1S79A

Solution structure of the central rrm of human la protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
GRWILKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lupus La protein
publication title Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, translation
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s79A00
1K73T 2KT5A 1U1LA 1H2UX 1WHVA 2MKSA 1VQKS 5LJ3Y 1QVGR 2DNRA 1N54B 5IM0A 3UWTA 2CQ4A 1WF0A 1K8AT 2JWNA 3NMRA 2WBRA 1FXLA 4FXVA 1FT8A 2MJUA 2CPHA 2DNGA 1DBDA 4WCEQ 3CCQS 3R1LA 2BOPA 2D3OR 2LMIA 4BS2A 2Q79A 3VAKA 1N52B 3UD3P 2KM8C 4CH1A 2XSFA 1WI6A 3B4DA 1U2FA 4Z2XA 2ZJPQ 2RS8A 4YOEA 3MD3A 1X4FA 2D9OA 2JRSA 2LEBA 2OIHA 3G9CA 4CIOA 1NU4A 3J7YU 3S6EA 1KOHA 2KHCA 1U6BA 2MMYA 2RVJA 3TO8A 1WF1A 2DNLA 1DZ5A 2F9JA 1RK8A 2PE8A 2AYGA 3G96A 3BS9A 3SXLA 1X5SA 2DNPA 1M5VC 5CXTA 4QU7A 2MHNA 3PIOQ 1OIAA 4PKDB 3SDEA 2J0QD 2HGNA 1VQ7S 5LSLA 3VAGA 3CCRS 3Q2SC 2CQ1A 2J8AA 4UY8T 1OWXA 3N9UC 1U1OA 2DNZA 2OTLS 1QM9A 5MLCV 1SJ4P 1DRZA 2X1GA 1YJNS 2MYFA 2YH1A 2MKHA 3ZZZA 2I2YA 2J76E 1HD0A 2CQ3A 2J0SD 3NNCA 2KVIA 2AD9A 1W2BR 3I56S 2EK1A 5H1SV 2M8DB 3CMES 1L3KA 1O0PA 3LQVA 5D78A 1VQ4S 1FJEB 2SXLA 2CQHA 2DGSA 1SXLA 2AYEA 1VQ6S 1S72S 4TU9A 1S79A 2LXIA 1D8ZA 3THTA 3MUVP 2CQCA 1X4CA 2B0GA 3MXHP 4C7QA 2MQPA 2OTJS 2F3JA 1U1MA 1AUDA 4RU2A 1PGZA 3S8SA 4QPTA 2E5HA 2A3JA 3BO2A 3UCUP 3IWNC 2KRRA 1HL6A 2VONA 2I38A 2CPFA 2MY7A 2XS2A 1VBYA 2RU3A 5FJ4A 2G0CA 4F26A 5CA5A 3S01A 3ULHA 1FNXH 1Q86T 3MUTP 2VODA 2N82B 2LEAA 5ITHA 2N7CA 3RW6A 4C0OC 1VQOS 4LMZA 2DNNA 1VC5A 1N88A 2KRBA 2MKIA 3NS5A 3CCLS 1UP1A 2BZ2A 2NZ4A 3DLLQ 3ZZYA 2LECA 1UFWA 1P1TA 1SJRA 1FHTA 3THPA 5GVQA 2E5IA 2DGUA 3UD4P 5LXYA 1WTBA 2MZ1A 4IO9Q 2LKZA 1KD1T 3MDFA 1X5OA 2CQBA 4ERDA 2RRBA 3HI9A 3PIPQ 2HGLA 2HVZA 2KG0A 4CH0S 2ZJQQ 2DGVA 1K9MT 1VBXA 1WF2A 2XS5A 2MSSA 5BJRA 2X1AA 3D2WA 2OSQA 2DNOA 4WFBQ 1JJHA 1X4BA 5DM6Q 2CPJA 2MQQA 2KH9A 3LPYA 2M2BA 1QVFR 3CC7S 5DDOC 4EGLA 1H2VZ 2L9WA 4F02A 2M0GB 5JVHQ 3NNHA 2RQ4A 2O3DA 1VBZA 2U2FA 2KXFA 2RQCA 5GAEU 5DDQC 1F9FA 4QU6A 3JB9k 2MB0B 2DIUA 2EVZA 2KI2A 4OZ0A 1WI8A 2LXUA 2DHSA 2QEXS 3B4MA 4IOCQ 2M52A 2MZTA 2DGQA 2M9KA 2DH8A 2MZSA 2NLWA 1D9AA 1YTYA 2UP1A 2JVOA 3CCMS 1M5KC 2MKKA 3CCSS 4ED5A 1HD1A 1HA1A 4A8XA 4M5DB 3VAIA 5LSOA 1Q7YT 3VF0B 1X5TA 3NS6A 5LJ5Y 3G71S 2F9DA 2DHAA 2PEHA 1X4AA 4WFAQ 1U1NA 2CQIA 3CCES 1SJ3P 1X4DA 5D77A 3K0JA 1U1PA 4WF9Q 1R8HA 3P3DA 1U1KA 2KM8B 1WHYA 3P6YC 4QQBA 1VQ9S 2DO0A 2VOOA 3CUNA 2YKAA 4P6QA 1WG4A 2XNQA 3UCZP 2MZRA 2D9PA 1FJ7A 5IQQA 1PO6A 2VOPA 3G8SA 1R8PA 4U67Q 2FC9A 1X4EA 5GAHU 2MZJA 1YJWS 1Q81T 1WEZA 3FEYB 2AYMA 3EGZA 2KXNB 3OW2R 1VQLS 1YJ9S 3CULA 3L3CA 2MPUA 3DXBA 4LJMA 3H2UB 1FO1A 2CPEA 2LCWA 4W92B 2GO9A 3CCVS 2GHPA 2QFJA 5JVGQ 5DM7Q 1DHMA 2V94A 2MQOA 1KOOA 1SJFA 3SDEB 2MY8A 3R27A 1A7GE 2KXHA 1VQ5S 2HYIB 1U6FA 3U1LA 2MGZB 1B7FA 3FEXB 3G6ES 1VQPS 2CQDA 2OJ3A 1CVJA 4WFNQ 2LYVA 2DHXA 2MQMA 3CPWR 2CPYA 5LXRA 2DNKA 3CC2S 2M88A 3EX7B 2L08A 2CPIA 1N8RT 2CPXA 1NJIT 4W90B 1WELA 3MI7X 4YUDA 2YH0A 1ZZNA 2L41A 2DGOA 2FHOB 3BEGB 4LIRA 3H2VE 5HL7Q 2DH9A 2DH7A 3S7RA 3CCJS 2HGMA 4YB1P 1JJ2R 1Q82T 4TLQA 2FC8A 3BO3A 2N3OA 1VQNS 1YI2S 2DGXA 4V19X 1M5OC 3IRWP 2DISA 4TU7A 2DITA 2JX2A 3UCGA 1UW4A 3J7ZT 1YIJS 1WHWA 1JJ4A 1YITS 2CQPA 2E5JA 1M90T 1VC6A 2G1DA 2MXYA 3G8TA 1WG5A 1XN9A 2LA4A 3SMZA 1WEYA 4OZ1A 1WWHA 5IFMA 1X5PA 1VQMS 3U1MA 2N3LA 2FY1A 2RS2A 1ZH5A 2K3KA 1VQ8S 3R1HA 3CTRA 1URNA 1VC0A 4Y00A 3Q2TC 4PR6A 2RT3A 2MKCA 2FPHX 3EGNA 1FJCA 1H2TZ 2MZQA 2RUGA 1M5PC 2DNMA 4J5OA 3CF5Q 5IM0B 1UAWA 2DNQA 3HHNB 1M1KT 5GAGU 1KC8T 2QA4S 4Y0FA 2CPDA 2K8GA 1YWXA 2CQ0A 2XNRA 2E44A 2DO4A 4F25A 2DNHA 3P49B 2ERRA 3TYTA 2CJKA 1WHXA 2ADBA 2M7SA 2MJNA 3BO4A 2MGZA 2E5GA 1IQTA 1X0FA 2G4BA 1WEXA 5HO4A 2LQ5A 2CQ2A 2RRAA 2DB1A 1X4GA 3US5A 5GMKa 4TU8A 2EK6A 2XB2D 4WIIA 2ZJRQ 3UE2A 3VAFA 2HZCA 1NO8A 3VALA 2RNEA 1RKJA 1BY9A 2CPZA 2KFYA 3CD6S 3CXCR 1X4HA 4PRFA 2OSRA 2DK2A 3G4SS 3I55S 2X1FA 3MURP 5CYJA 3TP2A 2CQGA 2KN4A 4IUFA 3CC4S 2DGTA 5GADU 1ZZFA 2ADCA 1U1RA 2M70A 2YTCA 1YHQS 3RW7A 2MQNA 1KQSR 2MSTA 2LA6A 3VAMA 2YWKA 1OPIA 5EN1A 2X1BA 5DDRC 2DHGA 3NNAA 3CMAS 2DGWA 3MOJB 4IOAQ 2DIVA 4C4WA 2KG1A 3MD1A 2KU7A 1H6KX 1JMTA 1P27B 3CCUS 3P5TL 3MUMP 1OO0B 5DDPC 2KYXA 2U1AA 1WG1A 4ZKAA 4CQ1A 1A9NB 4UQTA 4WKRA 1G2EA 1U1QA 3VAHA 3V4MA 2AYBA 5DETA 2MQLA 3VAJA 2DNYA 2JVRA 2MKJA 4FXWA 2M4MA 2M8HA 2XS7A 1SJQA
chains in the Genus database with same CATH superfamily
3P45B 5IM0A 4FBUA 3MEEB 4U8VA 1H72C 1QTMA 1Y3JA 2WBRA 1I1GA 5CD4A 4WCEQ 2BDPA 1XK8A 2MTLA 3W62A 1FX4A 5G4DA 4CH1A 2ZUAA 4F2RA 4EYIB 1IBLF 5HBMA 2VH7A 3KK3A 3GTYX 2AJ0A 2EPIA 4YQWA 3F44A 2NQPA 5L1JA 2PE8A 1IKYA 1NKCA 3NGDA 3MEKA 2J0QD 4OHXA 4LIWA 4AFFA 2GQCA 4UY8T 3I0SA 4YS2A 2C3MA 3R5DA 1FRHA 3ZZ0A 2NXJA 2R8HA 4G3IA 5I4MA 2ZDPA 4CO3A 3M8QB 4LR7A 2ZZMA 5GMDA 2FD2A 3J81U 3WC2A 4RNMA 3KFWX 3MPVA 3C46A 2E5HA 5HN0A 4NXMF 2X51A 1N0VC 2GMJA 2DVIA 2AEJA 5F3ZA 2MY7A 3NAIA 4FVCA 4F26A 2NYHA 5I3UA 5IT9Y 3VQTA 2C22A 1ZBTA 3H5XA 3BSOA 2VG6A 1FVQA 4IO9Q 3PEJA 2K1RA 1RB0A 1K9MT 4DQPA 4I7FA 4RZRA 4K5RA 4FN5A 1M5HA 4P71A 2GO8A 2NXCA 4IR9A 4B9LA 3FFIA 1MG7A 1I94F 3I5BA 3NNHA 2KXFA 2RQCA 3HDSA 1UCNA 4OHYA 2O5DA 4EI2A 3D6TB 2XLJA 1UTAA 3GE9A 2R7WA 4C11B 5JMNA 2YVSA 1MU2A 4DS5A 1RISA 2ZBRA 4WZMA 2KYZA 4A8XA 4KGZB 4A8OA 4OFZA 3H42A 1SPBP 2HZVA 2F9DA 1NM2A 1TVRA 4URSA 5KFWA 4F4ZA 3GIIA 4QIGA 2H9ZA 5E2QA 4LF5J 5B08A 2YKPA 1G3OA 1WC1A 2DRDA 2Y8WA 1T03A 5HBMB 1R8PA 2FC9A 3KK3B 3IBFB 4ZVOB 4E8UA 1FEEA 1L3UA 3HD1A 1IKYB 1HI8A 2CPEA 1NZAA 3CO9A 1RT4A 2FVPA 2LQ9A 2E7XA 2ASDA 3OD2A 3I0SB 1HQEA 2CNNB 3MM7A 2CFXA 3KJQB 2CPYA 3CDAA 3M32A 1PSDA 1FE0A 3TNVA 1SQEA 3K5LA 4MKBA 1GTHA 2DGOA 4ZDNA 1Q0NA 4G1QA 4DF4A 2N3OA 4OIXA 2BE2A 3AH6A 1IBLJ 1LK5A 4RWXA 3PW7A 4RW8B 1M90T 3J7AN 3GJSB 4Y2AA 2LU2A 1JQGA 2XCAA 2KB2A 4U8YA 1IQZA 5ETNA 1H98A 5I3UB 1OSDA 1AW0A 3CTRA 1S4EA 4QIEA 4ANEA 2VG6B 3UDVA 2OPQA 2AZ3A 1NSPA 3WHIA 2K1RB 1IKXA 1R6YA 2XWYA 1YWXA 3NAHA 2VB6A 1GQEA 5D4LA 3FFIB 4D3GA 2Q6BA 2DY9A 2HW3A 1C0TA 2G2YA 1XQIA 4MJKA 3TANA 2VPYB 3CJ0A 1D3WA 2B4UA 4NXMJ 3CXCR 1K1SA 2C2EA 4RBVA 4LBIA 5ADZA 5BYSA 3CC4S 4RW6A 1RCOB 2VZ9A 3OL9A 3VGUA 1DJ0A 4R0EA 3R7SB 2V8VA 3Q8YA 1MU2B 1L3SA 2IVFB 1JMTA 3EZ5A 1M5SA 1RTIB 2GMLA 2R2SA 4CO0A 2OPPA 3T5LA 1E6VA 3CVKA 2IMWP 2IM2A 3JSYA 1UW9A 5DETA 2C1EB 3BB5A 2M4MA 3GJRB 3UWTA 3EZOA 1X0PA 3H0PA 1UETA 1T03B 2CUYA 4IFYB 5T41A 5F41A 2FTRA 3IM9A 2LLZA 2IA0A 4I1TA 3LF0A 2J9DE 3HHEA 3ILIA 5RUBA 4FVMA 5I42A 4AXJA 2ZJPQ 1RT4B 2D9OA 1HBOA 2JRSA 1IR1A 3KNGA 3PACA 4OJ3A 2J0XA 3MM7B 2ZE2A 3G96A 5BR8F 3M32B 1NHUA 5CXTA 2VBWA 3SDEA 3NRBA 4TVAB 4KTQA 3J80U 4ZVGA 1R0CB 2V63A 1APSA 3AD9C 3LAMA 4G1QB 3HT3A 4OL8A 2I5JA 3ZZZA 2J0SD 2BE2B 3HFKA 4DV5J 2AD9A 3I56S 1NMEB 3U27A 3JSBA 2WVCA 3IBWA 1BXNA 2B9XA 2VPWB 4F4KA 2BQUA 3BH7B 3OV7A 1VK8A 3A3OB 4MH8A 1T94A 4HDGA 2XLKA 4LF1A 3H40A 1B64A 4J7CA 2ROGA 4ED2A 4PXEA 1V5IB 1IKXB 4DR3F 4HVZA 3BN4A 1FDDA 2MKIA 3TVYA 3RB3A 3QRPA 3QMQA 3OR2A 4FF2A 4P72A 3CJQA 4NL5A 1C0TB 4ICLA 2LKZA 5A8RA 1VBXA 2MLXA 3BBFA 1J5EF 5A76A 4OZNA 2JC1A 3C14A 3LPYA 4NXNJ 1QVFR 1R0BG 4RW6B 4N76A 4KV8A 5H9FJ 3PX0A 2U2FA 2AV5A 4OYPA 3D1OA 4DU8A 1HNXJ 4QU6A 4QWEA 3JAMU 3TZXA 4I6YA 3ZTRA 3DXSX 1VHIA 2W4CA 2QEXS 3Q8RB 3I9V9 1BQNA 3JQJA 2OPPB 1E6VB 2JSXA 3GIMA 2Z2YB 1TR0A 2W2QP 2R7RA 2XMAA 2W8KA 2G1HA 2PN6A 4X4VA 1CC8A 3MAAA 1LV5A 2BR0A 2PEHA 3MAHA 1WKLA 4YEAA 1CJTA 4F4WA 2J0WA 4CP5A 3LTOA 3TRGA 4ZLJA 3AFGA 3MEDA 2AYMA 3PCOB 1LQ9A 5D6GA 4NYPA 3SQOP 5DLGA 2ZE2B 3NGKA 5F9LA 4UT4A 1RDRA 5JVGQ 4RNFA 1RT6B 1HHQA 3SDEB 1RWOB 4X84A 4YY3F 1KVJA 4B9MA 4Y2KA 1E6YA 4PG7A 5JXSA 1CVJA 2I5JB 1SBRA 5THWA 1FERA 3CPWR 4M63A 3FBBA 1AZSA 3L95X 1FTCA 4G1IA 1RTZA 2PEBA 2YH0A 1PC5A 2CNLB 1H0HB 1J2VA 1Q82T 4LRFA 4TLQA 2FC8A 2FHKA 1M5OC 3NMAA 1HPZA 1YIJS 2B9YA 4C6AA 4M94A 1XN9A 2GJFA 5ETRA 2LQJA 2OMOA 3PYEA 5BR8J 2FY1A 2VDIA 2XZWA 3QT5A 3TUIC 4LRBA 3OR2B 4B3SF 1ZA2B 2A10A 4DCPB 2Y3YA 1RHQB 5A8RB 1T9YA 3D9BA 3CF5Q 4ZS6A 2W24A 4Y0FA 5DQIA 4CO5A 1FEHA 2R8KA 5D15A 2RKIA 3BO4A 1X0FA 3C14B 1WEXA 5E5NA 2V8PA 2CA9A 2HBRB 4GKJF 4J9SA 2CZ9A 1HNZF 1T05A 4HDHA 1WSRA 3IWXA 2D41A 3TP2A 4AL7A 2CQGA 1VIOA 3L09A 4OLPA 4J37A 5GADU 4DR3J 1NDKA 3X3UA 3MR6A 1RABB 1SIWB 1S99A 3MAAB 3BV8A 1YBTA 3GU0A 1OO0B 2FQQB 4CQ1A 3AHPA 3H8YA 4ZVRB 4CLSA 3PHTA 3ET6A 2CZ4A 3VAJA 1J5OA 1CJTB 2MKJA 1J5EJ 4NCBA 4CLUA 3HK2A 2GJIA 3UDEA 4QR0A 1RCXB 5KFRA 2JWNA 1IKWA 2LQ8A 1FD2A 4PCQA 3M2UA 3E51A 1DBDA 2L9NA 5AJ3F 4RR5A 1B7YB 4DN9A 2VBXA 3A3PB 3TX0A 2EW9A 5L39A 3VCDA 2H48B 2VG5A 2VHGA 5HMYA 2GHVC 2RVJA 3HP6A 4V19J 1PBUA 2J9DA 4OI1A 1DZ5A 4UOHA 1SQGA 1I3OB 4DL0C 2Y0BB 2GAGC 4OQJA 1AZSB 4OJ1A 2Z2ZA 4GO5X 4WU3A 1BC6A 2HGNA 3FUYA 3KLEA 2ZDOA 3FGVA 1OWXA 3H4DA 2I2YA 4B9SA 4ZCIA 4JV5F 5A2QU 4CRJA 4TN2A 1HPZB 1MWYA 3NLCA 2N4DA 2QRRA 3D1HA 4CO2A 6FDRA 1Q95G 3PFOA 4JBCA 5J1EB 2QA1A 1H73A 2HQGA 1B70B 2HIQA 4A8KA 4G1PA 5KFFA 2QL9B 2Z58B 1VC5A 2KRBA 3CCLS 2Q43A 2BZ2A 4KAIA 4P2FA 2RKIB 3DDKA 3OHAA 4ED7A 3GB0A 1T3OA 1TK5A 2XC9A 4CH0S 2ZJQQ 4GKKF 3ZXWA 5BJRA 4QOTA 1UKUA 1JJHA 2CAJA 1QE1A 2MQQA 2CG8A 3HVTA 2C2DA 1DY3A 6AT1B 1XC9A 5LT5A 5LM7E 1VBZA 1HBNB 4B3SJ 4FKXA 1MMDA 3C6TA 5KT3A 4K5SA 3QAUA 2NSBA 2MZTA 1T02A 3TAQA 5BYRA 5IZHA 4ZVEA 3ET6B 4M95A 2HFVA 1J5OB 4NLTA 3CCMS 2M5YA 1HD1A 2BV3A 1K0TA 2FUG9 1IKWB 2OAUA 1FK9B 4GKJJ 3M2UB 3KG1A 1RBOB 1HNZJ 3Q8VA 2YBVA 4ETZA 3CCWA 2BVZA 4CLPA 2VG5B 3R5GA 1ZAVA 4X64J 4JOUA 5D3GB 2ZH2A 1TL5A 4ZIVA 4I2PA 2BANA 2AHOB 3OLBA 1D09B 2L48A 2V50A 1RYRA 2D1CA 1KOOA 2J7WA 4FYVB 2G13A 2V8DA 4U7UD 4QPXA 1U6FA 3T19A 3K5MA 4IG3A 2ZVIA 2PMHA 2VBYA 2VL1A 2CNOB 2IMOA 2L41A 3BEGB 3NWRA 5AJ3J 4CLYA 2F40A 2XCPA 2QLFB 1QDUB 3V6HA 4V19X 3J7ZT 3ZC4A 3ONQA 5F8IA 5KFXA 2IPOB 4IQXA 4OZ1A 4RO0A 2EFOA 5GAGI 1JLEB 2HWIA 2FZGB 1PC4A 4OI6A 2HQFA 3IRXA 1S59A 4ZITA 1NLKL 2RT3A 4RW4B 3BYPA 3GONA 1Y10A 3KUEA 2LXFA 3IR5B 3R97A 2MZQA 3W5YA 2RB7A 4TYAA 2QA4S 3KHHA 4EZ6A 4JV5J 4DX5A 1QE1B 1RAAB 2H5EA 1Q8KA 3HVTB 5GMKa 3H20A 2AJQA 2EK6A 5F8LA 2ZJRQ 2HFNA 4JI0F 3SBMA 5DQHA 1Q4RA 5M2RA 2L9DA 3MURP 3C6TB 4DN0A 2AGPA 4KGKA 1UZDA 1NSQA 2Z0GA 1ZS6A 4L74A 3RB6A 1LEOA 3AB2B 2P9CA 1S0VA 1NKBA 2A6MA 3MOJB 3N5BA 4J9LA 1KRPA 4ZKAA 2ASYA 4GKKJ 4FXWA 2ASJA 2GIQA 2G2OA 2HWTA 3G2XA 1TK8A 2ZM6J 4LSNB 1RWMB 5CZVA 1K8AT 2ZH1A 3ADAC 1TTHB 2HQCA 2QSWA 2HAFA 3WDOA 4I2PB 1B0PA 1Y5IB 2Q6CA 1HBUA 2RQMA 2KM8C 3KNAA 1R31A 3PDNA 4OMFG 3ENVA 4DG1B 2RRNA 1RHMB 1YZ7A 4ELVA 4IG3B 4YB6A 4C8KA 3KG0A 4KE5A 4DSFA 3W2VA 2Z2MA 2B5JA 4UUWA 2HPUA 2OTLS 2R7UA 1QM9A 2MKHA 2IJFA 4LVNP 3NNCA 3D0IE 2CJXB 4KGMA 3M30B 3F56A 2CQHA 2DEIA 5L1KA 1S6OA 3K8WA 4C8MA 1D8ZA 3KXDA 2UXDJ 3QYYA 3BN7A 3TZZA 1HI0P 2BJ9A 4FPIA 3VR1A 3UCUP 1G6BA 1NH8A 1KLNA 4F3OA 1VBYA 1CEZA 4CH7A 5CA5A 4LFCJ 1FNXH 3R6LB 3MUTP 2CVEA 1S12A 3ISNC 4NMLA 4OYAA 1HWIA 1UEKA 3DC2A 3M9MB 4K4SA 1N6QB 4JI5F 1JKHA 2LECA 1CQMA 4JI6F 2JC0A 2R8IA 2HRTA 5EWFA 3PIPQ 3PW5A 2RU9A 1YDLA 1HNIA 2FZCB 4ZOSA 3W8GA 4ED8A 4ZPWR 4DR6F 1HNWF 3T6BA 4EBCA 3CJ2A 3DYAA 1HLWA 1LW0B 3EE3A 1QJHA 4FPRA 2QFIA 1F9FA 3HX9A 2XYGB 2ILYA 3M4XA 5EUHA 2V2VA 5DRKA 5KFAA 5C25A 1VYAA 3EZUA 1Y7PA 1JLFA 1Y3KA 3P5BP 1EP4A 3DFEA 1ZPWX 1NZ8A 1MW7A 2QMUB 1W7WA 2OP5A 2IAJA 2JFKA 2J9EA 4L72B 2A0FB 4JI0J 1FTRA 1FCAA 2GGPB 1HBUB 1RHUB 2QTWA 2DO0A 4PWDA 2Z56B 3AAWB 2NREA 2KFZA 3C8YA 4M5LA 3W9IA 5LSRA 3OL8A 1DARA 4X62F 2QSFA 2E5LF 3DXBA 4ZP8A 1AFIA 1N32J 4W92B 3W2VB 4LFAJ 4TXSA 5DM7Q 1DHMA 3GYGA 5CD4H 5KG4A 4AE5A 3GR1A 1NJIT 5LMNF 3ITHA 2ZVSA 2BYCA 2FIUA 3QT6A 1NRKA 1JNRB 2DD8S 4JI2F 3RBXA 4PWUA 4A8WA 4K4UA 1K44A 3IRWP 4CCHA 1ITPA 1MWQA 2MXYA 1KDNA 4DX7A 5KFKA 2HHSA 3RBZA 2P9GA 3DOMA 3CJ3A 4EFAC 1WC3A 3SV4A 4J90A 4DCOB 1ZH5A 1DQ9A 4MFBA 4HL9A 1JKHB 1U47A 4DPUA 4OI4A 3OR1B 3GYNA 3VGTA 4USJC 2E1AA 3DU6A 2DNHA 4J9NA 4FNIA 3DYAB 2DRBA 1T95A 3BGOP 1JLQA 3LGHA 4HH1A 2DB1A 4YR3A 5HVGA 1UA1A 1R27B 4DL4A 2J8SA 3U02A 2GIFA 4ZVFA 5E33A 3D4JA 1F1BB 2ALZA 3M2VA 4QYRA 4ZP7A 1JLFB 4KKOA 1AYEA 3GFHA 4B9VA 1EP4B 4PZVA 5F8NA 4JI5J 1A0OB 1BUXA 2WAQD 4KB7A 2DR5A 2IAJB 2KZMA 3BKTA 2KU7A 5U47A 1CULA 2ZOGA 5DDPC 2QL7B 1LXNA 4GO7X 3I96A 1U1QA 4F0KA 4DR6J 1HNWJ 2ASLA 2UV8A 2DR8A 4KC5A 3HVWA 1AROP 4L75A 1NB2A 1FDBA 1OQ6A 1S7HA 5F0UA 3OL6A 3M7VA 3MR5A 1N52B 4ETXA 3TAMB 1LW2A 2V4JA 2YY3A 1PJ5A 1C1BA 3IN5A 3G9CA 1PIEA 3EICA 1KOHA 3LH2S 3OTDA 2HNZA 1AA1B 3JTOA 1NXIA 2P2CB 4AQYF 3EYZA 2RDJA 4YR0A 1DQAA 2XLIA 2GQ2A 4MK7A 2HHHF 3ITHB 2WTFA 3E8OA 5HVFA 2J8AA 3L9ZA 3N9UC 2DNZA 3TJ9A 4P2SA 2WB4A 3T5JA 1UL3A 5E3CA 1HHTP 5H1SV 4IH7A 5E41A 3WIVA 3DOLB 3J7A1 4FS2A 4IQMA 2O67A 2AX0A 4DMZA 2GVZA 4X62J 2LXIA 2E5LJ 2P8IA 2V2KA 2Z30B 2CQCA 2WBMA 3DOMB 3HT0A 3WZ0A 1FRIA 4QZVB 4F4YA 3S8SA 5HQLA 2E1MC 4MFBB 2E1CA 3BO2A 2AJFE 2UVVA 2G0CA 2W8LA 2PSZA 1WNEA 4XIUA 4DFPA 1GXUA 2B4VA 1MLAA 2QMWA 4WU2A 5LMNJ 2FJWA 4OHZA 2HKEA 1NK4A 3PFEA 3ILOA 2C2NA 2BE9B 2OHDA 1U09A 2RRBA 3JYTB 4ZLPA 4JI2J 1MN9A 4CDIA 4NZ6A 1SH2A 3UVJB 4DUTA 3M2VB 2YWWA 3MFHA 4KKOB 4ZPAA 4MK8A 5L8RC 3B6BA 1YKWA 3D6HB 2KI2A 2C3OA 4K4VA 4IG0A 4RUBA 2GJ2A 3DLKA 1CULB 3DLEA 3HHLD 4B08A 2WB1D 4DL5A 3Q23A 3GR0A 3FBCA 4M5DB 3QGPA 5A8KB 2ZHBA 3EGVA 2BACA 1VGYA 3N6LA 5CYQA 3G71S 1X4AA 2FY8A 1U1KA 3R6GB 1KR4A 1U8WA 2VOOA 3CUNA 4J9QA 1LW2B 2V4JB 3CGIA 4ZJOA 1WG4A 1C1BB 3K2YA 2HNZB 4J9VA 2XMJA 3OW2R 2EFPA 3ICLA 2DBBA 3KJNB 5F3TA 3GIJA 2GO9A 4P10A 2QFJA 4N41A 4Q43A 3R3TA 3I4HX 2XMUA 4C8OA 1BWEA 1NK9A 3FEXB 3PEHA 4I6AA 3OTOF 1N33F 2JEIA 2HBYB 3FQLA 2GVZB 3B82A 1RT3A 4WFZA 4LIRA 1NDLA 1RLDA 1WC4A 3CCJS 1VRTA 1BQXA 2BX6A 1X8DA 4YDXA 5ETLA 1RHKB 1WKJA 3KMSA 3AXMA 2G1DA 4NYZA 1SL1A 4O0NA 3FCVA 4AQYJ 2CXEA 2OI2A 4FYXB 4ED3A 4ZK7M 3SCIE 4JI7F 1FXDA 1Y4ZB 3B8HA 4J91A 3NL0A 5J2PA 2K2PA 4BLGA 2HHHJ 2FPHX 1CSJA 3OVAA 1OYDA 3EGNA 1KVIA 1C1CA 1FRJA 1UVMA 1B0VA 3HHNB 4DX8H 1JLAB 3EXYA 3P49B 1NNDA 1IQTA 2KT3A 5K8NA 2BJ3A 1TAQA 1RHJB 3BGUA 1SL2A 2XQCA 2YXLA 3MCSA 2DK2A 3BR8A 2BJEA 4RUCA 4IG0B 4EO6A 3DLKB 2W25A 3DLEB 1BE4A 3QIPB 1RQ0A 1NAQA 2LA6A 1C0UB 1NBEB 1OPIA 5EN1A 2PGCA 5CYQB 4Q2LA 3P5TL 1ZAXA 3LP1A 2MEWA 4B9UA 4QCLA 1TU0B 4LFBF 2DXEA 4NRUA 4NRTA 1QLNA 3RRHA 3TW0A 2VV5A 4LF9F 2HFUA 4KHPF 1Y00A 3NMRA 5HMXA 3MPUB 4ER8A 1M1GA 1X7VA 5KFEA 3DHXA 3VVUA 3MD3A 1BQMA 3EMTA 4WJBA 5KT4A 3P96A 1F2HA 4ZVHA 1KN6A 2XMTA 3W65A 2WHOA 1Q8BA 2R2UA 3AOBA 3K59A 1UJ6A 3WX4A 3PIOQ 2XI3A 3QJJA 5LSLA 2V2QA 4L6V3 2V2ZA 1RT3B 2NSCA 1YLXA 1UWBA 1DRZA 2YH1A 1YSJA 3CJTA 3FMWA 3C19A 4O44A 4LF7J 1RI7A 2W01A 2DGSA 1SXLA 2Q3PA 4WE1A 1BHNA 5E3QA 1WDDA 4QW8A 2HNYA 2V67A 1FFSB 1F3VA 4TLRA 3IGNA 1NK7A 2DR9A 2R9LA 3ENWA 5J2PB 2DTJA 1I51B 2E9ZA 4B3RJ 2XS2A 2ZBIA 5FJ4A 4O3SA 1C1CB 4OJGA 1R8BA 3E2EA 3S01A 2VODA 4X4TA 1N33J 3BSCA 4LMZA 4PG6A 4P9SA 2BUNA 3J80Y 1FFWB 4RKUC 2OH2A 1FHTA 3GV8B 2CYYA 2Y0SD 3AJDA 3WC0A 4YFUA 4C8YA 4XO0A 2W7PA 4R25A 1TUWA 2DNOA 5KFZA 4FDFA 5DM6Q 5C42B 4NI2A 3DMJA 3KJFB 1CJVB 5JVHQ 2RQ4A 4ZJQA 4JI7J 3ILLA 1NSKL 1V6HA 2CRLA 4UOGA 2V9WA 2DHSA 4QW9A 4IOCQ 3LP1B 4DV4F 4X4RA 2J5AA 3P4UB 3TQEA 1U48A 3V81A 3IO1A 2R7SA 3VF0B 5CQGA 5LJ5Y 1XIQA 3BSNA 2EFQA 1U1NA 4EBEA 3OUYA 2ZWPA 5CCLA 2WSCC 1RACB 1XNRF 3P6YC 5IOLA 5K5MA 1BQMB 1FJ7A 1PO6A 4JV2A 5C7PA 4HLBA 1GX5A 3VZIA 3J7Z5 4OLOA 4ZN1A 2LQBA 2BW2A 3UNYA 3BGFA 3JAMY 1FO1A 2HFZA 1CJUB 3HHLA 2JJ4D 3RJMB 3LAKA 1N5YB 4WWSA 1MNEA 3DOKA 3T1AA 1Z2ZA 2B8QA 1UWBB 3W2WA 2GMHA 3H7HB 4LFBJ 3LGNA 2L08A 3BKFA 2YX7A 4CM0A 5KG5A 4O44B 4Y6IA 4YUDA 2IM1A 4KHPJ 4WE1B 1Y5NB 1F6TA 2R42A 3FK4A 1JXVA 3CD0A 3PJ9A 1RAOA 4FBTA 3G8QA 3RB0A 2FJEB 3NKYA 4TU7A 1HI1A 5L46A 3LGMA 3TQ1A 4MYUA 3FJ2A 4O23A 3FC9A 5IT0A 1KKHA 3JQMA 4P7VA 1Q8LA 1WWHA 4DJBA 4ECVA 3CT9A 1URNA 3I0RA 3ISZA 1CBKA 1DTTA 4LREA 3MM6A 2BJDA 4F04B 3QGIA 2E1PA 1WOPA 3HJVA 2DNQA 4WTYA 2QMXA 1HWLA 4UF4A 3QFWA 3TYTA 3HD2A 4DI6A 1IUJA 4OX9F 1Q53A 1AFJA 4ANCA 3DMJB 8RUCA 1Q16B 2YPZA 3M6XA 1K47A 3DLJA 1JX4A 3N01A 2OSRA 1MSWD 5DG8A 3UN2A 5HMWA 2OFGX 1KQSR 3HHDA 4C3KA 1QSYA 3IXQA 3QFHA 1LWCA 2X1BA 3V81B 4XTTA 4DXLA 3W63A 3PY8A 3BZQA 2KYXA 3K58A 4J9UE 1G2EA 2HAIA 4X4OA 2PFDA 2JEJA 2XZTB 3O5TB 2KT5A 3W5ZA 1H2UX 1OS5A 5LJ3Y 5L9NA 1TKTA 2Q66A 2CQ4A 1HBMA 3CB4A 1QAJA 2RILA 2CDRB 3R1LA 3TARA 4M5IA 3N6NA 2EI5A 2G0JA 3HHLB 2XHWA 2YNGA 3IAM9 4X4SA 1NU4A 3J7YU 3KJVA 3DOKB 2UU9J 3UQSA 4IKAA 1U2CA 2F9JA 1UMJA 5D4OA 3W2WB 2H3EB 5HJYA 2NXUA 3GV5B 4P75A 2RD5C 2VC0A 4JI1F 4PKDB 1N5SA 2WRMA 3CCRS 4DL2A 3Q2SC 3I32A 3NGTA 3V5RA 2MYFA 1NJWA 3FSXA 4ELUA 2WZ1A 2ZH9A 3EDQB 2VPXB 3K5OA 3MEGB 1EQMA 3U7JA 1VJQA 1X4CA 2B0GA 3F0NA 1RU1A 3MEEA 4L3NA 4BC9A 3I0RB 1V9OA 2AEMA 1DTTB 2K7JA 2N7CA 3RW6A 1JK9B 1RZMA 3NS5A 1C2PA 8AT1B 1UVKA 5DQGA 2L3MA 3A8EA 3SIPB 4HT5A 3LP0A 2Y8YA 4KFBB 4CTAA 3QRQA 2POKA 2BM1A 1Q1KA 4QJVA 2CWKA 4F67A 1H2VZ 3LP2A 1F5CA 4RPFA 4RJVA 2HHWA 2UVRA 3IS9A 1NK8A 1P9QC 5CZXA 5GAEU 4L76A 1LWCB 1PG5B 3GJQB 3HVRA 1GMUA 2DYAA 2LXUA 3K89A 2ZH4A 3GJTB 2Y1IA 4FP9A 3R7BB 3CMQA 5E3PA 1XR5A 4KO0B 2DKOB 2HIYA 2EC2A 1FDNA 4ZHRA 4EEYA 5D0GA 3M6WA 3AQPA 4NLPA 1U49A 4Q0BA 2R8GA 3AB4B 4DV3J 1U02A 3G6YA 4PQUA 5KG6A 3EDRB 3T3FA 2UVWA 2YNGB 3HHKA 1ELOA 4P6QA 2YNFB 2XYHB 1Y9OA 5GAHU 2MZJA 4LF5F 2AJ1A 4MYTA 3NG8A 3EGZA 1B4SA 4TYBA 4NEYA 2FLLA 2MQOA 1HQ2A 4DR4F 2B8PA 5ETOA 4A8FA 2HYIB 4LBPA 1EX8A 2HFSA 2EXUA 1HQUB 1FFGB 3DI6A 4WFNQ 2R7TA 3C16A 3IM8A 3H2LA 2RJZA 2GZOA 2UUCF 2QE5A 4C11A 2VJVA 2CKWA 5D0EA 2E66A 1F9EB 4FS1A 2VPZB 5KFLA 1OY6A 1SC4B 1VQNS 1DURA 2HLTA 2E5JA 4QR1A 1UEVA 2ZEJA 1U8SA 1WEYA 3MGJA 2VFSA 1G4CA 3LPEA 4C97A 1BGXT 2ZITA 1V3RA 4JI1J 4H4KA 2WVEA 2RDIA 2RUGA 2D7SA 1M5PC 3I5CA 3LP0B 1U26A 3EPIA 2XNRA 1Y11A 2EEYA 1CS4B 2AGOA 4CTAB 2YNHB 1LWEA 5KFTA 2PA3A 5LL6d 4ITSA 3LP2B 3EUNA 4WIIA 3QWUA 3VAFA 2MLZA 3PX4A 3IS9B 3AODA 3CJRA 3EGWB 4FYYB 2X1FA 3KUHA 2ACYA 2KTQA 3O8WA 1CPZA 4WYWA 2AT1B 2R7QA 2MQNA 4GC7A 3BSAA 4C8LA 4RW8A 2FZKB 2YWKA 4OI3A 1NK5A 4ZHRB 2N4CA 3CJ4A 3PM9A 4NASA 1CQNA 4Q0BB 4FF3A 2W4DA 3VAHA 3WX8A 4DV7F 4PQUB 3PR4A 3HKWA 3T5HA 2DXFA 3CJKA 4H4OA 3CDBA 3UDCA 5K8OA 4FF1A 4D3HA 2I6WA 4BS2A 4L3KA 1GEHA 3BYRA 3BF4A 3DGVA 3B4DA 4YOEA 3LANA 1KVKA 5CYMA 4DU7A 5CHCB 5F9NA 4C98A 2XY6A 2IJRA 2V6AA 3T5KA 3SQGB 2KL8A 2H5JB 3KMQA 3DI6B 2NXNA 3N6MA 3C16B 3SXLA 1L3VA 1PYTA 1LWFB 4WZQA 2B7BB 1GH8A 1LFWA 4CZCA 5BXIA 2CIMA 3KTQA 2HWHA 4OYMA 2YWGA 3CE8A 4DPWA 3ZTPA 1RTIA 3M9NB 1TL7A 4IFVA 2KJWA 2KO1A 2NPFA 4TU9A 1RP5A 3N5FA 2HQIA 4NLVA 2APOA 4DV5F 1FI4A 4IFYA 1HIYA 2F3JA 3D66A 3IWNC 3SFGA 2N7YA 4DR4J 3C6UB 5F8JA 1G7CB 1MROA 3K7RA 3TR5A 1PBAA 1UPPA 1Q86T 3R2CJ 2N82B 1UVIA 4K4WA 3WBZA 4AD6A 1TAUA 3D1QA 1IWGA 1XEZA 2UUCJ 2FJVA 1GFWB 3ZZYA 2ZNYA 1LWEB 3H5UA 2I8EA 1P1TA 2ZBCA 4YB5A 2C3YA 2HRYA 1WTBA 2MZ1A 1WORA 1KD1T 4TY8A 3T9ZA 1X9WA 3P8BB 4FXDA 3K17A 3BJYA 4HKQA 3IA0A 3B78A 2KH9A 4NCAA 2FHMA 5DDOC 1S7IA 1Q79A 3J81j 5KG1A 3ZTOA 3KLVA 3MCNA 2EVZA 4NXNF 2IHR1 4X4NA 2GQQA 3H98A 1S1XA 1KNZA 1HNXF 2IDLA 3DNCA 2JVOA 2ACMA 1UFLA 2WVDA 4DX6A 3QO9A 5KTQA 3G6XA 3CJKB 3DGPA 4X65J 4MTPA 1ROFA 4H4OB 2UXBF 2FLOA 3UPFA 4QYZK 3JQKA 1Q5VA 4Q2MA 3F73A 2V5HG 1S97A 4RL1A 3OPKA 2AJ4A 5CYMB 2XNQA 4ILLA 3KDNA 3CSKA 2YQ1A 4U67Q 4E0DA 2XY7A 1IR2A 4NA2A 1ZTWA 1UJ4A 2DPJA 2AX1A 2H51B 2WVFA 4PABA 2QZ8A 2YKNA 2MHEA 3BQ1A 3H2UB 4CNYA 3M9OB 1U0HB 4DWIA 2RF2B 3W66A 2HLUA 3OXLA 1T9WA 1K1QA 2AF6A 1WUUA 1RA6A 4WPAA 4ZPTR 4R0JA 4DV7J 3BH6B 1N34J 1R8CA 2CPXA 1TL7B 2W9BA 2KVQE 4IFVB 3GV7B 2ZBPA 3PW0A 3Q22A 3SI8A 1SB6A 2KDOA 2ZH6A 3JXOA 4DR5J 4U6PA 4LSLB 1MROB 1OY9A 5ETPA 2N3LA 4QYZJ 3EJMA 5B0DA 4K0KF 2GV1A 4YB7A 4ED4A 4TY8B 4C0HA 4M8LA 4EO8A 3QSIA 1RT6A 2WSFC 3OJUA 1TKXA 3ZZUA 2XMVA 4LRAA 1EHWA 2M7SA 1FKPA 3AA8A 3GG1A 1LOUA 2LQ5A 4ILMA 4ECWA 1EZZB 3ZFVA 3M1VB 3L7OA 1SC6A 4DQSA 2RNEA 1RKJA 1NK0A 4OHVA 1X4HA 3G4SS 2FDNA 4JV0A 2YX4A 5HI7A 2KN4A 1SKUB 2XSJB 4F0MA 1YHQS 1S1XB 4C3MA 4JI3F 4DUYF 2ZHOA 3CD7A 1ZAWA 3T1YF 3QO9B 3CWJA 2V4QA 3RB4A 3FQKA 3DGPB 4B9TA 2E9TA 2YPYA 4UQTA 2NZCA 4NLRA 2DNRA 3I6PA 5HROA 4DV2J 3MAQA 3NGSA 1V3SA 2YKNB 3SEOA 3VAKA 4UUXA 3PR5B 3DU5A 2XSFA 4Z2XA 1X4FA 2IYIA 4LR9A 3PJXA 4F0HA 1SKRA 2VQFF 1ZM4A 2BBEA 4IDKB 4H4KC 3EPGA 3BS9A 2XZDB 1X5SA 4M1KA 4NYOA 3DRSB 2UXBJ 4RNNA 2W9BB 4HI1A 4QWAA 4EUVA 1ZETA 3PYFA 1EQ0A 2VICA 4RNHA 3I9ZA 3KLFA 7AT1B 3A8KA 1L3KA 2A2DA 1FJEB 2ZC3A 2SXLA 1FDAA 1RXOB 4DFJA 1SCJB 3FZ2A 3OSNA 5DGAA 2EG1A 4ZVTB 4ID5B 1HWJA 2HMIB 2BQRA 1EETA 5AXLA 2VC1A 4W4MA 2AWZA 4IH6A 4ZP9A 4JV1A 3B54A 5ITHA 4TQRA 2ZFHA 4ZPBA 4PWWA 1YZ6A 1TKXB 1FKPB 4XAKA 1SJRA 3THPA 2YKOA 1RU2A 4CT9A 1CJKB 2QLXA 1X5OA 2HSEB 4ERDA 2VDHA 2D3UA 2DGVA 2ZHAA 1WF2A 1MMLA 4DCJB 1X4BA 4BWJA 4USWA 2CPJA 3R5AA 3SFUA 5KFYA 3GP9A 3D54A 5JJBA 2A2CA 2UZAA 3W9JA 3Q8SB 1RWXB 5DDQC 3MPDA 1F60B 1GXLA 4K0KJ 1S57A 4PEOA 1D9FA 4HTIA 4B17A 2J6TA 5KFJA 1F0XA 3B4MA 3EVMA 2M52A 2DGQA 4B3MF 5J1EA 3OXFA 4DOZA 2DR7A 4OI0A 4XDDA 2VF3A 4QIFA 3VAIA 3V4IA 3QGGA 5HROB 5ETVA 5AXKA 1U45A 4K4ZA 4Y2IA 3CCES 5D77A 4WF9Q 2ZH8A 3BM7A 5B0BA 2BMBA 3MF5A 1C4AA 1JJCB 2P9EA 2AQ4A 2WW4A 3MR7A 3G8SA 3HSDA 4Y2CA 4KH0B 4JI3J 4LF6F 3CJ5A 4DUYJ 2BEFA 1VQLS 1S0OA 4DPYA 2IIHA 3T1YJ 2LCWA 4X64F 4KGXB 5SUHA 1OY8A 3K5PA 4ZIWA 1A7GE 2HEKA 2XEXA 2KXHA 1WSVA 2RQKA 4K59A 1HBNA 2MGZB 1B7FA 4HHHA 2Z2LA 2PI5A 2DNKA 3MPWA 3EX7B 1YBUA 5HAOA 3KLFB 4ZA1A 2OPRA 2IM0A 2RSQA 2JLFA 1YJUA 3RGIA 4A47A 4IYQA 5HL7Q 2JEFA 2WOMA 3MMBB 2C42A 3N4WA 4JP8A 4ZPCA 2DRAA 2XMWA 1EETB 2DISA 1FK9A 2VQFJ 1JJ4A 3ZZPA 2DXDA 2LA4A 2JEGA 2CJQA 4M5MA 3HJFA 4HEA9 1HW8A 1T9TA 5D3GA 5F8MA 4PR6A 2WW8A 1FJCA 3CNQP 2UV8G 1ZM3A 2RAQA 4NLSA 4J5OA 3W3SA 4NLOA 3TEGA 3R5CA 2ERRA 2CJKA 2IC3A 4R8UA 5FDLB 1VQYA 1JLGA 2QLWA 3HM9A 1X4GA 2YWEA 5K9FA 3OQ2A 2I9SA 1JXLA 1FF2A 4BBYA 2YWHA 4ANDA 4Y28C 2HBZB 4LT6A 3VGVA 3D5MA 1SUQA 1S9FA 4WK3A 3MM9A 4J9OA 1EIYB 3F41A 4P2XA 2D69A 2MSTA 5HLFB 3VAMA 3FCWA 3DLGA 3V4IB 4PYDA 5C2GA 5IXUA 1JLEA 4IOAQ 2I1RA 4C4WA 3AY0A 2AGQA 3V6DB 2FGOA 4RW4A 2AYBA 1OSCA 4WFYA 2MKSA 4BDPA 4PG8A 1ZYQA 4ZLLA 2BQ3A 4MIWA 5E0OA 1FRXA 3C66A 1T9UA 5ETSA 3PW4A 2ZZNA 4FXVA 2MJUA 3GWCA 3CCQS 2D3OR 2LMIA 2ZM6F 4YHHF 3UD3P 5ETMA 1WI6A 1BMQB 2Q1LA 2OIHA 3PRBA 3TO8A 5I3PA 1DTQB 4B3MJ 3RR7A 4ECSA 2O1PA 5HANA 1M5VC 5D0HA 1KFDA 2OPRB 4CI0B 4DSIA 4IRKA 3RTVA 2COLA 2MDAA 3SV3A 2LDYA 3C2PA 2WOMB 3KK1A 2E29A 3D3BJ 5MLCV 1SJ4P 4LRDA 4FZVA 2KVIA 3OHBA 2M8DB 4U9RA 4CLTA 1OQ3A 2AZ1A 3QT7A 1AB8A 2GFFA 4LF6J 3THTA 1DQ8A 4LSNA 1U7LA 3L4BC 4HI2A 2A3JA 3RBEA 2VONA 1WD6A 2IBKA 3BGRA 2UXDF 1KLMB 3QT8A 2E7WA 2WK4A 2ZOMA 2CJ9A 4F3QA 2IBOA 4DG1A 3NGRA 1PJ6A 1U6ZA 2DCLA 3ETOA 3T1HF 2IC3B 4R8UB 3DM2A 4O4GA 4PPZA 4LFCF 4RUAA 1JLGB 2XO7A 1P8GA 2XMMA 1KQKA 4QWBA 3PO4A 3CO0P 1SUQB 4DQQA 2XY5A 4MKYA 3MM9B 5DO2A 4F02A 3GG0A 2GHWA 2V8GA 4DF8A 2JZ5A 3M30A 2UUWA 4KJIA 2YQ3A 1NHKL 3DLGB 4EU0A 1RGVA 1FE4A 2Z4PA 3W5XA 1TKZA 2M9KA 1OYEA 3NEKA 2ZBQA 1N48A 3PZPA 4HHJA 2OEJA 4KIAA 3K5NA 3UN3A 3SCKE 1ZA1B 2RUSA 3O6QA 2D3ZA 2EG2A 1N6QA 5H9EK 1WHYA 2R7VA 5KFVA 4K7QA 3CDEA 2PMZD 3OTBA 5EWEA 1HARA 2HVIA 4NEZA 5KFHA 5IT4A 2YKMA 5CH7B 2RDDA 2KXNB 4K4YA 3M8RA 5KFQA 4ZCLA 1LW0A 4ZMMA 3Q86A 1HNVA 4F3MA 1X9MA 1R6VA 2MY8A 3LWMA 2UXCJ 4ECQA 3DN9A 4HACB 1VQ5S 2Y9HA 3ENQA 3KK1B 3KHLA 3MPYA 1N32F 1Z1ZA 3AA9A 1VQPS 4LFAF 3N28A 4FKYA 3PKMA 4YN3B 2B4OA 9ATCB 4W90B 4N77A 1N5VA 1ZZNA 2FHOB 3LWLA 4UY85 4YHHJ 1NPRA 3C15A 1RKIA 5KOXA 3D68A 5AE2A 7FD1A 3S1TA 1NEEA 2ATLA 3BGRB 1NJYA 2GGPA 1I6JA 2EKNA 4FF4A 4OZ3A 2KHDA 1EAYC 1KHWA 4RU9A 4Z37A 1QAIA 5H9EJ 3H25A 3Q2TC 2NUUG 3DM2B 2AIRB 4O4GB 4ZVQB 3TA1A 4WP8A 2OEMA 2FJAB 5IM0B 3JS9A 2CDQA 2MLYA 2O66A 2E44A 1QAXA 2C2RA 3HKZD 3TVKA 1Z4UA 5KFCA 4H54A 2W7AA 1IR0A 3IWLA 2FJDB 2HBQB 2XB2D 1UPMB 4O3PA 3UE2A 2HZCA 1OJ4A 2QYCA 2DR6A 3VALA 2HQDA 3D0GE 4NOHA 3I55S 2NYIA 1XMQJ 1TKZB 1ZZFA 2BW7A 3HSZA 1FXRA 1R8AA 2HNDA 1S1WA 3T1HJ 2J7UA 3UW1A 5F8HA 4ED6A 2DGWA 4GMKA 4ECXA 4QWCA 3GFXA 2X7IA 1S9EA 1ULRA 1FWPA 2GVDA 3Q0AA 1VLYA 1U1LA 5IC4B 1QVGR 3OR1A 4DSEA 3GFZA 1S77D 2AU0A 3QZ8A 4R5PA 5HQ8A 2YKMB 3FDSA 2BOPA 2Q79A 3M6VA 4MIAA 2BOAA 1JB0C 1HFEL 4CLWA 1HNVB 3TWZA 5B09A 1RA7A 4UTGA 1SH0A 2NXEA 2P6TA 2AYGA 1D1UA 1ZM9A 5FLXU 4QU7A 3SZ2A 1YJ7A 3AT1B 3ISND 1OIAA 1TMMA 4Y65A 4I7FB 2A6OA 3THVA 1D9DA 4DDFA 3W61A 4M5NA 2NPIA 4EK2A 5EHHA 1U1OA 3LW5C 3C15B 2J76E 4OX8A 1W2BR 1RWNB 1FNMA 4ECUA 4C9DA 1RWPB 2AYEA 4AYBD 4A4JA 1KEKA 2VD3A 2OTJS 4WP9A 3ZZRA 4S0MA 4QPTA 2JHEA 3RAQA 3GIKA 2KRRA 5LMUF 2W2OP 2IYGA 4F4AA 4L73A 1HHSA 3SSQA 3PV8A 3TAMA 1FRLA 3GYXB 3QNWB 2LEAA 1TVRB 1VQOS 4NLYA 1N88A 2NZ4A 3VHQA 3OBIA 2A18A 4N56A 1S1TA 5CAAA 2DGUA 2VBZA 3UD4P 1P1LA 1S9GA 2HVZA 3OT9A 1I94J 1KTQA 2KT2A 3HSJA 4KPYA 1KSPA 2HHTA 1ZPVA 4EGLA 2W4PA 2M0GB 2O3DA 3DOLA 3CJ8A 2HNDB 4UOFA 2EBGA 1S1WB 1NHVA 1HQEB 3RG6A 2W7OA 2QIFA 3D67A 3FKBA 1F3FA 5H9FK 4PPDA 1O8BA 1S9EB 1RT1A 5KG3A 3EVOA 1T0TV 2GVDB 2LEPA 2W2PP 4DL3A 1VJWA 3VGSA 2AP6A 3A8JA 1NK6A 4KPCA 1T9XA 4OZ2A 5KG7A 4R5PB 2CQIA 1SJ3P 2QYGA 4QIWD 1Z2LA 2J9CA 4MK9A 5L9XA 1NDCA 2QO3A 1PAEX 3JYTA 1FJGF 4NLXA 2PA8D 3L3CA 2OPQB 3UDLA 3UVJA 5D4NA 3LA0A 1JLCA 3GLJA 3JSRA 5AXMA 3U1LA 1NKEA 4X4PA 1QUVA 2HHVA 3I31A 3RRKA 3WQPA 2PO4A 4LSZB 2MQMA 3KYLA 2CPIA 3IMQJ 4DPTA 2BABA 3ENAA 3TVZA 4RW9A 3S7RA 1AXQA 4M5DA 5A0YA 2G0IA 1YG0A 5A8KA 3IFEA 3BO3A 4CT8A 1SH3A 4P74A 1WHWA 1HYSA 3SSRA 3N0VA 1VC6A 3GZ7A 3QLHA 3HCXA 1NDPA 4LVOP 2F1FA 4FNHA 1R89A 1VQMS 1YGYA 5KT6A 5DJBA 4JI4F 3PRDA 4OYXA 4B9NA 3MTJA 1FA0A 2UUAF 2PI4A 1S1VA 1GX6A 4Y00A 3TUPA 1LFPA 3LOUA 1S1TB 3IP0A 1ZTTA 1H2TZ 3I82A 4ECRA 2CWXA 3AOAA 4WXOA 5DZ7A 1UAWA 1S9GB 4PXBA 2DCUB 2D74B 5BYQA 3BKUA 5HATA 3V6JA 2DO4A 1PKUA 4P73A 4JYAF 1U25A 1RAEB 2FGCA 1SJ1A 4DPXA 6FD1A 1VLOA 4IRDA 4ZVSB 5I42B 1VS3A 5ETQA 1HBOB 1QSLA 2F5GA 2AJ2A 2JOQA 5KFBA 3TI0A 4CLFA 3R5BA 5LMUJ 2B43A 5CYJA 3W60A 4X4QA 4Y2MA 3NBPA 2HURA 2X3GA 5IQ6A 4IUFA 2DGTA 5CCMA 5EX3A 1XMOF 1WOSA 3CCZA 1B0TA 1RT1B 4MAKA 1QSSA 2CNKB 3RAMA 1IBCB 2KG1A 1S6PA 4WKRA 2VJUA 1SV5A 2NUHA 5KFUA 2DNYA 5LOQA 2KZZA 1WHVA 4BCAA 4I69A 2F4VF 5A8WA 3O3LA 1JLAA 2XWXA 3C3LA 4JUZA 1YRTA 2B7CB 1FT8A 1URRA 1IVZA 2P5VA 1Q5YA 1LK7A 2UUBF 1U2FA 1JLCB 1H7WA 3ZZOA 3FEZA 3I87A 1IXKA 4PXDA 2FJBB 1UFKA 1WF1A 1RK8A 4ICLB 2R7OA 3H90A 2ZH5A 3OVSA 2EFGA 2CG4A 2MHNA 3QIPA 1SC3B 1C0UA 4CNZA 5L1IA 4DSJA 4RW9B 1DLOA 2GIRA 4XPEA 5A0YB 5M2PA 3SYZA 4KV8B 1TKDA 3CMES 1HYSB 1FJGJ 3KK2A 1O0PA 5D78A 1S49A 3QLHB 3QZ7A 2FJXA 4AXIA 2QG9B 3W64A 5J2QA 4CYUA 3MXHP 1VHFA 4C7QA 1BQNB 3HSGA 3NXZA 4ZPVR 4LF7F 2D3O1 1S1VB 1SKSA 3PVXA 3BPDA 4OYIA 3BQ2A 2HRUA 1HL6A 4B3OA 1X31C 4NZ0A 4ILRA 1GAOA 3QAEA 2HVDA 1KTVA 4G6VB 1UVLA 2F65A 4B3RF 4Q8FA 1LNQA 3NP5A 8ATCB 2E5IA 1IBMF 4USVA 3JTNA 1GNKA 2KG0A 1CC7A 4KQZA 3MEDB 2XG8A 1RHRB 4OX6A 2R3VA 4WYLA 3NBPB 2M2BA 2B56A 1Y0HA 2R2RA 4JI4J 4NX9A 2DPIA 2UUAJ 3FRYA 3N79A 5KFSA 1E6YB 1PCAA 3Q8UA 2DIUA 3KUGA 1N36F 1YK9A 3ILJA 2NCKL 4PQAA 1S6PB 2VA2A 4A8MP 3IG1A 1N5TA 4ELTA 3A3NB 1OMSA 4XDCA 1SV5B 3ELHA 4JYAJ 3PTWA 2ZOFA 3CCSS 2QV6A 5FIIA 5B7WA 5CABA 3M8WA 1X5TA 4EYHB 3NS6A 5A8WB 1I5OB 4PXCA 2B9WA 2DHAA 1R3NA 5C5JA 4WFAQ 1JLBA 2FB0A 3R5JB 3DRRA 2KM8B 3IC1A 1RE1B 4QQBA 5HSPA 1CLFA 2VFRA 4HR2A 1U0SA 1EJ7L 2IRXA 4DFMA 3UCZP 3AQOA 3NCPA 5KFNA 4F8RA 1YJWS 1TK0A 1XMOJ 2ZZTA 1YJ9S 4YY3J 2ZKUA 1VCTA 5C42A 3IAS9 3CDWA 2OELA 2V94A 1CJVA 1FX2A 5KG2A 4DPOA 2FVCA 5I3QA 4ZN3A 4Q45A 4M5KA 1KQGB 4HHUA 1DLOB 1HR0F 2GW8A 3UNGC 4YDDB 2F4VJ 1T05B 4ATNA 3KK2B 1O51A 5HK4A 3NCQA 2DH9A 2HGMA 1K0VA 5J2QB 4YB1P 5B0FA 4CYUB 2UUBJ 1T9VA 4DSKA 2JX2A 4DZ6A 3UCGA 4ZLNA 1UW4A 4JB8B 2H5IB 4RW7A 3FSIA 4B3OB 4DR7F 3L7UA 4USMA 3TUZC 5JUMA 1TV6A 4O3RA 1ICEB 1REGX 1L5UA 3A13A 4C48A 2RS2A 2K3KA 1VQ8S 1PJ7A 3R1HA 4Y34A 4O3OA 3FRZA 3SSSA 3EM1A 3D6MB 4DLEA 3NY0A 2CJYB 4DZDA 1CJUA 1WKKA 1N5YA 4USIA 4KT0C 3JTPA 3QPIA 2K06A 3IR6B 1TL3A 4CO4A 3BR9A 1DAXA 1RBAA 5L38A 2XTJP 5HO4A 1MWZA 3US5A 1YJVA 2JLEA 2HVHA 1IM6A 2HHXA 3GIRA 3G86A 2PMWA 3KHRA 1UZHA 1KP6A 3H59A 1UA0A 3IG1B 2E9RX 3PYGA 3KLEB 5KFGA 1YVFA 2E7VA 2DHGA 2C3UA 3PHEA 1IBMJ 3MUMP 2ZKTA 4ZVPB 1JLBB 1IWAA 1WG1A 1A9NB 2BKOA 3GMGA 2H65B 3DRRB 3RUBL 5G0RA 2M8HA 1K73T 3OTCA 3J7YI 1WF0A 1S0NA 3TJ8A 3W9HA 1KHVA 1IM4A 4OJHA 1WJ9A 2IVMA 4GVBA 2RS8A 4B02A 1N36J 4CIOA 4A46A 2AEFA 3POTA 5T14A 1H74A 2PD1A 3ETMA 4ED0A 2JLGA 3RBDA 1YRXA 1RAIB 4XK8C 5IT9U 3WIUA 4OYOA 2UU9F 1GT8A 5F8GA 5HP1A 1LWXA 3U1NA 1QTNB 2PIIA 3GFYA 3QATA 2EK1A 3BDPA 3LQVA 1HMVA 4RW7B 3MR2A 5KT5A 1VQ6S 4LQ3A 1S79A 1X9SA 1J27A 4OZLA 4BWMA 4DHVA 3MUVP 2YWFA 1TV6B 3ZNUA 2QLBB 4ZP6A 2C3PA 1T11A 2VA3A 5DLFA 2I38A 1WTFA 2XGPA 4YP3A 2CVIA 2G9OA 3V6KA 3ZTQA 3ULHA 3BGLA 1HR0J 3DLHA 4O3NA 4HYKA 3HLUA 2KKHA 1TL3B 4WIQA 4J9KA 3TX8A 3RRGA 4PG5A 2JFDA 2CZVC 5LXYA 4IR1A 2CQBA 2W9AA 4ZPDA 4DV1F 3HI9A 3VZHA 1VFJA 2BRKA 2XS5A 5GAEI 1S4FA 2BANB 2OSQA 3UFCX 1AUSL 4DR7J 2RE1A 3CC7S 1U24A 4IH5A 2C28A 4DBQA 4KBIA 2BJ8A 1IKVA 2BA9A 1L3TA 3MEGA 1FRKA 1RT7A 4Z7YA 3OJSA 3HULA 4TNOA 4MKAA 2MZSA 2NLWA 2BXJA 4C3LA 3GILA 2CJBA 1M0SA 5G0RB 2MKKA 4ED5A 1SVDA 4J9MA 1Q7YT 3TAPA 3TZYA 3A12A 5D4PA 5GAHI 4C8NA 5EDWA 1N5QA 2C2MB 2BE7D 3K0JA 1R8HA 2W2MP 1BD6A 2FYXA 5AXNA 3EVWA 3DRXA 3RR8A 4GVBB 3PG9A 2HHUA 3M8YA 1RT2A 5IQQA 3IRXB 3POTB 4KFBA 2ZUGA 4G65A 1VMBA 3D28A 1AT1B 4DV3F 4U7UK 4OI2A 1RUSA 3CCVS 2GHPA 2IFXA 2HS0A 3CD5A 4MT1A 2QLJB 3HF5A 2UVUA 2VUGA 4OYBA 3PW2A 5HP1B 1BLUA 5J2MA 4NA3A 4B3TF 2CQDA 3KOAA 2OJ3A 2K7KA 3CC2S 2V9KA 2CJAA 1N8RT 2E1RA 2YNIA 1WELA 1QD1A 1HMVB 5KFIA 4C2MA 4KO0A 4WP3A 2F7VA 3H2VE 2OMLA 3M8ZA 3A1YG 1NB7A 3NWGA 1YI2S 2DITA 1D0EA 1DFDA 5IV4A 2Y1RI 3G8TA 1XTZA 1WG5A 3A4TA 1CG2A 1X5PA 1S6UA 2YNFA 2DEJA 4C0BA 1VC0A 1T7PA 5IWAF 2MKCA 2RH3A 3EXCX 2LVWA 1TZ0A 4F4XA 7FDRA 3OVBA 1M1KT 5GAGU 3QSYB 2WONA 3HVAA 3IR7B 4F25A 1U2RA 4WKYA 3MCMA 1RBLA 1RSCA 1HQUA 2ZH3A 3VVTA 4USTA 2CQ2A 1SQFA 3JSMA 5T7LA 2LFVA 4ES2A 3Q83A 1NO8A 1IKVB 1WC6A 1RT7B 2FVQA 1XR6A 1RWVB 1XWLA 1KQFB 2NR0A 5B0CA 2KFNA 4TQSA 3H5SA 3FZBA 5SZTA 4I4BA 3CEDA 3W1YC 2B5JB 4WTOB 3M05A 4RX6A 2GA7A 3UD5A 4LUBA 1RAGB 1YQHA 3BREA 1GMWD 1N0UA 1H6KX 4DV1J 4ECYA 4U95A 1O5JA 3QIDA 4DR1F 2B3TB 3V4MA 3H5YA 3AOCA 1R0AA 3QGHA 4I6WA 1SJQA 4CLKA 1VQKS 4KR0B 1N54B 5B0GA 1RT2B 1TMJA 3TEHB 4C8ZA 1CS4A 3HZEA 1FKAF 2CPHA 1KBRA 2YNHA 2R4FA 3CIMA 4OZJA 1S1UA 2F8HA 2R2TA 1S10A 3OXGA 1N56A 1NPKA 2IVYA 3FSYA 3UR0A 5J2MB 3GCXP 1EARA 2ZC4A 2KJVA 1TUVA 2ILZA 3HPOA 1O6XA 1HNIB 1ZOTA 2EKYA 2YNIB 4GC6A 2OEKA 1B3TA 1X60A 2CQ1A 4OHWA 2GS8A 3D7SB 3M8PA 1VQSA 4K4TA 5K8MA 1TUGB 1VK3A 4MIBA 2VFTA 1KFSA 3T6JA 5KFDA 3PRVA 1RAHB 1H3DA 2IA6A 1S72S 2DT9A 4ENOA 1VISA 1FWKA 2ROPA 1JIHA 5C25B 1AUDA 4RU2A 4CWBA 4V1Ak 2W9CA 4OV6A 4USUA 3FBFA 3R2DJ 3KLIA 1TL4A 4JI6J 2VU5A 4B3TJ 5KAKA 4LBHA 3UO0A 4X4UA 2CADA 2HS3A 2AMCB 2WONB 2PFFB 2GAHC 2DNNA 4RNOA 4ES3A 1P6TA 3MMCA 3SQGA 5GMEA 3DLLQ 4EMDA 3IGVA 1RWKB 4DLGA 5GVQA 4PWDB 5EGYA 1Q78A 4AUKA 2YX1A 4K2JA 4URQU 1TL1A 3JSMB 5T7LB 4M5JA 1LWFA 1T8EA 4LF8F 3UR3C 5J2NA 3FNNA 4KY3A 5AE3A 1PAUB 2ABYA 2Y1LB 1B99A 3DRPA 4EZ9A 3LUYA 2HVEA 3KHGA 4YMEA 2BKPA 4ED1A 3DDNA 2V8HA 1XBWA 5IWAJ 2MB0B 4NLWA 2OKQA 5EX0A 1F5BA 4J9PA 1ACMB 4YR2A 3D0HE 1YTYA 4GRSA 1R0AB 3M6UA 3C6UA 1S76D 3DLBA 4MKVA 1W26A 3OFGA 1C4CA 1EKSA 4EWTA 1X4DA 1SKWA 5L1LA 4KGVB 1OPZA 2XGQA 5KT7A 4Z7CA 4N8NA 1IBKF 4PG4A 4X65F 1S1UB 3HFVA 2QGFB 4NLGA 3MWBA 2VASA 2VOPA 1H7XA 4TY9A 1VR6A 1Q81T 1WEZA 3FEYB 5A6PA 1TQLA 3RZAA 3K57A 4EBDA 2MPUA 4KH1B 4LJMA 5E3AA 3KG4A 4UQGA 2YQ0A 4NA1A 1IJEB 3MTKA 3R27A 3HHLC 4I64A 4PYAA 1UVJA 2J6UA 4DR1J 2F4FA 3OFFA 4DEZA 1RADB 2OLWA 2BM0A 2WVBA 1JLQB 3M8PB 4E2FB 1A6LA 2LYVA 3AD7C 2I0XA 4ZCKA 4USHA 4WK1A 4IO1A 2ZH7A 2P6SA 4CO1A 1N34F 4M5HA 3TJAA 3J81Y 3G6VA 2W9CB 1YX2A 3DRYA 4AT1B 4CLLA 3KLIB 5IS2A 3CCTA 3M8SA 1YJRA 4QR2A 4DR5F 2H4WB 3MMCB 4DV6F 5KOWA 3KKFA 3OFHA 1TL1B 1GK8A 4FYWB 4E98A 1U0HA 2RF2A 4O4RA 3AD8C 2JL9A 2K8GA 4NMXA 5D0RA 5J2NB 1GTEA 1JNZB 2OD6A 2E5GA 2V69A 3DRPB 2AKWB 2OO4A 4LF4F 1FNOA 2ATCB 2OD4A 3AJ2A 3OSPA 2VQEF 2CPZA 2KFYA 3KLGA 4PRFA 2WCXA 2HQ3A 1GXTA 1RTJA 1XERA 1FWLA 4DUZF 2ADCA 1U1RA 2M70A 1LXJA 2IJNA 2ZWOA 4PAAA 4X66F 3Q89A 4LSLA 4M5GA 3NNAA 3CMAS 2V0NA 2DIVA 5DZ6A 1P27B 4QWDA 1NPPA 3CCUS 1KS2A 2U1AA 2PDAA 4ECZA 5D8HB 4LF8J 3TOQA 1T3NA 3G82A 3DCAA 4I56A 2XS7A 4I67A 1NUEA 1UWAA 2EFNA 3RAXA 4DSLA 4TKTA 5DG9A 1FXLA 3MM5A 3Q24A 2BRLA 3KWMA 3HO1A 4DV2F 1MN7A 1D8YA 5IC6B 4P2MA 5ETKA 2LEBA 3M1VA 3QJPA 1W25A 2W2NP 2KHCA 3OL7A 1U6BA 2MMYA 2IY5B 2DNLA 4LQ9A 2B4PA 1GMWA 3TA2A 4ID8A 4BHQA 5A6WA 2X3DA 3PNIA 2DNPA 2XMKA 2XSJA 3PJWA 3KLHA 1WDTA 3I5AA 3MECA 3GPAA 3NCRA 4PUOA 4I2QA 1RJJA 3BQ0A 2X1GA 1IBKJ 1WC5A 1U4BA 4RBTA 1REVA 2YKQA 4KSEB 1Q7LB 3MMJA 2BJ7A 2MQPA 2VKRA 2XI2A 1PGZA 3QBCA 2ZD1A 1KONA 3RYLA 3VTIA 1HWUA 5K8PA 1WACA 3CJSA 5FLXY 2BJ1A 4ECTA 4C0OC 4H4MA 2MKYA 1UEUA 2DY1A 3M2RA 1UP1A 2QA2A 2HK3A 4IDKA 3X1LB 3MDFA 3MOZA 4NE9C 1MMNA 2J6SA 3DRSA 2MSSA 3GSIA 1PILA 4BC7A 3D2WA 4WFBQ 3KLGB 5E7OB 1RTJB 3FCHA 4CM2A 2L9WA 4NPOA 3W8PA 3BDEA 4DV0F 3H4BA 4I68A 4DV6J 3JB9k 1HW9A 4OZ0A 1WI8A 2H4YB 3HZGA 4ID5A 3DDIA 2HMIA 2QJ3A 1FVSA 2DH8A 4Q44A 5K20B 2K3IA 5IV3A 4XPCA 4OYZA 1UVNA 3G82B 2RMLA 2HS4A 5E3RA 1M5KC 2GNKA 3O2IA 1VRTB 5LSOA 3BPSP 3QJLA 3OTEA 1S6QA 1V3ZA 4N8OA 4IOBA 2C2ZB 2GCFA 1PYSB 4N5SA 2LP4A 1F5AA 4LF4J 3Q8QB 3MM5B 2R7XA 4ZVUB 4JI8F 3MHYA 4GVLA 5C24A 1VRUA 2VQEJ 1VQ9S 4A8QA 1CJKA 2XULA 2PC6A 5GADI 4F50A 3K8VA 3R7NB 3G87A 2MZRA 4J9RA 4DUZJ 4KHMA 2H54B 2B6AA 4X66J 4A8SA 4IRCA 3QRRA 3CIZA 9RUBA 1EKRA 1HWKA 5MAOA 3OTOJ 3KLHB 3TUJC 1SJFA 2AW0A 3MECB 3LALA 4PUOB 1YRUA 1VIXA 4I2QB 3FVYA 2G2ZA 2BKNA 4OV1A 1V5VA 3MCOA 2EBEA 2M88A 1XJWB 1XNQF 1M1HA 4LRCA 2XBPA 5HQMA 1REVB 3MI7X 3V2UC 1QUPA 4K2XA 2JDJA 4X2BA 1TFYA 1R7IA 2VG7A 2DH7A 2IRUA 4N7TA 4RLEA 3IBCB 1JJ2R 3ZZTA 4QIVA 4FYDA 4W98A 2ZD1B 2J7KA 1TP7A 1S5ZA 2CQPA 4HH0A 5KFPA 2PT0A 1P9YA 3SMZA 3QWPA 2EFVA 3PX6A 4OX7A 5IFMA 4MMOA 1XR7A 2FLNA 4USKA 4H4MB 3M2RB 3NGUA 3T41A 2QL5B 1RAFB 2DNMA 2FHJD 2XO6A 3VV2B 3GCWP 2EWHA 2HG4A 2GC8A 1KC8T 1G1XA 1VOMA 2CPDA 2CQ0A 2WSEC 2QN6B 1RTDA 3VQSA 3MZIA 3DKDA 2VKZG 2MGZA 4WXWA 4UZCA 2G4BA 2C2OB 2R8JA 2RRAA 4TU8A 3ZNJ1 4F7VA 5AE1A 1YJTA 1TELA 3TA0A 5M2UA 3OLAA 1BY9A 4AL5A 3CD6S 4RUHA 2OGUA 3ZTSA 3MMBA 2B9EA 2YTCA 4ES1A 4LF2A 1FKOA 1S6QB 4A48A 1FESA 3L7PA 3MD1A 4KRWA 1S48A 2HFOA 2LDIA 5DG7A 3MR3A 3MM8A 4LF9J 5HVHA 5C24B 1VRUB 2MQLA 3MFIA 2V68A 5DDRC 4URGA 3LO3A 3RU0A 2HNYB 2OUGA 2O01C 4Q5VA 1NH7A 4DL6A 1VBKA 3GSDA 2JH3A 4P7TA 5HJXA 2B6AB 1EB0A 2DNGA 4DV0J 2RHQB 5EWGA 3CDUA 1SIZA 4OYWA 5FDLA 4NWBA 1JXEA 2DHHA 2HK2A 2XM3A 3O1LA 3S6EA 2M3DA 5J1PA 1TFWA 2IRYA 3DHWC 2OPSA 1NCLA 2HHQA 2QC3A 4KHRA 4K4XA 2QT7A 1VQ7S 5HLFA 1RTHA 3VAGA 4NCGA 1SI9A 3MMAA 2H1YA 3PKYA 1VI7A 4JI8J 2VG7B 3O44A 1Q8IA 5DGBA 3PXGa 4NI2B 1YJNS 3FMBA 2NS1B 5KG0A 1HD0A 2CQ3A 4UZBA 4WFXA 3V6DA 1VQ4S 1LKZA 2XYPB 1KWMA 2RHSB 4O3QA 2QA4G 4OZ5A 3T9NA 4ALZA 4F2SA 4DR2F 1U1MA 3D3CJ 1IJFB 1WC0A 1RT5A 2CPFA 2V4RA 3EWGA 2FLPA 2RU3A 3E01A 1RAJA 4P52A 3PO5A 4NZ7A 1XNQJ 3OUYB 3NOCA 4HTJA 2VIHA 1RTDB 1DTQA 4LR8A 1NJZA 1UFWA 2F8EX 3PYDA 1RLCL 2OFHX 2HGLA 5B0EA 2X1AA 1W2IA 2B51A 4NLQA 3UN5A 4N47A 1RYSA 5K14A 4CLZA 4F36A 4DV4J 3SCJE 2QX0A 1HKAA 2HZAA 1XMBA 3ZO7A 2GX8A 1FKOB 4RWWA 2HHPA 1Y5LB 4NLDA 4DL7A 5C2CA 3MM8B 3R9LA 1D9AA 2UP1A 3OFEA 1KLMA 2FVSA 1HA1A 1XNRJ 3BBCA 2A1BA 2FVRA 1U1PA 3P3DA 4Y3CA 1UJ5A 2YKAA 1BWVA 3HMJG 5FD1A 2D9PA 1H38A 1X4EA 5KFMA 2OPSB 3CULA 5HMZA 2RIJA 3MM6B 4Q7AA 2DJWA 1N4LA 1PYOB 4DQRA 1WOOA 5DS7A 3VWSA 1RTHB 3NOGA 4NCGB 2UUTA 3AXKA 3MMAB 3HXMA 1VRQC 3UI3A 3G6ES 2EC0A 2IM3A 3BBBA 2DHXA 1SL0A 2C2KB 5LXRA 2UXCF 1FD8A 4UOCA 5A2QY 4ZJLA 4DFKA 2F8MA 2ALYB 3A8IA 1GMVA 3KDOA 3R8YA 1SC1B 1RWUA 2Z57B 4ZCMA 2DGXA 1FRMA 1QAYA 1ZM2A 1YITS 1RT5B 3M8QA 3E01B 4DQIA 2MQ8A 3FBEA 3U1MA 1NJXA 2VFUA 5B0AA 4RBUA 4O0IA 3TZWA 1S0MA 5J1NA 4QBUA 3GQCA 4NLUA 3Q8PB 4A8YA 2LU1A 1R43A 3I4PA 1YBAA 2ZNZA 5F0WA 4OX9J 1TKTB 2JNJA 1HBMB 4I0WA 2IDEA 4DS4A 1VDHA 1QY7A 4HACA 4AL6A 1IN0A 2ROEA 1WHXA 2ADBA 5ETTA 2MJNA 5AT1B 4U96A 2VFVA 4DR2J 3E3XA 5K14B 3KJVB 1F2GA 2Z8QA 5KFOA 3SCLE 4UW2A 4KYZA 4U7CA 3CW2C 3D6FB 2XHCA 2Y1JA 3QQCD 3RW7A 1JWWA 2FHJA 3AJ1A 3W7BA 5KT2A 1XMQF 4Q8EA 1RWWB 4HT7A 1NSAA 2F63A 3HFZB 4K8RA 2W1BA 2V34A 3NS7B 4WBFA 4K50A 1F9HA 2JVRA
chains in the Genus database with same CATH topology
2DR8A 1K73T 4KC5A 2DNRA 3I6PA 5IM0A 3OTCA 3J7YI 5HROA 4FBUA 3MEEB 1WF0A 3HVWA 1S0NA 1Y3JA 1QTMA 1AROP 3MAQA 1KHVA 2WBRA 1I1GA 1IM4A 1FDBA 4OJHA 1OQ6A 1S7HA 4WCEQ 2BDPA 1XK8A 2IVMA 5F0UA 3OL6A 1V3SA 2YKNB 3SEOA 3VAKA 3MR5A 1N52B 4ETXA 4UUXA 5G4DA 3PR5B 3DU5A 2XSFA 3TAMB 4Z2XA 4CH1A 1LW2A 2RS8A 4F2RA 4EYIB 2V4JA 1IBLF 1X4FA 2IYIA 2YY3A 3PJXA 4B02A 1C1BA 3IN5A 2VQFF 1SKRA 3G9CA 1ZM4A 4CIOA 5HBMA 4A46A 3POTA 1KOHA 5T14A 3LH2S 2VH7A 3KK3A 3OTDA 2HNZA 2PD1A 2AJ0A 3JTOA 2BBEA 2EPIA 4IDKB 4YQWA 4AQYF 3F44A 3EYZA 4ED0A 2NQPA 4H4KC 2RDJA 5L1JA 2PE8A 4YR0A 2JLGA 3RBDA 3EPGA 1IKYA 3BS9A 1DQAA 1YRXA 1X5SA 1NKCA 4XK8C 4M1KA 3NGDA 4NYOA 2XLIA 3MEKA 2GQ2A 4MK7A 3DRSB 2HHHF 3ITHB 2WTFA 2J0QD 2UU9F 1GT8A 4RNNA 2W9BB 5F8GA 5HP1A 3E8OA 4HI1A 4OHXA 3U1NA 4QWAA 4LIWA 4AFFA 2J8AA 4EUVA 2GQCA 4UY8T 3N9UC 3I0SA 2DNZA 2PIIA 4P2SA 2C3MA 1ZETA 2WB4A 3R5DA 1FRHA 3GFYA 3T5JA 1UL3A 4RNHA 5E3CA 3ZZ0A 1HHTP 2EK1A 3I9ZA 5H1SV 3KLFA 2R8HA 3BDPA 4G3IA 4IH7A 5I4MA 5E41A 1L3KA 3DOLB 2A2DA 1HMVA 2ZDPA 3LQVA 4RW7B 3MR2A 2ZC3A 4IQMA 2O67A 2AX0A 2SXLA 4DMZA 5KT5A 4CO3A 4FS2A 1VQ6S 1FDAA 3M8QB 4LQ3A 1S79A 1X9SA 2LXIA 4DFJA 4OZLA 4BWMA 4DHVA 3FZ2A 3MUVP 2ZZMA 3OSNA 2V2KA 5DGAA 2CQCA 2WBMA 2YWFA 1TV6B 2EG1A 3WZ0A 1FRIA 4QZVB 4ID5B 2FD2A 1HWJA 2HMIB 3WC2A 4RNMA 2BQRA 3KFWX 1EETA 4F4YA 3MPVA 3S8SA 3C46A 4ZP6A 2E5HA 2C3PA 2E1MC 2X51A 4MFBB 5HN0A 2E1CA 3BO2A 2VA3A 4NXMF 5DLFA 1N0VC 2GMJA 2AJFE 2I38A 2DVIA 1WTFA 5F3ZA 5AXLA 2UVVA 2XGPA 4YP3A 2VC1A 2MY7A 2CVIA 2G0CA 3NAIA 4FVCA 2PSZA 2W8LA 2G9OA 3V6KA 1WNEA 4F26A 4XIUA 2AWZA 3ULHA 3BGLA 4IH6A 4ZP9A 4DFPA 3DLHA 4JV1A 4O3NA 5ITHA 4HYKA 4TQRA 3HLUA 1GXUA 2ZFHA 2B4VA 2KKHA 4ZPBA 5I3UA 5IT9Y 2QMWA 3VQTA 2C22A 1TL3B 4WU2A 1TKXB 1ZBTA 2FJWA 4OHZA 4J9KA 1FKPB 3H5XA 4XAKA 3TX8A 1SJRA 3RRGA 1NK4A 3THPA 2YKOA 3PFEA 4PG5A 2JFDA 4CT9A 3BSOA 2CZVC 2VG6A 5LXYA 1FVQA 2QLXA 4IR1A 4IO9Q 1U09A 1X5OA 2CQBA 3PEJA 2W9AA 2RRBA 4ZPDA 4ERDA 3JYTB 3HI9A 4DV1F 2K1RA 4ZLPA 3VZHA 1VFJA 2D3UA 2DGVA 2ZHAA 1K9MT 2BRKA 1WF2A 4DQPA 2XS5A 4NZ6A 5GAEI 1S4FA 4I7FA 4RZRA 4K5RA 2BANB 1M5HA 2OSQA 4FN5A 3UFCX 1MMLA 2GO8A 1SH2A 4IR9A 1X4BA 4BWJA 4B9LA 3FFIA 2CPJA 2RE1A 3M2VB 3CC7S 3R5AA 3SFUA 5KFYA 1U24A 1I94F 4IH5A 3I5BA 3D54A 5JJBA 3MFHA 2C28A 2A2CA 2UZAA 4DBQA 3NNHA 4KKOB 4ZPAA 4KBIA 2KXFA 3Q8SB 2RQCA 1IKVA 3HDSA 2BA9A 4MK8A 5L8RC 5DDQC 1L3TA 4OHYA 2O5DA 3MEGA 1F60B 1FRKA 1RT7A 1GXLA 2KI2A 2C3OA 4K4VA 4IG0A 1D9FA 4HTIA 2XLJA 4B17A 2J6TA 3OJSA 2GJ2A 5KFJA 1F0XA 3B4MA 3DLKA 4TNOA 4MKAA 2M52A 2DGQA 3DLEA 2MZSA 3HHLD 2NLWA 2BXJA 4C3LA 3GE9A 3GILA 4B3MF 4B08A 2R7WA 4C11B 2YVSA 5J1EA 3OXFA 4DOZA 2DR7A 2CJBA 1M0SA 1MU2A 4XDDA 1RISA 5G0RB 4DS5A 2WB1D 4OI0A 2MKKA 4WZMA 4DL5A 3Q23A 4ED5A 2KYZA 3GR0A 4QIFA 4A8XA 4M5DB 3VAIA 3V4IA 4J9MA 1Q7YT 3QGPA 5A8KB 3TAPA 2ZHBA 5D4PA 3QGGA 4A8OA 5HROB 2BACA 4OFZA 5GAHI 1VGYA 3N6LA 5CYQA 4C8NA 2F9DA 1TVRA 4URSA 5EDWA 5KFWA 3G71S 1X4AA 5AXKA 4F4ZA 1U45A 4K4ZA 4Y2IA 3CCES 1N5QA 3GIIA 4QIGA 5D77A 3K0JA 4WF9Q 1R8HA 2ZH8A 1BD6A 1U1KA 3BM7A 2H9ZA 5AXNA 5B0BA 3DRXA 5E2QA 3MF5A 1C4AA 3RR8A 1KR4A 5B08A 2YKPA 2VOOA 2P9EA 1G3OA 3CUNA 4J9QA 2AQ4A 1LW2B 2V4JB 3CGIA 2HHUA 1WG4A 1T03A 1C1BB 1RT2A 5IQQA 3G8SA 5HBMB 1R8PA 2FC9A 3K2YA 3IRXB 3POTB 3KK3B 4KFBA 2ZUGA 4Y2CA 4E8UA 2HNZB 1FEEA 1VMBA 2XMJA 1L3UA 4LF6F 3CJ5A 3D28A 3OW2R 2EFPA 3ICLA 4DV3F 1VQLS 4U7UK 1S0OA 2DBBA 4OI2A 1IKYB 1HI8A 5F3TA 3GIJA 2CPEA 2LCWA 1NZAA 2GO9A 3CCVS 2GHPA 2QFJA 2IFXA 4X64F 3CO9A 2HS0A 5SUHA 1RT4A 4N41A 4Q43A 3CD5A 3K5PA 3R3TA 2LQ9A 3HF5A 3I4HX 2FVPA 2UVUA 2E7XA 2VUGA 2XMUA 1A7GE 4C8OA 2ASDA 3PW2A 5HP1B 2XEXA 2KXHA 1BLUA 1BWEA 2RQKA 1NK9A 4K59A 5J2MA 1HBNA 4NA3A 2MGZB 1B7FA 3FEXB 3I0SB 3PEHA 4B3TF 2CQDA 3KOAA 1HQEA 3MM7A 2OJ3A 4I6AA 2Z2LA 3OTOF 1N33F 2PI5A 2CFXA 2CPYA 2K7KA 3CDAA 2DNKA 3M32A 3MPWA 3CC2S 2V9KA 1PSDA 3EX7B 3KLFB 2JEIA 2CJAA 1N8RT 4ZA1A 1FE0A 2E1RA 2OPRA 3TNVA 2IM0A 2YNIA 1SQEA 1WELA 3K5LA 2RSQA 1HMVB 4MKBA 2JLFA 5KFIA 4C2MA 3FQLA 1GTHA 3B82A 1YJUA 2DGOA 1RT3A 4KO0A 4WFZA 4ZDNA 4A47A 4G1QA 4DF4A 4IYQA 2F7VA 3H2VE 4LIRA 2OMLA 2WOMA 5HL7Q 2JEFA 3CCJS 3A1YG 1VRTA 1BQXA 3MMBB 2C42A 2N3OA 3N4WA 1X8DA 4OIXA 4YDXA 1NB7A 3NWGA 1YI2S 4ZPCA 2DRAA 2XMWA 1EETB 2BE2A 2DISA 3AH6A 2DITA 3KMSA 1LK5A 4RWXA 1D0EA 1FK9A 1JJ4A 1DFDA 3PW7A 4RW8B 1M90T 3ZZPA 2G1DA 2Y1RI 4NYZA 1SL1A 3G8TA 1XTZA 1WG5A 2LA4A 1FJEB 2JEGA 2CJQA 4Y2AA 2LU2A 1CG2A 1X5PA 2XCAA 1S6UA 2KB2A 2YNFA 4ED3A 1IQZA 4ZK7M 1H98A 4C0BA 3SCIE 5I3UB 1OSDA 3HJFA 1AW0A 4HEA9 4JI7F 1FXDA 1HW8A 5D3GA 1Y4ZB 3B8HA 3CTRA 1VC0A 3NL0A 5F8MA 1T7PA 4PR6A 5IWAF 5J2PA 2K2PA 2MKCA 2FPHX 2RH3A 3EXCX 2LVWA 1CSJA 3OVAA 3EGNA 1TZ0A 2WW8A 4F4XA 4QIEA 1FJCA 2UV8G 1ZM3A 2VG6B 1KVIA 7FDRA 2OPQA 4NLSA 1C1CA 3OVBA 1FRJA 4J5OA 1UVMA 3W3SA 4NLOA 2K1RB 1B0VA 3HHNB 1IKXA 2XWYA