2O3DA 2CPIA 1DBDA 4QPTA 2MPUA 5GVQA 2LMIA 2EK1A 2K8GA 2CQCA 3MXHP 2DK2A 2CPZA 1K73T 2DH9A 3S7RA 2KYXA 2MY8A 4W92B 1X4EA 3R1LA 1NO8A 2KG1A 1QM9A 5LSLA 1VQMS 3MDFA 3SXLA 1X4HA 2MKKA 3TO8A 1JMTA 5GMKa 2MQPA 4WFAQ 2BZ2A 2X1BA 2N3LA 3MUMP 2L9WA 1M90T 2CQ0A 1WG1A 2JRSA 3CCUS 4Y00A 2AYEA 1K9MT 3VAGA 2FHOB 1VC0A 2RS2A 2DO4A 3UE2A 1AUDA 2MQMA 3UCUP 1U1PA 1G2EA 2RRBA 4V19X 4CH0S 4IUFA 1S72S 2KM8B 2MQLA 2RVJA 3VF0B 2ZJQQ 2XNRA 2MZSA 5CYJA 2DNZA 3NNHA 3G9CA 2J0SD 2DHSA 4TU7A 2CQ2A 4BS2A 1WWHA 3P3DA 2YH0A 2CQIA 3NMRA 1D9AA 1X4FA 2DNMA 5GAHU 5DM6Q 3NS6A 2OIHA 2D9PA 1YJ9S 2DNRA 4U67Q 2JVRA 2Q79A 2I38A 1WI8A 2DNPA 4CQ1A 2EK6A 5BJRA 5IQQA 2DNOA 4TU8A 3SMZA 2EVZA 2L41A 2VOOA 2DITA 1FJCA 2GO9A 2PE8A 4IO9Q 4P6QA 3VAHA 2KVIA 1ZZFA 3U1MA 1RKJA 2RQ4A 1VQ8S 1X5OA 4M5DB 3MUTP 1H6KX 2DGXA 3FEXB 1FJ7A 1R8HA 2DGOA 3CF5Q 1SJ3P 2MQNA 1HA1A 3IRWP 2MQOA 2LA6A 2OTLS 1U6FA 5DDQC 1UFWA 1A9NB 3CMES 2WBRA 2QFJA 4FXVA 2U1AA 2MKHA 5GAGU 3CCSS 5FJ4A 2V94A 1M5OC 3CC4S 1U2FA 1CVJA 2DGWA 2DNQA 3P5TL 2DO0A 2MZJA 1H2VZ 2HGLA 1X5PA 3US5A 5CA5A 4W90B 2XNQA 2KI2A 5JVGQ 2CPJA 3MUVP 2DGSA 1X4DA 3BEGB 1VQ4S 2LQ5A 1S79A 5DDRC 1VBZA 1N88A 3D2WA 3SDEA 3PIOQ 2KN4A 4TLQA 2CQBA 5DDOC 5GAEU 1A7GE 1WEYA 2I2YA 1DHMA 2CQ1A 1N54B 1F9FA 2LKZA 2ADBA 1YI2S 3NNCA 4OZ0A 3MD1A 2KXHA 2DHXA 1Q82T 2MJNA 1QVFR 2DH7A 2VODA 1QVGR 3BO3A 2YWKA 4WF9Q 3FEYB 1SJFA 2NLWA 4EGLA 3UCGA 3P6YC 2XS7A 2OSQA 3SDEB 1U1NA 1Q86T 1M5PC 1NU4A 1VQLS 1U6BA 3G96A 1P1TA 2XSFA 4QU6A 2MGZA 2QEXS 2E5JA 3UCZP 1H2TZ 5D77A 4IOAQ 2RUGA 4CH1A 1UAWA 2FC8A 4ED5A 2MYFA 2MB0B 2LXUA 1M5VC 2GHPA 3J7YU 2M8HA 2DIUA 2ZJRQ 2MGZB 4LMZA 3MURP 2XS2A 2M88A 1BY9A 2DNNA 1VBYA 1KOOA 3B4DA 3BO4A 5H1SV 2RS8A 1VQNS 1U1OA 1Q81T 3CCQS 2FC9A 3VAKA 1VQKS 4YUDA 3G8SA 1VBXA 4WFBQ 4YB1P 3TP2A 3MOJB 4ZKAA 3H2UB 1N52B 2RRAA 1R8PA 1YTYA 3BS9A 2DNGA 4LIRA 3S8SA 2CPHA 2DNKA 4PKDB 3IWNC 2CPDA 4F25A 2KG0A 2LYVA 2KRRA 2KM8C 2MY7A 2DGVA 2MZ1A 3P49B 2KXFA 2AD9A 1NJIT 2G1DA 2MZQA 4QQBA 2CJKA 2LA4A 2DGQA 1JJ2R 2MZTA 2YKAA 2DNHA 2HVZA 1U1MA 1YJWS 2F3JA 4Z2XA 1FHTA 1WF0A 2DHAA 2MKCA 2PEHA 1X4GA 1X5SA 3I56S 1KOHA 2DIVA 2X1GA 2X1FA 3CCMS 2MHNA 1WG4A 4C4WA 4CIOA 3CCES 1FXLA 1OIAA 2N3OA 1RK8A 2MKSA 4A8XA 1VQ7S 2RU3A 2MSTA 3JB9k 3NS5A 2KRBA 2DH8A 1M5KC 1VQ6S 4WKRA 1PGZA 3S6EA 3R1HA 2CPXA 3CULA 3I55S 2G4BA 1VC5A 3CTRA 5ITHA 1YJNS 1KC8T 3J7ZT 5DDPC 3VALA 1VC6A 3G4SS 1PO6A 2OSRA 5HL7Q 2JWNA 2XS5A 2UP1A 2MXYA 1VQOS 5LXRA 1YIJS 1FNXH 1B7FA 1HL6A 1X0FA 1FT8A 1M1KT 2CQPA 2CQ4A 1SJRA 1VQ9S 1WG5A 2XB2D 2YTCA 5IFMA 2KXNB 1WHYA 5LJ3Y 3CC2S 2M7SA 1WHVA 2DB1A 2KFYA 3UD4P 1DZ5A 3VAIA 3VAJA 2E5HA 4C7QA 2X1AA 2LEAA 3CMAS 3EGZA 1URNA 2M0GB 2M8DB 2M4MA 1P27B 3BO2A 2LCWA 3HHNB 2OJ3A 1U1QA 2CPYA 2RNEA 2SXLA 1ZZNA 5DETA 1OO0B 2KHCA 2HZCA 1WTBA 2AYGA 2RQCA 1ZH5A 1KD1T 1N8RT 1U1RA 2VOPA 2DGTA 1X5TA 2G0CA 2N82B 2JVOA 2CQHA 2LXIA 3CXCR 3Q2SC 4LJMA 1H2UX 5GADU 1Q7YT 3RW6A 2MJUA 3DXBA 3EX7B 5D78A 5LSOA 3ULHA 3K0JA 2M52A 3VAFA 1YHQS 2MKIA 4QU7A 1YWXA 2DNLA 2J76E 2MQQA 4PRFA 1SJ4P 5IM0A 2FY1A 1WI6A 3CCRS 1VQPS 3UWTA 2L08A 3U1LA 5LXYA 2ADCA 1W2BR 1WEXA 3R27A 3RW7A 3THTA 4RU2A 2J8AA 2CQDA 3CUNA 1VQ5S 3ZZZA 3CCJS 2MSSA 3LQVA 3CD6S 4F02A 2E44A 3S01A 5DM7Q 1JJHA 2LECA 1WHWA
chains in the Genus database with same CATH superfamily
3PFEA 4QIVA 2G9OA 3Q24A 4C8MA 4ZPVR 2HGMA 1QJHA 4RBTA 1LW2A 1MG7A 4YS2A 1CC8A 2F9JA 2VF3A 1S77D 3ISNC 3K5PA 2B4OA 4YOEA 4U7UD 1JJ4A 2LU2A 3GPAA 3LP2B 4TU9A 3K17A 1NHKL 1CULB 2YWGA 5JVHQ 5LJ5Y 2ZJPQ 4KHRA 2E5IA 4KE5A 2UZAA 2BVZA 4MKVA 3J7Z5 1IKXB 2HMIB 1LFWA 2IRYA 3OLAA 3M2UA 1S1WA 5K8MA 2Q6CA 4C3MA 3DLLQ 1B64A 3KLFB 4NLWA 4DR5J 2HFUA 3CDEA 3DOLA 4X4SA 1HKAA 1MROA 2FVRA 4ED3A 4LFBJ 2JX2A 1ZM3A 4ED1A 1T9TA 4DL4A 2MTLA 3MXHP 5CYQA 1BQNA 1K73T 1HBNB 1XC9A 4B3OB 4DX8H 3EXYA 3ENVA 1S9GB 2ILYA 4ZPDA 4C8OA 4DPWA 1S1TA 2W2NP 2H5EA 4FYYB 3W9HA 1CJTA 3I32A 5HLFB 5IC6B 1GEHA 3DCAA 3ZTRA 3DC2A 1CJKA 2HHQA 3JSYA 2JFDA 4DSIA 4CH0S 1YZ7A 3QGGA 4K7QA 1IBMF 2VDIA 2DXFA 2XHWA 1RU2A 1T95A 3D0GE 3CGIA 3OQ2A 3P3DA 1QD1A 5E0OA 1HQ2A 4QYRA 4ECXA 2I38A 3P96A 1HNZF 2EVZA 1QAIA 2VQEJ 1UPPA 5K8OA 1XQIA 2HAIA 2R2SA 3Q8VA 4NE9C 4F4YA 3ET6A 3KLHB 2E9ZA 3ZC4A 2UXCF 4USMA 2XYPB 4FNHA 1JB0C 5ETRA 4C2MA 3GB0A 3PXGa 1J5EF 3T41A 5CCMA 4DQQA 2CRLA 3QRRA 9ATCB 1XNRF 1VBZA 4B9TA 3SDEA 3MPDA 3DFEA 2F40A 4DV6J 3ZNJ1 1WEYA 1YGYA 2PA8D 4X2BA 3MM8A 1ZAVA 3BO3A 1XMBA 3QT6A 4YY3F 2DYAA 2N7YA 1RAFB 2EBGA 5G4DA 2CWXA 5IWAF 5EX3A 4IRCA 3C15A 5ETMA 3BGRB 3WX4A 2AQ4A 5L1IA 2XMUA 3NWRA 2HNYB 4ZP8A 4DV0J 3CNQP 3EUNA 4JI6F 1QTMA 1FWPA 1BY9A 4USTA 5CZVA 4EO8A 1XERA 3KG4A 3KHRA 2DPIA 4YUDA 5K14A 3PY8A 4OZJA 1R8PA 4UUXA 3NGUA 4WTYA 2PMZD 2Y3YA 1RT3B 3FMBA 3OTCA 3EGVA 2V8HA 3I0SA 2XMJA 2CJKA 1HHSA 4B9VA 2COLA 1JLEA 3W5ZA 4DR2F 6AT1B 3DRYA 2F4VJ 4NI2A 2HBQB 1WF0A 4C11A 3D6HB 1KQFB 4B3TF 2ZE2B 3OVAA 2N3OA 4ZK7M 5KT5A 1SQEA 3LP1B 4H4MB 3JB9k 1VQ6S 5DQHA 3KK2A 4LSZB 1AFJA 2ACYA 2LEPA 5HJXA 2ALYB 2KB2A 3LGNA 3GJRB 3J7ZT 3OPKA 2FVQA 2OSRA 3M1VB 4YP3A 3N79A 5I3UB 1CS4B 4OYXA 3A8KA 3JYTB 3CMQA 2DXDA 3SCJE 1ITPA 3CC2S 4QYZK 1HWKA 3QGHA 4WP8A 3GFXA 4PG7A 3IG1A 2FZGB 1ZZNA 1O8BA 3D5MA 2OFGX 4JYAJ 3HHLA 1YK9A 5F8MA 4NLDA 2AMCB 2RILA 3AHPA 4Q7AA 2FLLA 1EETB 4OJ1A 2OPQB 1KQGB 3VHQA 3NG8A 3SZ2A 4EZ6A 5GADU 3RG6A 4OZ2A 1FXRA 3ULHA 2BJ8A 3BZQA 4C6AA 1SJ4P 1LWCA 2ASJA 4NEYA 2QX0A 5LXYA 2ADCA 1F3FA 4K59A 2J6TA 4DSEA 2NXJA 3GQCA 3S01A 5I42A 1GNKA 1WHWA 2EFOA 5AXNA 1CPZA 2Q3PA 3UD3P 4ZJLA 3UDCA 4O44A 4LQ3A 5D0HA 2E1AA 3DOKA 5C2CA 4K4UA 3OFFA 1L3KA 2B6AA 3HFKA 3I9V9 5K8PA 3CCVS 3TVZA 2D9OA 2AJQA 1FVSA 1PYTA 1ZYQA 1UTAA 1KTQA 1QE1A 2F8MA 4Y2KA 1BLUA 4HH1A 1ZPVA 3NNAA 1EKRA 1WC6A 3FDSA 3QWUA 1XIQA 1NK6A 5A2QU 1N5VA 3I31A 2IIHA 2VH7A 1U0HB 3D54A 3RB4A 3POTA 2HHHF 4WYWA 3C6UA 4QIGA 4W92B 3BDEA 2KG1A 2GX8A 4L74A 3OT9A 3IM9A 3IN5A 2BZ2A 3MUMP 2YNIA 4P7VA 1XR5A 4OYOA 1V3SA 2QL7B 1GQEA 1R31A 3ZO7A 1F1BB 3SQGB 4O3SA 1SC4B 5F3TA 4O0IA 4A8FA 3KLIB 4DPYA 2XNRA 3KK3A 3O8WA 2CVIA 3RBEA 2J9EA 1DFDA 3Q22A 1AROP 4CQ1A 2WVBA 3V81B 4S0MA 4RUBA 4LF1A 4WZQA 3FGVA 4CLWA 2GO9A 5DS7A 3MMJA 4F4KA 2KFNA 5EGYA 1T94A 2OPPB 2RQ4A 2DT9A 1NUEA 5KT2A 5D3GA 4NLVA 2ZUAA 4LF9J 4OI6A 2C3PA 3X1LB 2EI5A 3N6NA 2GQCA 4DV1J 2MKYA 2UU9J 1BC6A 2HS4A 1TKDA 1D09B 2BE2A 5D15A 1N32F 4CI0B 4C0BA 2UXDF 2RJZA 1J5OB 3MD1A 1Q82T 5M2RA 1UVNA 2P9EA 3UDEA 1QVGR 1SJFA 1CSJA 1U1NA 1NU4A 4FKYA 3CJ4A 4ID5B 2FJAB 4B3RJ 3ZFVA 2VPYB 2IMOA 3QIDA 5A0YA 3Q8QB 4OQJA 1F9EB 4IOAQ 1WUUA 1BWVA 1TUWA 1FK9B 1IKVA 3J7YU 2QA2A 4CM2A 4YDXA 2MGZB 5HROA 1BMQB 4Y34A 1OY9A 4Q0BB 1WOOA 1XNQJ 2CADA 4EFAC 4DF8A 5F8JA 1FKOB 1IKWA 1YRTA 3VAKA 4GVLA 1QAJA 5A8RB 1NCLA 2YKPA 4A46A 2PN6A 4LIRA 5E2QA 3B82A 2ZBPA 2YNGB 3C6TB 2JLFA 4ANEA 3SCKE 1IR0A 2LA4A 2YKAA 2QLWA 4LFCF 5I3PA 3QFHA 4TY9A 2RB7A 3M2VB 4ED6A 3I56S 4DHVA 2UVRA 5JXSA 1Q5YA 2HKEA 2EFPA 4Q43A 4FKXA 1T05B 4E8UA 4I69A 1RK8A 3EVWA 3NS5A 3QZ8A 3NAHA 4JV0A 3R1HA 2E1CA 1NSPA 4L6V3 4RW9B 1YJNS 2IDLA 3O3LA 3VALA 1RLDA 2ZNYA 3QFWA 4ES3A 4EMDA 1S9FA 5IFMA 3GTYX 1X9SA 4DV5J 2AHOB 1Z2ZA 1EB0A 2CZ9A 1MWYA 3R6GB 5DLFA 4KGMA 4JI2J 2JZ5A 2ZDPA 3T5HA 3BO2A 4ELTA 4RWXA 1KS2A 2HHPA 3HO1A 4B3MJ 2B8QA 1FD8A 2C3UA 5B0GA 1KWMA 2CQHA 1J27A 3ILJA 1HNWJ 1H2UX 1LNQA 2H9ZA 1VRUA 4E98A 4U96A 5T14A 1NK9A 2FY1A 2L08A 3MEDA 2HVIA 3TZWA 4DUYF 3DOMB 3ZZZA 2J9DA 1FFWB 3MECA 5SUHA 1DTQA 3OFHA 1QLNA 2L3MA 5IM0B 3M7VA 3IRXA 4C9DA 5ETVA 3PIPQ 2JEJA 1RT7A 3OL8A 4QR2A 1U6ZA 3V2UC 3GJQB 4DR7J 3CC7S 3EZ5A 3J81j 1IQTA 2AU0A 1BQMA 1S0OA 1NAQA 1GMVA 2GVDB 4WBFA 1S1UA 3OW2R 1NK5A 2FYXA 4IQMA 5EN1A 2ZZNA 2V50A 3BSCA 4O3PA 2WK4A 4A4JA 4DL0C 2CFXA 4JUZA 3AAWB 2AW0A 1WF2A 1HARA 2W9AA 1K0TA 3HXMA 2J7KA 2VU5A 1FRXA 3QBCA 4I2QB 2UUAF 1HYSB 3DLEA 2NXEA 4ILRA 5HAOA 2HZVA 3QAEA 4DS4A 1TTHB 2XWYA 4NXMJ 2PDAA 2WVCA 2QA4S 4OHWA 1S49A 1DQ8A 4M5MA 3HI9A 3PHEA 2U2FA 4MH8A 2O1PA 3T19A 2YX4A 1RSCA 1WELA 2JC0A 4ZVRB 2MPUA 1JLQA 2DK2A 2DH9A 3WIVA 1AZSA 3CWJA 4KY3A 1RTHA 4IO1A 3OTEA 4EYIB 3LA0A 3QNWB 1X4HA 3TO8A 4CYUA 3OR1A 2H48B 4ALZA 4J9VA 4PCQA 4KGXB 2RRBA 5I4MA 3TZZA 1MU2A 3I82A 2EFVA 2VG7B 3VWSA 2VUGA 2QJ3A 3QPIA 2OIHA 2DNRA 4PWDB 1TMJA 1WI8A 3TAPA 5KFPA 3CJTA 2R8JA 1WNEA 3KUEA 2IA6A 2FHJD 2MLYA 1NK0A 4Q45A 4ICLB 1H6KX 2VIHA 2JLGA 4J9KA 2HRTA 5T7LA 2DEJA 4WXOA 4Q8EA 3DYAB 4YR3A 5DDQC 1S0VA 3MCMA 1Z1ZA 1RAOA 1WKKA 2BKPA 4NOHA 4F4ZA 3KFWX 2Q43A 3W64A 4J9QA 2PSZA 3ITHA 3DRRB 5KG6A 4FNIA 2ROEA 2V8GA 1PJ7A 3D2WA 5DGBA 4KGZB 2QE5A 4DR1F 1YI2S 1X0PA 1K0VA 4CH7A 2VODA 2J0WA 2YNHB 2YWKA 4CLSA 2OSQA 1KQKA 3TNVA 2XGQA 1TUVA 1NB7A 5HANA 2Z4PA 5AXKA 1HI0P 2XLKA 3BSOA 2HIQA 5D77A 4PYAA 2XYHB 9RUBA 3PW5A 1RYRA 1SH2A 2B5JA 3I0RA 3C8YA 1REVB 3KHHA 2J6SA 2HBYB 1S7HA 4RNHA 1HNIB 5GAGI 4HHHA 3TANA 1RBAA 2RS8A 2DEIA 3CCQS 1S9EA 2NCKL 1VQKS 2C2RA 1HHQA 3TP2A 2RRAA 4DQSA 1SC6A 1I1GA 4NCAA 2IJRA 1L5UA 2HNDA 2RQKA 4IFYB 5B0AA 3AD9C 4CLFA 1NJIT 2MZQA 4X4QA 5DJBA 1YG0A 2V0NA 1YJUA 4J9OA 3AOCA 1M5SA 4I64A 4JI1J 3W2VB 1F2GA 1HR0F 3C66A 2APOA 4NLGA 5D0GA 1GXUA 1ZAWA 2K7JA 3PO5A 1H73A 3K5MA 1U0SA 2FJVA 1SJ1A 5KG1A 3GFHA 1WSRA 4RO0A 4Y65A 4MKAA 2GIQA 2JWNA 4IDKA 1VHFA 1FEHA 5KFEA 1P6TA 1YIJS 1B7FA 1HL6A 1OPZA 1CG2A 4AUKA 2BACA 1Q7LB 3FBEA 5JMNA 3EGZA 1WTFA 3BH7B 4XIUA 3MR7A 3LPEA 4GRSA 1SH3A 2NZCA 2HK3A 4DLEA 1JXVA 2V9WA 2XMTA 4Y2MA 3K0JA 3JTPA 2DRDA 2FHMA 3W2WB 4NZ6A 2MKIA 1DURA 1H3DA 4DI6A 2IM2A 3TR5A 1PJ6A 4DG1A 1RAAB 3NOGA 5KFUA 2ZH6A 4URGA 3CE8A 2CQDA 4O4RA 3IBFB 1S59A 4KFBB 5DM7Q 4OYWA 5HSPA 4LF4J 3LP2A 2QLXA 4UQTA 1CULA 3OXFA 2ZBQA 3WC0A 2HK2A 1IKXA 2HMIA 4ED4A 2XLJA 2E7WA 3THPA 2KO1A 5KAKA 3QJJA 1NKBA 2XZWA 4OV1A 1IJEB 1NDKA 2CPEA 3KLFA 5C42B 4AQYF 2JEIA 1U1LA 4ERDA 4DPXA 3CIMA 4MKBA 3PR5B 5J1PA 1RB0A 2ZH7A 3G6ES 1U1KA 3H5XA 2CQGA 1DRZA 3NAIA 2G13A 4UUWA 1RAEB 2BQ3A 1RHRB 5DG8A 2OD4A 4FXWA 4MYUA 2L9DA 2UXBF 4AT1B 1D9DA 3OLBA 3GLJA 3CD5A 3OR2A 4IFVB 4DPUA 2RU9A 4KYZA 1ZM9A 1VGYA 4K4SA 3M8RA 4RW6B 2HVHA 3GYNA 4NA3A 4CTAB 4YN3B 4EK2A 4I7FA 2ZHAA 4C98A 2EG2A 1B7YB 4ECRA 4RW8A 1RTJA 4BDPA 4FS2A 4N76A 2J7UA 3KLGB 2MQMA 1Y4ZB 2V2VA 2V4JA 4V19X 5A8KA 3VGSA 2BJEA 3NNHA 4NZ7A 4B9SA 1PKUA 4CNYA 1FJGF 4QIWD 4X65F 4ITSA 1KVIA 4KAIA 1RCXB 4L76A 4TKTA 2IMWP 1Q8KA 3RB3A 4RZRA 3NXZA 1GX5A 3FEXB 3QT7A 2G1HA 3AXMA 2F63A 3NGRA 2MQNA 1REGX 4G1QA 5BR8F 3KLEB 3RJMB 2V94A 1XR7A 1VI7A 3Q8UA 8AT1B 3P5TL 2VC1A 4QBUA 3KG1A 3HK2A 4M5LA 1CEZA 2CPJA 3ZZRA 3BKFA 3PIOQ 1A7GE 3QIPB 3OSNA 2ADBA 3R5AA 2KVQE 1ZTTA 4IR1A 4WF9Q 4PPDA 1P1TA 2BE7D 1KONA 4DV2J 1B3TA 2NPIA 3NY0A 1Q16B 2FC8A 4M1KA 2OEMA 1BWEA 3H7HB 4QWAA 2RDDA 2R8KA 1R6VA 3Q89A 4M5DA 3G8SA 4HVZA 4AXIA 4DR3F 1FE4A 2AGPA 1HNZJ 2V8DA 5GAEI 3S8SA 2LYVA 1NPKA 4WE1A 4X64F 2MDAA 1RACB 2ZE2A 1TL1A 2AKWB 3LP1A 2HLUA 2HVZA 4FYVB 2J6UA 5DRKA 1IBKJ 1S12A 1WG4A 2CJBA 3C2PA 2HBRB 1J5EJ 2CIMA 1PGZA 3S6EA 1YJ7A 1T03B 3I55S 2G4BA 1VC5A 4M8LA 2ZVSA 1XNRJ 2IYGA 1RT1B 2H65B 4Q2LA 2H3EB 3E3XA 4O23A 1FRMA 3L7PA 5KG5A 3MCSA 1NSQA 4C48A 4NX9A 4YY3J 3WHIA 1EETA 1TVRA 2F65A 2OPQA 2CZVC 4OI1A 3C46A 4FVMA 2OAUA 2Q66A 2ZH1A 2M0GB 5IWAJ 2RNEA 2RQMA 3OFEA 4X4RA 3AA9A 4A47A 1MROB 4N7TA 4FF3A 1IKYA 1Q7YT 4WFYA 2VJUA 3IBWA 2R7WA 3GFYA 3UN5A 3LP0A 4JI6J 3SQOP 2ZFHA 3JS9A 3ILIA 3MR6A 2UVUA 1Q0NA 1W2BR 3R27A 4ZCLA 3THTA 1S1TB 1ZOTA 1YZ6A 1WKJA 2MSSA 4L3KA 1CJTB 1QAYA 2E44A 2JFKA 4NEZA 5SZTA 5HQ8A 1LWFA 1TAQA 5IT0A 2Z56B 2EEYA 4JI7F 4LRAA 5J2PB 2G0IA 2N4CA 3VV2B 2QL9B 5C24A 1X7VA 4OYZA 3Q2TC 3ZZYA 3N9UC 1WF1A 2FPHX 3NWGA 4IOBA 4R5PB 4BCAA 4LR9A 4CT9A 2AGQA 1HMVB 2GW8A 4HHJA 1N48A 1UW4A 5EWFA 3GIKA 3HF5A 3TUJC 4RL1A 4USWA 1YX2A 1YBTA 3ET6B 2DNYA 1VJWA 2BJ3A 4DUZF 4P2FA 3G71S 5F3ZA 5HJYA 2OGUA 3RB0A 1FDDA 3H8YA 2PI5A 2LMIA 2FHJA 3KMQA 2VHGA 2ZM6J 4LBPA 4OL8A 2QTWA 2MY8A 4JOUA 3NS7B 2ZH4A 2GAGC 5LSLA 1KFSA 2O67A 3MZIA 3OTOJ 4OX7A 3SXLA 2A1BA 4UOCA 4CO2A 4K5SA 2DRAA 1TELA 4XPEA 1VC0A 1C4AA 4IUFA 2KM8B 3O5TB 2RVJA 3V81A 4JV1A 3C15B 5AXLA 1V9OA 2BV3A 1WWHA 4DX7A 3MEGA 2MLZA 2P6SA 3JSBA 2A2CA 1YVFA 2JVRA 3D68A 3MMBB 2DCLA 3SMZA 2YWEA 3HFZB 3L7UA 4ZVPB 3AJDA 4DL2A 4FPIA 2J5AA 4A8KA 1ZZFA 1AYEA 2MHEA 5A8WA 2HVEA 3N0VA 1WC0A 3ZNUA 2HQCA 1Z4UA 1RLCL 3CCSS 5F9LA 1J5OA 4QW8A 3D1QA 2DO0A 2R7TA 2KT3A 1JLEB 2HWIA 4C11B 1IR1A 3HZGA 1S6PA 2F8EX 3DMJB 5EUHA 3K57A 2YPYA 1UL3A 1DHMA 4ID5A 4USJC 4M5JA 5BXIA 2YPZA 2HHHJ 3KK2B 2IY5B 1FK9A 5KFYA 4KH0B 1U6BA 2VG5A 3PKMA 2MGZA 4DBQA 4ZPAA 1T8EA 1TL5A 3UCZP 4Q0BA 4LBIA 3HFVA 4FP9A 4IG0B 5HMXA 4DCOB 2RUGA 3P4UB 2WRMA 3MPVA 4KJIA 5A8RA 1FERA 3IG1B 4X4UA 5IS2A 2OI2A 4CO1A 3HHLB 5ETKA 5A6PA 1DY3A 4CCHA 2PEBA 1UVIA 2YNGA 1NJZA 1ZM2A 2MLXA 4DQPA 2XMKA 4GKKF 2VBXA 1HBMA 3J7A1 3DGPB 2DNGA 1LWCB 1UFKA 5L8RC 4MIBA 3IWNC 2N4DA 2DGVA 2BXJA 1UJ5A 2XO6A 3T9NA 5EDWA 4G1PA 1XBWA 2UV8G 4RW9A 4YB6A 3G82A 1RADB 3MWBA 2QLJB 1M5KC 1NZAA 2HAFA 2FJEB 4O44B 5E33A 4J9MA 2YVSA 2B9EA 1N32J 2UVWA 3TJ9A 1J2VA 3KDOA 5LXRA 3D4JA 3DI6A 4JI5F 2KXNB 5IT4A 7FDRA 4PZVA 1DZ5A 1NSKL 1YJRA 1T11A 5LMUF 1QE1B 2VA3A 3CJ3A 1VBKA 4KSEB 3UVJB 4BC9A 2WW8A 4ZP9A 2IVFB 2N82B 2R7SA 4U8VA 2V63A 3J80Y 2HFZA 3DGVA 2P5VA 3RW6A 3MF5A 3GP9A 1FRJA 1S1XA 5IM0A 1WI6A 3IWXA 3M2RA 4CO4A 3I9ZA 4F7VA 3GCWP 4LF6F 4OMFG 5JUMA 3RGIA 1JLAB 4U8YA 3O6QA 4KGVB 2ZD1B 2K1RA 3ZTSA 3A8EA 4PR6A 3MAQA 2DY1A 3R5BA 3J81Y 2JSXA 3W66A 1K8AT 3MFIA 4X4TA 3BKTA 3KK3B 4MIAA 3OL9A 4AE5A 3ILLA 1XMOF 1HYSA 3IC1A 2OMOA 4ZJQA 4DEZA 3CEDA 1KQSR 5IXUA 3FSIA 3UR0A 2IM1A 1KVKA 2M9KA 1NRKA 1U7LA 1X4AA 5D3GB 1H72C 4B9UA 1NK4A 2DISA 3TZXA 1Q53A 3RBZA 3Q8RB 3NCRA 2B7BB 3ISZA 4DDFA 3TQ1A 4ZPTR 1OWXA 2V6AA 5KG3A 3QGIA 4USVA 5GVQA 5J2NB 3FCVA 4DCPB 4DQRA 4KQZA 4PG5A 4J9PA 5FLXY 4OYPA 3JTNA 3R1LA 3RTVA 4OHXA 2LQBA 4HYKA 1NH7A 2XCPA 3H20A 2F4FA 4B3SF 4UOGA 2OUGA 4JI0J 4F67A 4L3NA 2PFDA 4HR2A 4Q5VA 2CVEA 1T9WA 4TQSA 2VG7A 3ONQA 3CJ8A 1K9MT 4JB8B 2FHOB 5C2GA 1JLFA 2RS2A 2CKWA 1AUDA 2BRKA 5BYQA 4PWDA 4QZVB 2B4UA 1R3NA 3T5LA 5A0YB 4PABA 4K2XA 4OYAA 4EEYA 2DNMA 4ICLA 2PC6A 3PRBA 3T1YF 5HROB 2DNOA 2ZEJA 1C0TB 2YKQA 2L41A 3EE3A 4M94A 1XTZA 4ATNA 4CLLA 1N34F 1F0XA 3RZAA 1IKWB 3T5KA 2DGXA 1LW0B 3MTJA 3W60A 1HA1A 1PAEX 1VDHA 3DRRA 4OFZA 4ED0A 1N5TA 3CMES 2WBRA 3DRSB 2UUAJ 2JH3A 2NQPA 2Z0GA 3LOUA 4HL9A 4X4NA 2Q6BA 2XNQA 2D3UA 2VJVA 1ELOA 3BQ1A 3T6BA 2IYIA 1NBEB 3R5CA 3NNCA 2NUHA 2LDYA 3F41A 3DLBA 4CRJA 2O66A 2Z58B 3Q8SB 3K58A 2DR5A 1R7IA 3E01B 2Z30B 3ETMA 1R27B 3FEZA 3G96A 2I8EA 5B0FA 4QU6A 1REVA 3OHBA 1RBOB 1Q1KA 2VV5A 3MOZA 4WPAA 1HNIA 4H54A 2OPRA 4O3RA 2HEKA 2V2KA 4LF2A 4ZPBA 1OMSA 5FDLA 2WB1D 2HFVA 5J2MB 3KMSA 4O3OA 2OPSA 2BJ1A 2W4CA 4URSA 3MMAA 2DNNA 3KNAA 2VFVA 2ZVIA 3ZTOA 1UWBB 4YB7A 1NPRA 4IRKA 1MN9A 2QFIA 1AXQA 3MAHA 1H38A 2JEGA 5B0CA 1PC4A 3NCQA 1YTYA 1BE4A 1TK0A 1WD6A 3DN9A 1DJ0A 4C3KA 2JLEA 2MZ1A 3MEDB 3GJTB 4IH7A 4ZLJA 1NMEB 3V6DA 3MECB 1DTQB 3SI8A 4XAKA 3IRXB 4B08A 1ZA2B 1RT7B 2GIRA 3UPFA 2LLZA 3LTOA 2MKSA 4H4KC 3EGWB 2IHR1 1D1UA 2CDRB 3SEOA 1ZAXA 1S0NA 1Y5LB 4P10A 4QWDA 5IT9Y 1S1UB 1EJ7L 2FB0A 5DDPC 4YQWA 4HACB 3SFUA 1T0TV 2RH3A 4DR1J 1DTTB 2HQ3A 4ECWA 3PYFA 2DB1A 1X8DA 3DLEB 3IWLA 2E5HA 4K50A 1U1QA 3W2WA 3MR2A 2BEFA 3GFZA 2AZ3A 1N0UA 3HJVA 3MGJA 4CO3A 5KFQA 2VOPA 1OJ4A 2HLTA 5HVGA 1IJFB 3Q2SC 2ZBRA 4CNZA 2B9WA 1S1VB 4URQU 3FCHA 3TUIC 4K0KF 3MM5B 4WK3A 2M52A 1JLQB 3DHXA 3GCXP 4KFBA 2W9BB 2ZBIA 2CJAA 4OI2A 1RISA 1RTHB 2YWWA 5KG2A 5F8HA 4O4GB 3RW7A 3EJMA 3CCJS 1XK8A 4F2RA 1LK7A 4CYUB 5HI7A 2C2OB 4UY8T 1YQHA 3ZZUA 3D6TB 1UCNA 4KO0A 5J1EA 3OHAA 1LKZA 5C42A 3JQMA 1W25A 2AJFE 1FRKA 4RUCA 2C22A 1VYAA 1RABB 2DY9A 5ETTA 1HR0J 3FQLA 3HD1A 2GMLA 2Y1JA 2WHOA 3UN3A 1TL4A 4G3IA 3ISND 2NSCA 3KYLA 1GK8A 5DO2A 3KJFB 3GMGA 3V4MA 3CCLS 3U02A 2GGPB 4FYDA 4PPZA 2BM0A 3EGNA 1U45A 4YMEA 4QW9A 4RW6A 3DLKB 1WOSA 3M8PA 3ENWA 5HBMA 2IBKA 4CP5A 2KYXA 2R7OA 1X4EA 2ZWOA 1NO8A 5D4NA 4ZLLA 2C2ZB 3MMCA 2XULA 1PYOB 1IUJA 1M90T 2CQ0A 2V67A 4USUA 2AT1B 2PA3A 2XYGB 2V4RA 4KIAA 4HH0A 2OFHX 5CH7B 1UFLA 3CJKA 4RUHA 2KZZA 3JAMU 3A3PB 1G3OA 3SCIE 2K06A 1IBLF 5KFHA 4E0DA 4QYZJ 1CJVA 1VQYA 3I0RB 4ZITA 4LVNP 2RHQB 1RT6B 1MN7A 1RTIB 2VOOA 4JV5J 4KKOA 3AOBA 3KLEA 3FCWA 2ZH8A 2WONB 2IA0A 1S9EB 1RKJA 1X5OA 3I5AA 4LIWA 5HMWA 4ZVGA 2GS8A 4AQYJ 2MQOA 1L3UA 4UT4A 2BR0A 5KFCA 2AJ2A 4FBTA 3NGKA 1YBAA 4AFFA 3CD0A 3KUHA 5KFOA 3E8OA 1H2VZ 3US5A 4ECQA 2XI2A 2DCUB 1KN6A 4ECZA 2ILZA 2LQ5A 2EKNA 5EWGA 2CQBA 3CJSA 1SL2A 2UXBJ 1U49A 3Q0AA 4N8OA 2MJNA 2FLOA 1LEOA 1RZMA 3P8BB 1LV5A 4XTTA 3M30A 2QEXS 2E5JA 1FDBA 2D74B 2B56A 4ANDA 3BBBA 4CH1A 2XSJB 2LXUA 2RDIA 4HLBA 3UQSA 1N4LA 3W65A 1FI4A 3D3CJ 1Q8LA 4PXEA 1KOOA 3GJSB 1OSCA 2ROGA 5E7OB 1FJGJ 4X65J 4ED2A 1JK9B 1HI1A 3LUYA 1FD2A 2BA9A 3B6BA 2CPHA 3R9LA 4ZHRA 4TYBA 4DG1B 4X4VA 4DV7F 2AD9A 3LH2S 3K89A 1JJ2R 2MZTA 4USHA 3MAAB 1FHTA 2PEHA 1T03A 1X5SA 4USKA 3CCMS 1R0AB 1RT1A 2A6OA 2KRBA 4EO6A 3SFGA 4KB7A 3J7YI 3FUYA 2CPXA 4HDHA 4ZOSA 2W2OP 3MPYA 1ZM4A 1U2RA 1P8GA 2XS5A 4DR4F 1CBKA 2BW7A 3RR7A 1N33F 1F2HA 2VKZG 3VVUA 4NLPA 3G6VA 3D0HE 5LJ3Y 1TZ0A 2KFYA 4KR0B 3VR1A 4L75A 5CCLA 4PYDA 3W63A 2KZMA 5E3PA 2YBVA 2HQFA 1WTBA 2GVZA 1KD1T 2D69A 1SIZA 3HDSA 3PW0A 4I2PA 1X5TA 3N5BA 1TFYA 1TP7A 2H4YB 2XMMA 1N36F 4LJMA 1NJXA 4DN9A 4J90A 1GXLA 3OR2B 3KK1A 2Z57B 4RNNA 3FFIB 1S6QA 2RF2B 1QY7A 3F0NA 1YWXA 1S48A 3GR1A 3PDNA 1VQPS 4DLGA 2DJWA 4K8RA 2R3VA 2FZCB 4UTGA 5J2PA 4CZCA 1S76D 4GVBA 4I7FB 1UVJA 4RX6A 2RHSB 4RW8B 4DSKA 1RTJB 1N6QB 1X60A 4DPOA 2JHEA 1RAGB 1W26A 2V4JB 1N0VC 2M2BA 2R7UA 1TR0A 4R5PA 5A8KB 4DPTA 1KBRA 3MR3A 4J5OA 2VFUA 4LBHA 3H2LA 2CXEA 2F5GA 2ZBCA 1HMVA 2CPFA 3QT8A 3RAXA 1U8SA 3TAMA 1RU1A 3PR4A 4DN0A 3SSSA 2KH9A 5C5JA 1QDUB 4NLOA 2MZRA 2VDHA 1YITS 5F9NA 4OIXA 2IPOB 2NZ4A 4D3HA 3B54A 4OZ3A 4G1QB 1TQLA 4C8ZA 1SJQA 2KTQA 3GG0A 5B0DA 3PM9A 4EI2A 4CLPA 2ZH9A 2W4PA 2LDIA 4UZBA 1XJWB 2W1BA 2HRUA 1VQSA 1BGXT 2I0XA 3N6MA 4P7TA 4C97A 3HCXA 2N3LA 5DZ6A 1V3ZA 2JRSA 3VAGA 3D7SB 4P2MA 2QRRA 1LWXA 2IBOA 3MMBA 2ZJQQ 2MZSA 2DNZA 3TQEA 4YHHF 5HK4A 4WXWA 1RA7A 3QJPA 1PAUB 4Z7YA 3JAMY 4U67Q 5D0RA 5IQQA 3LO3A 1XMQJ 3M32B 3MPUB 1RXOB 4KC5A 5E5NA 4M5DB 1GH8A 2OLWA 4ZS6A 1A6LA 4EBCA 3WQPA 2DR9A 1A9NB 1O51A 3DMJA 4P2SA 2VA2A 1M5OC 3CC4S 1U2FA 4WE1B 1TL1B 3RR8A 5B0EA 1RBLA 3H5UA 5DQIA 2DGSA 2EWHA 2F7VA 2P9GA 3PHTA 4X62F 4DUZJ 2UUTA 2QSFA 1YRUA 1C0UB 3L7OA 2F8HA 2B4VA 4J37A 2RKIA 2PMHA 5D4LA 4X66F 1WSVA 2DH7A 4IG0A 1N56A 3BH6B 3PCOB 2B8PA 1I6JA 4PG6A 3PFOA 2IDEA 4B3RF 2E5LF 2EXUA 4RPFA 4RLEA 2EC2A 4PWWA 3KTQA 1H2TZ 2W2MP 5LT5A 1BHNA 1ZPWX 3PO4A 1TVRB 1VRTA 3ZZPA 1LWEA 3TVYA 3WIUA 1VK3A 2XS2A 3DGPA 4ZVSB 3OJSA 2GO8A 2I9SA 1HWJA 4XPCA 1IKYB 2FC9A 1N5YB 3CIZA 3A8IA 3H2UB 5KT4A 3LP0B 1PBAA 2RAQA 4HDGA 1HWUA 2KRRA 4B9NA 2KXFA 2V69A 1PJ5A 5CD4A 4QQBA 1JWWA 1AFIA 1RWOB 2BUNA 1SBRA 1LWFB 2IAJA 1I94F 2MHNA 3RRGA 1NHVA 3IS9A 3RU0A 3C16B 3W8GA 5AE1A 5C24B 2DVIA 3DRPB 2B9XA 1PIEA 5KG4A 5IV4A 3NGDA 2UP1A 4BBYA 1NZ8A 1FRIA 3TX0A 2R2RA 3UVJA 1VFJA 2AX0A 2GQ2A 3OXLA 4DV5F 5KFAA 3QQCD 3VAIA 2X1AA 5HQMA 2DD8S 4JI2F 1S99A 4R8UA 4OV6A 4OX9J 1HQUB 1WORA 1CLFA 4RW4B 4OYIA 5DETA 2VBYA 4MYTA 2E1MC 3PNIA 2HHSA 1MLAA 2FD2A 4KPYA 4HT5A 1JLAA 2HFOA 3PVXA 5E3AA 1U02A 2J76E 2FVSA 2ZD1A 1NNDA 3HD2A 1NXIA 4O0NA 2AV5A 1UZHA 2JOQA 2AP6A 3BR9A 4ETZA 1OQ6A 3SSRA 4GKKJ 3TUPA 2LECA 4PXBA 3GIIA 4HI1A 4MMOA 4NLYA 2GMJA 5ETNA 1G7CB 4QR0A 4DR7F 1E6VA 4LREA 3NBPB 3I87A 2MEWA 2IFXA 2HZAA 1VIOA 1HBOB 2EG1A 5IQ6A 2DGUA 3MEGB 2QL5B 2W25A 3QYYA 4XDCA 1T9YA 1TK8A 2KYZA 3MI7X 3F44A 2R7RA 4P71A 2QG9B 4RU9A 5HO4A 1U4BA 1UJ6A 5A8WB 2XBPA 3MEEB 5K9FA 3OVSA 1FO1A 2GMHA 1F6TA 2LXFA 1TK5A 5J2NA 5KFMA 3UI3A 3JQJA 4BHQA 4JI5J 3T3FA 4IOCQ 2VPXB 3HLUA 1K1SA 5LMUJ 2WW4A 1DBDA 3R2DJ 1KHWA 4CLYA 2YKMB 2BJDA 1S6PB 3OL7A 1SUQA 3KKFA 4JBCA 1MMNA 2AJ1A 3K8VA 3D1OA 2X1BA 1PYSB 3T1HF 2ASDA 3H98A 2BMBA 3TZYA 2HNZB 3CCUS 3DNCA 4U9RA 1FX4A 2XO7A 1U1PA 4LF7F 4G6VB 3I4PA 4DSJA 2VG5B 5CYJA 2R8HA 1C0TA 3G9CA 5HVHA 2CQ2A 2AEJA 2ZOMA 1UZDA 2G2OA 1Q8BA 3OSPA 3IP0A 5F8IA 3NRBA 3A1YG 1LW0A 3PKYA 2W8KA 4I6WA 4TU8A 3GIRA 3BQ2A 3LAMA 4NLTA 3K59A 4IO9Q 1RWNB 2E1PA 2HQGA 2ALZA 2O01C 3DRSA 1XMOJ 1VQ8S 1GXTA 2LQ8A 1QUPA 1R6YA 2DGOA 3DU5A 1HBMB 2LA6A 2G2ZA 2OKQA 1DQ9A 4I1TA 4ZIWA 4ILMA 5A76A 4HEA9 3VVTA 2K7KA 3KJNB 1RA6A 3UDVA 5H9FK 2E7VA 3W5XA 3GYXB 3BEGB 3K5LA 2GA7A 3DKDA 3E01A 4DWIA 3G82B 2BM1A 2C42A 4JI4J 3SV3A 2CJQA 2B3TB 4N8NA 4ETXA 4DR6F 2QMWA 1KHVA 3RBXA 3ZZ0A 5J2MA 2Y1IA 1IXKA 2YWFA 1C1BA 5KTQA 1EAYC 4B3SJ 2BYCA 2H4WB 2CNOB 3M8YA 3DI6B 3UNYA 2CDQA 4ID8A 4RBUA 3PYDA 2GJIA 1OSDA 1UWBA 5IZHA 5KFFA 1JIHA 4OLPA 4LMZA 4IKAA 3MURP 3IM8A 3C3LA 2KKHA 1HWLA 3DM2B 4DUTA 4CLTA 1S7IA 1B0TA 3Q8YA 2E29A 4BWMA 4YB1P 3T1YJ 3MOJB 2HQIA 3V4IA 1S1XB 3EYZA 2ZOFA 2HHTA 2CAJA 2VQFJ 4L72B 4F25A 3M2RB 1N34J 4CWBA 2KM8C 2E7XA 4WP3A 1RKIA 1S57A 4M5GA 2NREA 1V6HA 4I6YA 2DHAA 2K1RB 2DR8A 1WC3A 2X1GA 4ZVFA 4HACA 4C4WA 4CIOA 1OIAA 3N4WA 1H0HB 2WBMA 1DTTA 3VGUA 3WZ0A 1P9YA 2ACMA 1VISA 2XQCA 1F9HA 5ITHA 4IYQA 4TYAA 1SH0A 1VC6A 3D3BJ 4R0EA 3F56A 2MXYA 2RUSA 1FNXH 4P9SA 3VGTA 1NK8A 2M7SA 4F50A 1H7WA 1ULRA 4YEAA 1RHUB 2QZ8A 1KNZA 1S1VA 5A2QY 1FNMA 3MM5A 2SXLA 2W9BA 4X4OA 2W7OA 4EZ9A 2IM3A 1U1RA 4K2JA 2ROPA 2A18A 3CXCR 2LXIA 4O4GA 2IC3A 2VASA 3TA2A 3AQOA 5D78A 1SCJB 3W9JA 3BREA 3GZ7A 4Y2IA 1YHQS 3TARA 4PRFA 4C3LA 2QMXA 1U2CA 4NL5A 3KDNA 3CD7A 4GC7A 4ZCIA 1VQ5S 5M2PA 1GFWB 1URRA 1RWKB 4IH5A 2KT2A 4RJVA 3LAKA 1FWLA 2OEKA 1FRLA 2QGFB 1JLFB 4I67A 3ILOA 4K5RA 3G8TA 1WEZA 3HHLC 4AD6A 2OP5A 1NK7A 2HHVA 5EX0A 3L9ZA 4C8YA 1DQAA 2I5JA 2R7QA 2YWHA 2B43A 2VPWB 1GTHA 2GGPA 3A3NB 4OZLA 1FDAA 2JL9A 2X3DA 3O2IA 3DLGA 2BOPA 2GJFA 2YXLA 3HT3A 3B4MA 4J91A 2DRBA 4F26A 1RTDA 3QLHB 2Z2LA 3DLKA 4DQIA 1WJ9A 2LP4A 4OJ3A 1S6OA 4ELUA 3IO1A 2X3GA 3L3CA 2CPIA 1H7XA 3EZUA 1JQGA 2B7CB 2UUCF 2UUBJ 4XK8C 4UOHA 2Z2MA 1Y0HA 4CT8A 3R8YA 3S7RA 2QIFA 3P5BP 4ENOA 3I5CA 1B0VA 3Q83A 1QM9A 2H5IB 2XLIA 4FS1A 2HWHA 4ELVA 5GMKa 2XMVA 2L9WA 5KOWA 3GE9A 3D28A 5B7WA 3UCUP 1BQXA 1G2EA 1Y3JA 4EUVA 5KG7A 4LVOP 1RT6A 4I68A 3VF0B 4F0MA 1RTIA 3I5BA 2X7IA 4XO0A 2OPRB 2J0SD 1A0OB 2DHSA 2HFSA 1MWQA 3R2CJ 5FDLB 2WONA 2KFZA 4F0HA 1D8YA 2PD1A 2OPSB 3TVKA 4N5SA 2V2ZA 2EK6A 5BJRA 3CDAA 1F5BA 3MMAB 4LR7A 2YNFB 1U25A 3BPDA 1NB2A 2AX1A 3HSDA 1UJ4A 4A8MP 2MKHA 3IAM9 4O3NA 4M95A 3V6JA 3V6DB 1I5OB 3FZ2A 5D4PA 4DX6A 2WVDA 3HX9A 1HHTP 2KI2A 3BQ0A 1X4DA 4ECSA 2ZH3A 4HKQA 1TKZA 4TLQA 1FCAA 5U47A 3DDIA 3NP5A 2CQ1A 5CABA 4YR0A 2GCFA 4F3MA 4NLXA 2XSJA 4CO0A 2NLWA 1FDNA 3ENAA 1M5PC 5HMYA 4DV2F 3AJ1A 1AT1B 4LQ9A 3MM7A 2KJWA 5ADZA 4F0KA 3QSIA 2FJWA 1TL7A 2FHKA 4ZCMA 4MK7A 4ED5A 1U47A 5KFTA 2D3ZA 1HW9A 3CT9A 3M9MB 4KHPF 1SV5A 2AF6A 3PX0A 4H4OB 2YX7A 4YR2A 4ZN1A 4FF1A 3W8PA 4OLOA 1U1OA 1IBLJ 1RT2A 5HMZA 5C25A 2ASYA 2OO4A 1N52B 4M5HA 3VZIA 3MAAA 2I6WA 5CAAA 4IH6A 1Q78A 5EHHA 1M0SA 1R0AA 2GAHC 2QT7A 3PEJA 2ZZMA 5DLGA 3RB6A 2UUWA 1SB6A 2PI4A 2GHWA 3UDLA 3BV8A 4MJKA 4NPOA 2V4QA 3KJVA 1IBKF 5GMEA 4TQRA 4KO0B 5J1EB 3ZXWA 2WZ1A 3NKYA 3TRGA 3CO0P 2YKNB 2ZH2A 1IN0A 3CDUA 3A13A 1ICEB 1Q5VA 5HL7Q 2AWZA 1R0BG 3T1AA 2H54B 4GO7X 1VQOS 2DXEA 2BBEA 3H0PA 3JXOA 4N41A 4DMZA 3VAJA 3MM6A 2LQ9A 4FYXB 1JLBB 4ZCKA 4B9LA 1EQMA 3FFIA 1DAXA 2B4PA 2RF2A 1SC1B 3SSQA 4P75A 4EBDA 2QA1A 4LF8F 4CO5A 4U95A 2L48A 3LWLA 3M8PB 4OI0A 3DXBA 4N47A 4DX5A 3TJAA 4OX6A 5HBMB 3X3UA 3M8QB 4ECUA 4ZLNA 4Q8FA 3M6XA 2AEFA 1VCTA 2P8IA 4JI8F 1N6QA 3BGFA 3C19A 3CCRS 2IVYA 3SCLE 4K4XA 4W98A 3UWTA 3GILA 2HRYA 2JNJA 2VFSA 3D66A 2A6MA 3MMCB 2RMLA 3L09A 4DV7J 2DHGA 4IG3A 4GC6A 4KTQA 5ETSA 3CPWR 4DOZA 1JLGA 2W8LA 2AIRB 3LW5C 4WU2A 3CJKB 1VR6A 1FJEB 1TKTA 3R5DA 5ETOA 1CJVB 4D3GA 3Q8PB 2YH1A 3PYEA 2AYMA 3RRKA 3RBDA 2QN6B 3SYZA 4KKOB 1HPZA 1D8ZA 2ERRA 3I4HX 4DR4J 1E6YB 3PEHA 4CM0A 2R4FA 1N33J 4M5NA 4RNMA 1S10A 1JLCB 3VAMA 3D6MB 4TLRA 4QPTA 2WSEC 3R5JB 4M63A 1PSDA 5GAHI 2R42A 2ZM6F 2Y8WA 3EPIA 1SQFA 2W24A 1N36J 3OTOF 3MDFA 2MQPA 2E9RX 4WFAQ 2FLNA 2BQRA 2J7WA 3BPSP 4Y00A 3HULA 4RWWA 3EVOA 3M30B 4LSLA 1IBMJ 1RJJA 3M32A 4AL6A 2VG6B 2Z2ZA 4NXNF 4TU7A 4BS2A 1TL3B 1C4CA 4HHUA 1YJ9S 1RAJA 3FC9A 4ECVA 2Q79A 2DNPA 5DQGA 4UF4A 1FWKA 4OJHA 2K3IA 3EZOA 4LF5F 4WFXA 1RWPB 3VAHA 2GHVC 1KLMB 4WWSA 3N6LA 1RYSA 3PJ9A 1TU0B 1FJ7A 2R2UA 3C14B 3CF5Q 4NA2A 3FMWA 4ZHRB 3BSAA 4RR5A 2UXCJ 3AA8A 3D9BA 5FJ4A 1C0UA 2XZTB 5KFWA 1V5IB 1CVJA 4W90B 3AODA 3QAUA 1VQ4S 5L1KA 3O1LA 5DDRC 3HJFA 2XWXA 2H5JB 2GNKA 3PW2A 3EM1A 3TWZA 4EYHB 4KV8B 3FBCA 1RHJB 1RTZA 1YSJA 4DS5A 1B0PA 2W7AA 4QIEA 3HHDA 1TUGB 3H4DA 2MB0B 4BC7A 1TKXA 3AH6A 2ABYA 2DIUA 1N5YA 3PX4A 4A8SA 2UV8A 2E66A 1RT4B 2GVZB 3BO4A 1U09A 1LK5A 4YHHJ 4I2PB 2FGCA 1KDNA 3NEKA 2OELA 1EIYB 4TVAB 3KK1B 4OHYA 1SKWA 1S6QB 2KG0A 3IMQJ 1SI9A 2G1DA 2DR7A 2I1RA 2XHCA 3DXSX 4DV4F 3ZZOA 4GVBB 4WJBA 4LT6A 4DR2J 3C16A 5LMNF 2MKCA 3DRPA 3HZEA 1SL0A 3EVMA 2X1FA 4B3TJ 1NM2A 3K8WA 3CCES 4ZLPA 3H5SA 1FXLA 2RU3A 1K47A 4P2XA 3IXQA 1MMDA 1UEKA 2BX6A 2MQ8A 4GO5X 4X62J 1X9MA 3TAMB 1PO6A 3T9ZA 1HQUA 5KFVA 3HVTA 4MFBB 2BANA 2CQPA 4RW4A 1VQ9S 3BBCA 4X66J 1VLOA 1WHYA 2KL8A 4I56A 1KFDA 2W9CB 3OTBA 2LEAA 5HVFA 3QGPA 2OHDA 1URNA 4J9NA 3PG9A 1ZBTA 2E5LJ 3N28A 3AOAA 1KVJA 2RQCA 1NDCA 5KFNA 5DG7A 2DGTA 1Z2LA 1PG5B 1HQEA 2HSEB 3M8SA 3FSYA 3A12A 2ZHBA 5ETLA 3EX7B 3CW2C 4F3QA 1FNOA 2NYHA 1K44A 2QYCA 2YQ0A 2DNLA 2MQQA 1FKAF 4K4VA 1OYEA 4NMXA 5KFKA 4PAAA 3U1NA 3FNNA 3HVRA 1HLWA 5L38A 1F5AA 3OD2A 3NBPA 3OUYA 1HBOA 4C0OC 2F9DA 4YDDB 1D9FA 3I6PA 2IRUA 1SXLA 2CWKA 4DV3F 3PJXA 4CLZA 1HNVA 1UP1A 1UMJA 2GJ2A 2KU7A 5RUBA 3CCTA 1NPPA 1YDLA 1HD1A 1OS5A 3W5YA 2WOMB 1DLOA 2WCXA 1EHWA 4NZ0A 1I94J 3RAQA 4Y0FA 3MEEA 4DFMA 4ZPCA 1FESA 3UR3C 3TEHB 4ZVUB 2B0GA 4ZVTB 2P6TA 3ZTQA 4IR9A 3Q23A 5CYMB 2AYBA 4ES1A 2ZZTA 2A3JA 2YKMA 4F4WA 4NYZA 2C2EA 4ECTA 1OPIA 5M2UA 4C8NA 5K8NA 3LPYA 1EX8A 4NYPA 1OQ3A 1AUSL 4GKJF 4QJVA 2EK1A 2K8GA 2CPZA 4I6AA 2HNZA 3GWCA 5AT1B 4I0WA 8RUCA 1NH8A 3QZ7A 2RKIB 4JI0F 2NS1B 1JMTA 1FKPA 3W61A 1SL1A 3OBIA 1RE1B 1L3SA 3BB5A 2DO4A 1SKSA 2IJNA 3CJ0A 2NYIA 3HHEA 1S72S 2QLBB 2FJBB 3G87A 2WSCC 2YH0A 1GMWD 2JDJA 2CQIA 1X4FA 1G6BA 2EFGA 3KWMA 1VRTB 1LWEB 1CC7A 4ZVQB 1EP4A 1WACA 4TY8B 3QRPA 1FJCA 2PE8A 2DKOB 4P6QA 3DDNA 3BKUA 1R43A 4LSNA 3VZHA 1T02A 2HHXA 5KFZA 5EWEA 1JKHB 4QWCA 5J2QA 1FTRA 4FXVA 1RT5A 4Y28C 5KFRA 4DZDA 3PX6A 2DTJA 1T9UA 1X5PA 5CA5A 5FIIA 1S5ZA 5B08A 3PYGA 5AXMA 2IAJB 4HTIA 2GV1A 5HQLA 5C7PA 2KN4A 3TAQA 2UXDJ 2XY7A 2C2MB 4YB5A 4IQXA 1ZTWA 2LKZA 1P9QC 5L46A 3IS9B 1T9VA 3UCGA 2VPZB 1EKSA 1Q86T 4TXSA 5THWA 4JI3F 4HI2A 1T9XA 1R8BA 3DM2A 4DJBA 3T1HJ 1UAWA 4PXCA 3AY0A 3TA0A 4LF7J 4R8UB 5HP1A 1IWGA 4P73A 2W4DA 1S97A 3RUBL 3OVBA 1SPBP 3OTDA 1VQNS 1T3NA 2HVDA 1O6XA 4ZIVA 3H90A 1IM6A 3GV7B 1ACMB 2GFFA 3JSRA 2BRLA 3R3TA 4PKDB 3QRQA 1R89A 3PRVA 5H9EJ 5DZ7A 3FBBA 2QA4G 4AXJA 3AQPA 1YJWS 2F3JA 4LFCJ 4Z2XA 4ANCA 2M3DA 1NDPA 3ADAC 4Q44A 2VB6A 1KOHA 3OV7A 4BWJA 2FTRA 1E6VB 1VQ7S 2D41A 3PACA 2XI3A 3Q86A 3MM9A 3CULA 1KC8T 1X9WA 1FF2A 2VBWA 3LGHA 3FVYA 4DR6J 4DL3A 4CLKA 1M1KT 4USIA 2CQ4A 5HATA 2YTCA 1Y3KA 2L9NA 1RWXB 1WC5A 3L4BC 4X84A 3CMAS 3M05A 1IR2A 2QC3A 1U48A 2V34A 3J7AN 2M8DB 2RDJA 4K4YA 4PWUA 4F8RA 4DU8A 3M6VA 2HZCA 4MKYA 1N8RT 5A6WA 2G0CA 2HBZB 1KP6A 5F8LA 2JVOA 1RCOB 3G6YA 3KUGA 3LWMA 2EFQA 2NXNA 5CHCB 2DHHA 4LRBA 1TV6A 3ZZTA 1SUQB 3FKBA 2J8AA 5B0BA 3JSMA 4DUYJ 1RP5A 4UY85 3QO9B 3RAMA 2Y1RI 2HW3A 3NMAA 5GMDA 1FTCA 4DL7A 2OTJS 1IBCB 2D3OR 4NASA 2RRNA 1FFGB 4NWBA 2W2QP 4WIIA 1RWVB 3DRXA 3BM7A 5KFSA 1RDRA 1UVKA 1YLXA 3QLHA 2KDOA 1JNZB 2EW9A 2PFFB 1HW8A 4LFAF 3EICA 3CSKA 1Q95G 1IM4A 4OYBA 4Z37A 3EWGA 1NSAA 2KHDA 2FGOA 1O0PA 4U6PA 3BN7A 3GIJA 1UEUA 3B8HA 2BW2A 1XN9A 5L39A 4WIQA 1EARA 4OZ1A 1KSPA 1JJCB 4IRDA 5AJ3F 4RW7A 1C1CB 4N77A 2N7CA 4B02A 1YRXA 4FDFA 3R6LB 2FY8A 1KR4A 4OX8A 3CVKA 2CQCA 2LVWA 1XWLA 4NLQA 3IA0A 4ED8A 4C8KA 3K7RA 1HBUB 1SKUB 2XZDB 1U8WA 2MKKA 2NSBA 3MCNA 1RWUA 2DPJA 2PT0A 5L1JA 4Z7CA 2V5HG 3TJ8A 3UE2A 1G1XA 3R7BB 1C1BB 4JP8A 2YNFA 1GMUA 1HNXF 2RSQA 1JXLA 4F4XA 4PUOB 3OJUA 2J0XA 1D9AA 3MEKA 3P45B 2D9PA 1FA0A 2XTJP 3JQKA 1FFSB 1OY8A 2ZUGA 4FYWB 2QMUB 3FRZA 4ZDNA 4JV5F 5E3RA 4LRCA 3PW7A 2A2DA 1ROFA 5DGAA 4A8QA 4NYOA 1RHMB 5D6GA 3V4IB 3IRWP 2OTLS 3ETOA 3KHGA 1U6FA 4EU0A 3CO9A 4C0HA 1W7WA 3M6UA 2U1AA 3U7JA 4BLGA 2GQQA 1V3RA 5HN0A 3CDWA 4F4AA 1GT8A 3PZPA 3BR8A 3GSIA 1HBNA 4B3OA 1S9GA 4XDDA 5DDOC 2I2YA 4QCLA 1N54B 2UUCJ 4NCGB 5HLFA 2NPFA 3GONA 3WDOA 4A8OA 2XS7A 3HSZA 1D0EA 3TW0A 1MWZA 2XSFA 3TUZC 2XMAA 3W3SA 3B78A 4H4OA 3NGSA 5IC4B 5B09A 4RUAA 3BGUA 4QOTA 2HURA 1B4SA 1Y10A 3OFGA 1MW7A 4J7CA 2M8HA 3UD5A 2LFVA 3AFGA 1SIWB 3KOAA 2YQ3A 5IV3A 3B4DA 3RRHA 2C2KB 2IC3B 3CJ5A 4WFBQ 1QSLA 1VMBA 1NKEA 4LRFA 4EBEA 3KLHA 3LF0A 4FXDA 2FDNA 3NL0A 3P49B 4CDIA 3M9OB 1JX4A 2BKOA 1Q8IA 2DNHA 1U1MA 1BD6A 2YKNA 3HSGA 2JC1A 2V9KA 1H98A 3N5FA 3UFCX 1TAUA 2ZITA 2MSTA 5BYSA 2FLPA 3L95X 1AB8A 4YFUA 2I5JB 5GADI 5G0RB 1JLBA 1RUSA 4DR5F 3DLGB 3BGRA 1WG5A 2XB2D 4B17A 4ES2A 1CJUB 1WHVA 1GAOA 3UD4P 5KOXA 1RTDB 4A8YA 4LFBF 1F5CA 4C7QA 1W2IA 2HNYA 2LCWA 2OJ3A 3M8QA 2XCAA 4NRUA 3HT0A 3HKZD 4DFJA 2KHCA 2AYGA 4LR8A 1ZH5A 2DR6A 8ATCB 2B51A 3T6JA 4KHPJ 4M5IA 3TEGA 4OI4A 1YJTA 2AJ4A 4PG8A 2ZKTA 1XEZA 1RT3A 1QAXA 1Y9OA 5KFBA 3U1LA 2AEMA 2C3YA 4PQUB 3CD6S 4F02A 1D3WA 2RE1A 1JJHA 3ELHA 4LUBA 4NCBA 2PIIA 3VQTA 1AW0A 1KRPA 3T5JA 4H4MA 1K1QA 2MKJA 4OZNA 2OEJA 1YKWA 2VQEF 3V6KA 3G6XA 3D0IE 4WFNQ 2XC9A 4DSLA 3M1VA 3H2VE 1E6YA 3BYRA 1LW2B 5I3UA 1CS4A 1U26A 3JYTA 5KFJA 3MD3A 4B9MA 5CXTA 1WOPA 3KNGA 1JLCA 5LOQA 2IM0A 2W2PP 3UN2A 1KLNA 2ATCB 3HPOA 1GMWA 2FQQB 4RKUC 4KT0C 3R7SB 3M2UB 1S1WB 2HGNA 4DV6F 5F0UA 4ZVEA 4R0JA 2O3DA 1LXJA 1V5VA 3BSNA 4HT7A 3DOLB 3K5OA 3JTOA 2HQDA 3J80U 4LF8J 1Y00A 7FD1A 1TKZB 1UEVA 1I51B 5KFLA 4J9SA 4QPXA 1VJQA 1S6UA 1T3OA 5CYQB 1BQNB 2VG6A 3DLJA 4DF4A 3E2EA 5JJBA 2ATLA 1TL3A 1WG1A 2HFNA 4JI8J 1IVZA 3MFHA 3FRYA 4ZJOA 4MT1A 4NLUA 4DV0F 2FVPA 3CCWA 3MM7B 2CG8A 4KGKA 1TL7B 3J81U 4DU7A 3BYPA 1KLMA 2E9TA 2HHWA 3EDRB 5E41A 4KBIA 2AZ1A 5F8GA 1CJKB 4ZPWR 5MAOA 1SV5B 3C14A 1M1GA 4ZVOB 1XMQF 5K20B 4O3QA 2HHUA 5E3CA 1Q4RA 1RT2B 3H59A 5C25B 1UETA 4OI3A 1DARA 3UO0A 4KHMA 1SJ3P 1RWMB 2F4VF 3HMJG 3H42A 1UFWA 2IVMA 5BR8J 3A4TA 3M8ZA 1Q79A 3PTWA 5CD4H 5GAGU 3EDQB 1IQZA 1UW9A 2DNQA 3DLHA 2MZJA 1U0HA 3GU0A 2ZC4A 5JVGQ 4ZP7A 3KJVB 2FUG9 4FZVA 1GX6A 2BJ7A 3QMQA 4KV8A 2BQUA 3V5RA 2A0FB 2CNKB 5FLXU 3OL6A 1F3VA 3SDEB 2LQJA 3SQGA 2CUYA 1RGVA 3V6HA 1UVLA 2ZWPA 1S4FA 3KLIA 5FD1A 3MM8B 5DG9A 1YJVA 4JYAF 2C3OA 1RT4A 2MYFA 2BE9B 2NR0A 3CJ2A 3MM6B 3HM9A 3BDPA 4UQGA 5KFGA 4OYMA 2A10A 4NXNJ 4H4KA 5H1SV 2JJ4D 4F2SA 1B70B 1SVDA 2OPPA 2J9CA 3FZBA 4J9RA 4DR3J 4ZKAA 3FSXA 3TOQA 4LF5J 4ZMMA 5CZXA 3KG0A 2MY7A 3DHWC 4X64J 5K14B 3H4BA 3IFEA 3QJLA 2P2CB 3IGNA 3WX8A 5L9XA 2BKNA 1APSA 1VK8A 4IG3B 3I0SB 2GIFA 2WB4A 4A8XA 4MFBA 2V8VA 2Y1LB 1JLGB 2DH8A 3KLVA 4WKRA 4NI2B 3R5GA 2XGPA 5K5MA 1BUXA 2W9CA 3FBFA 3UNGC 1TKTB 4WP9A 3G4SS 2V68A 5D4OA 1LXNA 3QATA 5LL6d 5J1NA 1QTNB 2YY3A 3A3OB 1I3OB 1RI7A 3LANA 1RHKB 1HPZB 3DU6A 2E1RA 3R97A 2IJFA 4OX9F 4LRDA 2RIJA 4ER8A 4DFKA 3KHLA 3TX8A 2ZDOA 1FKOA 2EBEA 2MJUA 1TFWA 5LSOA 2Y0BB 2PO4A 3CJRA 5BYRA 1NKCA 4WFZA 1ZETA 2D3O1 5H9FJ 3I96A 4R25A 3C6TA 2R8IA 1L3VA 6FD1A 5LSRA 2P9CA 3LQVA 3HP6A 2O5DA 4DFPA 3M2VA 4V19J 2WOMA 4J9LA 1RWWB 2E5GA 3LALA 1T05A 4JI7J 1FXDA 2XY5A 4LSLB 4DV4J 3IAS9 2KT5A 2C2DA 1AA1B 1X4CA 2CJXB 1VS3A 2R2TA 1UA1A 5I42B 2RT3A 4UW2A 5LMNJ 4DXLA 3K5NA 3GG1A 2H1YA 2C28A 2VONA 2R8GA 2M5YA 5CYMA 3CB4A 1CQNA 2VL1A 1WHXA 2VICA 4LF9F 5IT9U 1RAIB 1HD0A 4U7UK 1X31C 1GTEA 2J0QD 1KEKA 4DV1F 4WCEQ 3DOKB 2VBZA 1IWAA 2WVFA 1QSSA 5D8HB 2LEBA 1S4EA 2B6AB 2UU9F 4ZP6A 2K3KA 3G86A 2FIUA 3O44A 2WAQD 4FF4A 3W9IA 2HIYA 2V2QA 2XG8A 1F60B 3W62A 4UOFA 3DOMA 2ZKUA 3BF4A 2VC0A 2VZ9A 4J9UE 3POTB 3F73A 3C6UB 2AYEA 5ETQA 2EC0A 2HPUA 4U7CA 3IBCB 1UA0A 1XNQF 2YNIB 4TY8A 3N01A 4FBUA 3EPGA 4CLUA 3BGOP 2VFTA 2GVDA 2XMWA 5GAHU 5DM6Q 1TKXB 2GC8A 3NS6A 4DV3J 2QSWA 2WSFC 4Y6IA 2K2PA 2QYGA 4DZ6A 1JKHA 2CA9A 4F3OA 1JXEA 3IR6B 4DCJB 2KVIA 4I2QA 2RD5C 2AJ0A 1R8AA 4V1Ak 3KJQB 2CJYB 4K4ZA 3M8WA 3E51A 4AYBD 3PRDA 2VD3A 1R0CB 1NLKL 3VCDA 4P52A 2DGWA 3VGVA 3GV8B 2HGLA 3NOCA 4DL6A 3MUVP 1NEEA 3AD7C 1S79A 1NJYA 3D1HA 3ZTPA 2LU1A 5GAEU 4JI4F 2DBBA 2D7SA 1Y11A 1F9FA 3NGTA 1PCAA 2Y0SD 2KXHA 5L1LA 4WK1A 4GKJJ 5ETPA 1QVFR 4NLRA 1NDLA 1HIYA 5L9NA 3FEYB 2BE2B 1FEEA 4EGLA 1MSWD 3PJWA 2Y9HA 3P6YC 2OMLA 3AB4B 2J8SA 1SC3B 3SBMA 3HVTB 1SKRA 2BANB 4MK9A 4TNOA 3IR5B 4B3MF 4Y3CA 5F41A 1M5VC 5KT3A 1N5SA 1HNWF 3FQKA 2ZJRQ 4KH1B 1L3TA 1Y5IB 1NHUA 4NA1A 3PW4A 3A8JA 4M5KA 2M88A 4MTPA 2QO3A 1B99A 4TN2A 3MR5A 1RHQB 2HS3A 1SQGA 1HQEB 3MTKA 1IKVB 4NLSA 4OZ5A 1EZZB 2YKOA 2H51B 3DYAA 3BS9A 2VQFF 2CPDA 3HHKA 4P74A 2PGCA 3ENQA 4RBVA 1HFEL 2JEFA 3UW1A 4K4TA 1JNRB 2AGOA 1OY6A 3FJ2A 3NCPA 3OUYB 4KPCA 1PC5A 1X4GA 5I3QA 5CQGA 2DIVA 2WTFA 4QWBA 1HNVB 2Z8QA 3BGLA 4E2FB 4AL5A 2FJXA 1UWAA 5KFXA 4N56A 2YNHA 3TI0A 1VIXA 3CTRA 1DLOB 3BBFA 5IOLA 4OHVA 4RNFA 4NXMF 3HVWA 1X0FA 1FT8A 2Q1LA 1WKLA 3S1TA 1QSYA 1LOUA 2YQ1A 6FDRA 5AE3A 3R7NB 1P27B 2CPYA 4JI3J 1Y7PA 4QR1A 2W7PA 1OO0B 3D67A 4RNOA 3FK4A 3H40A 2R9LA 3H25A 2QLFB 1UVMA 4EWTA 3QO9A 1C2PA 1OYDA 2R7VA 2Y8YA 3SIPB 4IFYA 1FE0A 3EXCX 3G2XA 1WEXA 4LF6J 3K2YA 1XR6A 1VRUB 1FVQA 3AB2B 1FKPB 2ZH5A 4X4PA 3W2VA 3D6FB 3THVA 2KJVA 1H74A 3HKWA 4A48A 1HWIA 3IGVA 1FX2A 4G65A 2CQ3A 2R7XA 1UKUA 5D0EA 5MLCV 1Y5NB 2QV6A 3HHLD 2HYIB 3VTIA 4WYLA 3CJQA 3MHYA 4FPRA 2ZHOA 1EP4B 4ILLA 2XY6A 4GMKA 1KTVA 1ZS6A 1BQMB 3IR7B 3M9NB 4F04B 4DSFA 3W7BA 1C1CA 4LSNB 3M6WA 4ZVHA 1X4BA 2M70A 3CCZA 4WTOB 1RQ0A 3EMTA 2V8PA 4KRWA 5J2QB 2VFRA 2MMYA 1RT5B 1HBUA 2CZ4A 3TYTA 4PXDA 5E3QA 2UUBF 3HVAA 2EFNA 4MK8A 3QSYB 1EQ0A 1QUVA 3ICLA 2YX1A 2G2YA 4OHZA 1VQMS 2Z2YB 2G0JA 4MAKA 4P72A 1AZSB 4PUOA 3NLCA 7AT1B 4ZN3A 3GSDA 4QIFA 1MNEA 4FF2A 1VHIA 4UZCA 3W1YC 2ZC3A 3DDKA 2MQLA 3GIMA 1PBUA 2WVEA 3OR1B 4QWEA 1CQMA 3NMRA 5KT6A 3AT1B 4NRTA 1ZA1B 5HP1B 1KKHA 4ECYA 3AD8C 1WDDA 5F0WA 1MU2B 1M1HA 2X51A 2DITA 5KFIA 3U1MA 4MIWA 2CJ9A 3MUTP 2OH2A 3SV4A 4LFAJ 5T41A 1R8HA 4JI1F 3BJYA 2UVVA 3MCOA 2QFJA 2FVCA 1U24A 4IFVA 2BOAA 3GYGA 5T7LB 4NCGA 1UPMB 2BJ9A 3U27A 2CG4A 2BDPA 1N88A 4A8WA 3QWPA 5AJ3J 4CTAA 1NJWA 2EPIA 2POKA 1WC4A 1MMLA 4ED7A 2CNLB 4OZ0A 2C3MA 2DHXA 2W01A 5F8NA 3ITHB 3MM9B 1YBUA 5H9EK 2ZOGA 3AJ2A 5AE2A 3GR0A 3KLGA 5KFDA 2PMWA 1VQLS 4PEOA 1T7PA 2J9DE 4F36A 3WC2A 4AL7A 2HS0A 1VLYA 2GHPA 2FJDB 3VQSA 2EKYA 2BABA 4Y2CA 4PQAA 2HG4A 2C2NA 1VBYA 2D1CA 3G8QA 1HNXJ 3CDBA 1Q81T 4JV2A 2ASLA 1G4CA 1VBXA 2B5JB 2GZOA 2XEXA 3WBZA 3MPWA 2DNKA 4LF4F 3OXGA 1TV6B 3AXKA 4L73A 3LGMA 2DGQA 3JSMB 2FZKB 4NMLA 2NXUA 5G0RA 3H5YA 1WC1A 1R8CA 2HNDB 2VKRA 2IRXA 4Y2AA 2NUUG 3QIPA 3GV5B 2NXCA 3BN4A 4FVCA 4OJGA 1CJUA 2F1FA 1WDTA 1N5QA 1M5HA 4WU3A 1BXNA 2XM3A 4I4BA 1RAHB 3M4XA 3HSJA 4W4MA 2CYYA 1VRQC 1VOMA 3KXDA 1SJRA 4WKYA 4ZA1A 3TA1A 2ZNZA 3QT5A 3PV8A 4IDKB 1S0MA 1FRHA 2M4MA 4C8LA 1TMMA 5KT7A 3HHNB 4G1IA 1P1LA 3RYLA 2HWTA 4FN5A 4RW7B 2CNNB 4HTJA 4PG4A 5LM7E 4Q2MA 2OD6A 2B9YA 4PQUA 4K4WA 5KG0A 4K0KJ 1PILA 3VAFA 1O5JA 4QU7A 1LFPA 4DL5A 4WZMA 1LQ9A 2C1EB 4RU2A 3CUNA 1HI8A
chains in the Genus database with same CATH topology
5SZTA 3PFEA 4QIVA 3RAMA 1LWFA 1TAQA 2Y1RI 4HI1A 5HQ8A 2HW3A 5IT0A 3NMAA 2G9OA 3Q24A 1FTCA 4MMOA 4DL7A 2OTJS 4C8MA 4JI7F 4ZPVR 2HGMA 4NLYA 2D3OR 2GMJA 1G7CB 4QR0A 1QJHA 2RRNA 5J2PB 4DR7F 1E6VA 4RBTA 4NWBA 2N4CA 1LW2A 3NBPB 3I87A 4WIIA 1CC8A 2IFXA 2F9JA 1VIOA 1S77D 1HBOB 2EG1A 3ISNC 5C24A 3DRXA 1X7VA 5IQ6A 3BM7A 3K5PA 2B4OA 4YOEA 2DGUA 5KFSA 1RDRA 3MEGB 2W25A 1UVKA 3QLHA 3QYYA 4XDCA 2KDOA 3ZZYA 1JJ4A 2LU2A 3Q2TC 3LP2B 3N9UC 4TU9A 1JNZB 1WF1A 2EW9A 2FPHX 1TK8A 2KYZA 3MI7X 3NWGA 2PFFB 1HW8A 2YWGA 3F44A 4IOBA 4LFAF 4R5PB 5JVHQ 2R7RA 3CSKA 5LJ5Y 2ZJPQ 4KHRA 2E5IA 1IM4A 4KE5A 2UZAA 2BVZA 4BCAA 4Z37A 4RU9A 2KHDA 3J7Z5 1IKXB 2HMIB 2FGOA 1O0PA 4CT9A 2AGQA 1LFWA 4U6PA 2IRYA 3BN7A 3OLAA 5HO4A 3M2UA 1S1WA 1HMVB 2GW8A 1U4BA 3GIJA 1UEUA 3B8HA 5K8MA 4HHJA 1UJ6A 1N48A 5A8WB 1UW4A 2Q6CA 2BW2A 2XBPA 3MEEB 1FO1A 5K9FA 2GMHA 3OVSA 2LXFA 1XN9A 4C3MA 5L39A 5EWFA 3HF5A 3GIKA 1TK5A 3DLLQ 1B64A 3TUJC 3KLFB 5J2NA 5KFMA 3UI3A 4NLWA 4OZ1A 4BHQA 3CDEA 3DOLA 1KSPA 4X4SA 2DNYA 1MROA 1VJWA 3T3FA 2FVRA 4DUZF 4IOCQ 4IRDA 2VPXB 4ED3A 3HLUA 1K1SA 3G71S 5AJ3F 5F3ZA 4RW7A 1C1CB 4N77A 2N7CA 2JX2A 1ZM3A 4ED1A 3RB0A 1DBDA 1YRXA 4B02A 1FDDA 3H8YA 1KR4A 4OX8A 4DL4A 2PI5A 2LMIA 3CVKA 2FHJA 1KHWA 3MXHP 2CQCA 3KMQA 2YKMB 1BQNA 5CYQA 2LVWA 1XWLA 1K73T 4NLQA 1HBNB 3IA0A 2BJDA 4ED8A 1XC9A 4DX8H 4C8KA 4B3OB 3EXYA 1S6PB 3ENVA 4OL8A 2MY8A 4JOUA 3OL7A 1S9GB 3K7RA 2ZH4A 1HBUB 2ILYA 4ZPDA 5LSLA 1SUQA 4C8OA 1KFSA 2O67A 3MZIA 1S1TA 3KKFA 4OX7A 3SXLA 2MKKA 2H5EA 2NSBA 4JBCA 1MMNA 2A1BA 2AJ1A 3K8VA 4UOCA 4CO2A 3D1OA 2X1BA 3I32A 5HLFB 1RWUA 4K5SA 3T1HF 2ASDA 3H98A 2DPJA 2DRAA 2PT0A 5L1JA 2HNZB 3CCUS 2V5HG 4XPEA 3DCAA 1VC0A 3DNCA 1C4AA 3DC2A 4U9RA 3UE2A 1G1XA 2HHQA 2XO7A 1U1PA 3JSYA 4LF7F 4G6VB 2JFDA 3I4PA 4DSJA 2VG5B 4CH0S 4DSIA 4IUFA 3QGGA 2KM8B 3O5TB 1C1BB 2RVJA 1IBMF 3V81A 5CYJA 2XHWA 2R8HA 4JV1A 1C0TA 1T95A 5AXLA 3D0GE 3G9CA 1V9OA 3CGIA 2YNFA 2BV3A 3OQ2A 2CQ2A 1HNXF 1WWHA 2RSQA 3P3DA 1JXLA 4F4XA 4PUOB 3OJUA 2J0XA 1D9AA 3MEGA 2ZOMA 3MEKA 5E0OA 2P6SA 4QYRA 1Q8BA 3JSBA 3OSPA 2D9PA 2A2CA 5F8IA 1YVFA 1FA0A 2JVRA 3NRBA 3A1YG 1LW0A 2I38A 4ECXA 3PKYA 3MMBB 2ZUGA 2DCLA 2W8KA 3P96A 4I6WA 4TU8A 1HNZF 3SMZA 3BQ2A 3LAMA 3FRZA 2EVZA 2YWEA 4NLTA 4ZDNA 1QAIA 4JV5F 3K59A 4IO9Q 4DL2A 5E3RA 2ALZA 5K8OA 2O01C 2J5AA 4A8KA 1ZZFA 2HAIA 3DRSA 2A2DA 2R2SA 3PW7A 1ROFA 2MHEA 1VQ8S 5A8WA 5DGAA 4A8QA 4NYOA 3N0VA 1GXTA 5D6GA 1QUPA 1R6YA 4F4YA 2DGOA 3V4IB 3DU5A 3IRWP 1HBMB 2LA6A 2OTLS 3ETOA 3KHGA 1U6FA 1Z4UA 4EU0A 3KLHB 2E9ZA 2OKQA 3ZC4A 3CO9A 2UXCF 1DQ9A 4C0HA 4I1TA 3M6UA 2U1AA 3U7JA 3CCSS 5F9LA 1J5OA 2GQQA 1V3RA 1JB0C 4FNHA 4ILMA 5HN0A 4C2MA 4QW8A 3CDWA 3GB0A 3D1QA 4HEA9 2DO0A 3PXGa 1GT8A 3PZPA 1J5EF 2K7KA 2R7TA 2KT3A 1JLEB 3BR8A 1RA6A 2HWIA 1HBNA 4C11B 5CCMA 4DQQA 2CRLA 3HZGA 3GYXB 4B3OA 3BEGB 1S6PA 2F8EX 3DMJB 2GA7A 5EUHA 3K5LA 3E01A 3K57A 1VBZA 1XNRF 4B9TA 1S9GA 4XDDA 4DWIA 3SDEA 2BM1A 3DFEA 5DDOC 2F40A 1UL3A 2C42A 1WEYA 2I2YA 4QCLA 1DHMA 1YGYA 3SV3A 4ID5A 4USJC 2CJQA 1N54B 2B3TB 4N8NA 2PA8D 4ETXA 4DR6F 4X2BA 2QMWA 3MM8A 1ZAVA 4NCGB 5HLFA 1KHVA 3BO3A 2NPFA 3KK2B 1XMBA 3WDOA 1FK9A 4YY3F 5KFYA 4A8OA 3ZZ0A 2N7YA 5J2MA 2XS7A 2Y1IA 1U6BA 1IXKA 1D0EA 3TW0A 1MWZA 2YWFA 2EBGA 2VG5A 2XSFA 3PKMA 5G4DA 5IWAF 2MGZA 1C1BA 4DBQA 5KTQA 3TUZC 3W3SA 4ZPAA 3B78A 4H4OA 5EX3A 1TL5A 1T8EA 2BYCA 5B09A 3UCZP 4IRCA 4Q0BA 4FP9A 3BGRB 4IG0B 3WX4A 3DI6B 5HMXA 4RUAA 2CDQA 4ID8A 2RUGA 4RBUA 3BGUA 4QOTA 2GJIA 2AQ4A 5L1IA 1OSDA 3OFGA 1UWBA 2XMUA 1MW7A 5IZHA 5KFFA 1JIHA 2M8HA 2WRMA 2HNYB 4ZP8A 4OLPA 3MPVA 4KJIA 5A8RA 4LMZA 4IKAA 3EUNA 3MURP 1FERA 3C3LA 2KKHA 1SIWB 3IG1B 4X4UA 4JI6F 5IS2A 1QTMA 3KOAA 1BY9A 4CO1A 3HHLB 1HWLA 2YQ3A 3DM2B 3B4DA 5A6PA 1B0TA 3RRHA 5CZVA 4EO8A 4CCHA 1XERA 2E29A 1UVIA 2YNGA 3KG4A 4BWMA 3KHRA 2IC3B 2DPIA 4YUDA 5K14A 3CJ5A 4WFBQ 1NJZA 1ZM2A 4DQPA 2XMKA 4YB1P 4GKKF 3MOJB 2VBXA 3PY8A 1QSLA 1VMBA 2HQIA 3V4IA 1S1XB 1HBMA 4OZJA 3EYZA 1R8PA 3J7A1 2ZOFA 1NKEA 4UUXA 2DNGA 1LWCB 3KLHA 4EBEA 3LF0A 4WTYA 2PMZD 5L8RC 2HHTA 4MIBA 3IWNC 4L72B 4F25A 3M2RB 2N4DA 1RT3B 2KM8C 4FXDA 2FDNA 2DGVA 2E7XA 3FMBA 3OTCA 3NL0A 3P49B 2BXJA 1RKIA 1UJ5A 2V8HA 3M9OB 3I0SA 2XMJA 2CJKA 2NREA 3T9NA 1JX4A 1HHSA 4B9VA 1V6HA 5EDWA 4I6YA 1Q8IA 2COLA 2DNHA 4G1PA 1JLEA 4DR2F 1U1MA 1BD6A 1XBWA 3DRYA 2YKNA 2UV8G 1WF0A 2DHAA 4C11A 2K1RB 1KQFB 2DR8A 4RW9A 2JC1A 4YB6A 4B3TF 2V9KA 1H98A 2X1GA 4ZVFA 3N5FA 4C4WA 4CIOA 2ZE2B 3UFCX 1TAUA 3OVAA 1OIAA 2N3OA 4ZK7M 5KT5A 2ZITA 3N4WA 1SQEA 2MSTA 5BYSA 1H0HB 3L95X 3LP1B 2WBMA 3MWBA 4H4MB 3JB9k 1DTTA 2FLPA 1M5KC 1VQ6S 3WZ0A 5DQHA 1NZAA 2FJEB 3KK2A 4O44B 5E33A 4YFUA 2I5JB 5GADI 4J9MA 1AFJA 2ACYA 2LEPA 5G0RB 2KB2A 2YVSA 3LGNA 5ITHA 4IYQA 4TYAA 3J7ZT 3OPKA 1SH0A 1VC6A 2UVWA 2FVQA 2OSRA 1JLBA 4R0EA 3M1VB 4YP3A 1J2VA 3F56A 2MXYA 5LXRA 3N79A 1FNXH 5I3UB <