1S7EA

Solution structure of hnf-6
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
147
structure length
147
Chain Sequence
EINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the hepatocyte nuclear factor 6alpha and its interaction with DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Hepatocyte nuclear factor 6
total genus 23
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2004-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1s7eA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1s7eA01
4IEJA 4C3HJ 2EZKA 3VPRA 1WCMJ 4XRSG 2HOTA 3HOVJ 3TP0A 3S1QJ 1R69A 1ZUGA 4X4BA 1UG2A 3BTIA 3S1RJ 5IYBJ 2Y9ZA 1B72A 2GLOA 2AW6A 3IH3A 1QRYA 2HINA 1ETQA 3GTJJ 3RQIA 1TWGJ 3IV5A 2OR1L 3OIOA 5EEAA 5IOYA 1YSEA 4I6UA 3GTLJ 3SCFA 3IH4A 3CROL 1BJZA 4MFEA 3CQZJ 5EG0B 2NVXJ 1HCRA 1JH9A 2TCTA 2LTPA 4FE7A 1NK3P 4A93J 5EGOB 1W0UA 4RBOA 3UKGA 1RIOA 3QYXA 4G12A 3ZKCA 1F43A 1UXCA 4ABZA 4Y52J 3OMTA 1WH5A 2X6OA 1IUFA 5FKMA 2LCVA 2BJCA 2L7MP 4FCYA 4V2GA 4DYQA 1Z0XA 3KZ3A 1GDTA 4X4CA 1CQTA 4Z5CA 3FKIJ 4NDLA 1XS9A 1ZS4A 1WGXA 5M3MJ 3HOXJ 1D5YA 1X58A 2VUMJ 1ETYA 5F0FA 2GRLA 1B8IB 3H5TA 2LYSA 2XPUA 4F8DA 4M3FA 4M3DA 2XSDC 2IUOA 2L8NA 4BY7J 3OQNA 5K98B 1PRUA 2R93J 4JCYA 4Y42A 2PUGA 3TW7A 5FLVA 1XG1A 3H0GJ 3BQZA 5EGOA 2JA7J 1RKWA 1JJ8C 4DW6A 4IWRA 2IV1A 2LYPA 3TP3A 4XIDA 5F27A 3S17J 3S16J 1HDPA 4YG7B 1IGNA 1RZRA 4DYCA 2L0KA 1TWFJ 5EF6A 2ME0A 1FJLA 3LSGA 1ZZ9A 1JUPA 2DA6A 3NARA 3BR6A 1HDDC 1WH6A 4V2FA 2X48A 2H8RA 3O8HA 1LLIA 2DMQA 2IEKA 1ZQ3P 5IP7J 4W1UA 1VNDA 2MEZA 4FN3A 4IA8A 3QQAA 5F04A 1AKHB 4JX5A 1ETKA 2N8GA 5FKNA 2AXUA 3CMYA 2LYLA 2I10A 2P81A 4C2MJ 3PO2J 1HF0A 4M3GA 1JUSA 5EG0A 5DS9A 3G7DA 1RPWA 2Y0SN 4RDUA 1ZZCA 5J1UA 4X4EA 4JQDA 3LSPA 2XI8A 5FLMJ 1R63A 1RZSA 1NERA 3E7LA 5F1JA 1MBJA 3BTJA 3JRBA 1F36A 2HOAA 3LNQA 3GBFA 3MLFA 4FBIA 2HOSA 1ETVA 4MIMA 5C4XJ 4QIWN 4JCXA 3HZIB 5IPAA 2M2EA 4FISA 4X4GA 5FKOA 1S7EA 1U9NA 4GFBA 5F0HA 1WH7A 4BBRJ 3CCYA 1MBEA 2ECCA 1UTXA 1OCPA 3G1OA 3JRDA 2AUWA 2LYJA 2XJ3A 5EYRA 4PU4C 4XRSA 3PO3J 1OJLA 2EWTA 2ELKA 2IU7A 3D1NI 1FEXA 1JTYA 1DU0A 1ZAYA 1T33A 1HLVA 4X4FA 4A3JJ 3A01A 1NEQA 2WAQN 2IAIA 2IVGA 3JXDL 2XB0X 3U3WA 3H3VK 5JLWA 3RZDJ 3GTGJ 2DN0A 3IVPA 2EZHA 3EUSA 1TWHJ 1AHDP 3G1LA 5K7HA 1U9OA 1JWLA 1JFSA 1XWRA 2ICTA 5A7LA 1SFOJ 2EH3A 2M8GX 3ZHIA 1ORKA 4A69C 2OF7A 4IHVA 5FKKA 3MKLA 5DTDA 4A3LJ 3SCGA 1MH3A 1GUUA 2M34A 2K9SA 1ZZBA 3QF3A 4XK4A 1ZKGA 1ZVVA 2NOGA 4DYRA 2JVLA 4MLOA 3F6WA 3HKZN 4M3EA 3OOUA 2W48A 1H8AC 3UFDA 2HXOA 2LYRA 3LSJA 4OB4A 4DZJA 2LP0A 1BDIA 1ZK8A 1X2NA 1POUA 3LSRA 2L49A 4EEFG 2KEJA 1IJWC 3BG9A 1LE8B 1QVTA 1JKPC 1YRNA 2PPXA 2WUSR 1APLC 2FX0A 3CDLA 2JWTA 5FJ8J 3OQOA 1T56A 1IV6A 3BG5A 2MSYA 3SCHA 2GBYA 5IYCJ 2X9DA 3BTCA 1Y9QA 1MBKA 3GBGA 2Y30A 4X4HA 1IRZA 4MFDA 2XRLA 2ZB9A 3HEFA 3FYMA 1SQ8A 5C3EJ 2RAEA 3BR1A 3QPSA 2YS9A 3GTKJ 5IP6A 2EBYA 2GZUA 4C3JJ 2E19A 4W97A 2ICPA 1QP4A 1PRAA 2JA8J 1GV5A 1GV2A 3S2HJ 3S8QA 3G1MA 3S14J 4A3GJ 2XB5A 2CRGA 2Y9YA 3A02A 4CYCB 3L1PA 2ECBA 2WV1A 1ETOA 1JKOC 1WETA 5GPAA 5K7FA 2R5YB 2BNMA 3OSFA 3ZQLA 1JKQC 4UUSA 2YUSA 2R63A 1I3QJ 1A5JA 2DJNA 3SDGA 2HSGA 2B63J 3OQMA 1U8BA 3Q3SA 2PIJA 2CQXA 2EZIA 3HB9A 1O4XA 1G2HA 3JRCA 4Z58A 1TWCJ 2JA6J 1PRVA 3ZQHA 4B3AA 1ENHA 2EBIA 2E2JJ 3R1FA 2PUEA 5M5XJ 2LYQA 5IYDJ 1Y1VJ 3FIWA 3M3YJ 1PUFB 1B72B 4IHXA 3B6CA 1X2MA 1RETA 2QF7A 2XPVA 2PUDA 5F0CA 1WIZA 2CU7A 3BR0A 1RESA 4CYCA 4Z59A 1ZZ8A 3ZQFA 2O7OA 5GP9A 1FTZA 1B0NA 5GPCA 2VKVA 2LYKA 5HODA 2LFBA 2R0QC 2XCJA 4JYKA 4J19A 3OSGA 2B5AA 2KPJA 3BS3A 4D7MA 3KJXA 4A3BJ 2HQ5A 2HYJA 4BKXA 2JK3A 2FJRA 3JRFA 4GHJA 2DMUA 3MVPA 4IHYA 2R5ZA 1AKHA 4MCTA 1LCDA 2R5YA 2EZLA 3HOWJ 1GT0C 3GTOJ 4O8BA 3QPLA 3GTMJ 2KDZA 1SANA 3OP9A 2O9LA 1PUFA 1CJGA 4D5FA 2XGEA 1TC3C 4I8TA 2LLKA 4J1WA 3ZHMA 1NK2P 1IDYA 2VPRA 2XIUA 3HGGA 1QPIA 2G0EA 2MW8A 3DEWA 3GN5A 1HOMA 4XRMA 2MGQA 1GVDA 2NS7A 2K9QA 5K7ZA 1EF4A 1MH4A 4Y7NJ 1PNRA 2HDDA 3BR5A 1JT0A 1QQBA 3SFIA 2FJ1A 1X2LA 4GQMA 3BG3A 1JGGA 3HM5A 2O8KA 1MBHA 1IC8A 3S1NJ 2R7ZJ 2CSFA 1ZR4A 1DU6A 2JA5J 4X4DA 4B4CA 3HOYJ 2NVQJ 4A3IJ 4BY1J 3GN5B 3MN2A 2CROA 1H89C 1VFCA 3JRGA 5IP9J 2AXZA 4JX6A 1QVUA 1DWKA 1Z77A 1ZGWA 1BW6A 4FE4A 2KZ8A 2WIUB 1RPEL 3FMYA 2O49A 1ADRA 3SJMA 2HXIA 3JXCL 2JJ7A 2TRTA 2DA5A 4XICA 1NTCA 1LFUP 1LE8A 1YRNB 2KEKA 2NS8A 4M6VA 1WH8A 3I4MJ 3S15J 3DNVB 4S0HB 2Y2ZA 3F0CA 4LOCA 4AUXA 5C44J 3S2DJ 1DW9A 1VPWA 4I76A 1JJ6C 9ANTA 3W6VA 3QQ6A 4D7NA 1R9TJ 4M3BA 3BD1A 3FISA 3BR3A 1X57A 3F51A 1POGA 3I4NJ 4X4IA 2PUAA 5E3MA 2XGDA 1ETXA 3O9XA 2CUFA 5C4JJ 5EDNA 1UXDA 4JX4A 1MSEC 3LISA 1RR7A 5EZGA 3ZQCA 2IVBA 3JR9A 4PU7A 3K7AJ 1Q1VA 5M3FJ 1BA5A 3JXBC 4I6ZA 4NDWA 3VK0A 2DA2A 3FK7A 1K61A 2LKXA 5IOZA 1BL0A 4A3FJ 1AU7A 4A3DJ 5F08A 3O8GA 2A6CA 1ITYA 2COBA 1JKRC 1ZZ6A 4AYBN 2JMWA 2XPWA 1VI0A 2DA7A 2FD5A 1A6IA 3GTPJ 2YU9J 3LFPA 4JP0A 1RZRD 3HOZJ 2NVYJ 1ZZ7A 1BW5A 1L1MA 4MO7A 3ZOBA 2AO9A 3TW6A 4A3MJ 1OCTC 3HGYA 2M9HA 4PU8A 1LFBA 5E3NA 2L9RA 2CUEA 1QQAA 3BTLA 2VI6A 5J1YA 2PUFA 4QSHA 2DA1A 2LR8A 2EF8A 2L7FP 1OFCX 1RKTA 1P7JA 2GRMA 2CQQA 2NVTJ 3IH2A 3FYAA 1OSLA 1QPZA 2JCGA 1FIPA 2PUBA 3LOCA 4HNVA 2DMNA 2BNNA 1MBFA 3A03A 5FKLA 4I6RA 1QP7A 5EZHA 4Z5DA 2PMZN 5JLXA 1B8IA 2HI3A 2GM4A 2R5ZB 3FK6A 4BBSJ 3RZZA 2K40A 3WHCA 4Z5HA 4FTHA 1K83J 1IG7A 4MCXA 1QP0A 2DMTA 2LK2A 2LVSA 3PM1A 2MQKA 3CLCA 1FIAA 2AWIA 3JREA 1I6HJ 2DA4A 5J1RA 2OFYA 2KEIA 1MNMC 2O4AA 1I50J 2ID3A 2M0CA 4UUSB 2OPTA 4B1RA 2PE5A 1ZTRA 2D5VA 2L7ZA 2ME6A 1W0TA 4DZPA 4YBAA 1XC5A 3BT9A 2E2IJ 1FTTA 2MG4A 2DA3A 4IVZA 2QCOA 3BR2A 3WHBA 3S1MJ 3HBLA 2FQ4A 4A3EJ 4X6AJ 2XGCA 3Q0UA 3GTQJ 4BXXJ 1LCCA 2E1OA 1U78A 1H88C 2ID6A 2JN6A 2LY9A 1JT6A 4QTRA 3RZOJ 2AXVA 4L5EA 2DTZA 4C3IJ 2KT0A 2O38A 4YG4A 3BDNA 1MSFC 2H1KA 3PXPA 1ZPQA 3QWGA 3NAUA 3JRHA 1ZR2A 5M5WJ 2AHQA 3F52A 5J3LA 3HDDA 4J1XA 1VF9A 2E2HJ 2CJJA 1Y7YA 5E3LA 3BQYA 2IVQA 3A01B 4AC0A 1TWAJ 4A3CJ 1WI3A 3B7HA 1BDHA 3JRAA 1UMQA 3HOUJ 1MBGA 2DMPA 2BNOA 4X1EA 1JFTA 3ZQIA 1LQCA 2EQRA 2WB1N 1JTXA 4A3KJ 2R1JL 2PUCA 2LD5A 4PU3C 1IDZA 1PERL 4YG1A 3TRBA 3C2BA 3JRIA 3M4OJ 2IBDA 4IHWA 3G5GA 2VKEA 2Y31A 1UHSA 3TEDA 3CECA 3KXAA 4I6TA 5BNGA 5M5YJ 3Q0WA 3B6AA 3Q0VA 4YARA 1P7IA 3K2AA 3ZQGA 4UUTA 1ETWA 3DCFA 1EFAA 1JUMA 1WPKA 2K9NA 1E3OC 2R92J 4D5CA 3RKQA 1LMB3 1Y1WJ 5E3OA
chains in the Genus database with same CATH superfamily
2UXXA 4IEJA 2EZKA 4OIRF 1WCMJ 2H6CA 4XRSG 4RAYA 1W4MA 1Q1HA 3KP5A 3TP0A 2KPMA 3S1QJ 2IS6A 3WTUC 2VLAA 4X4BA 1UG2A 1OCZH 2KQRA 1BR1A 2JUCA 4I7HA 1QZZA 3J7YJ 1TTYA 1SVLA 5KNLA 3CO7C 3RQIA 3SHFA 1TWGJ 2OR1L 2Z9OA 3J81Z 3ZQ7A 4ZYHA 4EZIA 1YSEA 2EILH 2KIMA 2VB6A 1FPQA 2DT7B 1JH9A 3T0YA 4E7KA 4L5IA 4LITA 5EGOB 1W0UA 3H5NA 5TGTA 3QYXA 2F4MB 3HIFA 2VQLA 1X1DA 4Y52J 2F5DA 2QVOA 2Z99A 1XMXA 2BE5F 2L7MP 1YI2I 2LCVA 4MQ9F 1Z0XA 4OAYA 2F5FA 4Z5CA 2I5UA 2PI0A 3FKIJ 4NDLA 1XS9A 1V54H 2FA5A 2PQ8A 1WGXA 4CO8A 5F0FA 2F2EA 2LLWA 2PXTA 2LYSA 4F8DA 2XSDC 2IUOA 2FF4A 3KX2A 3GEZA 3K10A 4Y42A 2P5VA 3TW7A 3TFLA 5FLVA 2PUGA 5H6RA 2DOEA 3BQZA 4RB2C 3CCSI 4KMUX 1T39A 1RKWA 4IWRA 3RDIA 4EK9A 2IV1A 2LYPA 3TP3A 4YG7B 1RNLA 5F27A 1C0WA 3S16J 3SX0A 2M4HA 1FWZA 3DTEA 4DYCA 3MAJA 2DA6A 3NARA 4G7ZF 4LB6B 1WH6A 4V2FA 2DOFA 3GCMA 3GX4X 3O8HA 1LLIA 5GAGJ 3HTUA 1VNDA 2CV2A 2MEZA 2ZJPF 3TEPA 4LG0A 1AKHB 4Q2JA 3PNYA 2N8GA 5FKNA 3CMYA 2I10A 2P81A 2XF5A 1SFEA 5DS9A 1RPWA 3VSKA 1XB4A 2HCSA 2FUG2 4IHSA 3DPTA 3LSPA 1TT5B 2VKHA 2DFHA 4K2EA 4L0YB 2GXBA 2HQAA 4Q48A 4UVCA 2O8XA 3SEQA 2HOAA 4U7BA 4GYGA 3LNQA 2C6YA 2OTLI 4JK1X 3VB2A 4JCXA 5AIQA 5FKOA 1FMVA 3RJPA 2GA1A 4WWCA 3CCYA 5FROA 5HLGA 2EA4A 1R23A 2DDBA 3PFYA 3IL2A 3JRDA 3CUQA 5EYRA 5E1WA 1OJLA 2ELKA 3OYGA 3PQKA 1JTYA 2ZKZA 2IJLA 4X4FA 2VJ5A 2EIKH 3M07A 3JAMK 2IVGA 2VJJA 3HC7A 3HTSB 5DUIA 3I5UA 3K1MA 3RZDJ 2XF7A 2P0WA 3EUSA 4D0PA 2OQRA 2KMUA 4EATA 4YRVA 3DTKA 1SFOJ 1JHHA 3TELA 1S6LA 2M8GX 3ZHIA 2OF7A 2DAOA 2RV8A 2L9SA 3CO6C 3F21A 1GHCA 1STZA 1REPC 3QYBA 5DDGA 2J5PA 3A0HC 3HHGA 3SCGA 1GVJA 2KP6A 4F52A 5JFRA 5D5UB 1G6NA 1H9GA 3H92A 2BEOA 4M3EA 3OYNA 2DDAA 2ZXIA 1ZYRF 5D8KB 3LSJA 3M1EA 4DZJA 1POUA 1R58A 5L3EA 5LGUA 1QBJA 3ERED 1FOWA 1R00A 2VQCA 1BR2A 2WB1A 3FXUA 1QVTA 2ADUA 2OZUA 4G7OF 1IAWA 3CDLA 5LHHA 4LIVA 3SCHA 3ZMDA 2W82A 4NC7A 3WTSC 2X9DA 2RGVA 2VE8A 4OIQF 1Z21A 3D5LA 3G73A 3HPHA 1MBKA 3UNGC 1P4XA 2Q2EA 1B9NA 1KYWA 2R7UA 1TW2A 2XRLA 1OR7A 1ZLKA 1SQ8A 2Y48A 3GWZA 2CUJA 1X4OA 3OYDA 3QPSA 5ICGA 3BZ6A 1QP4A 3BC8A 2R7RA 4CHUA 2RKHA 1WQ2A 3QOPA 3S2HJ 3GF2A 3S14J 2HKOA 4A3GJ 2Y9YA 1X3UA 4XN0A 2G7UA 5ICFA 4HEA2 2LF8A 2ZMEB 3KYDB 1YG2A 2WY7Q 1WETA 4BJTA 3OSFA 3ZQLA 4O6JA 4KISA 2P4WA 4KN4X 1I3QJ 3KZYA 5B1BH 1VQ8I 1LVAA 4XR6A 2B63J 1QGPA 1QNTA 4M72A 2PIJA 3HB9A 1G2HA 3PE5A 1T0FA 4Z58A 4B3XA 3G71I 3K1NA 1ENHA 1KQ0A 4BHPA 2F48A 2V9KA 3FDYA 5M5XJ 1Y1VJ 2OZ6A 3S8PA 2YX4A 2ICWG 3ZN1A 1B72B 2PBIA 2P7VB 1RETA 4P55A 2QF7A 1IXCA 2JA2A 2CU7A 1R22A 2A69F 1BIAA 1U2WA 2DT5A 3KE2A 3WTZA 1EH8A 2FMLA 2R0QC 2XCJA 3BS3A 1HW5A 2KPJA 3UR3C 3N97A 5K5RA 1FBUA 4OIOF 3JRFA 3D0SA 2DK8A 2DMUA 4PGHA 4IHYA 2R5ZA 1AKHA 2PXUA 2KL4A 1GT0C 3GTOJ 5FLXK 3QPLA 3KL4A 1O7LA 1SANA 3IHUA 1PUFA 4I8TA 2QENA 5HDKA 4B8XA 1W7PA 2BYVE 2LLKA 3HGGA 3E5XA 3SEZA 1P92A 2G0EA 2MW8A 3I71A 3RPUD 2X85A 1UB9A 3GN5A 2VJ4A 3G0TA 3CJRB 4BQQA 2K9QA 5K7ZA 2JZYA 2VQHA 4Y7NJ 2GIVA 1DP3A 1WJBA 1JT0A 5DCMB 4G94A 4U0WA 1BR4A 2DBBA 1JGGA 4NB5A 3HM5A 4HPQA 1DGWY 1A36A 3S1NJ 2E7WA 2R7ZJ 4UNOA 4NQWA 1ZR4A 2CV1A 1X1AA 2H09A 2YPRA 2NVQJ 3C2GA 4E6KG 4BY1J 2BOLA 4XNFA 4XKBA 4PJ0C 5KAIC 2VEOA 4JX6A 1QVUA 1DWKA 1BW6A 2LREA 2IS1A 2O49A 1BI1A 2M30A 3JXCL 4EGYA 2TRTA 4XICA 2DA5A 2O0YA 1XDSA 3OOPA 1LE8A 1YRNB 4HQMA 5LRSA 2NNYA 2NS8A 4BGDA 4EGZA 2KEKA 4II2A 4I0BA 4F3QA 3L2CA 3S15J 3DNVB 5GAEJ 2Y2ZA 2KISA 4XL9A 1HXDA 4GXOA 5BOXA 4I76A 2VXZA 1HQCA 5JHFA 1OLTA 3WU2C 4HA8A 1W5CC 1R9TJ 4BHBA 3FISA 1X57A 3F51A 4A0XA 2XAUA 2K9MA 2BGCA 5E3MA 2ZBKA 2XGDA 1G8XA 5IY5H 1ETXA 4LMYA 4F55A 5D6EA 2JT1A 3VSLA 3JAMZ 2OBPA 2KJBA 2FNAA 2K02A 2BW3B 2VN2A 4DQ2A 1MDMB 1IW7F 3R0AA 5LGTA 2KZGA 5K1YA 3CMAI 1B59A 2PXKA 4NDWA 4XORA 3V7SA 4M9XA 2DA2A 1K61A 3DP7A 3ML6A 5IOZA 2CWEA 3V7RA 1B6AA 4A3FJ 4A3DJ 5D4RA 1ITYA 4BXUA 2PG4A 3I54A 4Y15A 2JMWA 4AYBN 3ABLH 5DM7F 4H0EA 1BBYA 2FD5A 1O3QA 3LFPA 4JP0A 1FYMA 2VKDA 1RZRD 4BS9A 4MO7A 2AO9A 3TW6A 2M9HA 4XKWA 3HUGB 5K5QA 2L9RA 1U8RA 2HZDA 1WJAA 2EINH 1N75A 1IF1A 2PX9A 3M9LA 3CJTB 4WK8F 1J2XA 4NC8A 4IRGA 3CCMI 4WVLA 2HQRA 4DBRA 1OCOH 3ZRGA 5ERIA 2XGXA 5JI6A 4WX9A 5DT2A 2PUBA 3LL7A 4LD5A 2GA2A 1DULA 2V6EA 2I8DA 3NROA 2DQLA 1ZREA 3MEJA 4DE8A 2DMNA 2QQBA 3ROUA 3Q9SA 4I6RA 1D8KA 1D0ZA 4WF2A 1KQ9A 4PDKA 2IA0A 1QHHD 2LRDA 3RZZA 1K83J 3RTRA 2E60A 1IG7A 5E20A 1QP0A 4ZZDA 3PM1A 1T98A 3M7GA 2Y0MA 4ON0A 3KIOA 1YFHA 1QB2A 2MQKA 2LBFB 1D1BA 2CQKA 1MNMC 1SD4A 2P6SA 3TOAA 3RSNA 2PE5A 1I6XA 2L7ZA 2ME6A 1I1SA 4L5JA 1U5TB 1S7OA 3OYLA 2RNGA 3BR2A 1OISA 3S1MJ 2HYFA 2L3DA 2M4GA 1Z9CA 2A5YB 1VZ0A 3Q0UA 5D6FA 3I59B 1WSUA 4CZCA 2JN6A 1ON2A 3H36A 4LLGF 2XHKA 2VXDA 3KLNA 4HNUA 4BUPA 2KT0A 5CPRB 2BY2A 3JRHA 4ZJZA 3WODF 3Q5FA 2KRFA 2MLGA 3IP4B 4OAZA 3NWTA 1IN7A 2AHQA 1L0OC 2E2HJ 4IHTA 2IPQX 2CJJA 1Y7YA 3BQYA 5IT3A 3OS0A 2JPCA 1T6SA 1IN5A 1MDMA 2L7KA 2WA0A 1MBGA 5F64A 2DMPA 2HU9A 1ZHFA 5HOOA 3FXMA 3AL0C 3G3ZA 4R8HA 3CP2A 4A3KJ 2PUCA 5CVIA 1IDZA 1A35A 1PERL 1O7FA 3QOEA 3TRBA 2BVLA 1W7PB 4IHWA 3G5GA 3E6CC 2PLYA 3KXAA 3GZ5A 3RYPA 5BNGA 3Q0WA 4RAFA 1O57A 2MH9A 2V7FA 2YBDA 3ZQGA 1EFAA 1R5GA 4MTDA 3IWZA 2JPBA 4HW0A 3OYAA 2K9NA 1HKTA 3EUKL 5L3DA 1E3OC 2R92J 4D5CA 4CICA 4OIPF 2VODA 2CS3A 1E0EA 5ICCA 5E3OA 1Y1WJ 4XQFA 4C3HJ 3OYBA 2Y75A 2KJCA 1ZUGA 1TLHB 1B72A 1G3SA 2F4OB 5IYBJ 2AW6A 4IRIA 3K4CA 2RDPA 2HPIA 5EEAA 5KAFC 4NC6A 3KP4A 1UJ8A 3MZYA 2MD5A 3ONQA 3IH4A 2XF6A 3CROL 3CQZJ 3SQNA 4EVIA 1E17A 5EG0B 4NHJA 3A9ZA 2LTPA 1NK3P 1LEAA 3M1CA 4RBOA 1RIOA 2DYSH 3ZKCA 1F43A 2FFHA 1UXCA 2VBYA 3CLQA 4EQZA 3G4SI 3A9YA 2NOJB 3M8JA 3OMTA 5D5XB 2X6WA 3GLXA 3AAFA 2X6XA 4FCYA 3BZKA 3I58A 1N77A 2OJED 1SMTA 2M0MA 4ESBA 4UB6C 2XC7A 2BVMA 4ITVA 2OD5A 1SFXA 1XMAA 5M3MJ 4ZYGA 5D5VB 2CO5A 3OV8A 4CH7A 1HA8A 1ETYA 3QP6A 2GRLA 1PUEE 2Q1ZB 3X2QH 3H5TA 4M3FA 1LPQA 1P4WA 3OQNA 3A4CA 1PRUA 2R93J 4JCYA 2QSHX 5E17F 3H0GJ 2EIMH 3C3WA 4DIQA 2JA7J 2OC6A 3MMYB 3KFWX 3OYCA 2PMZA 5J4YA 4MHGA 1IRFA 5J40A 4UB8C 1NH3A 3KEOA 2L0KA 1VQ5I 4KIGA 3TO6A 1HSTA 3WE2A 3LSGA 2PXVA 1MNDA 3KP3A 1HDDC 2E35A 1KU3A 2H8RA 2K5CA 1ZQ3P 2A68F 4A6DA 2HCNA 5DSXA 3QQAA 5F04A 2E1NA 4JX5A 2AXUA 2LH9A 1FZPB 5H6QA 3KEQA 4KITB 2CW8A 4M3GA 1JUSA 4C9YA 5EG0A 5HVQC 2Y0SN 2HOEA 4RDUA 1ZZCA 3F8CA 3QOXA 2FXAA 4HF1A 4JQDA 3CD6I 2UUZA 5FLMJ 2YSRA 5DTRA 2KFDA 3BTJA 2OCEA 1IRGA 4IO9F 1EKEA 1UZCA 5ILUA 3LAPA 4FBIA 2HOSA 1ETVA 5JVGF 4UVAA 6PAXA 2OV7A 3HZIB 2M2EA 3MFKA 4X4GA 2PJRB 4DE9A 1DP7P 1U9NA 4HG2A 4GFBA 3LFKA 3E6MA 1E2XA 2K3PA 4XLCA 2X4HA 2ECCA 3VEPA 1UTXA 3K4MA 3U9GA 1OCPA 4GCVA 3ZQQA 2XJ3A 3BCBA 2HEOA 4PU4C 3T8TA 1IN4A 4XRSA 4FHTA 2OAZA 3D1NI 2LYCA 4WXCA 1FEXA 1T33A 1JGSA 3U21A 5LHGA 2G9WA 2WAQN 4QLCU 2IAIA 1OMIA 2XB0X 2DCEA 1G3TA 3U3WA 5IT9Z 2X1CA 1FSEA 2GZWA 5F1RA 1P2FA 3BG6A 3GTGJ 3MKZA 4MEXF 1JWLA 2EH3A 2ISZA 1A6QA 1X3ZB 3P5JA 2IS4A 3HHHA 4OBMA 4IHVA 2OU2A 2IGKA 3MKLA 5DTDA 1I27A 4A3LJ 4YIFA 2FEZA 1G3WA 2GIZA 4G7HF 1TL8A 1WVRA 1YTYA 4XK4A 3EYIA 2XV4S 3QF3A 4LG0B 2VT3A 4MTEA 4ENNA 4P96A 2DXIA 2BY3A 3IAS2 3OOUA 1IN8A 1BJAA 4PFPA 2VONA 3UFDA 2LYRA 3DQVC 2BHYA 4M6XA 2NAZA 3V7CA 3DM5A 2LP0A 1T95A 1U0JA 3J7AO 1BDIA 5CLSA 3LSRA 1EJ9A 4EEFG 2WV0A 2KEJA 1IJWC 2J5OA 4CZZA 3BG7A 2WUSR 4YIRX 1APLC 2YX7A 3L2WA 1VQPI 3E6DA 3KP7A 1X1PA 2W24A 5IYCJ 3VFZA 4KT5C 1ULYA 5DTMA 2P8TA 3I4PA 3GBGA 5DV5A 4X4HA 2STTA 1MMGA 1YQAA 2JUGA 2JVGA 4CCNA 3HEFA 1MD0A 1G59A 1HW1A 3RI4A 3FYMA 3T1BA 4HAMA 2RAEA 5D8LB 1Z05A 5IP6A 3FX3A 1ZAOA 4W97A 3IKVA 2UWMA 2HDCA 3L2RA 1MMNA 2L54A 1CGPA 2RQPA 3L1PA 1DUXC 5GPAA 3F3XA 5K7FA 2HYGD 3V4GA 2R5YB 4BDYA 1JKQC 1TQPA 2YUSA 3ME5A 1A5JA 5LGNA 3DBRB 3SDGA 4IJAA 4RB0A 3OQMA 1OCRH 1U8BA 2PXFA 3DFGA 2CQXA 2EZIA 2M45A 3EUHA 3ZGKA 5B1AH 1ACIA 5DM6F 3ZQHA 1UG0A 2EBIA 2E2JJ 2PUEA 1YE9A 2LYQA 5BS6A 2IP2A 1X2MA 1TQIA 1Y0UA 3HG9A 1S5LC 2XPVA 2HPMA 3OY9A 3AG3H 4YEJA 3BR0A 1RESA 4CYCA 1ZZ8A 4XLNF 3ZQFA 5GP9A 1B0NA 3LWFA 1X3WB 3G6EI 5BPIA 5L3CA 2LYKA 2LFBA 4JYKA 4J19A 1MW7A 5B5EC 1JXSA 4BKXA 2JK3A 2VBWA 4BQAA 1P4AA 2HTSA 3MVPA 3QOWA 2BV6A 1XDUA 2VC1A 2DLLA 4RLQA 1RUOA 4I98B 4ER3A 4O8BA 3OP9A 5E18F 3CJQB 3ZR8X 3OYHA 2L9VA 4CUGA 4XOTA 4YFXF 2KDZA 4DBQA 3AG2H 1TC3C 5FFXA 3WE3A 3PUBA 4FX0A 4IQJA 2CW0F 4J1WA 3ZHMA 1IDYA 4I09A 4BE0A 3WGGA 3DKXA 3J7AY 3K4LA 3LQQA 4N4OB 4ER0A 1FBQA 3PUFA 4HX8A 2K4JA 4XKVA 2BW3A 4HNTA 4ZYEA 2R7SA 3OS2A 2X6YA 5HS9A 1PNRA 2DTRA 1QQBA 1USSA 3KPHA 3SFIA 4ER5A 2Y0SA 2FJ1A 5B66C 2R7OA 3CP8A 2XXPA 2L9NA 3BG3A 2XASA 4ZTJA 3VYTB 2O8KA 2PFBA 2A07F 3I53A 5BPDA 3FBIB 2HVRA 2PJPA 1F4KA 3HOYJ 3C1DA 2NNNA 3MD2A 3MKYB 1ZN2A 1Z77A 3RKWA 2KZ8A 1XSXA 3K4JA 4MNUA 5DCMA 3FMYA 2ISYA 2Y69H 4IVNA 1R4NB 3SZGA 1L3LA 1IZ1A 2XXAA 3HRTA 4PZJA 2JJ7A 2LG4A 3FM5A 3TL4X 1LFUP 5JHUA 1LKXA 4M6VA 1WH8A 4A5MA 1NHAA 3I4MJ 2E36A 3KP2A 3RKYA 3FXLA 3QPTA 4AUXA 5C44J 2E1CA 3S2DJ 5FD5A 4D7NA 2Z3YA 4M3BA 3FF5A 1TT0A 3BD1A 3KP6A 4HRAA 4X4IA 2PUAA 2AQEA 5GADJ 4L18B 1FP1D 3DEEA 3H5RA 2UZKA 4M9ZA 3HSEA 3O9XA 4ZH4F 1R1VA 1UXDA 4JX4A 1RRJA 3DKWA 3RPUA 5JVTA 2LNMA 1RR7A 3BOQA 3ZQCA 1LVKA 1O3SA 1WI9A 4I6ZA 4E7LA 3GFJA 1VQMI 3FK7A 4H4KC 2ZNZA 1NG6A 3CJNA 1AU7A 1TQMA 2A6CA 2WTEA 3FXKA 2XPWA 4ZC3A 1DDNA 4FX4A 2J7UA 2DA7A 1A6IA 3GTPJ 3GW2A 3L7WA 4Y33A 3F22A 2L1PA 1GXPA 4BDZA 1J5YA 3GXOA 4RGXA 3HOZJ 1BW5A 4AM3A 2DK5A 5D4SA 5E3NA 2HFZA 1ZARA 3JSPA 1A04A 2PUFA 2VI6A 5J1YA 3HOTA 2DA1A 2B9SA 3U1KA 2L7FP 3ELKA 3ASNH 2JVHA 3S93A 2W85A 3L2UA 1EH7A 2A6EF 1QPZA 2JCGA 2QUFA 4RMNA 3FXJA 3S3NA 3Q9VA 2ZSHB 2R7FA 4RLFA 3KYLA 1TNTA 2GAUA 3H9GA 3GMEA 2X1EA 1OYWA 1V5GA 4HF2A 2Q2EB 2MA3A 4QPOA 3OR2C 1MBFA 5FKLA 1YIJI 3R09A 2PMZN 3KYCB 4XLEA 1B8IA 1N25A 2R5ZB 4Z2YA 1FOXA 1FYKA 4BBSJ 1U5TC 3WHCA 4Z5HA 4LIUA 2DMTA 2LK2A 1YITI 1BC8C 1FIAA 3WTXC 3ERMA 1VTNC 2AWIA 1I6HJ 2DA4A 4EJOA 3FHZA 1SFUA 2FU4A 3V42A 2WC2A 2O4AA 2QQ9A 1I50J 2ID3A 1MMSA 1KU7A 4O3MA 5E8IA 1Z6TA 2HFHA 2NS0A 2D5VA 1ZG1A 2XKOA 5GTHC 1RUNA 3GZDC 1W0TA 3PJRA 3BT9A 1VQKI 2E2IJ 2DA3A 4HDVA 4G6TB 4R1HA 1WRJA 2CMPA 4EQQA 2KIQA 4HDUA 3TDUC 3REOA 1YS6A 2EJRA 2E1OA 1VQNI 2ID6A 3V8JA 4EJVA 3K70D 1JT6A 1LJ9A 4ENMA 3M8FA 1AWCA 1VQ6I 3IAM2 1A31A 3NRVA 3MZHA 2AXVA 4L5EA 2O38A 1U6GA 3BDNA 4PK4A 2H1KA 3TO7A 3NAUA 3S3OA 2AXTC 2EFOA 3W6KB 4DJAA 1BOAA 2VOPA 4KIFA 2VE9A 3F52A 5J3LA 3ZP5A 5E3LA 4AIJA 3JRAA 2R7WA 3HOUJ 3GFLA 3LSMA 5H20A 1D3YA 1JFTA 1ZRCA 4HSTA 2R1JL 4GRIA 5A2QZ 2IT0A 1XMKA 1EH6A 2VKEA 1UHSA 1W36D 3S2WA 3TEDA 2XAFA 2ZMEA 3CECA 4A0ZA 1WKMA 3GZCA 3B6AA 3O6BB 1IXSB 1P7IA 3K2AA 3I55I 2J7WA 2CW7A 5ICEA 3CDHA 2VT2A 1VQOI 2P5LC 2XAQA 3OYMA 3RKQA 1NG7A 2G7HA 1MSEC 3F6WA 4GO1A 1BI0A 3VPRA 1R69A 1UFMA 5CKTA 4E70A 2GLOA 5E1ZB 2NXNB 2XDVA 1ETQA 1YX5A 4OMZA 3EUAA 3GTJJ 4ER7A 3NEUA 3IV5A 2Z2SB 3OIOA 2D2WA 4AYBA 4I0AA 5IOYA 3E5UA 1Z67A 1Z3YA 3EUHC 3GTLJ 3SCFA 2AXLA 5F6FA 3GFMA 1BJZA 4MFEA 1FX7A 2DO7A 1HBXG 2WWYA 1R7JA 2NVXJ 2DI3A 1Z7LA 2ESHA 3F6VA 3E97A 2V6CA 3TDZC 3UKGA 2WAFA 3R4KA 2KKOA 2EFWA 4ABZA 2PXQA 4E4HA 2BBYA 1WH5A 2X6OA 1IUFA 4HQEA 2BJCA 1Z6RA 4V2GA 2HKXA 2DFFA 2VQGA 4DYQA 5BQTA 1GDTA 1S29A 2LY1A 2ZFWA 1UAAA 1BM9A 3HOXJ 3FHNA 1K7AA 1X58A 2EB7A 3IWFA 1PP7U 2KRHA 2ZXWH 1B8IB 2XPUA 3KCCA 4M3DA 3BJ6A 1OYYA 4BE1A 1I3AA 1WZ2A 2NVUB 2L8NA 4RS8A 3OKZA 5K98B 2LC2A 2V1UA 1FT9A 2CV0A 1SAXA 3CUOA 1XG1A 2EWNA 2E34A 3DF8A 4I01A 4G9YA 4DW6A 3OL3A 4BJ6C 2LBFA 3RKXA 4XIDA 3WG7H 3S17J 2R7XA 4ASNA 3C18A 2A61A 2ACJA 1WJ5A 1IGNA 3CUQB 5EF6A 2W7NA 2L01A 1P9QC 2PMUA 1J75A 4FASD 1MJ9A 2LLVA 1RR8C 2MLKA 2IEKA 4C30A 2XAHA 3WTTC 3NZLA 2ZNYA 4FN3A 1HW2A 2K7LA 5LEJA 1BN5A 4OWRB 3BP8A 3H3ZA 1XCBA 2WAEA 4FETA 3K9TA 5HLHA 4C2UA 2LYLA 3H5AA 3G7DA 2DJIA 1IO2A 4Y4RA 4JOMA 4X4EA 3OIQA 4N9IA 1D1CA 1RZSA 2MFZA 1NERA 1PVEA 2DPUA 3ZN0A 2V4JC 5LLQA 4A6EA 2A6TA 3A0BC 3GBFA 5J8CA 4MIMA 3HRMA 4YIIA 1OYIA 5C4XJ 3OWTA 3TBIA 4QIWN 5IPAA 2LSOA 4L0ZB 4M71A 5B3SH 1X1CA 2ZJ2A 4ETSA 1Y56A 1MBEA 2WADA 3T8RA 3AG4H 3G1OA 2AUWA 3BJAA 4LG3A 2IU7A 4KJZA 4HYEA 1HLVA 3OIPA 4CDGA 1WJCA 2XRNA 4JQFA 1D1AA 5J4VA 5JLWA 3FKJA 4PJMA 3NQOA 5LHIA 2EZHA 1Y8QB 1TWHJ 3UWPA 4BU2A 2W25A 5K7HA 1J59A 1BI2A 4L9NA 1XWRA 2ICTA 5A7LA 3VYUB 4A69C 2IRFG 5FKKA 2CFXA 3OYFA 3QRFF 3AL0B 3ZCOA 3HOSA 4BEHA 2W4SA 1ZVVA 2NOGA 2JVLA 4MLOA 3CF2A 4D1QA 1GLNA 2MYSA 2W48A 1CF7A 1H8AC 2HXOA 4RGSA 3IUOA 4OB4A 5FB2A 1ZK8A 4F91B 4BH9A 2L49A 2K85A 4AVPA 1V3FA 1LE8B 1YRNA 1LQ1A 2FX0A 1K6YA 1T56A 1IV6A 4Q4ZF 2QBYB 5CYVA 4RB1A 1MFQC 3BTCA 1XD7A 2FOKA 4KFCA 1CF7B 1FP2A 4HRIA 2H1LA 3RYRA 2Y30A 4B48A 1D8JA 3TMOA 1XGMA 1IRZA 2ZB9A 1T0FC 5GAHi 3ABMH 2V1XA 4CCJA 5C3EJ 2RVCA 3F8MA 2LKSA 4A2UA 4ZDOA 4A5NA 4E7ZA 3DU6A 2ICPA 1PRAA 2VJIA 2A6HF 2JA8J 1GV5A 3F9KA 2H6BA 1GV2A 1SFKA 3S8QA 3GLLA 2XB5A 5J8FA 2CRGA 3A02A 4HX7A 1MIJA 4CYCB 3OYEA 3CCQI 2IGNA 3EDPA 3O2PE 3QU6A 2ELHA 4PJNA 1JKOC 4FQGA 2KRCA 3HJEA 2BNMA 4UUSA 3C7JA 2R63A 1TBXA 1WWXA 1KU9A 1BOBA 1IUYA 2HSGA 3BJOA 4KICA 1PJRA 1O4XA 1OR7C 3JRCA 1SVOA 3LSIA 4ANJA 2A5WA 3R1FA 5IYDJ 4U0YA 4CGZA 5HLIA 1PUFB 1Y6IA 5FD6A 2QM3A 4EM2A 2IGOA 5HS7A 5F0CA 4B44A 3CZ6A 5KCMA 1WIZA 1QZXA 4E7HA 5LD2C 1IXRC 1YYVA 2O7OA 2FNPA 5HDNA 5GPCA 4G6DA 5H2FC 5HODA 4ESJA 2B5AA 3HRSA 3OSGA 3OYJA 3I9V2 2HZTA 3CUQC 3K4KA 4ZDPA 4A3BJ 5CVVA 4IOAF 3R0JA 2VL8A 4OMYA 1B4AA 2VPLA 4GHJA 3OWQA 3CLOA 4MCTA 4HF0A 1Z1DA 2R5YA 2EZLA 2R7DA 2QKLB 2PJRA 4KYWA 1W5TA 2HNHA 3GTMJ 2O9LA 4P9FA 4EM1A 4EJTA 1E3HA 4RM3A 4XLAA 2GOXB 4D5FA 3L2VA 3WGIA 1CJGA 1AA7A 2XAJA 1NK2P 4UV9A 3ESWB 1QPIA 1XX5A 3I0TA 4PGGA 4IOCF 3DEWA 1TW3A 2M7AA 5JUWA 1LFPA 2MGQA 4I99C 3NWSA 3M9AA 2DQRA 2R7TA 3PFIA 1EF4A 2F6CA 4O5VA 2CG4A 2RREA 2Z16A 3SFZA 2XKPA 1WJDA 4LK1F 4HX4A 1YW9A 1X2LA 2V26A 1HC8A 5DRYA 4NNJA 1RIOH 2QA4I 2PXDA 4ZZLA 2COMA 2DODA 2AQFA 2FRHA 1IC8A 2CSFA 2PXPA 4YELA 3KLOA 1J0RA 1DU6A 2F4IA 2EFNA 4DNCA 4A3IJ 4XLPF 1VQ7I 1S8NA 3L9FA 3GN5B 3WGHA 2CROA 2V1NA 5IP9J 2HQNA 2P5KA 3M8EA 2AXZA 4Z6YA 1XCVA 1JI8A 3FMSA 3HKZA 3CC4I 2WIUB 1D5VA 2MC3A 2R3SA 1YW8A 5ILSA 2HXIA 3U2RA 1SAUA 2LKPA 3BWGA 1W1WE 1NTCA 3K1PA 1YJWI 3SXYA 1Z3XA 1X19A 2QEXI 3GZ6A 2HVQA 2E71A 4P9UA 5FRNA 3I64A 4S0HB 4LB5A 4LOCA 2PN6A 1DW9A 1VPWA 2W57A 3VWBA 2BY0A 3QQ6A 2CQ7A 1POGA 3I4NJ 2EV0A 3TO9A 3E5QA 3GUDA 3L00A 2IA1A 3QU3A 2ESNA 5AONA 1SD6A 2CUFA 5EDNA 1XTAA 5EEGA 4BQNA 5DRTA 5EZGA 2CQNA 2D1HA 3DTIA 3PSFA 4YG2F 2IVBA 3JR9A 5EEHA 3K7AJ 2ODRD 5M3FJ 1BA5A 3K0LA 1LNWA 2W00A 3R6SA 1FOYA 3LSKA 2CUZA 1PYVA 4HSRA 1OQYA 2LKXA 1FLIA 1BL0A 1VQLI 3K2ZA 3O8GA 2RNJA 5F08A 5KK1A 2COBA 3BCAA 1JKRC 3P9KA 1VI0A 1I39A 2Q0OA 3QP5A 4OOIA 5CVUA 2JRMA 3LAJA 3JTGA 3LMMA 1YJ9I 2NVYJ 1L1MA 4MEYF 3ZOBA 3LQXA 1FY7A 4LFUA 4PU8A 1H9TA 1YX3A 3A9XA 4GGGA 1LFBA 1QO0D 3BTLA 1X4PA 3CESA 5DUKA 2EF8A 2QSFX 1OFCX 3B02A 1U2ZA 2OTJI 1R5ID 3SYTA 4XSXF 1FSHA 1KZHA 4ER6A 5KHDA 1MZBA 2JRTA 4XLHA 3RCOA 1OSLA 2O61A 1HKSA 1V5EA 2VC0A 4DOZA 5LBQA 4IQ4A 4HNVA 3MQ0A 2WY8Q 3TKYA 3DKYA 2BNNA 3BZCA 4J01A 3A03A 3ABTA 3OL4A 4XRFA 2B7EA 1B9MA 5JLXA 5TRDA 4Z5DA 2O3FA 4AVZA 2MBFA 4LJZF 2GM4A 3FK6A 1AOYA 2K40A 4CCLA 3H35A 1R49A 1B1BA 4KMFA 2GQQA 2LVSA 2MD0A 2KIUA 3PIPF 1T38A 5J1RA 2OFYA 2KEIA 3FWEA 2QLZA 4KUMA 2XROA 2O03A 5TISC 4UUSB 4S04A 3L09A 4N4NB 4MQVA 1LDKB 4YFNF 1KU2A 5DD4A 1FTTA 4UY8I 2D45A 2MG4A 4UV8A 1X1BA 2QCOA 4ZYDA 2LOOA 3K69A 4B47A 1H0MA 3BPXA 3W3CA 1KGSA 3HBLA 2FQ4A 3DLLF 4A3EJ 4X6AJ 1TZLA 2H8WA 2EFPA 3W2AA 1LCCA 1H88C 4PFOA 3MZ8A 4XN3A 2DPDA 2EPFA 4QTRA 1LUJB 3RZOJ 4XKCA 4B43A 2DTZA 4YG4A 4PCQA 4Q5SF 3IRRA 3QWGA 1QQIA 4M74A 4UXNA 3ABUA 3S3MA 1HQ1A 3QYFA 3QPHA 1VQ4I 5LEKA 1W7PD 3OMYA 4J1XA 3HSFA 3RPQA 2E7XA 2QZ8A 3JTHA 3A01B 1PP8F 1TWAJ 4A3CJ 3PNVA 2LMDA 1T8IA 1SD7A 3BDDA 1FMWA 4X1EA 4XM3A 2BNOA 1KA8A 3V8LA 3KEYA 2WB1N 3F72A 2L02A 4IVZA 3P9IA 2A3SA 2QYOA 2LD5A 3H9JA 4PU3C 2BHZA 2QKMB 1SVMA 4AIHA 2P7CB 2ZSIB 3ECHA 4U7DA 1UHWA 2E1MB 1W5SA 4XLFA 4AIKA 2OA4A 1ZRDA 2ZXHA 3CCUI 2MABA 3K70C 4YARA 4EKGA 3A1YA 3E1SA 4UUTA 1DQUA 1FNNA 3TOBA 4A12A 4ENJA 4BE2A 4HV6A 1RZ4A 3W2VA 1MJAA 1WPKA 3P7NA 1ZH5A 3MWMA 2PXBA 3QAHA 4EJUA 3MCZA 2HOTA 1V55H 3VOEA 3HOVJ 3QYEA 1Y39A 2OCCH 4LK0F 1D0XA 2F5VA 3BTIA 3ZMVA 3S1RJ 2Y9ZA 3IH3A 2QQ8A 1QRYA 2HINA 1ZGAA 3AFHA 4KN7X 2AS5F 1ZG3A 1P6RA 3CCEI 3QFIA 1F1ZA 2GOMA 5BMZA 4I6UA 2CH0A 2M1BA 4HLXA 4MGRA 4E7IA 3CC2I 1HCRA 2TCTA 4A93J 4FE7A 2X0LA 4G12A 3KETA 1BIBA 4KIBA 3CCRI 1MGTA 2ZMEC 3VODA 1ZELA 3EETA 1TNSA 4RM2A 2ZJRF 5FKMA 3ZMUA 2O6GE 1YHQI 1YIOA 4P5OA 3J7ZI 4NBQA 4C2TA 3KZ3A 2V79A 3HYIA 3SDBA 2V9VA 1CQTA 4X4CA 1ZS4A 1WHUA 1N78A 4M73A 1D5YA 2VUMJ 4R79A 2IS2A 1PDNC 1R5HA 3JW4A 4BY7J 1MMAA 2Z5UA 1M1EB 2MC4A 4LGWA 5LRRA 4CCMA 2DU9A 5EGOA 1DPUA 4GYIA 3VYSB 3TGNA 1FOKA 2ZC2A 1JJ8C 1FBSA 2MH2A 4LLLA 1HDPA 2UV1A 5EJCA 4IXAA 5HS8A 1XGNA 1RZRA 2EV5A 5E1XA 1TWFJ 2ME0A 1FJLA 1V4RA 2JSCA 2PXEA 5DEQA 2ELJA 2RQQA 3S32A 1ZZ9A 1JUPA 3CCVI 3BR6A 4XOPA 5E8GA 4KA4A 2X48A 3CMMA 3DWLE 2BZTA 2XVCA 3F23A 2DMQA 2VIXA 4XSZF 5IP7J 4RGUA 4RAGA 4W1UA 2CYYA 2TDXA 2DOAA 4L9VA 2IXSA 2ZO4A 3E3VA 4BEHB 4IA8A 1ETKA 2M7BA 2KIFA 3ECOA 2K9LA 3D5RC 4C2MJ 3OYIA 1HF0A 3PO2J 2HDWA 3LA2A 5FRMA 4BL0B 5J1UA 4IZZA 5DTQA 2KHMA 3VYRB 1LDJA 3FXRA 3ZMTA 4BJ5C 3DU5A 3E0JB 4KNYA 4F92B 1R63A 2XI8A 3E7LA 2EA2A 3HZJA 1K4SA 1R36A 4XBFA 1MBJA 2DFEA 3ULQB 5F1JA 4N9HA 4CXFA 1F36A 3JRBA 4J00A 5FGMA 4RA2A 1U5TA 3MLFA 1HSJA 2OQGA 1R1TA 4HOBA 5CQEA 1K6OA 4FISA 4I2OA 3EPZA 1S7EA 1BC7C 4WXHA 4BNCA 5F0HA 1WH7A 4BBRJ 3ZPXA 2IW5A 3LA3A 4E7SA 2VOOA 5J6XA 1RC9A 3N4MA 2HS5A 2LYJA 4IPAA 3RIRA 2ZJQF 2W84A 3PO3J 2EWTA 1DU0A 1ZAYA 3BPVA 1IRXA 1T08B 4U87A 4A3JJ 3A01A 1NEQA 3JXDL 2X51A 3H3VK 4I02A 1XPXA 4TV7A 2BY1A 3CF5F 2DN0A 3WTVC 3IVPA 3I56I 1AHDP 1MKMA 3OS1A 3G1LA 1U9OA 2LF7A 4UUVA 2V1DA 1JFSA 2FSWA 1USTA 4RAZA 1ORKA 2YU3A 2PEXA 4FT8A 2ZCWA 1MH3A 1GUUA 5IT9K 2M34A 2K9SA 1ZZBA 1S3JA 4IX7A 4KDPA 3NDBB 1ZKGA 1S9HA 4DYRA 3H9QA 3HKZN 2HGCA 2EIJH 3WU1B 2JQ7A 2E1MC 3FMRA 5LFAA 2KDOA 2WAQA 1ZG5A 3W2WA 1X2NA 3WG9A 3R60A 2H94A 3BG9A 4BQOA 1HKQA 4IL6C 4PJJA 1JKPC 4CCKA 2PPXA 5JR3A 3C2HA 3CC7I 3H3UA 2JWTA 5FJ8J 4V19K 3OQOA 3U1DA 3BG5A 2MSYA 2GBYA 5DD8A 3SR4A 3F8NA 4OU0A 3ZMSA 1Y9QA 3F8BA 5HDGA 4Q47A 3FXOA 1ZRFA 5ED4A 3HL2A 5A2QK 1LEBA 4MFDA 1IN6A 4WXDA 2M8EA 2L4AA 3WU0A 3BR1A 2YS9A 3GTKJ 2BXZA 2DT6A 2EBYA 4N0BA 4C3JJ 2E19A 4AWXB 3DBLB 2GZUA 1Z91A 2BXYA 4BAYA 3RQ4A 3PQJA 3GFIA 3G1MA 3O3KA 2ECBA 2WV1A 2UXNA 3DXJF 4PSWA 1ETOA 1J09A 3KZIC 4IRHA 2FBIA 4AU7A 3GUUA 1ONVA 2XUBA 1K4TA 1TP4A 4IKFA 2DJNA 2D1VA 4QPQA 2E5NA 3J80Z 4U88A 2OUMA 3Q3SA 3R61A 1IV8A 3K4BA 3PL8A 1TWCJ 4CCOA 3K6GA 1F5TA 2JA6J 4B3AA 1PRVA 4G6QA 4QWQA 2RN7A 3FIWA 4HLYA 1NW3A 3CCLI 1GXQA 2K86A 4IHXA 3M3YJ 3B6CA 2ZFUA 3A2KA 3IKTA 4CSWA 2PUDA 1RI7A 3DPUA 4Z59A 2KLOA 5L3GA 1FTZA 2ETHA 5DYMA 1MMDA 3FMQA 2VKVA 3F6OA 4KT6A 1O3TA 1MJBA 5TJJA 3KJXA 2IA2A 4D7MA 1K78B 2E5ZA 4NQWB 2HQ5A 2HYJA 3OYKA 4BACA 2FJRA 4HZFA 1S7AA 1LCDA 3VDXA 3HOWJ 3DLAA 4CA0A 3HRUA 2JQEA 4EM0B 4EKIA 2QGUA 2XGEA 3ZMZA 5L3BA 2DW4A 3G2BA 5ILVA 2NRAC 3OR1C 2K3FA 2KZVA 2VPRA 2FMYA 4ESFA 3L2QA 4EMSA 2XIUA 2M87A 4BHCA 1R71A 2HR3A 2IGMA 2HVSA 2WBMA 1K78A 4XRMA 1HOMA 1GVDA 1XGSA 3D5SC 1QA6A 1I5ZA 2NS7A 1MH4A 1XSDA 2HDDA 3BR5A 2R7QA 3WTWC 1LB2A 4PSXA 4HBLA 2R4GA 1YLFA 3SZPA 3T5XA 1YOVB 4GQMA 4YFKF 1MBHA 2MXDA 1F9NA 3SZTA 1EV7A 1XGOA 5CJ9A 2JA5J 4X4DA 4B4CA 4II3A 4U0VA 3MN2A 1ERDA 1H89C 1VFCA 3JRGA 4CYDA 3CMEI 2JSPA 2FBKA 2STWA 1WFXA 3CDIA 2O5RA 3J81K 1ZGWA 1LMB3 2PXLA 4FE4A 1RPEL 3JCUC 1ON1A 1OPCA 1ADRA 3SJMA 3J80K 4UHTA 3F8FA 5K5OA 1UHMA 4AD9A 1OCCH 2XAGA 1JHFA 3P9CA 4IF4A 2DYRH 3F0CA 4M9SA 4BXFA 2L4MA 3CTAA 3NXHA 1JJ6C 1YJNI 9ANTA 3W6VA 3GZNB 4Y17A 3BR3A 3FZVA 2EV6A 1W36C 3K4NA 1G4DA 3DV8A 4S05A 4JBAA 2JTVA 2LDUA 3ZXSA 4AIDA 5C4JJ 3QODA 1Y8RB 1UCRA 5L3FA 3LISA 1XSVA 1D0YA 1DGRM 3BLYA 3ASOH 1ODDA 4X0GA 1J7KA 2EFQA 2CGPA 4PU7A 4A0YA 1Q1VA 2ZXJA 4Y3OA 3JXBC 2P6TA 2NYXA 3VK0A 5FLXZ 1ZGJA 3HSRA 2L5QA 1E3PA 3HPGA 3IRQA 1WJEA 1SD5A 2V3CC 1U3EM 1YO5C 2HTJA 3HXLA 2Z33A 2V9PA 1OKRA 2GXGA 3BROA 3QWLA 4ZDLA 5HNFA 1MNEA 3DBHB 1ZZ6A 2LNBA 1QHGA 2IVMA 5KVRA 1O3RA 3PNTA 2YU9J 5DCFA 3DEUA 4ZTFA 4L9TA 4OINF 2VBZA 1ZZ7A 4PJLA 4E7JA 4A3MJ 1OCTC 3HGYA 4F7ZA 2XIGA 2XSJC 2CUEA 1QQAA 3KZZA 4QSHA 2A05A 2LR8A 3ABKH 1RKTA 1XN7A 1P7JA 1WJFA 2FOWA 3AKZA 2GRMA 1KONA 2H27A 2CQQA 2F5EA 2NVTJ 1J9IA 1KYZA 3IH2A 3FYAA 1UELB 2QQAA 4HV5A 3V8KA 4GDFA 2QSGX 3ZPLA 1QU3A 2R7VA 5CQGA 5CVJA 5GAGi 1LDDA 2W1OA 3I59A 2K4BA 1FIPA 5FFZA 5FO5A 2K27A 3LOCA 1SC7A 2Q8KA 2CSOA 2F5CA 2LY2A 2M3AA 4EJWA 3H0DA 3GZDA 2L2OA 1ZLJA 5CVRA 1QP7A 5EZHA 3FM3A 1EA3A 3ISPA 3I3LA 2HI3A 4EV0A 1QPMA 2Z1DA 4P1WA 4FTHA 4BYYA 4MCXA 2HWVA 5J47A 3CLCA 3JREA 1QZYA 4L9JA 4ZYAA 2M0CA 3B73A 3LFUA 1Y0NA 4RGRA 1R6RA 5AIPA 1S72I 2OPTA 3COAC 4B1RA 2X1DA 1ZTRA 2GWRA 1K79A 2M5WA 2QBYA 5HLTA 2CFOA 1JE8A 4DZPA 4YBAA 3H1CA 1XC5A 4RB3C 3BY6A 3W6JB 2M4KA 3GYHX 3HUGA 3WHBA 3WTYC 3FBNB 2XGCA 3CCJI 3LSHA 3GTQJ 4BXXJ 1U78A 3LA7A 2LY9A 3DPLC 3N05A 1YW7A 3LQRA 5GAHJ 4F93B 2FBHA 4C3IJ 4DGWB 1MSFC 3JSOA 1ZPQA 3PXPA 2VBXA 2FE3A 1FC3A 4UVBA 1ZR2A 4PUSA 5M5WJ 3PSIA 2YR2A 3HDDA 1QZEA 4Y13A 1VF9A 2PMHA 3EQLF 3EYYA 1I1GA 2DFIA 2RC4A 3GVAA 3IC7A 2IVQA 3GO5A 4AC0A 4M6YA 1WI3A 1YS7A 2XXQA 3B7HA 1SMYF 1BDHA 1UMQA 4D9JA 1G3YA 5HNHA 3AG1H 1R1UA 4WCGA 3ZQIA 1LQCA 2EQRA 1BI3A 1JTXA 5GTIC 4G8XA 1SEUA 5E79C 1VQ9I 4YG1A 4XMYA 3C2BA 4ENKA 3JRIA 4B09A 3M4OJ 2IBDA 3E6BA 2Y31A 4LLNA 1Z7UA 1DPRA 1R4MB 1FYLA 4I6TA 3TQNA 5M5YJ 3PIOF 3Q0VA 5D5WB 3MKWB 4NUBA 3LSTA 1ETWA 3DCFA 1T2KA 3VWSA 1KQ8A 1JUMA 1V5FA 3FXQA 2QWWA 2EK5A 3MEXA 2GXAA 2VASA 2B0LA 2FQ3A 4XONA
chains in the Genus database with same CATH topology
4IEJA 4C3HJ 2EZKA 3VPRA 1WCMJ 4XRSG 2HOTA 3HOVJ 3TP0A 3S1QJ 1R69A 1ZUGA 4X4BA 1UG2A 3BTIA 3S1RJ 5IYBJ 2Y9ZA 1B72A 2GLOA 2AW6A 3IH3A 1QRYA 2HINA 1ETQA 3GTJJ 3RQIA 1TWGJ 3IV5A 2OR1L 3OIOA 5EEAA 5IOYA 1YSEA 4I6UA 3GTLJ 3SCFA 3IH4A 3CROL 1BJZA 4MFEA 3CQZJ 5EG0B 2NVXJ 1HCRA 1JH9A 2TCTA 2LTPA 4FE7A 1NK3P 4A93J 5EGOB 1W0UA 4RBOA 3UKGA 1RIOA 3QYXA 4G12A 3ZKCA 1F43A 1UXCA 4ABZA 4Y52J 3OMTA 1WH5A 2X6OA 1IUFA 5FKMA 2LCVA 2BJCA 2L7MP 4FCYA 4V2GA 4DYQA 1Z0XA 3KZ3A 1GDTA 4X4CA 1CQTA 4Z5CA 3FKIJ 4NDLA 1XS9A 1ZS4A 1WGXA 5M3MJ 3HOXJ 1D5YA 1X58A 2VUMJ 1ETYA 5F0FA 2GRLA 1B8IB 3H5TA 2LYSA 2XPUA 4F8DA 4M3FA 4M3DA 2XSDC 2IUOA 2L8NA 4BY7J 3OQNA 5K98B 1PRUA 2R93J 4JCYA 4Y42A 2PUGA 3TW7A 5FLVA 1XG1A 3H0GJ 3BQZA 5EGOA 2JA7J 1RKWA 1JJ8C 4DW6A 4IWRA 2IV1A 2LYPA 3TP3A 4XIDA 5F27A 3S17J 3S16J 1HDPA 4YG7B 1IGNA 1RZRA 4DYCA 2L0KA 1TWFJ 5EF6A 2ME0A 1FJLA 3LSGA 1ZZ9A 1JUPA 2DA6A 3NARA 3BR6A 1HDDC 1WH6A 4V2FA 2X48A 2H8RA 3O8HA 1LLIA 2DMQA 2IEKA 1ZQ3P 5IP7J 4W1UA 1VNDA 2MEZA 4FN3A 4IA8A 3QQAA 5F04A 1AKHB 4JX5A 1ETKA 2N8GA 5FKNA 2AXUA 3CMYA 2LYLA 2I10A 2P81A 4C2MJ 3PO2J 1HF0A 4M3GA 1JUSA 5EG0A 5DS9A 3G7DA 1RPWA 2Y0SN 4RDUA 1ZZCA 5J1UA 4X4EA 4JQDA 3LSPA 2XI8A 5FLMJ 1R63A 1RZSA 1NERA 3E7LA 5F1JA 1MBJA 3BTJA 3JRBA 1F36A 2HOAA 3LNQA 3GBFA 3MLFA 4FBIA 2HOSA 1ETVA 4MIMA 5C4XJ 4QIWN 4JCXA 3HZIB 5IPAA 2M2EA 4FISA 4X4GA 5FKOA 1S7EA 1U9NA 4GFBA 5F0HA 1WH7A 4BBRJ 3CCYA 1MBEA 2ECCA 1UTXA 1OCPA 3G1OA 3JRDA 2AUWA 2LYJA 2XJ3A 5EYRA 4PU4C 4XRSA 3PO3J 1OJLA 2EWTA 2ELKA 2IU7A 3D1NI 1FEXA 1JTYA 1DU0A 1ZAYA 1T33A 1HLVA 4X4FA 4A3JJ 3A01A 1NEQA 2WAQN 2IAIA 2IVGA 3JXDL 2XB0X 3U3WA 3H3VK 5JLWA 3RZDJ 3GTGJ 2DN0A 3IVPA 2EZHA 3EUSA 1TWHJ 1AHDP 3G1LA 5K7HA 1U9OA 1JWLA 1JFSA 1XWRA 2ICTA 5A7LA 1SFOJ 2EH3A 2M8GX 3ZHIA 1ORKA 4A69C 2OF7A 4IHVA 5FKKA 3MKLA 5DTDA 4A3LJ 3SCGA 1MH3A 1GUUA 2M34A 2K9SA 1ZZBA 3QF3A 4XK4A 1ZKGA 1ZVVA 2NOGA 4DYRA 2JVLA 4MLOA 3F6WA 3HKZN 4M3EA 3OOUA 2W48A 1H8AC 3UFDA 2HXOA 2LYRA 3LSJA 4OB4A 4DZJA 2LP0A 1BDIA 1ZK8A 1X2NA 1POUA 3LSRA 2L49A 4EEFG 2KEJA 1IJWC 3BG9A 1LE8B 1QVTA 1JKPC 1YRNA 2PPXA 2WUSR 1APLC 2FX0A 3CDLA 2JWTA 5FJ8J 3OQOA 1T56A 1IV6A 3BG5A 2MSYA 3SCHA 2GBYA 5IYCJ 2X9DA 3BTCA 1Y9QA 1MBKA 3GBGA 2Y30A 4X4HA 1IRZA 4MFDA 2XRLA 2ZB9A 3HEFA 3FYMA 1SQ8A 5C3EJ 2RAEA 3BR1A 3QPSA 2YS9A 3GTKJ 5IP6A 2EBYA 2GZUA 4C3JJ 2E19A 4W97A 2ICPA 1QP4A 1PRAA 2JA8J 1GV5A 1GV2A 3S2HJ 3S8QA 3G1MA 3S14J 4A3GJ 2XB5A 2CRGA 2Y9YA 3A02A 4CYCB 3L1PA 2ECBA 2WV1A 1ETOA 1JKOC 1WETA 5GPAA 5K7FA 2R5YB 2BNMA 3OSFA 3ZQLA 1JKQC 4UUSA 2YUSA 2R63A 1I3QJ 1A5JA 2DJNA 3SDGA 2HSGA 2B63J 3OQMA 1U8BA 3Q3SA 2PIJA 2CQXA 2EZIA 3HB9A 1O4XA 1G2HA 3JRCA 4Z58A 1TWCJ 2JA6J 1PRVA 3ZQHA 4B3AA 1ENHA 2EBIA 2E2JJ 3R1FA 2PUEA 5M5XJ 2LYQA 5IYDJ 1Y1VJ 3FIWA 3M3YJ 1PUFB 1B72B 4IHXA 3B6CA 1X2MA 1RETA 2QF7A 2XPVA 2PUDA 5F0CA 1WIZA 2CU7A 3BR0A 1RESA 4CYCA 4Z59A 1ZZ8A 3ZQFA 2O7OA 5GP9A 1FTZA 1B0NA 5GPCA 2VKVA 2LYKA 5HODA 2LFBA 2R0QC 2XCJA 4JYKA 4J19A 3OSGA 2B5AA 2KPJA 3BS3A 4D7MA 3KJXA 4A3BJ 2HQ5A 2HYJA 4BKXA 2JK3A 2FJRA 3JRFA 4GHJA 2DMUA 3MVPA 4IHYA 2R5ZA 1AKHA 4MCTA 1LCDA 2R5YA 2EZLA 3HOWJ 1GT0C 3GTOJ 4O8BA 3QPLA 3GTMJ 2KDZA 1SANA 3OP9A 2O9LA 1PUFA 1CJGA 4D5FA 2XGEA 1TC3C 4I8TA 2LLKA 4J1WA 3ZHMA 1NK2P 1IDYA 2VPRA 2XIUA 3HGGA 1QPIA 2G0EA 2MW8A 3DEWA 3GN5A 1HOMA 4XRMA 2MGQA 1GVDA 2NS7A 2K9QA 5K7ZA 1EF4A 1MH4A 4Y7NJ 1PNRA 2HDDA 3BR5A 1JT0A 1QQBA 3SFIA 2FJ1A 1X2LA 4GQMA 3BG3A 1JGGA 3HM5A 2O8KA 1MBHA 1IC8A 3S1NJ 2R7ZJ 2CSFA 1ZR4A 1DU6A 2JA5J 4X4DA 4B4CA 3HOYJ 2NVQJ 4A3IJ 4BY1J 3GN5B 3MN2A 2CROA 1H89C 1VFCA 3JRGA 5IP9J 2AXZA 4JX6A 1QVUA 1DWKA 1Z77A 1ZGWA 1BW6A 4FE4A 2KZ8A 2WIUB 1RPEL 3FMYA 2O49A 1ADRA 3SJMA 2HXIA 3JXCL 2JJ7A 2TRTA 2DA5A 4XICA 1NTCA 1LFUP 1LE8A 1YRNB 2KEKA 2NS8A 4M6VA 1WH8A 3I4MJ 3S15J 3DNVB 4S0HB 2Y2ZA 3F0CA 4LOCA 4AUXA 5C44J 3S2DJ 1DW9A 1VPWA 4I76A 1JJ6C 9ANTA 3W6VA 3QQ6A 4D7NA 1R9TJ 4M3BA 3BD1A 3FISA 3BR3A 1X57A 3F51A 1POGA 3I4NJ 4X4IA 2PUAA 5E3MA 2XGDA 1ETXA 3O9XA 2CUFA 5C4JJ 5EDNA 1UXDA 4JX4A 1MSEC 3LISA 1RR7A 5EZGA 3ZQCA 2IVBA 3JR9A 4PU7A 3K7AJ 1Q1VA 5M3FJ 1BA5A 3JXBC 4I6ZA 4NDWA 3VK0A 2DA2A 3FK7A 1K61A 2LKXA 5IOZA 1BL0A 4A3FJ 1AU7A 4A3DJ 5F08A 3O8GA 2A6CA 1ITYA 2COBA 1JKRC 1ZZ6A 4AYBN 2JMWA 2XPWA 1VI0A 2DA7A 2FD5A 1A6IA 3GTPJ 2YU9J 3LFPA 4JP0A 1RZRD 3HOZJ 2NVYJ 1ZZ7A 1BW5A 1L1MA 4MO7A 3ZOBA 2AO9A 3TW6A 4A3MJ 1OCTC 3HGYA 2M9HA 4PU8A 1LFBA 5E3NA 2L9RA 2CUEA 1QQAA 3BTLA 2VI6A 5J1YA 2PUFA 4QSHA 2DA1A 2LR8A 2EF8A 2L7FP 1OFCX 1RKTA 1P7JA 2GRMA 2CQQA 2NVTJ 3IH2A 3FYAA 1OSLA 1QPZA 2JCGA 1FIPA 2PUBA 3LOCA 4HNVA 2DMNA 2BNNA 1MBFA 3A03A 5FKLA 4I6RA 1QP7A 5EZHA 4Z5DA 2PMZN 5JLXA 1B8IA 2HI3A 2GM4A 2R5ZB 3FK6A 4BBSJ 3RZZA 2K40A 3WHCA 4Z5HA 4FTHA 1K83J 1IG7A 4MCXA 1QP0A 2DMTA 2LK2A 2LVSA 3PM1A 2MQKA 3CLCA 1FIAA 2AWIA 3JREA 1I6HJ 2DA4A 5J1RA 2OFYA 2KEIA 1MNMC 2O4AA 1I50J 2ID3A 2M0CA 4UUSB 2OPTA 4B1RA 2PE5A 1ZTRA 2D5VA 2L7ZA 2ME6A 1W0TA 4DZPA 4YBAA 1XC5A 3BT9A 2E2IJ 1FTTA 2MG4A 2DA3A 4IVZA 2QCOA 3BR2A 3WHBA 3S1MJ 3HBLA 2FQ4A 4A3EJ 4X6AJ 2XGCA 3Q0UA 3GTQJ 4BXXJ 1LCCA 2E1OA 1U78A 1H88C 2ID6A 2JN6A 2LY9A 1JT6A 4QTRA 3RZOJ 2AXVA 4L5EA 2DTZA 4C3IJ 2KT0A 2O38A 4YG4A 3BDNA 1MSFC 2H1KA 3PXPA 1ZPQA 3QWGA 3NAUA 3JRHA 1ZR2A 5M5WJ 2AHQA 3F52A 5J3LA 3HDDA 4J1XA 1VF9A 2E2HJ 2CJJA 1Y7YA 5E3LA 3BQYA 2IVQA 3A01B 4AC0A 1TWAJ 4A3CJ 1WI3A 3B7HA 1BDHA 3JRAA 1UMQA 3HOUJ 1MBGA 2DMPA 2BNOA 4X1EA 1JFTA 3ZQIA 1LQCA 2EQRA 2WB1N 1JTXA 4A3KJ 2R1JL 2PUCA 2LD5A 4PU3C 1IDZA 1PERL 4YG1A 3TRBA 3C2BA 3JRIA 3M4OJ 2IBDA 4IHWA 3G5GA 2VKEA 2Y31A 1UHSA 3TEDA 3CECA 3KXAA 4I6TA 5BNGA 5M5YJ 3Q0WA 3B6AA 3Q0VA 4YARA 1P7IA 3K2AA 3ZQGA 4UUTA 1ETWA 3DCFA 1EFAA 1JUMA 1WPKA 2K9NA 1E3OC 2R92J 4D5CA 3RKQA 1LMB3 1Y1WJ 5E3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEJ A;  4C3H J;  2EZK A;  3VPR A;  1WCM J;  4XRS G;  2HOT A;  3HOV J;  3TP0 A;  3S1Q J;  1R69 A;  1ZUG A;  4X4B A;  1UG2 A;  3BTI A;  3S1R J;  5IYB J;  2Y9Z A;  1B72 A;  2GLO A;  2AW6 A;  3IH3 A;  1QRY A;  2HIN A;  1ETQ A;  3GTJ J;  3RQI A;  1TWG J;  3IV5 A;  2OR1 L;  3OIO A;  5EEA A;  5IOY A;  1YSE A;  4I6U A;  3GTL J;  3SCF A;  3IH4 A;  3CRO L;  1BJZ A;  4MFE A;  3CQZ J;  5EG0 B;  2NVX J;  1HCR A;  1JH9 A;  2TCT A;  2LTP A;  4FE7 A;  1NK3 P;  4A93 J;  5EGO B;  1W0U A;  4RBO A;  3UKG A;  1RIO A;  3QYX A;  4G12 A;  3ZKC A;  1F43 A;  1UXC A;  4ABZ A;  4Y52 J;  3OMT A;  1WH5 A;  2X6O A;  1IUF A;  5FKM A;  2LCV A;  2BJC A;  2L7M P;  4FCY A;  4V2G A;  4DYQ A;  1Z0X A;  3KZ3 A;  1GDT A;  4X4C A;  1CQT A;  4Z5C A;  3FKI J;  4NDL A;  1XS9 A;  1ZS4 A;  1WGX A;  5M3M J;  3HOX J;  1D5Y A;  1X58 A;  2VUM J;  1ETY A;  5F0F A;  2GRL A;  1B8I B;  3H5T A;  2LYS A;  2XPU A;  4F8D A;  4M3F A;  4M3D A;  2XSD C;  2IUO A;  2L8N A;  4BY7 J;  3OQN A;  5K98 B;  1PRU A;  2R93 J;  4JCY A;  4Y42 A;  2PUG A;  3TW7 A;  5FLV A;  1XG1 A;  3H0G J;  3BQZ A;  5EGO A;  2JA7 J;  1RKW A;  1JJ8 C;  4DW6 A;  4IWR A;  2IV1 A;  2LYP A;  3TP3 A;  4XID A;  5F27 A;  3S17 J;  3S16 J;  1HDP A;  4YG7 B;  1IGN A;  1RZR A;  4DYC A;  2L0K A;  1TWF J;  5EF6 A;  2ME0 A;  1FJL A;  3LSG A;  1ZZ9 A;  1JUP A;  2DA6 A;  3NAR A;  3BR6 A;  1HDD C;  1WH6 A;  4V2F A;  2X48 A;  2H8R A;  3O8H A;  1LLI A;  2DMQ A;  2IEK A;  1ZQ3 P;  5IP7 J;  4W1U A;  1VND A;  2MEZ A;  4FN3 A;  4IA8 A;  3QQA A;  5F04 A;  1AKH B;  4JX5 A;  1ETK A;  2N8G A;  5FKN A;  2AXU A;  3CMY A;  2LYL A;  2I10 A;  2P81 A;  4C2M J;  3PO2 J;  1HF0 A;  4M3G A;  1JUS A;  5EG0 A;  5DS9 A;  3G7D A;  1RPW A;  2Y0S N;  4RDU A;  1ZZC A;  5J1U A;  4X4E A;  4JQD A;  3LSP A;  2XI8 A;  5FLM J;  1R63 A;  1RZS A;  1NER A;  3E7L A;  5F1J A;  1MBJ A;  3BTJ A;  3JRB A;  1F36 A;  2HOA A;  3LNQ A;  3GBF A;  3MLF A;  4FBI A;  2HOS A;  1ETV A;  4MIM A;  5C4X J;  4QIW N;  4JCX A;  3HZI B;  5IPA A;  2M2E A;  4FIS A;  4X4G A;  5FKO A;  1S7E A;  1U9N A;  4GFB A;  5F0H A;  1WH7 A;  4BBR J;  3CCY A;  1MBE A;  2ECC A;  1UTX A;  1OCP A;  3G1O A;  3JRD A;  2AUW A;  2LYJ A;  2XJ3 A;  5EYR A;  4PU4 C;  4XRS A;  3PO3 J;  1OJL A;  2EWT A;  2ELK A;  2IU7 A;  3D1N I;  1FEX A;  1JTY A;  1DU0 A;  1ZAY A;  1T33 A;  1HLV A;  4X4F A;  4A3J J;  3A01 A;  1NEQ A;  2WAQ N;  2IAI A;  2IVG A;  3JXD L;  2XB0 X;  3U3W A;  3H3V K;  5JLW A;  3RZD J;  3GTG J;  2DN0 A;  3IVP A;  2EZH A;  3EUS A;  1TWH J;  1AHD P;  3G1L A;  5K7H A;  1U9O A;  1JWL A;  1JFS A;  1XWR A;  2ICT A;  5A7L A;  1SFO J;  2EH3 A;  2M8G X;  3ZHI A;  1ORK A;  4A69 C;  2OF7 A;  4IHV A;  5FKK A;  3MKL A;  5DTD A;  4A3L J;  3SCG A;  1MH3 A;  1GUU A;  2M34 A;  2K9S A;  1ZZB A;  3QF3 A;  4XK4 A;  1ZKG A;  1ZVV A;  2NOG A;  4DYR A;  2JVL A;  4MLO A;  3F6W A;  3HKZ N;  4M3E A;  3OOU A;  2W48 A;  1H8A C;  3UFD A;  2HXO A;  2LYR A;  3LSJ A;  4OB4 A;  4DZJ A;  2LP0 A;  1BDI A;  1ZK8 A;  1X2N A;  1POU A;  3LSR A;  2L49 A;  4EEF G;  2KEJ A;  1IJW C;  3BG9 A;  1LE8 B;  1QVT A;  1JKP C;  1YRN A;  2PPX A;  2WUS R;  1APL C;  2FX0 A;  3CDL A;  2JWT A;  5FJ8 J;  3OQO A;  1T56 A;  1IV6 A;  3BG5 A;  2MSY A;  3SCH A;  2GBY A;  5IYC J;  2X9D A;  3BTC A;  1Y9Q A;  1MBK A;  3GBG A;  2Y30 A;  4X4H A;  1IRZ A;  4MFD A;  2XRL A;  2ZB9 A;  3HEF A;  3FYM A;  1SQ8 A;  5C3E J;  2RAE A;  3BR1 A;  3QPS A;  2YS9 A;  3GTK J;  5IP6 A;  2EBY A;  2GZU A;  4C3J J;  2E19 A;  4W97 A;  2ICP A;  1QP4 A;  1PRA A;  2JA8 J;  1GV5 A;  1GV2 A;  3S2H J;  3S8Q A;  3G1M A;  3S14 J;  4A3G J;  2XB5 A;  2CRG A;  2Y9Y A;  3A02 A;  4CYC B;  3L1P A;  2ECB A;  2WV1 A;  1ETO A;  1JKO C;  1WET A;  5GPA A;  5K7F A;  2R5Y B;  2BNM A;  3OSF A;  3ZQL A;  1JKQ C;  4UUS A;  2YUS A;  2R63 A;  1I3Q J;  1A5J A;  2DJN A;  3SDG A;  2HSG A;  2B63 J;  3OQM A;  1U8B A;  3Q3S A;  2PIJ A;  2CQX A;  2EZI A;  3HB9 A;  1O4X A;  1G2H A;  3JRC A;  4Z58 A;  1TWC J;  2JA6 J;  1PRV A;  3ZQH A;  4B3A A;  1ENH A;  2EBI A;  2E2J J;  3R1F A;  2PUE A;  5M5X J;  2LYQ A;  5IYD J;  1Y1V J;  3FIW A;  3M3Y J;  1PUF B;  1B72 B;  4IHX A;  3B6C A;  1X2M A;  1RET A;  2QF7 A;  2XPV A;  2PUD A;  5F0C A;  1WIZ A;  2CU7 A;  3BR0 A;  1RES A;  4CYC A;  4Z59 A;  1ZZ8 A;  3ZQF A;  2O7O A;  5GP9 A;  1FTZ A;  1B0N A;  5GPC A;  2VKV A;  2LYK A;  5HOD A;  2LFB A;  2R0Q C;  2XCJ A;  4JYK A;  4J19 A;  3OSG A;  2B5A A;  2KPJ A;  3BS3 A;  4D7M A;  3KJX A;  4A3B J;  2HQ5 A;  2HYJ A;  4BKX A;  2JK3 A;  2FJR A;  3JRF A;  4GHJ A;  2DMU A;  3MVP A;  4IHY A;  2R5Z A;  1AKH A;  4MCT A;  1LCD A;  2R5Y A;  2EZL A;  3HOW J;  1GT0 C;  3GTO J;  4O8B A;  3QPL A;  3GTM J;  2KDZ A;  1SAN A;  3OP9 A;  2O9L A;  1PUF A;  1CJG A;  4D5F A;  2XGE A;  1TC3 C;  4I8T A;  2LLK A;  4J1W A;  3ZHM A;  1NK2 P;  1IDY A;  2VPR A;  2XIU A;  3HGG A;  1QPI A;  2G0E A;  2MW8 A;  3DEW A;  3GN5 A;  1HOM A;  4XRM A;  2MGQ A;  1GVD A;  2NS7 A;  2K9Q A;  5K7Z A;  1EF4 A;  1MH4 A;  4Y7N J;  1PNR A;  2HDD A;  3BR5 A;  1JT0 A;  1QQB A;  3SFI A;  2FJ1 A;  1X2L A;  4GQM A;  3BG3 A;  1JGG A;  3HM5 A;  2O8K A;  1MBH A;  1IC8 A;  3S1N J;  2R7Z J;  2CSF A;  1ZR4 A;  1DU6 A;  2JA5 J;  4X4D A;  4B4C A;  3HOY J;  2NVQ J;  4A3I J;  4BY1 J;  3GN5 B;  3MN2 A;  2CRO A;  1H89 C;  1VFC A;  3JRG A;  5IP9 J;  2AXZ A;  4JX6 A;  1QVU A;  1DWK A;  1Z77 A;  1ZGW A;  1BW6 A;  4FE4 A;  2KZ8 A;  2WIU B;  1RPE L;  3FMY A;  2O49 A;  1ADR A;  3SJM A;  2HXI A;  3JXC L;  2JJ7 A;  2TRT A;  2DA5 A;  4XIC A;  1NTC A;  1LFU P;  1LE8 A;  1YRN B;  2KEK A;  2NS8 A;  4M6V A;  1WH8 A;  3I4M J;  3S15 J;  3DNV B;  4S0H B;  2Y2Z A;  3F0C A;  4LOC A;  4AUX A;  5C44 J;  3S2D J;  1DW9 A;  1VPW A;  4I76 A;  1JJ6 C;  9ANT A;  3W6V A;  3QQ6 A;  4D7N A;  1R9T J;  4M3B A;  3BD1 A;  3FIS A;  3BR3 A;  1X57 A;  3F51 A;  1POG A;  3I4N J;  4X4I A;  2PUA A;  5E3M A;  2XGD A;  1ETX A;  3O9X A;  2CUF A;  5C4J J;  5EDN A;  1UXD A;  4JX4 A;  1MSE C;  3LIS A;  1RR7 A;  5EZG A;  3ZQC A;  2IVB A;  3JR9 A;  4PU7 A;  3K7A J;  1Q1V A;  5M3F J;  1BA5 A;  3JXB C;  4I6Z A;  4NDW A;  3VK0 A;  2DA2 A;  3FK7 A;  1K61 A;  2LKX A;  5IOZ A;  1BL0 A;  4A3F J;  1AU7 A;  4A3D J;  5F08 A;  3O8G A;  2A6C A;  1ITY A;  2COB A;  1JKR C;  1ZZ6 A;  4AYB N;  2JMW A;  2XPW A;  1VI0 A;  2DA7 A;  2FD5 A;  1A6I A;  3GTP J;  2YU9 J;  3LFP A;  4JP0 A;  1RZR D;  3HOZ J;  2NVY J;  1ZZ7 A;  1BW5 A;  1L1M A;  4MO7 A;  3ZOB A;  2AO9 A;  3TW6 A;  4A3M J;  1OCT C;  3HGY A;  2M9H A;  4PU8 A;  1LFB A;  5E3N A;  2L9R A;  2CUE A;  1QQA A;  3BTL A;  2VI6 A;  5J1Y A;  2PUF A;  4QSH A;  2DA1 A;  2LR8 A;  2EF8 A;  2L7F P;  1OFC X;  1RKT A;  1P7J A;  2GRM A;  2CQQ A;  2NVT J;  3IH2 A;  3FYA A;  1OSL A;  1QPZ A;  2JCG A;  1FIP A;  2PUB A;  3LOC A;  4HNV A;  2DMN A;  2BNN A;  1MBF A;  3A03 A;  5FKL A;  4I6R A;  1QP7 A;  5EZH A;  4Z5D A;  2PMZ N;  5JLX A;  1B8I A;  2HI3 A;  2GM4 A;  2R5Z B;  3FK6 A;  4BBS J;  3RZZ A;  2K40 A;  3WHC A;  4Z5H A;  4FTH A;  1K83 J;  1IG7 A;  4MCX A;  1QP0 A;  2DMT A;  2LK2 A;  2LVS A;  3PM1 A;  2MQK A;  3CLC A;  1FIA A;  2AWI A;  3JRE A;  1I6H J;  2DA4 A;  5J1R A;  2OFY A;  2KEI A;  1MNM C;  2O4A A;  1I50 J;  2ID3 A;  2M0C A;  4UUS B;  2OPT A;  4B1R A;  2PE5 A;  1ZTR A;  2D5V A;  2L7Z A;  2ME6 A;  1W0T A;  4DZP A;  4YBA A;  1XC5 A;  3BT9 A;  2E2I J;  1FTT A;  2MG4 A;  2DA3 A;  4IVZ A;  2QCO A;  3BR2 A;  3WHB A;  3S1M J;  3HBL A;  2FQ4 A;  4A3E J;  4X6A J;  2XGC A;  3Q0U A;  3GTQ J;  4BXX J;  1LCC A;  2E1O A;  1U78 A;  1H88 C;  2ID6 A;  2JN6 A;  2LY9 A;  1JT6 A;  4QTR A;  3RZO J;  2AXV A;  4L5E A;  2DTZ A;  4C3I J;  2KT0 A;  2O38 A;  4YG4 A;  3BDN A;  1MSF C;  2H1K A;  3PXP A;  1ZPQ A;  3QWG A;  3NAU A;  3JRH A;  1ZR2 A;  5M5W J;  2AHQ A;  3F52 A;  5J3L A;  3HDD A;  4J1X A;  1VF9 A;  2E2H J;  2CJJ A;  1Y7Y A;  5E3L A;  3BQY A;  2IVQ A;  3A01 B;  4AC0 A;  1TWA J;  4A3C J;  1WI3 A;  3B7H A;  1BDH A;  3JRA A;  1UMQ A;  3HOU J;  1MBG A;  2DMP A;  2BNO A;  4X1E A;  1JFT A;  3ZQI A;  1LQC A;  2EQR A;  2WB1 N;  1JTX A;  4A3K J;  2R1J L;  2PUC A;  2LD5 A;  4PU3 C;  1IDZ A;  1PER L;  4YG1 A;  3TRB A;  3C2B A;  3JRI A;  3M4O J;  2IBD A;  4IHW A;  3G5G A;  2VKE A;  2Y31 A;  1UHS A;  3TED A;  3CEC A;  3KXA A;  4I6T A;  5BNG A;  5M5Y J;  3Q0W A;  3B6A A;  3Q0V A;  4YAR A;  1P7I A;  3K2A A;  3ZQG A;  4UUT A;  1ETW A;  3DCF A;  1EFA A;  1JUM A;  1WPK A;  2K9N A;  1E3O C;  2R92 J;  4D5C A;  3RKQ A;  1LMB 3;  1Y1W J;  5E3O A; 
#chains in the Genus database with same CATH topology
 2UXX A;  4IEJ A;  2EZK A;  4OIR F;  1WCM J;  2H6C A;  4XRS G;  4RAY A;  1W4M A;  1Q1H A;  3KP5 A;  3TP0 A;  2KPM A;  3S1Q J;  2IS6 A;  3WTU C;  2VLA A;  4X4B A;  1UG2 A;  1OCZ H;  2KQR A;  1BR1 A;  2JUC A;  4I7H A;  1QZZ A;  3J7Y J;  1TTY A;  1SVL A;  5KNL A;  3CO7 C;  3RQI A;  3SHF A;  1TWG J;  2OR1 L;  2Z9O A;  3J81 Z;  3ZQ7 A;  4ZYH A;  4EZI A;  1YSE A;  2EIL H;  2KIM A;  2VB6 A;  1FPQ A;  2DT7 B;  1JH9 A;  3T0Y A;  4E7K A;  4L5I A;  4LIT A;  5EGO B;  1W0U A;  3H5N A;  5TGT A;  3QYX A;  2F4M B;  3HIF A;  2VQL A;  1X1D A;  4Y52 J;  2F5D A;  2QVO A;  2Z99 A;  1XMX A;  2BE5 F;  2L7M P;  1YI2 I;  2LCV A;  4MQ9 F;  1Z0X A;  4OAY A;  2F5F A;  4Z5C A;  2I5U A;  2PI0 A;  3FKI J;  4NDL A;  1XS9 A;  1V54 H;  2FA5 A;  2PQ8 A;  1WGX A;  4CO8 A;  5F0F A;  2F2E A;  2LLW A;  2PXT A;  2LYS A;  4F8D A;  2XSD C;  2IUO A;  2FF4 A;  3KX2 A;  3GEZ A;  3K10 A;  4Y42 A;  2P5V A;  3TW7 A;  3TFL A;  5FLV A;  2PUG A;  5H6R A;  2DOE A;  3BQZ A;  4RB2 C;  3CCS I;  4KMU X;  1T39 A;  1RKW A;  4IWR A;  3RDI A;  4EK9 A;  2IV1 A;  2LYP A;  3TP3 A;  4YG7 B;  1RNL A;  5F27 A;  1C0W A;  3S16 J;  3SX0 A;  2M4H A;  1FWZ A;  3DTE A;  4DYC A;  3MAJ A;  2DA6 A;  3NAR A;  4G7Z F;  4LB6 B;  1WH6 A;  4V2F A;  2DOF A;  3GCM A;  3GX4 X;  3O8H A;  1LLI A;  5GAG J;  3HTU A;  1VND A;  2CV2 A;  2MEZ A;  2ZJP F;  3TEP A;  4LG0 A;  1AKH B;  4Q2J A;  3PNY A;  2N8G A;  5FKN A;  3CMY A;  2I10 A;  2P81 A;  2XF5 A;  1SFE A;  5DS9 A;  1RPW A;  3VSK A;  1XB4 A;  2HCS A;  2FUG 2;  4IHS A;  3DPT A;  3LSP A;  1TT5 B;  2VKH A;  2DFH A;  4K2E A;  4L0Y B;  2GXB A;  2HQA A;  4Q48 A;  4UVC A;  2O8X A;  3SEQ A;  2HOA A;  4U7B A;  4GYG A;  3LNQ A;  2C6Y A;  2OTL I;  4JK1 X;  3VB2 A;  4JCX A;  5AIQ A;  5FKO A;  1FMV A;  3RJP A;  2GA1 A;  4WWC A;  3CCY A;  5FRO A;  5HLG A;  2EA4 A;  1R23 A;  2DDB A;  3PFY A;  3IL2 A;  3JRD A;  3CUQ A;  5EYR A;  5E1W A;  1OJL A;  2ELK A;  3OYG A;  3PQK A;  1JTY A;  2ZKZ A;  2IJL A;  4X4F A;  2VJ5 A;  2EIK H;  3M07 A;  3JAM K;  2IVG A;  2VJJ A;  3HC7 A;  3HTS B;  5DUI A;  3I5U A;  3K1M A;  3RZD J;  2XF7 A;  2P0W A;  3EUS A;  4D0P A;  2OQR A;  2KMU A;  4EAT A;  4YRV A;  3DTK A;  1SFO J;  1JHH A;  3TEL A;  1S6L A;  2M8G X;  3ZHI A;  2OF7 A;  2DAO A;  2RV8 A;  2L9S A;  3CO6 C;  3F21 A;  1GHC A;  1STZ A;  1REP C;  3QYB A;  5DDG A;  2J5P A;  3A0H C;  3HHG A;  3SCG A;  1GVJ A;  2KP6 A;  4F52 A;  5JFR A;  5D5U B;  1G6N A;  1H9G A;  3H92 A;  2BEO A;  4M3E A;  3OYN A;  2DDA A;  2ZXI A;  1ZYR F;  5D8K B;  3LSJ A;  3M1E A;  4DZJ A;  1POU A;  1R58 A;  5L3E A;  5LGU A;  1QBJ A;  3ERE D;  1FOW A;  1R00 A;  2VQC A;  1BR2 A;  2WB1 A;  3FXU A;  1QVT A;  2ADU A;  2OZU A;  4G7O F;  1IAW A;  3CDL A;  5LHH A;  4LIV A;  3SCH A;  3ZMD A;  2W82 A;  4NC7 A;  3WTS C;  2X9D A;  2RGV A;  2VE8 A;  4OIQ F;  1Z21 A;  3D5L A;  3G73 A;  3HPH A;  1MBK A;  3UNG C;  1P4X A;  2Q2E A;  1B9N A;  1KYW A;  2R7U A;  1TW2 A;  2XRL A;  1OR7 A;  1ZLK A;  1SQ8 A;  2Y48 A;  3GWZ A;  2CUJ A;  1X4O A;  3OYD A;  3QPS A;  5ICG A;  3BZ6 A;  1QP4 A;  3BC8 A;  2R7R A;  4CHU A;  2RKH A;  1WQ2 A;  3QOP A;  3S2H J;  3GF2 A;  3S14 J;  2HKO A;  4A3G J;  2Y9Y A;  1X3U A;  4XN0 A;  2G7U A;  5ICF A;  4HEA 2;  2LF8 A;  2ZME B;  3KYD B;  1YG2 A;  2WY7 Q;  1WET A;  4BJT A;  3OSF A;  3ZQL A;  4O6J A;  4KIS A;  2P4W A;  4KN4 X;  1I3Q J;  3KZY A;  5B1B H;  1VQ8 I;  1LVA A;  4XR6 A;  2B63 J;  1QGP A;  1QNT A;  4M72 A;  2PIJ A;  3HB9 A;  1G2H A;  3PE5 A;  1T0F A;  4Z58 A;  4B3X A;  3G71 I;  3K1N A;  1ENH A;  1KQ0 A;  4BHP A;  2F48 A;  2V9K A;  3FDY A;  5M5X J;  1Y1V J;  2OZ6 A;  3S8P A;  2YX4 A;  2ICW G;  3ZN1 A;  1B72 B;  2PBI A;  2P7V B;  1RET A;  4P55 A;  2QF7 A;  1IXC A;  2JA2 A;  2CU7 A;  1R22 A;  2A69 F;  1BIA A;  1U2W A;  2DT5 A;  3KE2 A;  3WTZ A;  1EH8 A;  2FML A;  2R0Q C;  2XCJ A;  3BS3 A;  1HW5 A;  2KPJ A;  3UR3 C;  3N97 A;  5K5R A;  1FBU A;  4OIO F;  3JRF A;  3D0S A;  2DK8 A;  2DMU A;  4PGH A;  4IHY A;  2R5Z A;  1AKH A;  2PXU A;  2KL4 A;  1GT0 C;  3GTO J;  5FLX K;  3QPL A;  3KL4 A;  1O7L A;  1SAN A;  3IHU A;  1PUF A;  4I8T A;  2QEN A;  5HDK A;  4B8X A;  1W7P A;  2BYV E;  2LLK A;  3HGG A;  3E5X A;  3SEZ A;  1P92 A;  2G0E A;  2MW8 A;  3I71 A;  3RPU D;  2X85 A;  1UB9 A;  3GN5 A;  2VJ4 A;  3G0T A;  3CJR B;  4BQQ A;  2K9Q A;  5K7Z A;  2JZY A;  2VQH A;  4Y7N J;  2GIV A;  1DP3 A;  1WJB A;  1JT0 A;  5DCM B;  4G94 A;  4U0W A;  1BR4 A;  2DBB A;  1JGG A;  4NB5 A;  3HM5 A;  4HPQ A;  1DGW Y;  1A36 A;  3S1N J;  2E7W A;  2R7Z J;  4UNO A;  4NQW A;  1ZR4 A;  2CV1 A;  1X1A A;  2H09 A;  2YPR A;  2NVQ J;  3C2G A;  4E6K G;  4BY1 J;  2BOL A;  4XNF A;  4XKB A;  4PJ0 C;  5KAI C;  2VEO A;  4JX6 A;  1QVU A;  1DWK A;  1BW6 A;  2LRE A;  2IS1 A;  2O49 A;  1BI1 A;  2M30 A;  3JXC L;  4EGY A;  2TRT A;  4XIC A;  2DA5 A;  2O0Y A;  1XDS A;  3OOP A;  1LE8 A;  1YRN B;  4HQM A;  5LRS A;  2NNY A;  2NS8 A;  4BGD A;  4EGZ A;  2KEK A;  4II2 A;  4I0B A;  4F3Q A;  3L2C A;  3S15 J;  3DNV B;  5GAE J;  2Y2Z A;  2KIS A;  4XL9 A;  1HXD A;  4GXO A;  5BOX A;  4I76 A;  2VXZ A;  1HQC A;  5JHF A;  1OLT A;  3WU2 C;  4HA8 A;  1W5C C;  1R9T J;  4BHB A;  3FIS A;  1X57 A;  3F51 A;  4A0X A;  2XAU A;  2K9M A;  2BGC A;  5E3M A;  2ZBK A;  2XGD A;  1G8X A;  5IY5 H;  1ETX A;  4LMY A;  4F55 A;  5D6E A;  2JT1 A;  3VSL A;  3JAM Z;  2OBP A;  2KJB A;  2FNA A;  2K02 A;  2BW3 B;  2VN2 A;  4DQ2 A;  1MDM B;  1IW7 F;  3R0A A;  5LGT A;  2KZG A;  5K1Y A;  3CMA I;  1B59 A;  2PXK A;  4NDW A;  4XOR A;  3V7S A;  4M9X A;  2DA2 A;  1K61 A;  3DP7 A;  3ML6 A;  5IOZ A;  2CWE A;  3V7R A;  1B6A A;  4A3F J;  4A3D J;  5D4R A;  1ITY A;  4BXU A;  2PG4 A;  3I54 A;  4Y15 A;  2JMW A;  4AYB N;  3ABL H;  5DM7 F;  4H0E A;  1BBY A;  2FD5 A;  1O3Q A;  3LFP A;  4JP0 A;  1FYM A;  2VKD A;  1RZR D;  4BS9 A;  4MO7 A;  2AO9 A;  3TW6 A;  2M9H A;  4XKW A;  3HUG B;  5K5Q A;  2L9R A;  1U8R A;  2HZD A;  1WJA A;  2EIN H;  1N75 A;  1IF1 A;  2PX9 A;  3M9L A;  3CJT B;  4WK8 F;  1J2X A;  4NC8 A;  4IRG A;  3CCM I;  4WVL A;  2HQR A;  4DBR A;  1OCO H;  3ZRG A;  5ERI A;  2XGX A;  5JI6 A;  4WX9 A;  5DT2 A;  2PUB A;  3LL7 A;  4LD5 A;  2GA2 A;  1DUL A;  2V6E A;  2I8D A;  3NRO A;  2DQL A;  1ZRE A;  3MEJ A;  4DE8 A;  2DMN A;  2QQB A;  3ROU A;  3Q9S A;  4I6R A;  1D8K A;  1D0Z A;  4WF2 A;  1KQ9 A;  4PDK A;  2IA0 A;  1QHH D;  2LRD A;  3RZZ A;  1K83 J;  3RTR A;  2E60 A;  1IG7 A;  5E20 A;  1QP0 A;  4ZZD A;  3PM1 A;  1T98 A;  3M7G A;  2Y0M A;  4ON0 A;  3KIO A;  1YFH A;  1QB2 A;  2MQK A;  2LBF B;  1D1B A;  2CQK A;  1MNM C;  1SD4 A;  2P6S A;  3TOA A;  3RSN A;  2PE5 A;  1I6X A;  2L7Z A;  2ME6 A;  1I1S A;  4L5J A;  1U5T B;  1S7O A;  3OYL A;  2RNG A;  3BR2 A;  1OIS A;  3S1M J;  2HYF A;  2L3D A;  2M4G A;  1Z9C A;  2A5Y B;  1VZ0 A;  3Q0U A;  5D6F A;  3I59 B;  1WSU A;  4CZC A;  2JN6 A;  1ON2 A;  3H36 A;  4LLG F;  2XHK A;  2VXD A;  3KLN A;  4HNU A;  4BUP A;  2KT0 A;  5CPR B;  2BY2 A;  3JRH A;  4ZJZ A;  3WOD F;  3Q5F A;  2KRF A;  2MLG A;  3IP4 B;  4OAZ A;  3NWT A;  1IN7 A;  2AHQ A;  1L0O C;  2E2H J;  4IHT A;  2IPQ X;  2CJJ A;  1Y7Y A;  3BQY A;  5IT3 A;  3OS0 A;  2JPC A;  1T6S A;  1IN5 A;  1MDM A;  2L7K A;  2WA0 A;  1MBG A;  5F64 A;  2DMP A;  2HU9 A;  1ZHF A;  5HOO A;  3FXM A;  3AL0 C;  3G3Z A;  4R8H A;  3CP2 A;  4A3K J;  2PUC A;  5CVI A;  1IDZ A;  1A35 A;  1PER L;  1O7F A;  3QOE A;  3TRB A;  2BVL A;  1W7P B;  4IHW A;  3G5G A;  3E6C C;  2PLY A;  3KXA A;  3GZ5 A;  3RYP A;  5BNG A;  3Q0W A;  4RAF A;  1O57 A;  2MH9 A;  2V7F A;  2YBD A;  3ZQG A;  1EFA A;  1R5G A;  4MTD A;  3IWZ A;  2JPB A;  4HW0 A;  3OYA A;  2K9N A;  1HKT A;  3EUK L;  5L3D A;  1E3O C;  2R92 J;  4D5C A;  4CIC A;  4OIP F;  2VOD A;  2CS3 A;  1E0E A;  5ICC A;  5E3O A;  1Y1W J;  4XQF A;  4C3H J;  3OYB A;  2Y75 A;  2KJC A;  1ZUG A;  1TLH B;  1B72 A;  1G3S A;  2F4O B;  5IYB J;  2AW6 A;  4IRI A;  3K4C A;  2RDP A;  2HPI A;  5EEA A;  5KAF C;  4NC6 A;  3KP4 A;  1UJ8 A;  3MZY A;  2MD5 A;  3ONQ A;  3IH4 A;  2XF6 A;  3CRO L;  3CQZ J;  3SQN A;  4EVI A;  1E17 A;  5EG0 B;  4NHJ A;  3A9Z A;  2LTP A;  1NK3 P;  1LEA A;  3M1C A;  4RBO A;  1RIO A;  2DYS H;  3ZKC A;  1F43 A;  2FFH A;  1UXC A;  2VBY A;  3CLQ A;  4EQZ A;  3G4S I;  3A9Y A;  2NOJ B;  3M8J A;  3OMT A;  5D5X B;  2X6W A;  3GLX A;  3AAF A;  2X6X A;  4FCY A;  3BZK A;  3I58 A;  1N77 A;  2OJE D;  1SMT A;  2M0M A;  4ESB A;  4UB6 C;  2XC7 A;  2BVM A;  4ITV A;  2OD5 A;  1SFX A;  1XMA A;  5M3M J;  4ZYG A;  5D5V B;  2CO5 A;  3OV8 A;  4CH7 A;  1HA8 A;  1ETY A;  3QP6 A;  2GRL A;  1PUE E;  2Q1Z B;  3X2Q H;  3H5T A;  4M3F A;  1LPQ A;  1P4W A;  3OQN A;  3A4C A;  1PRU A;  2R93 J;  4JCY A;  2QSH X;  5E17 F;  3H0G J;  2EIM H;  3C3W A;  4DIQ A;  2JA7 J;  2OC6 A;  3MMY B;  3KFW X;  3OYC A;  2PMZ A;  5J4Y A;  4MHG A;  1IRF A;  5J40 A;  4UB8 C;  1NH3 A;  3KEO A;  2L0K A;  1VQ5 I;  4KIG A;  3TO6 A;  1HST A;  3WE2 A;  3LSG A;  2PXV A;  1MND A;  3KP3 A;  1HDD C;  2E35 A;  1KU3 A;  2H8R A;  2K5C A;  1ZQ3 P;  2A68 F;  4A6D A;  2HCN A;  5DSX A;  3QQA A;  5F04 A;  2E1N A;  4JX5 A;  2AXU A;  2LH9 A;  1FZP B;  5H6Q A;  3KEQ A;  4KIT B;  2CW8 A;  4M3G A;  1JUS A;  4C9Y A;  5EG0 A;  5HVQ C;  2Y0S N;  2HOE A;  4RDU A;  1ZZC A;  3F8C A;  3QOX A;  2FXA A;  4HF1 A;  4JQD A;  3CD6 I;  2UUZ A;  5FLM J;  2YSR A;  5DTR A;  2KFD A;  3BTJ A;  2OCE A;  1IRG A;  4IO9 F;  1EKE A;  1UZC A;  5ILU A;  3LAP A;  4FBI A;  2HOS A;  1ETV A;  5JVG F;  4UVA A;  6PAX A;  2OV7 A;  3HZI B;  2M2E A;  3MFK A;  4X4G A;  2PJR B;  4DE9 A;  1DP7 P;  1U9N A;  4HG2 A;  4GFB A;  3LFK A;  3E6M A;  1E2X A;  2K3P A;  4XLC A;  2X4H A;  2ECC A;  3VEP A;  1UTX A;  3K4M A;  3U9G A;  1OCP A;  4GCV A;  3ZQQ A;  2XJ3 A;  3BCB A;  2HEO A;  4PU4 C;  3T8T A;  1IN4 A;  4XRS A;  4FHT A;  2OAZ A;  3D1N I;  2LYC A;  4WXC A;  1FEX A;  1T33 A;  1JGS A;  3U21 A;  5LHG A;  2G9W A;  2WAQ N;  4QLC U;  2IAI A;  1OMI A;  2XB0 X;  2DCE A;  1G3T A;  3U3W A;  5IT9 Z;  2X1C A;  1FSE A;  2GZW A;  5F1R A;  1P2F A;  3BG6 A;  3GTG J;  3MKZ A;  4MEX F;  1JWL A;  2EH3 A;  2ISZ A;  1A6Q A;  1X3Z B;  3P5J A;  2IS4 A;  3HHH A;  4OBM A;  4IHV A;  2OU2 A;  2IGK A;  3MKL A;  5DTD A;  1I27 A;  4A3L J;  4YIF A;  2FEZ A;  1G3W A;  2GIZ A;  4G7H F;  1TL8 A;  1WVR A;  1YTY A;  4XK4 A;  3EYI A;  2XV4 S;  3QF3 A;  4LG0 B;  2VT3 A;  4MTE A;  4ENN A;  4P96 A;  2DXI A;  2BY3 A;  3IAS 2;  3OOU A;  1IN8 A;  1BJA A;  4PFP A;  2VON A;  3UFD A;  2LYR A;  3DQV C;  2BHY A;  4M6X A;  2NAZ A;  3V7C A;  3DM5 A;  2LP0 A;  1T95 A;  1U0J A;  3J7A O;  1BDI A;  5CLS A;  3LSR A;  1EJ9 A;  4EEF G;  2WV0 A;  2KEJ A;  1IJW C;  2J5O A;  4CZZ A;  3BG7 A;  2WUS R;  4YIR X;  1APL C;  2YX7 A;  3L2W A;  1VQP I;  3E6D A;  3KP7 A;  1X1P A;  2W24 A;  5IYC J;  3VFZ A;  4KT5 C;  1ULY A;  5DTM A;  2P8T A;  3I4P A;  3GBG A;  5DV5 A;  4X4H A;  2STT A;  1MMG A;  1YQA A;  2JUG A;  2JVG A;  4CCN A;  3HEF A;  1MD0 A;  1G59 A;  1HW1 A;  3RI4 A;  3FYM A;  3T1B A;  4HAM A;  2RAE A;  5D8L B;  1Z05 A;  5IP6 A;  3FX3 A;  1ZAO A;  4W97 A;  3IKV A;  2UWM A;  2HDC A;  3L2R A;  1MMN A;  2L54 A;  1CGP A;  2RQP A;  3L1P A;  1DUX C;  5GPA A;  3F3X A;  5K7F A;  2HYG D;  3V4G A;  2R5Y B;  4BDY A;  1JKQ C;  1TQP A;  2YUS A;  3ME5 A;  1A5J A;  5LGN A;  3DBR B;  3SDG A;  4IJA A;  4RB0 A;  3OQM A;  1OCR H;  1U8B A;  2PXF A;  3DFG A;  2CQX A;  2EZI A;  2M45 A;  3EUH A;  3ZGK A;  5B1A H;  1ACI A;  5DM6 F;  3ZQH A;  1UG0 A;  2EBI A;  2E2J J;  2PUE A;  1YE9 A;  2LYQ A;  5BS6 A;  2IP2 A;  1X2M A;  1TQI A;  1Y0U A;  3HG9 A;  1S5L C;  2XPV A;  2HPM A;  3OY9 A;  3AG3 H;  4YEJ A;  3BR0 A;  1RES A;  4CYC A;  1ZZ8 A;  4XLN F;  3ZQF A;  5GP9 A;  1B0N A;  3LWF A;  1X3W B;  3G6E I;  5BPI A;  5L3C A;  2LYK A;  2LFB A;  4JYK A;  4J19 A;  1MW7 A;  5B5E C;  1JXS A;  4BKX A;  2JK3 A;  2VBW A;  4BQA A;  1P4A A;  2HTS A;  3MVP A;  3QOW A;  2BV6 A;  1XDU A;  2VC1 A;  2DLL A;  4RLQ A;  1RUO A;  4I98 B;  4ER3 A;  4O8B A;  3OP9 A;  5E18 F;  3CJQ B;  3ZR8 X;  3OYH A;  2L9V A;  4CUG A;  4XOT A;  4YFX F;  2KDZ A;  4DBQ A;  3AG2 H;  1TC3 C;  5FFX A;  3WE3 A;  3PUB A;  4FX0 A;  4IQJ A;  2CW0 F;  4J1W A;  3ZHM A;  1IDY A;  4I09 A;  4BE0 A;  3WGG A;  3DKX A;  3J7A Y;  3K4L A;  3LQQ A;  4N4O B;  4ER0 A;  1FBQ A;  3PUF A;  4HX8 A;  2K4J A;  4XKV A;  2BW3 A;  4HNT A;  4ZYE A;  2R7S A;  3OS2 A;  2X6Y A;  5HS9 A;  1PNR A;  2DTR A;  1QQB A;  1USS A;  3KPH A;  3SFI A;  4ER5 A;  2Y0S A;  2FJ1 A;  5B66 C;  2R7O A;  3CP8 A;  2XXP A;  2L9N A;  3BG3 A;  2XAS A;  4ZTJ A;  3VYT B;  2O8K A;  2PFB A;  2A07 F;  3I53 A;  5BPD A;  3FBI B;  2HVR A;  2PJP A;  1F4K A;  3HOY J;  3C1D A;  2NNN A;  3MD2 A;  3MKY B;  1ZN2 A;  1Z77 A;  3RKW A;  2KZ8 A;  1XSX A;  3K4J A;  4MNU A;  5DCM A;  3FMY A;  2ISY A;  2Y69 H;  4IVN A;  1R4N B;  3SZG A;  1L3L A;  1IZ1 A;  2XXA A;  3HRT A;  4PZJ A;  2JJ7 A;  2LG4 A;  3FM5 A;  3TL4 X;  1LFU P;  5JHU A;  1LKX A;  4M6V A;  1WH8 A;  4A5M A;  1NHA A;  3I4M J;  2E36 A;  3KP2 A;  3RKY A;  3FXL A;  3QPT A;  4AUX A;  5C44 J;  2E1C A;  3S2D J;  5FD5 A;  4D7N A;  2Z3Y A;  4M3B A;  3FF5 A;  1TT0 A;  3BD1 A;  3KP6 A;  4HRA A;  4X4I A;  2PUA A;  2AQE A;  5GAD J;  4L18 B;  1FP1 D;  3DEE A;  3H5R A;  2UZK A;  4M9Z A;  3HSE A;  3O9X A;  4ZH4 F;  1R1V A;  1UXD A;  4JX4 A;  1RRJ A;  3DKW A;  3RPU A;  5JVT A;  2LNM A;  1RR7 A;  3BOQ A;  3ZQC A;  1LVK A;  1O3S A;  1WI9 A;  4I6Z A;  4E7L A;  3GFJ A;  1VQM I;  3FK7 A;  4H4K C;  2ZNZ A;  1NG6 A;  3CJN A;  1AU7 A;  1TQM A;  2A6C A;  2WTE A;  3FXK A;  2XPW A;  4ZC3 A;  1DDN A;  4FX4 A;  2J7U A;  2DA7 A;  1A6I A;  3GTP J;  3GW2 A;  3L7W A;  4Y33 A;  3F22 A;  2L1P A;  1GXP A;  4BDZ A;  1J5Y A;  3GXO A;  4RGX A;  3HOZ J;  1BW5 A;  4AM3 A;  2DK5 A;  5D4S A;  5E3N A;  2HFZ A;  1ZAR A;  3JSP A;  1A04 A;  2PUF A;  2VI6 A;  5J1Y A;  3HOT A;  2DA1 A;  2B9S A;  3U1K A;  2L7F P;  3ELK A;  3ASN H;  2JVH A;  3S93 A;  2W85 A;  3L2U A;  1EH7 A;  2A6E F;  1QPZ A;  2JCG A;  2QUF A;  4RMN A;  3FXJ A;  3S3N A;  3Q9V A;  2ZSH B;  2R7F A;  4RLF A;  3KYL A;  1TNT A;  2GAU A;  3H9G A;  3GME A;  2X1E A;  1OYW A;  1V5G A;  4HF2 A;  2Q2E B;  2MA3 A;  4QPO A;  3OR2 C;  1MBF A;  5FKL A;  1YIJ I;  3R09 A;  2PMZ N;  3KYC B;  4XLE A;  1B8I A;  1N25 A;  2R5Z B;  4Z2Y A;  1FOX A;  1FYK A;  4BBS J;  1U5T C;  3WHC A;  4Z5H A;  4LIU A;  2DMT A;  2LK2 A;  1YIT I;  1BC8 C;  1FIA A;  3WTX C;  3ERM A;  1VTN C;  2AWI A;  1I6H J;  2DA4 A;  4EJO A;  3FHZ A;  1SFU A;  2FU4 A;  3V42 A;  2WC2 A;  2O4A A;  2QQ9 A;  1I50 J;  2ID3 A;  1MMS A;  1KU7 A;  4O3M A;  5E8I A;  1Z6T A;  2HFH A;  2NS0 A;  2D5V A;  1ZG1 A;  2XKO A;  5GTH C;  1RUN A;  3GZD C;  1W0T A;  3PJR A;  3BT9 A;  1VQK I;  2E2I J;  2DA3 A;  4HDV A;  4G6T B;  4R1H A;  1WRJ A;  2CMP A;  4EQQ A;  2KIQ A;  4HDU A;  3TDU C;  3REO A;  1YS6 A;  2EJR A;  2E1O A;  1VQN I;  2ID6 A;  3V8J A;  4EJV A;  3K70 D;  1JT6 A;  1LJ9 A;  4ENM A;  3M8F A;  1AWC A;  1VQ6 I;  3IAM 2;  1A31 A;  3NRV A;  3MZH A;  2AXV A;  4L5E A;  2O38 A;  1U6G A;  3BDN A;  4PK4 A;  2H1K A;  3TO7 A;  3NAU A;  3S3O A;  2AXT C;  2EFO A;  3W6K B;  4DJA A;  1BOA A;  2VOP A;  4KIF A;  2VE9 A;  3F52 A;  5J3L A;  3ZP5 A;  5E3L A;  4AIJ A;  3JRA A;  2R7W A;  3HOU J;  3GFL A;  3LSM A;  5H20 A;  1D3Y A;  1JFT A;  1ZRC A;  4HST A;  2R1J L;  4GRI A;  5A2Q Z;  2IT0 A;  1XMK A;  1EH6 A;  2VKE A;  1UHS A;  1W36 D;  3S2W A;  3TED A;  2XAF A;  2ZME A;  3CEC A;  4A0Z A;  1WKM A;  3GZC A;  3B6A A;  3O6B B;  1IXS B;  1P7I A;  3K2A A;  3I55 I;  2J7W A;  2CW7 A;  5ICE A;  3CDH A;  2VT2 A;  1VQO I;  2P5L C;  2XAQ A;  3OYM A;  3RKQ A;  1NG7 A;  2G7H A;  1MSE C;  3F6W A;  4GO1 A;  1BI0 A;  3VPR A;  1R69 A;  1UFM A;  5CKT A;  4E70 A;  2GLO A;  5E1Z B;  2NXN B;  2XDV A;  1ETQ A;  1YX5 A;  4OMZ A;  3EUA A;  3GTJ J;  4ER7 A;  3NEU A;  3IV5 A;  2Z2S B;  3OIO A;  2D2W A;  4AYB A;  4I0A A;  5IOY A;  3E5U A;  1Z67 A;  1Z3Y A;  3EUH C;  3GTL J;  3SCF A;  2AXL A;  5F6F A;  3GFM A;  1BJZ A;  4MFE A;  1FX7 A;  2DO7 A;  1HBX G;  2WWY A;  1R7J A;  2NVX J;  2DI3 A;  1Z7L A;  2ESH A;  3F6V A;  3E97 A;  2V6C A;  3TDZ C;  3UKG A;  2WAF A;  3R4K A;  2KKO A;  2EFW A;  4ABZ A;  2PXQ A;  4E4H A;  2BBY A;  1WH5 A;  2X6O A;  1IUF A;  4HQE A;  2BJC A;  1Z6R A;  4V2G A;  2HKX A;  2DFF A;  2VQG A;  4DYQ A;  5BQT A;  1GDT A;  1S29 A;  2LY1 A;  2ZFW A;  1UAA A;  1BM9 A;  3HOX J;  3FHN A;  1K7A A;  1X58 A;  2EB7 A;  3IWF A;  1PP7 U;  2KRH A;  2ZXW H;  1B8I B;  2XPU A;  3KCC A;  4M3D A;  3BJ6 A;  1OYY A;  4BE1 A;  1I3A A;  1WZ2 A;  2NVU B;  2L8N A;  4RS8 A;  3OKZ A;  5K98 B;  2LC2 A;  2V1U A;  1FT9 A;  2CV0 A;  1SAX A;  3CUO A;  1XG1 A;  2EWN A;  2E34 A;  3DF8 A;  4I01 A;  4G9Y A;  4DW6 A;  3OL3 A;  4BJ6 C;  2LBF A;  3RKX A;  4XID A;  3WG7 H;  3S17 J;  2R7X A;  4ASN A;  3C18 A;  2A61 A;  2ACJ A;  1WJ5 A;  1IGN A;  3CUQ B;  5EF6 A;  2W7N A;  2L01 A;  1P9Q C;  2PMU A;  1J75 A;  4FAS D;  1MJ9 A;  2LLV A;  1RR8 C;  2MLK A;  2IEK A;  4C30 A;  2XAH A;  3WTT C;  3NZL A;  2ZNY A;  4FN3 A;  1HW2 A;  2K7L A;  5LEJ A;  1BN5 A;  4OWR B;  3BP8 A;  3H3Z A;  1XCB A;  2WAE A;  4FET A;  3K9T A;  5HLH A;  4C2U A;  2LYL A;  3H5A A;  3G7D A;  2DJI A;  1IO2 A;  4Y4R A;  4JOM A;  4X4E A;  3OIQ A;  4N9I A;  1D1C A;  1RZS A;  2MFZ A;  1NER A;  1PVE A;  2DPU A;  3ZN0 A;  2V4J C;  5LLQ A;  4A6E A;  2A6T A;  3A0B C;  3GBF A;  5J8C A;  4MIM A;  3HRM A;  4YII A;  1OYI A;  5C4X J;  3OWT A;  3TBI A;  4QIW N;  5IPA A;  2LSO A;  4L0Z B;  4M71 A;  5B3S H;  1X1C A;  2ZJ2 A;  4ETS A;  1Y56 A;  1MBE A;  2WAD A;  3T8R A;  3AG4 H;  3G1O A;  2AUW A;  3BJA A;  4LG3 A;  2IU7 A;  4KJZ A;  4HYE A;  1HLV A;  3OIP A;  4CDG A;  1WJC A;  2XRN A;  4JQF A;  1D1A A;  5J4V A;  5JLW A;  3FKJ A;  4PJM A;  3NQO A;  5LHI A;  2EZH A;  1Y8Q B;  1TWH J;  3UWP A;  4BU2 A;  2W25 A;  5K7H A;  1J59 A;  1BI2 A;  4L9N A;  1XWR A;  2ICT A;  5A7L A;  3VYU B;  4A69 C;  2IRF G;  5FKK A;  2CFX A;  3OYF A;  3QRF F;  3AL0 B;  3ZCO A;  3HOS A;  4BEH A;  2W4S A;  1ZVV A;  2NOG A;  2JVL A;  4MLO A;  3CF2 A;  4D1Q A;  1GLN A;  2MYS A;  2W48 A;  1CF7 A;  1H8A C;  2HXO A;  4RGS A;  3IUO A;  4OB4 A;  5FB2 A;  1ZK8 A;  4F91 B;  4BH9 A;  2L49 A;  2K85 A;  4AVP A;  1V3F A;  1LE8 B;  1YRN A;  1LQ1 A;  2FX0 A;  1K6Y A;  1T56 A;  1IV6 A;  4Q4Z F;  2QBY B;  5CYV A;  4RB1 A;  1MFQ C;  3BTC A;  1XD7 A;  2FOK A;  4KFC A;  1CF7 B;  1FP2 A;  4HRI A;  2H1L A;  3RYR A;  2Y30 A;  4B48 A;  1D8J A;  3TMO A;  1XGM A;  1IRZ A;  2ZB9 A;  1T0F C;  5GAH i;  3ABM H;  2V1X A;  4CCJ A;  5C3E J;  2RVC A;  3F8M A;  2LKS A;  4A2U A;  4ZDO A;  4A5N A;  4E7Z A;  3DU6 A;  2ICP A;  1PRA A;  2VJI A;  2A6H F;  2JA8 J;  1GV5 A;  3F9K A;  2H6B A;  1GV2 A;  1SFK A;  3S8Q A;  3GLL A;  2XB5 A;  5J8F A;  2CRG A;  3A02 A;  4HX7 A;  1MIJ A;  4CYC B;  3OYE A;  3CCQ I;  2IGN A;  3EDP A;  3O2P E;  3QU6 A;  2ELH A;  4PJN A;  1JKO C;  4FQG A;  2KRC A;  3HJE A;  2BNM A;  4UUS A;  3C7J A;  2R63 A;  1TBX A;  1WWX A;  1KU9 A;  1BOB A;  1IUY A;  2HSG A;  3BJO A;  4KIC A;  1PJR A;  1O4X A;  1OR7 C;  3JRC A;  1SVO A;  3LSI A;  4ANJ A;  2A5W A;  3R1F A;  5IYD J;  4U0Y A;  4CGZ A;  5HLI A;  1PUF B;  1Y6I A;  5FD6 A;  2QM3 A;  4EM2 A;  2IGO A;  5HS7 A;  5F0C A;  4B44 A;  3CZ6 A;  5KCM A;  1WIZ A;  1QZX A;  4E7H A;  5LD2 C;  1IXR C;  1YYV A;  2O7O A;  2FNP A;  5HDN A;  5GPC A;  4G6D A;  5H2F C;  5HOD A;  4ESJ A;  2B5A A;  3HRS A;  3OSG A;  3OYJ A;  3I9V 2;  2HZT A;  3CUQ C;  3K4K A;  4ZDP A;  4A3B J;  5CVV A;  4IOA F;  3R0J A;  2VL8 A;  4OMY A;  1B4A A;  2VPL A;  4GHJ A;  3OWQ A;  3CLO A;  4MCT A;  4HF0 A;  1Z1D A;  2R5Y A;  2EZL A;  2R7D A;  2QKL B;  2PJR A;  4KYW A;  1W5T A;  2HNH A;  3GTM J;  2O9L A;  4P9F A;  4EM1 A;  4EJT A;  1E3H A;  4RM3 A;  4XLA A;  2GOX B;  4D5F A;  3L2V A;  3WGI A;  1CJG A;  1AA7 A;  2XAJ A;  1NK2 P;  4UV9 A;  3ESW B;  1QPI A;  1XX5 A;  3I0T A;  4PGG A;  4IOC F;  3DEW A;  1TW3 A;  2M7A A;  5JUW A;  1LFP A;  2MGQ A;  4I99 C;  3NWS A;  3M9A A;  2DQR A;  2R7T A;  3PFI A;  1EF4 A;  2F6C A;  4O5V A;  2CG4 A;  2RRE A;  2Z16 A;  3SFZ A;  2XKP A;  1WJD A;  4LK1 F;  4HX4 A;  1YW9 A;  1X2L A;  2V26 A;  1HC8 A;  5DRY A;  4NNJ A;  1RIO H;  2QA4 I;  2PXD A;  4ZZL A;  2COM A;  2DOD A;  2AQF A;  2FRH A;  1IC8 A;  2CSF A;  2PXP A;  4YEL A;  3KLO A;  1J0R A;  1DU6 A;  2F4I A;  2EFN A;  4DNC A;  4A3I J;  4XLP F;  1VQ7 I;  1S8N A;  3L9F A;  3GN5 B;  3WGH A;  2CRO A;  2V1N A;  5IP9 J;  2HQN A;  2P5K A;  3M8E A;  2AXZ A;  4Z6Y A;  1XCV A;  1JI8 A;  3FMS A;  3HKZ A;  3CC4 I;  2WIU B;  1D5V A;  2MC3 A;  2R3S A;  1YW8 A;  5ILS A;  2HXI A;  3U2R A;  1SAU A;  2LKP A;  3BWG A;  1W1W E;  1NTC A;  3K1P A;  1YJW I;  3SXY A;  1Z3X A;  1X19 A;  2QEX I;  3GZ6 A;  2HVQ A;  2E71 A;  4P9U A;  5FRN A;  3I64 A;  4S0H B;  4LB5 A;  4LOC A;  2PN6 A;  1DW9 A;  1VPW A;  2W57 A;  3VWB A;  2BY0 A;  3QQ6 A;  2CQ7 A;  1POG A;  3I4N J;  2EV0 A;  3TO9 A;  3E5Q A;  3GUD A;  3L00 A;  2IA1 A;  3QU3 A;  2ESN A;  5AON A;  1SD6 A;  2CUF A;  5EDN A;  1XTA A;  5EEG A;  4BQN A;  5DRT A;  5EZG A;  2CQN A;  2D1H A;  3DTI A;  3PSF A;  4YG2 F;  2IVB A;  3JR9 A;  5EEH A;  3K7A J;  2ODR D;  5M3F J;  1BA5 A;  3K0L A;  1LNW A;  2W00 A;  3R6S A;  1FOY A;  3LSK A;  2CUZ A;  1PYV A;  4HSR A;  1OQY A;  2LKX A;  1FLI A;  1BL0 A;  1VQL I;  3K2Z A;  3O8G A;  2RNJ A;  5F08 A;  5KK1 A;  2COB A;  3BCA A;  1JKR C;  3P9K A;  1VI0 A;  1I39 A;  2Q0O A;  3QP5 A;  4OOI A;  5CVU A;  2JRM A;  3LAJ A;  3JTG A;  3LMM A;  1YJ9 I;  2NVY J;  1L1M A;  4MEY F;  3ZOB A;  3LQX A;  1FY7 A;  4LFU A;  4PU8 A;  1H9T A;  1YX3 A;  3A9X A;  4GGG A;  1LFB A;  1QO0 D;  3BTL A;  1X4P A;  3CES A;  5DUK A;  2EF8 A;  2QSF X;  1OFC X;  3B02 A;  1U2Z A;  2OTJ I;  1R5I D;  3SYT A;  4XSX F;  1FSH A;  1KZH A;  4ER6 A;  5KHD A;  1MZB A;  2JRT A;  4XLH A;  3RCO A;  1OSL A;  2O61 A;  1HKS A;  1V5E A;  2VC0 A;  4DOZ A;  5LBQ A;  4IQ4 A;  4HNV A;  3MQ0 A;  2WY8 Q;  3TKY A;  3DKY A;  2BNN A;  3BZC A;  4J01 A;  3A03 A;  3ABT A;  3OL4 A;  4XRF A;  2B7E A;  1B9M A;  5JLX A;  5TRD A;  4Z5D A;  2O3F A;  4AVZ A;  2MBF A;  4LJZ F;  2GM4 A;  3FK6 A;  1AOY A;  2K40 A;  4CCL A;  3H35 A;  1R49 A;  1B1B A;  4KMF A;  2GQQ A;  2LVS A;  2MD0 A;  2KIU A;  3PIP F;  1T38 A;  5J1R A;  2OFY A;  2KEI A;  3FWE A;  2QLZ A;  4KUM A;  2XRO A;  2O03 A;  5TIS C;  4UUS B;  4S04 A;  3L09 A;  4N4N B;  4MQV A;  1LDK B;  4YFN F;  1KU2 A;  5DD4 A;  1FTT A;  4UY8 I;  2D45 A;  2MG4 A;  4UV8 A;  1X1B A;  2QCO A;  4ZYD A;  2LOO A;  3K69 A;  4B47 A;  1H0M A;  3BPX A;  3W3C A;  1KGS A;  3HBL A;  2FQ4 A;  3DLL F;  4A3E J;  4X6A J;  1TZL A;  2H8W A;  2EFP A;  3W2A A;  1LCC A;  1H88 C;  4PFO A;  3MZ8 A;  4XN3 A;  2DPD A;  2EPF A;  4QTR A;  1LUJ B;  3RZO J;  4XKC A;  4B43 A;  2DTZ A;  4YG4 A;  4PCQ A;  4Q5S F;  3IRR A;  3QWG A;  1QQI A;  4M74 A;  4UXN A;  3ABU A;  3S3M A;  1HQ1 A;  3QYF A;  3QPH A;  1VQ4 I;  5LEK A;  1W7P D;  3OMY A;  4J1X A;  3HSF A;  3RPQ A;  2E7X A;  2QZ8 A;  3JTH A;  3A01 B;  1PP8 F;  1TWA J;  4A3C J;  3PNV A;  2LMD A;  1T8I A;  1SD7 A;  3BDD A;  1FMW A;  4X1E A;  4XM3 A;  2BNO A;  1KA8 A;  3V8L A;  3KEY A;  2WB1 N;  3F72 A;  2L02 A;  4IVZ A;  3P9I A;  2A3S A;  2QYO A;  2LD5 A;  3H9J A;  4PU3 C;  2BHZ A;  2QKM B;  1SVM A;  4AIH A;  2P7C B;  2ZSI B;  3ECH A;  4U7D A;  1UHW A;  2E1M B;  1W5S A;  4XLF A;  4AIK A;  2OA4 A;  1ZRD A;  2ZXH A;  3CCU I;  2MAB A;  3K70 C;  4YAR A;  4EKG A;  3A1Y A;  3E1S A;  4UUT A;  1DQU A;  1FNN A;  3TOB A;  4A12 A;  4ENJ A;  4BE2 A;  4HV6 A;  1RZ4 A;  3W2V A;  1MJA A;  1WPK A;  3P7N A;  1ZH5 A;  3MWM A;  2PXB A;  3QAH A;  4EJU A;  3MCZ A;  2HOT A;  1V55 H;  3VOE A;  3HOV J;  3QYE A;  1Y39 A;  2OCC H;  4LK0 F;  1D0X A;  2F5V A;  3BTI A;  3ZMV A;  3S1R J;  2Y9Z A;  3IH3 A;  2QQ8 A;  1QRY A;  2HIN A;  1ZGA A;  3AFH A;  4KN7 X;  2AS5 F;  1ZG3 A;  1P6R A;  3CCE I;  3QFI A;  1F1Z A;  2GOM A;  5BMZ A;  4I6U A;  2CH0 A;  2M1B A;  4HLX A;  4MGR A;  4E7I A;  3CC2 I;  1HCR A;  2TCT A;  4A93 J;  4FE7 A;  2X0L A;  4G12 A;  3KET A;  1BIB A;  4KIB A;  3CCR I;  1MGT A;  2ZME C;  3VOD A;  1ZEL A;  3EET A;  1TNS A;  4RM2 A;  2ZJR F;  5FKM A;  3ZMU A;  2O6G E;  1YHQ I;  1YIO A;  4P5O A;  3J7Z I;  4NBQ A;  4C2T A;  3KZ3 A;  2V79 A;  3HYI A;  3SDB A;  2V9V A;  1CQT A;  4X4C A;  1ZS4 A;  1WHU A;  1N78 A;  4M73 A;  1D5Y A;  2VUM J;  4R79 A;  2IS2 A;  1PDN C;  1R5H A;  3JW4 A;  4BY7 J;  1MMA A;  2Z5U A;  1M1E B;  2MC4 A;  4LGW A;  5LRR A;  4CCM A;  2DU9 A;  5EGO A;  1DPU A;  4GYI A;  3VYS B;  3TGN A;  1FOK A;  2ZC2 A;  1JJ8 C;  1FBS A;  2MH2 A;  4LLL A;  1HDP A;  2UV1 A;  5EJC A;  4IXA A;  5HS8 A;  1XGN A;  1RZR A;  2EV5 A;  5E1X A;  1TWF J;  2ME0 A;  1FJL A;  1V4R A;  2JSC A;  2PXE A;  5DEQ A;  2ELJ A;  2RQQ A;  3S32 A;  1ZZ9 A;  1JUP A;  3CCV I;  3BR6 A;  4XOP A;  5E8G A;  4KA4 A;  2X48 A;  3CMM A;  3DWL E;  2BZT A;  2XVC A;  3F23 A;  2DMQ A;  2VIX A;  4XSZ F;  5IP7 J;  4RGU A;  4RAG A;  4W1U A;  2CYY A;  2TDX A;  2DOA A;  4L9V A;  2IXS A;  2ZO4 A;  3E3V A;  4BEH B;  4IA8 A;  1ETK A;  2M7B A;  2KIF A;  3ECO A;  2K9L A;  3D5R C;  4C2M J;  3OYI A;  1HF0 A;  3PO2 J;  2HDW A;  3LA2 A;  5FRM A;  4BL0 B;  5J1U A;  4IZZ A;  5DTQ A;  2KHM A;  3VYR B;  1LDJ A;  3FXR A;  3ZMT A;  4BJ5 C;  3DU5 A;  3E0J B;  4KNY A;  4F92 B;  1R63 A;  2XI8 A;  3E7L A;  2EA2 A;  3HZJ A;  1K4S A;  1R36 A;  4XBF A;  1MBJ A;  2DFE A;  3ULQ B;  5F1J A;  4N9H A;  4CXF A;  1F36 A;  3JRB A;  4J00 A;  5FGM A;  4RA2 A;  1U5T A;  3MLF A;  1HSJ A;  2OQG A;  1R1T A;  4HOB A;  5CQE A;  1K6O A;  4FIS A;  4I2O A;  3EPZ A;  1S7E A;  1BC7 C;  4WXH A;  4BNC A;  5F0H A;  1WH7 A;  4BBR J;  3ZPX A;  2IW5 A;  3LA3 A;  4E7S A;  2VOO A;  5J6X A;  1RC9 A;  3N4M A;  2HS5 A;  2LYJ A;  4IPA A;  3RIR A;  2ZJQ F;  2W84 A;  3PO3 J;  2EWT A;  1DU0 A;  1ZAY A;  3BPV A;  1IRX A;  1T08 B;  4U87 A;  4A3J J;  3A01 A;  1NEQ A;  3JXD L;  2X51 A;  3H3V K;  4I02 A;  1XPX A;  4TV7 A;  2BY1 A;  3CF5 F;  2DN0 A;  3WTV C;  3IVP A;  3I56 I;  1AHD P;  1MKM A;  3OS1 A;  3G1L A;  1U9O A;  2LF7 A;  4UUV A;  2V1D A;  1JFS A;  2FSW A;  1UST A;  4RAZ A;  1ORK A;  2YU3 A;  2PEX A;  4FT8 A;  2ZCW A;  1MH3 A;  1GUU A;  5IT9 K;  2M34 A;  2K9S A;  1ZZB A;  1S3J A;  4IX7 A;  4KDP A;  3NDB B;  1ZKG A;  1S9H A;  4DYR A;  3H9Q A;  3HKZ N;  2HGC A;  2EIJ H;  3WU1 B;  2JQ7 A;  2E1M C;  3FMR A;  5LFA A;  2KDO A;  2WAQ A;  1ZG5 A;  3W2W A;  1X2N A;  3WG9 A;  3R60 A;  2H94 A;  3BG9 A;  4BQO A;  1HKQ A;  4IL6 C;  4PJJ A;  1JKP C;  4CCK A;  2PPX A;  5JR3 A;  3C2H A;  3CC7 I;  3H3U A;  2JWT A;  5FJ8 J;  4V19 K;  3OQO A;  3U1D A;  3BG5 A;  2MSY A;  2GBY A;  5DD8 A;  3SR4 A;  3F8N A;  4OU0 A;  3ZMS A;  1Y9Q A;  3F8B A;  5HDG A;  4Q47 A;  3FXO A;  1ZRF A;  5ED4 A;  3HL2 A;  5A2Q K;  1LEB A;  4MFD A;  1IN6 A;  4WXD A;  2M8E A;  2L4A A;  3WU0 A;  3BR1 A;  2YS9 A;  3GTK J;  2BXZ A;  2DT6 A;  2EBY A;  4N0B A;  4C3J J;  2E19 A;  4AWX B;  3DBL B;  2GZU A;  1Z91 A;  2BXY A;  4BAY A;  3RQ4 A;  3PQJ A;  3GFI A;  3G1M A;  3O3K A;  2ECB A;  2WV1 A;  2UXN A;  3DXJ F;  4PSW A;  1ETO A;  1J09 A;  3KZI C;  4IRH A;  2FBI A;  4AU7 A;  3GUU A;  1ONV A;  2XUB A;  1K4T A;  1TP4 A;  4IKF A;  2DJN A;  2D1V A;  4QPQ A;  2E5N A;  3J80 Z;  4U88 A;  2OUM A;  3Q3S A;  3R61 A;  1IV8 A;  3K4B A;  3PL8 A;  1TWC J;  4CCO A;  3K6G A;  1F5T A;  2JA6 J;  4B3A A;  1PRV A;  4G6Q A;  4QWQ A;  2RN7 A;  3FIW A;  4HLY A;  1NW3 A;  3CCL I;  1GXQ A;  2K86 A;  4IHX A;  3M3Y J;  3B6C A;  2ZFU A;  3A2K A;  3IKT A;  4CSW A;  2PUD A;  1RI7 A;  3DPU A;  4Z59 A;  2KLO A;  5L3G A;  1FTZ A;  2ETH A;  5DYM A;  1MMD A;  3FMQ A;  2VKV A;  3F6O A;  4KT6 A;  1O3T A;  1MJB A;  5TJJ A;  3KJX A;  2IA2 A;  4D7M A;  1K78 B;  2E5Z A;  4NQW B;  2HQ5 A;  2HYJ A;  3OYK A;  4BAC A;  2FJR A;  4HZF A;  1S7A A;  1LCD A;  3VDX A;  3HOW J;  3DLA A;  4CA0 A;  3HRU A;  2JQE A;  4EM0 B;  4EKI A;  2QGU A;  2XGE A;  3ZMZ A;  5L3B A;  2DW4 A;  3G2B A;  5ILV A;  2NRA C;  3OR1 C;  2K3F A;  2KZV A;  2VPR A;  2FMY A;  4ESF A;  3L2Q A;  4EMS A;  2XIU A;  2M87 A;  4BHC A;  1R71 A;  2HR3 A;  2IGM A;  2HVS A;  2WBM A;  1K78 A;  4XRM A;  1HOM A;  1GVD A;  1XGS A;  3D5S C;  1QA6 A;  1I5Z A;  2NS7 A;  1MH4 A;  1XSD A;  2HDD A;  3BR5 A;  2R7Q A;  3WTW C;  1LB2 A;  4PSX A;  4HBL A;  2R4G A;  1YLF A;  3SZP A;  3T5X A;  1YOV B;  4GQM A;  4YFK F;  1MBH A;  2MXD A;  1F9N A;  3SZT A;  1EV7 A;  1XGO A;  5CJ9 A;  2JA5 J;  4X4D A;  4B4C A;  4II3 A;  4U0V A;  3MN2 A;  1ERD A;  1H89 C;  1VFC A;  3JRG A;  4CYD A;  3CME I;  2JSP A;  2FBK A;  2STW A;  1WFX A;  3CDI A;  2O5R A;  3J81 K;  1ZGW A;  1LMB 3;  2PXL A;  4FE4 A;  1RPE L;  3JCU C;  1ON1 A;  1OPC A;  1ADR A;  3SJM A;  3J80 K;  4UHT A;  3F8F A;  5K5O A;  1UHM A;  4AD9 A;  1OCC H;  2XAG A;  1JHF A;  3P9C A;  4IF4 A;  2DYR H;  3F0C A;  4M9S A;  4BXF A;  2L4M A;  3CTA A;  3NXH A;  1JJ6 C;  1YJN I;  9ANT A;  3W6V A;  3GZN B;  4Y17 A;  3BR3 A;  3FZV A;  2EV6 A;  1W36 C;  3K4N A;  1G4D A;  3DV8 A;  4S05 A;  4JBA A;  2JTV A;  2LDU A;  3ZXS A;  4AID A;  5C4J J;  3QOD A;  1Y8R B;  1UCR A;  5L3F A;  3LIS A;  1XSV A;  1D0Y A;  1DGR M;  3BLY A;  3ASO H;  1ODD A;  4X0G A;  1J7K A;  2EFQ A;  2CGP A;  4PU7 A;  4A0Y A;  1Q1V A;  2ZXJ A;  4Y3O A;  3JXB C;  2P6T A;  2NYX A;  3VK0 A;  5FLX Z;  1ZGJ A;  3HSR A;  2L5Q A;  1E3P A;  3HPG A;  3IRQ A;  1WJE A;  1SD5 A;  2V3C C;  1U3E M;  1YO5 C;  2HTJ A;  3HXL A;  2Z33 A;  2V9P A;  1OKR A;  2GXG A;  3BRO A;  3QWL A;  4ZDL A;  5HNF A;  1MNE A;  3DBH B;  1ZZ6 A;  2LNB A;  1QHG A;  2IVM A;  5KVR A;  1O3R A;  3PNT A;  2YU9 J;  5DCF A;  3DEU A;  4ZTF A;  4L9T A;  4OIN F;  2VBZ A;  1ZZ7 A;  4PJL A;  4E7J A;  4A3M J;  1OCT C;  3HGY A;  4F7Z A;  2XIG A;  2XSJ C;  2CUE A;  1QQA A;  3KZZ A;  4QSH A;  2A05 A;  2LR8 A;  3ABK H;  1RKT A;  1XN7 A;  1P7J A;  1WJF A;  2FOW A;  3AKZ A;  2GRM A;  1KON A;  2H27 A;  2CQQ A;  2F5E A;  2NVT J;  1J9I A;  1KYZ A;  3IH2 A;  3FYA A;  1UEL B;  2QQA A;  4HV5 A;  3V8K A;  4GDF A;  2QSG X;  3ZPL A;  1QU3 A;  2R7V A;  5CQG A;  5CVJ A;  5GAG i;  1LDD A;  2W1O A;  3I59 A;  2K4B A;  1FIP A;  5FFZ A;  5FO5 A;  2K27 A;  3LOC A;  1SC7 A;  2Q8K A;  2CSO A;  2F5C A;  2LY2 A;  2M3A A;  4EJW A;  3H0D A;  3GZD A;  2L2O A;  1ZLJ A;  5CVR A;  1QP7 A;  5EZH A;  3FM3 A;  1EA3 A;  3ISP A;  3I3L A;  2HI3 A;  4EV0 A;  1QPM A;  2Z1D A;  4P1W A;  4FTH A;  4BYY A;  4MCX A;  2HWV A;  5J47 A;  3CLC A;  3JRE A;  1QZY A;  4L9J A;  4ZYA A;  2M0C A;  3B73 A;  3LFU A;  1Y0N A;  4RGR A;  1R6R A;  5AIP A;  1S72 I;  2OPT A;  3COA C;  4B1R A;  2X1D A;  1ZTR A;  2GWR A;  1K79 A;  2M5W A;  2QBY A;  5HLT A;  2CFO A;  1JE8 A;  4DZP A;  4YBA A;  3H1C A;  1XC5 A;  4RB3 C;  3BY6 A;  3W6J B;  2M4K A;  3GYH X;  3HUG A;  3WHB A;  3WTY C;  3FBN B;  2XGC A;  3CCJ I;  3LSH A;  3GTQ J;  4BXX J;  1U78 A;  3LA7 A;  2LY9 A;  3DPL C;  3N05 A;  1YW7 A;  3LQR A;  5GAH J;  4F93 B;  2FBH A;  4C3I J;  4DGW B;  1MSF C;  3JSO A;  1ZPQ A;  3PXP A;  2VBX A;  2FE3 A;  1FC3 A;  4UVB A;  1ZR2 A;  4PUS A;  5M5W J;  3PSI A;  2YR2 A;  3HDD A;  1QZE A;  4Y13 A;  1VF9 A;  2PMH A;  3EQL F;  3EYY A;  1I1G A;  2DFI A;  2RC4 A;  3GVA A;  3IC7 A;  2IVQ A;  3GO5 A;  4AC0 A;  4M6Y A;  1WI3 A;  1YS7 A;  2XXQ A;  3B7H A;  1SMY F;  1BDH A;  1UMQ A;  4D9J A;  1G3Y A;  5HNH A;  3AG1 H;  1R1U A;  4WCG A;  3ZQI A;  1LQC A;  2EQR A;  1BI3 A;  1JTX A;  5GTI C;  4G8X A;  1SEU A;  5E79 C;  1VQ9 I;  4YG1 A;  4XMY A;  3C2B A;  4ENK A;  3JRI A;  4B09 A;  3M4O J;  2IBD A;  3E6B A;  2Y31 A;  4LLN A;  1Z7U A;  1DPR A;  1R4M B;  1FYL A;  4I6T A;  3TQN A;  5M5Y J;  3PIO F;  3Q0V A;  5D5W B;  3MKW B;  4NUB A;  3LST A;  1ETW A;  3DCF A;  1T2K A;  3VWS A;  1KQ8 A;  1JUM A;  1V5F A;  3FXQ A;  2QWW A;  2EK5 A;  3MEX A;  2GXA A;  2VAS A;  2B0L A;  2FQ3 A;  4XON A; 
#chains in the Genus database with same CATH homology
 4IEJ A;  4C3H J;  2EZK A;  3VPR A;  1WCM J;  4XRS G;  2HOT A;  3HOV J;  3TP0 A;  3S1Q J;  1R69 A;  1ZUG A;  4X4B A;  1UG2 A;  3BTI A;  3S1R J;  5IYB J;  2Y9Z A;  1B72 A;  2GLO A;  2AW6 A;  3IH3 A;  1QRY A;  2HIN A;  1ETQ A;  3GTJ J;  3RQI A;  1TWG J;  3IV5 A;  2OR1 L;  3OIO A;  5EEA A;  5IOY A;  1YSE A;  4I6U A;  3GTL J;  3SCF A;  3IH4 A;  3CRO L;  1BJZ A;  4MFE A;  3CQZ J;  5EG0 B;  2NVX J;  1HCR A;  1JH9 A;  2TCT A;  2LTP A;  4FE7 A;  1NK3 P;  4A93 J;  5EGO B;  1W0U A;  4RBO A;  3UKG A;  1RIO A;  3QYX A;  4G12 A;  3ZKC A;  1F43 A;  1UXC A;  4ABZ A;  4Y52 J;  3OMT A;  1WH5 A;  2X6O A;  1IUF A;  5FKM A;  2LCV A;  2BJC A;  2L7M P;  4FCY A;  4V2G A;  4DYQ A;  1Z0X A;  3KZ3 A;  1GDT A;  4X4C A;  1CQT A;  4Z5C A;  3FKI J;  4NDL A;  1XS9 A;  1ZS4 A;  1WGX A;  5M3M J;  3HOX J;  1D5Y A;  1X58 A;  2VUM J;  1ETY A;  5F0F A;  2GRL A;  1B8I B;  3H5T A;  2LYS A;  2XPU A;  4F8D A;  4M3F A;  4M3D A;  2XSD C;  2IUO A;  2L8N A;  4BY7 J;  3OQN A;  5K98 B;  1PRU A;  2R93 J;  4JCY A;  4Y42 A;  2PUG A;  3TW7 A;  5FLV A;  1XG1 A;  3H0G J;  3BQZ A;  5EGO A;  2JA7 J;  1RKW A;  1JJ8 C;  4DW6 A;  4IWR A;  2IV1 A;  2LYP A;  3TP3 A;  4XID A;  5F27 A;  3S17 J;  3S16 J;  1HDP A;  4YG7 B;  1IGN A;  1RZR A;  4DYC A;  2L0K A;  1TWF J;  5EF6 A;  2ME0 A;  1FJL A;  3LSG A;  1ZZ9 A;  1JUP A;  2DA6 A;  3NAR A;  3BR6 A;  1HDD C;  1WH6 A;  4V2F A;  2X48 A;  2H8R A;  3O8H A;  1LLI A;  2DMQ A;  2IEK A;  1ZQ3 P;  5IP7 J;  4W1U A;  1VND A;  2MEZ A;  4FN3 A;  4IA8 A;  3QQA A;  5F04 A;  1AKH B;  4JX5 A;  1ETK A;  2N8G A;  5FKN A;  2AXU A;  3CMY A;  2LYL A;  2I10 A;  2P81 A;  4C2M J;  3PO2 J;  1HF0 A;  4M3G A;  1JUS A;  5EG0 A;  5DS9 A;  3G7D A;  1RPW A;  2Y0S N;  4RDU A;  1ZZC A;  5J1U A;  4X4E A;  4JQD A;  3LSP A;  2XI8 A;  5FLM J;  1R63 A;  1RZS A;  1NER A;  3E7L A;  5F1J A;  1MBJ A;  3BTJ A;  3JRB A;  1F36 A;  2HOA A;  3LNQ A;  3GBF A;  3MLF A;  4FBI A;  2HOS A;  1ETV A;  4MIM A;  5C4X J;  4QIW N;  4JCX A;  3HZI B;  5IPA A;  2M2E A;  4FIS A;  4X4G A;  5FKO A;  1S7E A;  1U9N A;  4GFB A;  5F0H A;  1WH7 A;  4BBR J;  3CCY A;  1MBE A;  2ECC A;  1UTX A;  1OCP A;  3G1O A;  3JRD A;  2AUW A;  2LYJ A;  2XJ3 A;  5EYR A;  4PU4 C;  4XRS A;  3PO3 J;  1OJL A;  2EWT A;  2ELK A;  2IU7 A;  3D1N I;  1FEX A;  1JTY A;  1DU0 A;  1ZAY A;  1T33 A;  1HLV A;  4X4F A;  4A3J J;  3A01 A;  1NEQ A;  2WAQ N;  2IAI A;  2IVG A;  3JXD L;  2XB0 X;  3U3W A;  3H3V K;  5JLW A;  3RZD J;  3GTG J;  2DN0 A;  3IVP A;  2EZH A;  3EUS A;  1TWH J;  1AHD P;  3G1L A;  5K7H A;  1U9O A;  1JWL A;  1JFS A;  1XWR A;  2ICT A;  5A7L A;  1SFO J;  2EH3 A;  2M8G X;  3ZHI A;  1ORK A;  4A69 C;  2OF7 A;  4IHV A;  5FKK A;  3MKL A;  5DTD A;  4A3L J;  3SCG A;  1MH3 A;  1GUU A;  2M34 A;  2K9S A;  1ZZB A;  3QF3 A;  4XK4 A;  1ZKG A;  1ZVV A;  2NOG A;  4DYR A;  2JVL A;  4MLO A;  3F6W A;  3HKZ N;  4M3E A;  3OOU A;  2W48 A;  1H8A C;  3UFD A;  2HXO A;  2LYR A;  3LSJ A;  4OB4 A;  4DZJ A;  2LP0 A;  1BDI A;  1ZK8 A;  1X2N A;  1POU A;  3LSR A;  2L49 A;  4EEF G;  2KEJ A;  1IJW C;  3BG9 A;  1LE8 B;  1QVT A;  1JKP C;  1YRN A;  2PPX A;  2WUS R;  1APL C;  2FX0 A;  3CDL A;  2JWT A;  5FJ8 J;  3OQO A;  1T56 A;  1IV6 A;  3BG5 A;  2MSY A;  3SCH A;  2GBY A;  5IYC J;  2X9D A;  3BTC A;  1Y9Q A;  1MBK A;  3GBG A;  2Y30 A;  4X4H A;  1IRZ A;  4MFD A;  2XRL A;  2ZB9 A;  3HEF A;  3FYM A;  1SQ8 A;  5C3E J;  2RAE A;  3BR1 A;  3QPS A;  2YS9 A;  3GTK J;  5IP6 A;  2EBY A;  2GZU A;  4C3J J;  2E19 A;  4W97 A;  2ICP A;  1QP4 A;  1PRA A;  2JA8 J;  1GV5 A;  1GV2 A;  3S2H J;  3S8Q A;  3G1M A;  3S14 J;  4A3G J;  2XB5 A;  2CRG A;  2Y9Y A;  3A02 A;  4CYC B;  3L1P A;  2ECB A;  2WV1 A;  1ETO A;  1JKO C;  1WET A;  5GPA A;  5K7F A;  2R5Y B;  2BNM A;  3OSF A;  3ZQL A;  1JKQ C;  4UUS A;  2YUS A;  2R63 A;  1I3Q J;  1A5J A;  2DJN A;  3SDG A;  2HSG A;  2B63 J;  3OQM A;  1U8B A;  3Q3S A;  2PIJ A;  2CQX A;  2EZI A;  3HB9 A;  1O4X A;  1G2H A;  3JRC A;  4Z58 A;  1TWC J;  2JA6 J;  1PRV A;  3ZQH A;  4B3A A;  1ENH A;  2EBI A;  2E2J J;  3R1F A;  2PUE A;  5M5X J;  2LYQ A;  5IYD J;  1Y1V J;  3FIW A;  3M3Y J;  1PUF B;  1B72 B;  4IHX A;  3B6C A;  1X2M A;  1RET A;  2QF7 A;  2XPV A;  2PUD A;  5F0C A;  1WIZ A;  2CU7 A;  3BR0 A;  1RES A;  4CYC A;  4Z59 A;  1ZZ8 A;  3ZQF A;  2O7O A;  5GP9 A;  1FTZ A;  1B0N A;  5GPC A;  2VKV A;  2LYK A;  5HOD A;  2LFB A;  2R0Q C;  2XCJ A;  4JYK A;  4J19 A;  3OSG A;  2B5A A;  2KPJ A;  3BS3 A;  4D7M A;  3KJX A;  4A3B J;  2HQ5 A;  2HYJ A;  4BKX A;  2JK3 A;  2FJR A;  3JRF A;  4GHJ A;  2DMU A;  3MVP A;  4IHY A;  2R5Z A;  1AKH A;  4MCT A;  1LCD A;  2R5Y A;  2EZL A;  3HOW J;  1GT0 C;  3GTO J;  4O8B A;  3QPL A;  3GTM J;  2KDZ A;  1SAN A;  3OP9 A;  2O9L A;  1PUF A;  1CJG A;  4D5F A;  2XGE A;  1TC3 C;  4I8T A;  2LLK A;  4J1W A;  3ZHM A;  1NK2 P;  1IDY A;  2VPR A;  2XIU A;  3HGG A;  1QPI A;  2G0E A;  2MW8 A;  3DEW A;  3GN5 A;  1HOM A;  4XRM A;  2MGQ A;  1GVD A;  2NS7 A;  2K9Q A;  5K7Z A;  1EF4 A;  1MH4 A;  4Y7N J;  1PNR A;  2HDD A;  3BR5 A;  1JT0 A;  1QQB A;  3SFI A;  2FJ1 A;  1X2L A;  4GQM A;  3BG3 A;  1JGG A;  3HM5 A;  2O8K A;  1MBH A;  1IC8 A;  3S1N J;  2R7Z J;  2CSF A;  1ZR4 A;  1DU6 A;  2JA5 J;  4X4D A;  4B4C A;  3HOY J;  2NVQ J;  4A3I J;  4BY1 J;  3GN5 B;  3MN2 A;  2CRO A;  1H89 C;  1VFC A;  3JRG A;  5IP9 J;  2AXZ A;  4JX6 A;  1QVU A;  1DWK A;  1Z77 A;  1ZGW A;  1BW6 A;  4FE4 A;  2KZ8 A;  2WIU B;  1RPE L;  3FMY A;  2O49 A;  1ADR A;  3SJM A;  2HXI A;  3JXC L;  2JJ7 A;  2TRT A;  2DA5 A;  4XIC A;  1NTC A;  1LFU P;  1LE8 A;  1YRN B;  2KEK A;  2NS8 A;  4M6V A;  1WH8 A;  3I4M J;  3S15 J;  3DNV B;  4S0H B;  2Y2Z A;  3F0C A;  4LOC A;  4AUX A;  5C44 J;  3S2D J;  1DW9 A;  1VPW A;  4I76 A;  1JJ6 C;  9ANT A;  3W6V A;  3QQ6 A;  4D7N A;  1R9T J;  4M3B A;  3BD1 A;  3FIS A;  3BR3 A;  1X57 A;  3F51 A;  1POG A;  3I4N J;  4X4I A;  2PUA A;  5E3M A;  2XGD A;  1ETX A;  3O9X A;  2CUF A;  5C4J J;  5EDN A;  1UXD A;  4JX4 A;  1MSE C;  3LIS A;  1RR7 A;  5EZG A;  3ZQC A;  2IVB A;  3JR9 A;  4PU7 A;  3K7A J;  1Q1V A;  5M3F J;  1BA5 A;  3JXB C;  4I6Z A;  4NDW A;  3VK0 A;  2DA2 A;  3FK7 A;  1K61 A;  2LKX A;  5IOZ A;  1BL0 A;  4A3F J;  1AU7 A;  4A3D J;  5F08 A;  3O8G A;  2A6C A;  1ITY A;  2COB A;  1JKR C;  1ZZ6 A;  4AYB N;  2JMW A;  2XPW A;  1VI0 A;  2DA7 A;  2FD5 A;  1A6I A;  3GTP J;  2YU9 J;  3LFP A;  4JP0 A;  1RZR D;  3HOZ J;  2NVY J;  1ZZ7 A;  1BW5 A;  1L1M A;  4MO7 A;  3ZOB A;  2AO9 A;  3TW6 A;  4A3M J;  1OCT C;  3HGY A;  2M9H A;  4PU8 A;  1LFB A;  5E3N A;  2L9R A;  2CUE A;  1QQA A;  3BTL A;  2VI6 A;  5J1Y A;  2PUF A;  4QSH A;  2DA1 A;  2LR8 A;  2EF8 A;  2L7F P;  1OFC X;  1RKT A;  1P7J A;  2GRM A;  2CQQ A;  2NVT J;  3IH2 A;  3FYA A;  1OSL A;  1QPZ A;  2JCG A;  1FIP A;  2PUB A;  3LOC A;  4HNV A;  2DMN A;  2BNN A;  1MBF A;  3A03 A;  5FKL A;  4I6R A;  1QP7 A;  5EZH A;  4Z5D A;  2PMZ N;  5JLX A;  1B8I A;  2HI3 A;  2GM4 A;  2R5Z B;  3FK6 A;  4BBS J;  3RZZ A;  2K40 A;  3WHC A;  4Z5H A;  4FTH A;  1K83 J;  1IG7 A;  4MCX A;  1QP0 A;  2DMT A;  2LK2 A;  2LVS A;  3PM1 A;  2MQK A;  3CLC A;  1FIA A;  2AWI A;  3JRE A;  1I6H J;  2DA4 A;  5J1R A;  2OFY A;  2KEI A;  1MNM C;  2O4A A;  1I50 J;  2ID3 A;  2M0C A;  4UUS B;  2OPT A;  4B1R A;  2PE5 A;  1ZTR A;  2D5V A;  2L7Z A;  2ME6 A;  1W0T A;  4DZP A;  4YBA A;  1XC5 A;  3BT9 A;  2E2I J;  1FTT A;  2MG4 A;  2DA3 A;  4IVZ A;  2QCO A;  3BR2 A;  3WHB A;  3S1M J;  3HBL A;  2FQ4 A;  4A3E J;  4X6A J;  2XGC A;  3Q0U A;  3GTQ J;  4BXX J;  1LCC A;  2E1O A;  1U78 A;  1H88 C;  2ID6 A;  2JN6 A;  2LY9 A;  1JT6 A;  4QTR A;  3RZO J;  2AXV A;  4L5E A;  2DTZ A;  4C3I J;  2KT0 A;  2O38 A;  4YG4 A;  3BDN A;  1MSF C;  2H1K A;  3PXP A;  1ZPQ A;  3QWG A;  3NAU A;  3JRH A;  1ZR2 A;  5M5W J;  2AHQ A;  3F52 A;  5J3L A;  3HDD A;  4J1X A;  1VF9 A;  2E2H J;  2CJJ A;  1Y7Y A;  5E3L A;  3BQY A;  2IVQ A;  3A01 B;  4AC0 A;  1TWA J;  4A3C J;  1WI3 A;  3B7H A;  1BDH A;  3JRA A;  1UMQ A;  3HOU J;  1MBG A;  2DMP A;  2BNO A;  4X1E A;  1JFT A;  3ZQI A;  1LQC A;  2EQR A;  2WB1 N;  1JTX A;  4A3K J;  2R1J L;  2PUC A;  2LD5 A;  4PU3 C;  1IDZ A;  1PER L;  4YG1 A;  3TRB A;  3C2B A;  3JRI A;  3M4O J;  2IBD A;  4IHW A;  3G5G A;  2VKE A;  2Y31 A;  1UHS A;  3TED A;  3CEC A;  3KXA A;  4I6T A;  5BNG A;  5M5Y J;  3Q0W A;  3B6A A;  3Q0V A;  4YAR A;  1P7I A;  3K2A A;  3ZQG A;  4UUT A;  1ETW A;  3DCF A;  1EFA A;  1JUM A;  1WPK A;  2K9N A;  1E3O C;  2R92 J;  4D5C A;  3RKQ A;  1LMB 3;  1Y1W J;  5E3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...