1S7QA

Crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7qA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7qA01
4KQ3L 1A3RL 3SE3C 2GK0A 4YHIB 3HC0A 1W0WB 2YWYA 2B4CC 2X4SB 2NLJA 1FFNB 2Z4QB 3O4LD 4GAYB 3E0GA 3SE4C 2IBZY 3BIKA 3GRWA 2P1YA 1S3KH 4JHZA 1DSFL 4KZDL 2CK0H 43C9A 4G7VL 5C0DA 3TN0A 4LSPL 5JR1L 2C3VB 3CH8A 3MOAL 3DIFA 1WWBX 4DKEL 2QQNH 4IRZH 1SJEB 2ATKB 1F2QA 2D31A 4WI7A 1Q38A 3AROA 1ZLUK 3WHE1 2IEPA 5I1CL 3RA7H 3DNKA 5DS8B 4HIIA 2GSIA 4RQQB 2Z91A 1S5IL 5CKGA 1CLOH 1Q94A 3CCHB 3HI6L 2FLRT 3O3AB 3ARGB 6CGTA 4XVTH 3HB3D 4CNIA 1T89A 4PYHA 2WZPD 5C6TH 3I3EA 3UAJD 1WBZB 3TCLB 3UJTH 2EYRA 5D7SL 1JGLH 3TYGH 4W6YB 5CEZH 4X99B 2R0ZL 1KBGH 5E8PA 4LRIC 3QI9A 4JGUA 5DEFA 1NAMH 3BYYA 3K4ZA 4GKNB 1RFDH 1QO3A 4RFEB 1AR1C 1QSEA 4TVPD 1C1EL 1J0ZA 1U95A 4NM8H 4L8DB 3HHRB 2X9YA 3LN9A 4OZFA 3SDCB 4ODTL 3PWVA 4PPTA 3TH3T 5C0JA 1EHXA 1ZWIB 5ICXA 2QJDA 5E0QA 2AS5M 1MI5D 4FTVE 4RGNC 2MCG1 2YXMA 4HCRH 3FRPG 2IMNA 4XNZB 3DVFA 3RVVC 5D7KE 1JPST 1I8MB 2Y06L 1QHOA 2XWJA 5GJSH 2AGJH 2XYCA 3RGVC 1TQBB 5MP6L 1SVCP 5DYOB 5TF1H 3NVQA 2RR3A 5C07A 3H3PH 4G3YH 4LEXH 3SDDC 1Y6KR 4NQVB 4TPRL 1DQLL 1HN1A 3NCCB 1AJ7H 3ARVA 4W4OC 4N1CA 3W5MA 3UPRA 1CG9B 3FB7B 4BFIA 3X12A 3S35L 3SKJL 1KIRB 1S7XB 5DA4A 1LD9A 5E9DD 1MY7A 1WQVT 2QQLH 5JIKA 5I18H 3WXVL 3B3IB 1Z9LA 1IQWL 3PWNA 3T4YB 1BVKA 5C0IA 1ZT4A 3MX0A 1XF3B 1T66C 5A2KH 3BDYL 3IXTA 32C2A 4MXVF 1T0NA 3RIAF 4KV5F 2IBZX 3ZDXF 8FABB 1W8OA 1Z3GH 5E4EC 3GMNB 1K2DA 4YXLH 2IC2A 4JKKA 4OFKA 3JXAA 1XF5B 4K23H 3JV4B 1K9TA 4DQOH 4JPWL 1J8HB 5DJYA 2EDXA 1CL7H 3GDBA 2AEIT 1ZHBA 2Z0BA 4Y19D 1I1AB 1MFDH 3VWKA 2IG2L 4RMRA 5ESAA 1JF6A 1KJ2B 5SWQB 3TF7A 4LBEB 5KTEL 1VFBA 4FQ2L 4TYUA 1UEYA 3N1PC 4Y4KD 4WTZA 5I76B 4PRAA 3JVGC 4LLVA 1BZ9B 1TTGA 5HGDB 3RWCA 2EEDA 4NT6B 2OBGA 1UC6A 4KQ4L 2QL1A 3EO9L 4NM4L 3FOLA 1EX0A 4XZUB 5DR5L 1PEWA 1RZKC 2UVFA 1E6JL 2L4OA 2FNBA 1K4DB 1NLDH 3LQZB 5CFHA 5CLWA 1ZT7A 5I8EA 4M6AA 1JZ3A 2YPLB 3G08A 1NGZB 1T5WB 5F3HB 2BHYA 1BFOB 5C0AB 5C0ND 2ZSWA 3UDWC 3FQUB 4G7YL 3MGOB 1LE5B 5IESH 1G7HB 2GTZB 3D25A 3WEXA 1MLCB 4GRLB 3GNML 4BUGA 1HHKB 4ZTPH 1CXKA 4AQ1B 2W59A 3O41B 4TTGA 2CJUL 4K3GA 3QH3A 4MCYB 4H88L 3K8LA 4F7EA 3K3QA 1HNGA 2VZTA 1G7MB 1N64L 2CLVB 3SQOL 3C09B 3MNVA 4JZOA 2V5RA 4O2EB 3OV6A 3OTTA 4QWWC 5A3IC 1VKXB 2DMCA 3W39A 1JYXA 2HVKB 5DHYB 1AGEB 4D0CB 4X80H 3QIBB 1W72A 3VFVA 2JCCB 4R3SB 2KPNA 5CWSA 2NY5C 4MQ7B 4HIJB 4RMVA 3F7YA 3I6LE 4WW1B 2HFGH 3E2HC 3OKLA 2NY3D 3WFZA 3P0VL 2DQDH 2XPGB 2A74A 5KS9E 2UUDH 5IB2A 2LU4A 1G9EA 4KRMB 1UEMA 5FGCE 1YQ2A 4ZUUA 3QNXB 1EHAA 4Z7VB 3IB4A 3RKPA 2R9HD 1LP9B 4JB9L 2WWKT 4KC3B 1ZA6B 5HSFA 3ZMRA 2C3HA 1M7DA 1DZBA 1MLBA 3CLFL 3V52L 5BJTB 4O00A 3DHMA 2A9ML 2QSQA 3LZFH 5AAMA 3ARSA 1SYVB 3QEUA 1RURH 4KMLB 3PL6B 1RJLB 1T1XB 3BRFA 4P59L 4EZMA 2VDOH 1MHHA 4ZTOL 4FFZL 5DD5H 3LD8B 1J88A 1OARL 3E8UH 5J56B 3QHTC 2XZCH 1DP0A 4OGXH 1JIBA 2B1HH 4UBDC 4U7MA 5T1KA 4KROD 3BP4B 4G5ZH 4YHZH 4RWYH 5HD8C 2RBLA 4GW4B 2HJLA 3GI9L 1UFUA 1R5VB 2FX9H 4PRIE 3L7EB 4NCC1 1GAFH 4N8CL 4XMKL 1QSFA 3MJ6A 1GHFH 1S7UB 4JO2H 4EN3A 4LQ1A 3PP3K 3NH7H 4FFYL 2CR6A 3JWDL 2IAND 4DW2H 3W0WB 1CZ8L 5LGKA 1ES0B 5ACZB 5L7XL 2ORBL 2O93L 5F7HA 2R8SH 3BT2L 4H1LB 4N9GA 1FYTD 4I4WA 1BQSA 2ZUXA 4MXQD 4ELKA 5ILTH 5DJCA 1E4XH 5AAWA 5C3LD 3KHQA 4NBZB 3SE4A 2UWEF 4JFHE 2HMIC 1XAUA 4HFWB 4JRYE 3WIIL 1GGCL 1UM4H 3OKKB 1AO7B 1F4HA 3PV6A 5CJQH 3MZGB 3NFSH 3R1GH 2F5BL 4ZFGH 5ITFB 5T3ZL 4EVNB 1CXEA 1VPOH 1FDLH 2EYSA 2FX8H 1XT5A 1VFAB 4LVHB 4QNPF 4Z7VF 4NJ9L 5HPMB 1B0RA 5D1ZA 1YYML 3TWCH 2DD8H 4QY8A 1TVHB 2BOCB 1YEFL 4K3HA 3WS3A 2QHLA 3OR6B 4CVZA 1N4XH 3TN0D 4TNVK 4HFUL 2OQJB 1FFOB 4TSBH 5ESQB 1VESA 4LVNC 1U36A 5AZEH 4PJAE 3TEUA 3KYMB 2NW2A 4U1LA 4OUUB 1X5GA 2EZ0C 3V0WH 5KG9A 1H3WM 3PWPA 5IVXA 3NFPA 3MLRL 3I85A 1A1MA 4QF1B 4BKLB 3HI1A 4XNYL 1FZKA 3QO0B 4JFZL 3F62A 2NY6D 5E2WH 5JO5A 4JHAH 4M6OL 1YPZB 4HUWA 3T0EE 2M1KA 1XGQA 4LRIA 1J18A 4J3OC 1NBZA 4Z76B 5EC1B 3HAEA 3VGDA 1NLBL 3WJJC 2HWZL 1PYWB 3ULSA 2VDNH 4NZUH 4QRRE 5EWIH 4XWGL 3GJFK 3REWA 3QDGB 2Y5TB 4HK3J 4C55A 5E94B 2X1QA 4MVBC 1RU9L 3QI9D 1FV1B 5A2IH 2VAJA 1R5WB 1BLNB 4OZHE 5EO1A 1C08B 4JKLA 1QSED 4GKSA 4AMKH 4E5XA 1F11B 3GGWB 1L8JA 3MLVL 3INUL 4O58H 4WCYH 1SM3H 3WNLA 1A7PL 1MNUH 2I26N 1G7JA 4ZFZB 1A21A 3RGVA 5A16A 3MV7E 5I74C 5EBMB 1IGFH 3MOBL 2R2HB 4Q74A 1N5YL 1K8IB 4PJ9B 5J6HB 4LHQB 2F9BT 1A9BB 3F65A 2Q87A 1L0YA 3PF2A 4PJ5B 4GLRI 4W4OA 4OF7A 2P5ED 4DKFL 4QTHB 3W9DB 4WUUE 1AD0A 3FQTA 3QIUB 5I6XB 4YXHL 3LQAH 1I9IL 1S9KC 5ANMA 3ZTNH 5C07D 5E6ZA 5IIEB 4PGDA 1QFUL 3OB8A 3THML 4I18A 3NABL 1XGYL 4R97B 4X7DC 1VA9A 3P77B 4MDIA 2I07A 1IC4H 1U6AL 2YMXL 2ITDB 2JJSC 4XNUL 1JZ8A 3MFGB 4AEIH 3WJLA 5LJYH 2F74A 1H5BA 2YBRA 4PLJC 1CIDA 4DGYL 4DZ8B 3U30B 5FK9B 4DGVL 3QXAB 5JZ7C 1KACB 1OSZA 5D6DA 5BRZB 4P23B 2CKNA 2EDOA 3P0YL 4HBQA 4G42A 4OCWH 3D39A 3MRCA 4PYGA 4Y7MA 2FEEI 1MWAA 4HS6A 4NO0B 1UCBH 4L4VB 1HQ4B 2ZOKA 5IP4A 3DMMA 3H0TA 4P99A 4MNGE 3QUXD 3B9VA 3VDBA 3QPQD 1QFPA 1XCTB 3K4DA 4KKCC 4BQ6A 3MQIA 2OCFD 5F7UA 5I1AA 4U1HB 4EXPX 9CGTA 3LEVL 2H2SD 1RIVL 2E8ZA 4J2XA 4P5MB 3MRJB 3FHAA 3JVGA 4S1SH 2ZUYA 3DVGB 3ZE2F 2ZNWA 4JFEB 5DQDH 5CJ8A 5FKPB 5INDB 1FL3B 1CFNA 5D9SB 4PJ7B 3DV4A 3NACH 3GSOA 1CGXA 5CINL 4ONGH 5HHOB 2HKHL 5JOFB 1DCLA 3FQXA 2E6QA 4LLQB 1N6UA 1TMCA 1WAAA 4NCC2 3RVXC 1QYGL 4M48H 4X98A 2LU7A 5TE4L 5LWYH 3DGGA 3N9GH 3HLAA 4QHUB 1IGMH 3VG9B 2FIKA 3IVKA 4KK6D 5MI0C 3S34H 3QDME 3V5HA 3ZSSA 3MLUH 4S0UC 3UZQA 3KPSB 4DVBA 1IC5H 3EJZC 4E41A 2E7CA 3WN5A 4E0RB 2DI8A 2IPUG 1A6ZB 2A1WH 2JLLA 3MREB 3P4NA 1RK1B 4YHLL 2BERA 3WIHH 5JDSB 2BNRB 4LEOA 3L5WA 3GMRB 2DQJH 4QGTA 2BNUA 1TQCB 4JY6A 1MCIA 3FQWB 4P46A 2PYEE 4WO4B 1TFHA 3D48R 4O5LH 4BZ1L 4ISVB 3IFOA 4QXGH 5L0QC 3LEYL 2HP4A 5GZOD 4LCUA 4Y5VB 1IARB 1WC7A 2ZJSH 1MHCB 5DWUL 1A6TB 1FAKT 4NKMA 4Q9QL 4RIRB 3TFKC 3RKDD 1U8MB 4I3RL 3D85A 4OGZA 1YNLL 3SKMA 4NQCB 4XVSL 3OX8A 4U6YB 5M94B 3ZKXC 4ODWA 1FBIH 4MJ6A 4KJYB 4XCNA 5D72L 5GGTH 1MCHA 1JPGB 1MFCH 3F58L 4HPOH 1IEBB 2WBJB 1NEUA 4ETYA 1AHWB 4K94C 5J9PA 2DBLL 2FJFA 2OP4H 3J7HA 4LIQH 3NAAH 1GGIL 3CVHL 1ZLWK 4PRHA 4C54A 5TH2A 3N85L 2D7TH 3IETB 1AGCA 5CD5D 1CDCA 3LRHA 1T6VN 1RUKH 2OZ4H 3QIWA 4RCAA 5A2JH 2H32A 3KS0H 1FVCA 2YZ8A 1YEIL 4RRPG 3VMPA 5CGYC 3KPRE 3L5HA 4PB9H 1UACL 5LQBL 3QXVA 4XAWL 2WUBH 1JI1A 3O6FB 3RDTC 1WBYA 3MPCA 3RZCC 1MHEA 4L4TD 4PRDB 5T1KD 3I2CL 1FIGL 3MBEC 1A6WH 3W82A 1XR8B 4P4RB 5C6WH 2ARWA 1WGOA 1QSFD 5GGQL 4EN3D 1E4KC 4B50A 4KHXH 1UADC 2ESVB 5TDPA 5BQ7B 2K9UA 1FZOA 3QEQA 4OTXL 4YHKH 3JTSA 2A6KB 2AXGB 1P4LB 3ZTJG 5KOMC 3STLA 5JW4N 1IC7H 4RFNB 3ARUA 4G9FA 2P24B 3OG4B 5C8JA 3PUCA 1NFIA 1JK8B 3HMXA 1JNHA 5KSAC 1B0GA 2CLZA 1WFNA 3LHPH 5BV7L 3B8SA 1VGKA 3MGTA 4WNQA 1LK2B 3DOSA 4P2CG 5DVOA 4JDZB 3ZTJH 1FNEA 2XXMB 1OPGH 2NX5A 3PWJB 3MRLB 5D1ZD 1UYWL 2A73B 3VXNA 5A2FA 1AXTH 3TNMA 4GG6B 5TDOB 3TO4C 1QA9A 3C08H 5KANI 4F9LA 1RUMH 5F88A 3EYOA 1CK0H 5J1AB 5EBWA 4JFQB 3LPGA 5AWNH 1RIUL 1KIQA 1VADA 2NYYC 4PRPA 1X6LA 3RNKA 1U8PA 4N8VG 3NIDE 4OSUH 4JGMA 4JAMB 3STBA 2CDFB 3QUZC 4KTDH 4NQDA 4JFXA 3PWPD 2AKRB 1GCFA 3TA3D 4FQIL 4QYOB 5D8JH 3UTSB 3L3HB 5CEXB 4HT1H 2R1XA 2DRUA 2NR6D 2V7NA 1EXUA 3NCJL 4P2OC 5JMOC 4PIRF 4JZNB 3SKNB 2H3NA 3KLDA 4X4XA 4YX2H 1GRWA 1E27A 2DTMH 2FO4B 2BOBB 1SMAA 4N5ED 3DGCR 3Q6FB 4QT5B 3O8XC 4AEHH 1FO0H 2OI9B 3BKYH 3MJ9L 2VITA 2LABA 4CDHA 5IVZB 3MV8E 4G6AC 5IVNA 1NGWA 3TVMB 3OPZL 1NUDA 1KJMB 1ZE3C 1F2XK 1U8NB 3GBLA 5CZXD 2VLKA 3BH9A 1G9MH 1HNFA 5DC9B 5FHBL 5FYLL 2W92A 3Q48A 3CMOL 3ULUE 3WBDA 3EGSA 1IBGH 2R4RL 4WFFD 1Q1JH 2PTTB 3LIZH 4FQHA 2E6PA 2YEZA 3TIDB 3GMMA 4DKAA 3BEWB 3WDHA 2X9XA 1CFVH 1P2CB 3G5ZA 3S3SA 3KJ4C 4F15C 4HKBB 2R69L 3FT4B 2B1AH 4XRCA 4AIZB 1R6VA 3HNVH 5DRXB 1OGTA 3FFCA 2QV2A 2D7MA 3N0PB 3GO1L 2QQKL 4NKOA 4TUOB 5T3XH 5B8CA 2UYLA 3C9NB 4HWBA 2VDLL 3AXLB 3L3GA 4Z7UA 2M8XA 1FAIH 2VISA 5L2KB 4G8IA 4JO3L 3B4NA 3UTZB 4PJFA 5CSGA 3CH1A 5HI3D 3DV6B 4DCQB 3O2DA 5TE6H 4PLOB 3OF6A 5HGAB 5E6IB 3DVNB 4PS4H 1JMXA 3GSRA 3D39D 3MXWL 2GAZA 3GMQB 1QLEH 1IGTA 2NY6C 1FE8H 3AREA 4YDLC 5BVPL 2VDPH 3ES6B 1T7ZA 2ICWJ 1UM6H 3DMMD 1YN6A 3CU1A 1A7NH 2Q6WA 3T0WA 5TQ2L 4NC2B 3TT3H 4CDGC 2ZOLA 1DQDH 3RU8H 4U6VL 2YD3A 5CZVH 4WEBL 5IBLC 4F2MA 2Z35A 1OLLA 2FEDC 2QADD 2YPVH 5GS0C 3PWUA 3CVHB 5KS9F 2HTLC 4D9RE 4IIQA 1BQHG 5JQ6L 3VWJB 4UV4H 1DE4A 4BH8A 4TVPE 5CBEA 4HGWB 4YBLB 4PJHB 1UZ8B 5C0CE 2W60B 3QCUH 3S37L 1A2YA 3JTTA 2ITCA 5DJAA 1CICD 5FKAA 3DHJA 4U1MA 4O51B 1MI5E 4XCFL 4YBQD 4PJAB 5K9QI 3FN0H 4H20L 1YC7A 5DRZA 4YJZL 1I75A 3HZMA 3OKMA 2V2WB 1F97A 3MLWH 4XXCC 4BQ8A 4E41D 4YEFA 4PJBE 2RFXA 5D5MA 4QOKE 3BGAA 4C4KO 5IBUB 5I1EH 4RWHA 4M62L 5DUPH 1T3FB 3BP7A 1DQML 1MJUH 1NAKL 3ARGC 2FCBA 5FF6B 1UKQA 3TFKA 5HY9A 4GH7B 2EXYD 3OMZA 1KB5A 1LDPL 2CKBL 5E9DE 3CFEB 1D6VL 3LKNA 5F3BB 5CJOL 2EKJA 4FABL 2W65A 4KHTH 4GMTL 1W0VA 1XH3B 3OSKA 3S9DB 3C87A 4OZHB 1RZ8A 1BZ7A 1VEPA 4LRNL 2YD5A 5FYKL 3VGEA 1Q9OA 3DX7B 1NCCL 1QKZL 3SDCC 1CGWA 5C08E 3LS4L 4CN6A 1UWEH 4LDEB 2NY4C 3VRJB 4D3CH 1GSMA 1BM3H 4JFPA 4QCIA 1L7TL 1B88A 3T77B 4FQ1L 2PR4H 4XNZC 4P4KB 3VXOA 3VFUA 1JGEA 4TVPH 3OKOB 2UUDK 1OF2A 4WUUB 3RDTA 3SCMB 4QRPB 3DRQA 3HI5L 3QIWD 2VC2L 3MBEA 2LTQC 1NC4A 1PD6A 2C7UA 1UWGL 4PJAF 5C7XH 3JZ7A 2AJVL 5DEGA 2H8PB 2QEJA 2QKIB 4PTTB 4WHTA 1V7NL 3NGBB 2ZCKL 4F7TA 4ZS6D 2GT9A 3MRBB 1OT2A 3V6FB 3ARTA 4N90D 4P0DA 2X1WL 1UH2A 3TJEH 5E5MB 4EOWH 4PGCB 4Y1AA 4RMUA 2P8LB 5E5RB 5DURB 4K7FB 5DVNA 4HIEB 5IHUH 3BP6A 5BZDA 4WRLA 4L8BA 3ZL4H 1Z5LB 3BO8A 5CKAA 4C56D 2X4QB 3QEQD 2F53E 2SEBB 1HH9B 3EFDH 2P7TA 4PJDA 4A6YL 4QXUH 4G9FD 5JXAH 1CD8A 3QPXH 4OZHF 3KS0J 1YDPA 1TZIB 5GZOC 1NGXB 1DQJA 2DLFL 2EH7L 4HXAH 4ONHA 1OAKH 1FFPB 3G6AB 3U4BL 3O3DA 3MROA 3WFHA 5EU5B 1H3TA 5IMMB 1X4YA 3V8OA 3IDYB 3VD9A 1YEJL 3PDGA 1KYOJ 4AM0A 3N50A 5I17A 4YXKL 1S9YA 1KLGA 4NO2B 1INEL 3I9GH 5BO1H 3GIVB 2WUCH 1A4JB 3BUTA 5K9JL 2NX5D 3G5XA 1DEEB 1FLTX 3QUZA 2BVQA 2AJUL 3RL2B 1FC1A 2D03L 4X9GA 4PJXE 2BSRB 4PV9A 4LSUL 4ODXB 5HI5D 4G43A 3S4SB 3FZUC 2VAAA 3VRLE 3ZHDA 5LKNA 4N0CC 4NYLA 5FO9A 1CD1A 5CHNB 3TPUA 3KHOA 4Y5YA 3P4OB 4V1DA 5FAAA 5IGXH 4Y4HB 3DO7B 5T1DH 3QRGL 4YHNA 2FL5B 5EA0L 2VH5H 2VLJD 5D7LA 4C83A 1CD9B 1C12B 4MAYC 1RVFL 3EO1B 5GJTH 2OR9L 4UTAL 4UNUA 3GSQA 4FQPA 2R0WH 3OG6B 5EUOE 4ZO9A 1YY8B 5FYJU 5MEOA 3VXUB 2F54A 1YMME 2J4WH 4D9QE 2R2CA 1CXFA 3CC5A 2JK5B 3HFMH 1A1NA 1U8IA 2FSEB 3C8HA 3IKCA 2H6PA 1OP5H 1QFWH 1J10A 1FORL 4WIQA 4X6CA 5GXBB 5EB9A 3MJ8B 2IANE 1MRDL 2OTPA 1VSCA 1FRGH 4BQ9A 3O9WA 4KAQL 5C0EB 5FGSA 1FZJA 3BPLB 3KLHD 4M8QA 1FYTE 3WDJA 2Q86A 5D7IB 2XN9E 3I6GB 5BS0D 5IT2L 3BGFB 4L8CA 2XZZA 1NBVL 3QO1B 3CDGB 2XZAH 4OD2A 3SDAD 2VXQH 1JTPA 1N0XH 4G9DA 3RIFF 1TVDA 5DD1H 5I30L 5E1AB 5JW3H 4PRBA 2C1PB 4RGMB 1ADQL 3PL6C 4QRQB 3MNWA 4XTRC 3AAZB 1P9MC 4PG2C 3LAFA 1I1YB 1YECL 2AXJA 3LD8C 4YUEH 5ADPL 3H7LA 1ORSA 4HUKB 4M7KH 43CAA 3SE9H 1KJVB 3OZ9H 5MERA 2GYSA 3PJSA 2CMRL 4DAGL 4EDWH 5I19L 4OGAC 4IOIB 4PGEA 2Q7YA 3OF6D 5F7KC 2PXYC 4NRZB 5IFAL 1X5LA 2VDRL 3CLEH 2JIXA 4IOFD 5B22A 1EO8H 4LFHG 1RJCA 1ACYH 2C9AA 3ARED 2FH6A 1V3MA 3NPSC 1W0WA 1S7RB 3GMLB 4ZOBA 1FFNA 1RPQA 2Z4QA 4GAYA 4O4YL 4V2BA 5E99H 2G60L 3MACL 1KCKA 1VB9A 1A7QL 3U36A 4OZ4A 1D5BB 3E3QC 4U05A 1CT8B 3LH2L 2XWTB 3ULVD 2R29H 1LEIA 3GIZL 5D93B 2C3VA 2EC9T 1HHGA 4LVHC 4XBGB 5I8CA 1NGQL 1SJEA 2ATKA 3OKDB 2EE2A 1BGXH 4XP9L 4UMGA 5F7MC 1OAZL 2ED9A 1QEWA 1U8OA 4OFIA 4RQQA 4XXCA 4G8EB 4OAWB 1NCNA 2AXHA 4IMKC 3CCHA 3EJYC 5I1HH 4JFFB 35C8L 1ZK9A 4ODHL 2CR3A 4YE4H 4ONFL 2CQVA 3HCVB 4M5ZL 4OB5H 3O3AA 2A0LC 3WFCL 1KG0B 3ARGA 4KPHH 1OAXH 4KRPB 2D3VA 3PDOB 5IUSA 2FX7H 2E8YA 3GRWH 2FDBP 1R0AH 1N7ML 5F7DB 4N1EA 3CSGA 3GJFB 3UO1L 4CU7A 4UZGA 4OLXH 1WBZA 3TCLA 1AKJB 1AFVL 4JRXD 1GGBL 4RBPH 5F1IA 5FHAH 5GGRB 4X99A 1F8TH 1C7TA 4AIOA 4U6HB 1T22B 3GBNL 4UIMB 4Y4FB 4GKNA 4TNWK 3A6BH 4RFEA 2FECI 2WBWB 2R0KH 4L8DA 4OF8A 3DSFL 3SDCA 1K6QL 5FYJL 4N0UB 2VE6B 2IQ9L 3EBAA 3FO9B 4MA7L 1ZWIA 2FATH 1TPXB 2J8UE 1TZHB 2F8VA 3FQRB 3VXTB 3OKNB 4BZ2L 3O0RL 5DUML 5FV2A 4JFDD 4R7NB 1I8MA 5DD0H 3CFJB 2FHCA 4LLWB 1L6ZA 5KW9H 5DYOA 1RJZB 3TC9A 4EIZC 2P48B 3DUHA 5ID1B 4LPTA 1PKQA 5GS0H 4NQVA 1UENA 1XIWA 1KN4H 1OY3B 1CG9A 3FB7A 1GYAA 1KIRA 2OLDA 4QRSA 4XCCL 5DHVB 5I6XC 4U1SB 1DJSA 1WT5C 2NY1B 1W0YT 1NUNB 3B3IA 3S98A 2FHBA 1NC4D 3T4YA 3HC4H 5ADOH 1OTSD 1GXEA 2LFGA 3C6LC 4K3JH 4G80B 3NIDF 1FFRA 1XF3A 1BZQK 1CQYA 2OL3L 1CLOL 1FVDB 1HQRB 4TRPH 5HVHB 8FABA 1FC2D 4YBQC 3U30C 5IWLA 5FGBC 2B0SH 1XF5A 2NY2D 4XVTL 1JZ7A 2WWKO 3RRQA 4XC1H 2RAMA 5LAXB 1I8IB 5EZJA 4LHUB 1J8HA 1OAYH 5C6TL 3OQ3B 2LAAA 3CFBB 4UU9B 2GJ6B 3UJTL 3FCTA 1I4FB 2NXZD 1MCOH 4R26L 1I1AA 1KBGL 4M3JA 5SWQA 1KJ2A 1NAML 4LBEA 4JDVB 1RFDL 4ZFOL 2F8OA 15C8H 4L1HA 4IJ3B 1YMHA 5HHXH 3DYPA 5EZLB 4NM8L 4G8GB 3UBXI 5I76A 1BZ9A 3KPPB 3E6FB 1O0VA 3B2VH 2OXGA 3ULUF 1FGVL 3MSPA 1A14H 1JN6A 4XZUA 4LVOC 1PSKH 3S5LA 3AS2A 2HN7B 5IR1B 5JXED 3LQZA 1K4DA 4Q2ZB 4X5WB 4HCRL 4WTZG 5D96C 4N0CA 1I8LA 1P5VA 3IDJA 4M93B 1T5WA 3RWHB 5F3HA 1BFOA 2AGJL 4OIBA 5C0AA 4ERSH 3C5ZB 3FQUA 3D0VB 3H3PL 1JPTH 4G3YL 1X6NA 2AABH 2GEEA 1LE5A 4LEXL 3UTTE 3L3DA 1ITBB 2DIJA 1MLCA 3NZ8B 1AJ7L 3F6LA 4GRLA 1HHKA 3T65B 1CFBA 3O41A 2RCSH 2EDTA 4MCYA 1BD2E 3FO0L 1A9EB 3LKOB 2E7LC 4Y16B 2QQLL 5I18L 1G7MA 2F19H 5E95B 2CLVA 4BJLA 4KUCD 1GGYA 4GMSH 4CU6A 2V6HA 2EIDA 1VKXA 3TNNB 3JWDC 1DBMH 5DHYA 1AGEA 3O6LH 4WGVB 1TQCC 4D0CA 5B39B 3QIBA 1H15B 2CRIA 2JCCA 4R3SA 4WO4C 1J1OH 1LO5A 4R6UA 4JZJA 4MQ7A 1KTLB 3P73B 4HIJA 1RZFH 3OJ2C 4J3TA 4URTB 4WW1A 4YXLL 5JDJA 4X6FB 2BSSB 2F54D 1DN2A 4KK5D 1XF4B 1X5FA 3F7VB 5E2VH 1QSFE 2XPGA 4J4PC 1QRNA 1F42A 2DI9A 3VGFA 4Z7VA 3DX9B 1KEGH 3BXNB 1CL7L 1KTRL 1SMOA 5CGMA 3ABZA 1EO5A 1HDMB 2IF7A 5FEBA 5BJTA 5HYSG 2WBJC 3CFDB 3KPQB 1U91B 3J8F7 1SYVA 4M3KB 1SEBB 1CVRA 3QQ9C 3PL6A 3RX5A 1RJLA 4HIXL 2A77H 5DFVC 1MCQA 4KJPD 1P9MA 3EZJB 4TUJB 4PG2A 5DJZB 2VZSA 1W72H 3B43A 4Y2DB 4OLYH 5CIPH 1P5UA 4YWGH 4DUWA 2AEQL 2EDYA 2EKSB 2HLFC 5E2UH 4HS3B 2XZQL 4G6KH 3BP4A 1C16B 4F7MB 1YUHB 4JKWA 2QSVA 1MHPH 3VFRA 1NLDL 1R5VA 3IGAB 3L7EA 5F7WC 4X7SH 3FN3A 3NA4A 1KPVB 3PV7A 1S7UA 1IFHL 4L5FH 1WITA 2PKDA 1FZMB 5DJ8B 1DN0B 1F4AA 4PJBF 1U3HD 3W0WA 5E56A 4KRLB 3WD5H 1ES0A 3EOTH 4G6FD 5ACZA 3K4AA 4K71B 4HWEH 4YDVB 4H1LA 1AP2B 5AG9A 3QISA 2ZG3A 3BRDA 4C58B 5JUEH 5JHDB 3GHBH 2M2DA 2NXYB 5IVXE 2C4FU 3FT2B 3PABB 4HFWA 5EN2B 4O2CB 2NTFB 3QYCA 3OKKA 5EU3B 4KI5C 4HK0B 1FSKB 2IPKB 2BC4A 1K8DA 4X80L 4XVJH 2HYMA 4OIIH 4PGZA 1KIUA 4RFNC 5ITFA 5SWSB 2Z31B 3B8YA 5EFIB 5SWZA 4EVNA 5ICZB 1VFAA 2D4DA 4YHYB 1MCPH 5HPMA 2HFGL 4M1CD 3TZVC 1KCSH 2DQDL 1MIEH 3HPJB 3NA9L 2FD6H 4BFBD 5DJDB 3OR6A 1UJTA 4ESKA 4RA3A 1SY6A 1FFOA 3OXRB 3VD7A 5ESQA 5IB5B 3IDXH 2CSPA 2EDEA 3KYMA 2Q8BH 1E6OL 2VDQH 4MD4B 4CADB 4OUUA 1DSFH 1S9WB 2DLIA 1LDSA 4JE4B 4R90H 5F1SA 4KZDH 3LZFL 1X5KA 4F58H 1RURL 4QF1A 4BKLA 3QO0A 1T7VA 5JR1H 4HWZA 4PJXB 3VXMB 1H8NA 5DD6B 1CF8H 4ZO8A 1FQ9C 4HJ0C 2Y5EA 2RB8A 3SJVE 4H5SB 1YPZA 1A3LH 4QHLB 1ZKAA 1P84J 1MAJA 3E8UL 5GGSY 3VXRB 3PGCB 2XZCL 3QFDB 1FG2B 4Z76A 4OGXL 5EC1A 4LPCA 2B1HL 1JHTB 1PYWA 2WNGA 4G5ZL 1SEQH 3U7WL 4YHZL 1HIMH 2FGWL 4H0GA 5DZOA 2FX9L 5GRUH 2ZSVB 1GAFL 1GOHA 3QDGA 1KB9J 1GHFL 4JO2L 3GHEH 3I02B 5D1QA 1HH6B 5E94A 4DN4H 1FV1A 3NH7L 1R5WA 3D3VD 2BX5A 1C08A 4DW2L 3V7MA 4DK3A 3T4AB 3QA3B 1F11A 1NAMB 3GGWA 3IJYB 5D7SH 1Z2KA 3QULA 2R8SL 4ORZC 5CZKA 3TYFA 4HGMA 4IRJB 1GZQB 2BFVL 2AQ2A 2J7LA 5ILTL 1E4XL 2PYFB 3TVMC 2QSCL 4IOFC 3SO5A 1J1XL 2R2HA 1HCVA 1K8IA 4PJ9A 5J6HA 1A9BA 3MLTB 4FQXB 3R1GL 1TVBB 4QTHA 5DVMA 3V5KA 3W9DA 4ZFGL 2XG4A 3NIFE 3QIUA 5BXFA 2FX8L 1FDLL 5IIEA 2BY1A 3BQUD 4C57C 2E7MA 3ARYA 4ZS7H 4P5TB 3TWCL 2DD8L 4UDTB 1DUZB 3OGCB 4HMEA 1XIWD 3IJHB 4NQXB 2VXTL 2ITDA 2Y06H 5JA9A 1N4XL 2HVJB 5E1HB 4PR5B 1JYNA 1U41A 2AI0L 4TSBL 2HT3C 2MKWA 4PJXF 1CE6B 1I9EA 3QXAA 2H41A 4TPRH 5F7NC 3VRLF 3X17A 1JI2A 5BRZA 3WCYA 4P23A 1WAAE 3V0WL 5GS3A 1JNNH 2K3TA 4OFPA 4LP4A 4NHCL 2LU3A 3RTQD 3BHBB 5E2WL 4NO0A 3FOMB 3LPFA 4JHAL 1HQ4A 3C5SB 1IQWH 4I0PD 1WZKA 2UY7A 3L1OH 1IAKB 3WSQL 5E6IC 2IBBA 4YPJA 1XCTA 1KGCD 2VDNL 3BDYH 4NZUL 4JM4H 1G7PB 4U1HA 5EUOF 3KXFE 3FTGB 3MRJA 1I1AD 5IHBA 3DVGA 2APBA 4TTDC 4JFEA 3RP1A 2ADIB 2UVEA 2P5WD 5FKPA 1BOGB 5INDA 4HJJL 5D9SA 4PJ7A 1QLRB 4FRWA 2HFFB 3T09A 2WP3T 4AMKL 1MSPA 4LLQA 2EDKA 1KN2H 4LSRH 1SM3L 1MNUL 1ZHLB 4OCXL 1MWAH 3ZO0A 1NC2B 2XWBB 1PQZB 5KTEH 4PJ8B 4WI8A 4ZOCA 4CBPA 4XPFL 1VEOA 3B9KB 4BSJA 4FQJL 4NQEE 1NMAH 3MRPB 1II4E 3KPSA 5I75C 4POZD 2CGRH 4NO3B 5C0AD 3I3BA 3LQAL 1A6ZA 3K1DA 3MREA 4S1QH 1H8OA 1M6OB 3ZTNL 3MRDB 1HHIB 1MFAH 4RDQG 1A7OH 5JDSA 2BNRA 2APFA 3AM8A 3GMRA 3S7GA 4GRLD 4PRHE 3SGEI 3G5VB 3L3JB 5EULV 1L0QA 2NY0C 3FQWA 3NCEB 1N6QH 4AEIL 3EYQD 4WO4A 2EH8L 4ISVA 1HOCB 3HR5B 5I73B 4HUXB 5HYJE 2XI9A 4GRWE 3SPVB 4Y5VA 1YNKH 1MHCA 3ZZ1A 3EW3B 5EOCH 1ORQB 4CMMB 1A6TA 1T83C 4RIRA 3SGDI 4HLZG 1U8MA 3LKPB 4XWOC 3QIBD 1I1FB 5EG6C 1RQ5A 5KBNC 4NQCA 4YHPB 2FJGA 1F3JB 1X5YA 3ARXA 4H88H 4MA3B 2AJYH 4U6YA 4KJYA 1UCBL 2DDQH 3HC3H 2ARJA 2MSPA 3LDBB 4N90E 1TIUA 4MAUH 5KVDH 4MQXD 4OLZH 2WBJA 1AHWA 1K5NA 1QRND 3ZT6A 3RWJB 1T7XA 2J8UB 3K46A 3QDJD 5JPMB 3AY4C 4HLZH 3KAAA 4M5YH 5L9DH 1KENL 4S1SL 5J1SC 2ARJQ 1KC5L 3IETA 3VGBA 3QUYD 2Q8AH 3QEQE 2DL9A 4GAJH 5DQDL 2G75A 4W70A 3HE6B 1V05A 2K1MA 4OJFH 4G9FE 1WICA 2BRRH 1Z9SA 2DKUA 4ONGL 1F90H 3RJDA 4WV1B 4JB9H 3VGGA 3RVTD 4P4KC 4IRSB 3CLFH 4M48L 3HZYB 4XP6H 3O6FA 5JIIA 5E8NB 4P2RB 1T04B 4PRDA 3T8XB 1IGML 4HQQH 3S34L 5DJ2B 5KOVC 3U0PB 1XR8A 2MHAB 2NZIA 4K2UH 4P4RA 4P59H 3SO3B 2NX5E 4FFZH 4G6ML 1IC5L 1OARH 3S35X 3FONA 3K8KA 3STZA 1AIFB 2A1WL 1OTUC 2J1KA 2QQQA 3WIHL 4HJGB 2ESVA 2DQJL 2JE8A 4N8CH 4PRPE 1QP1A 2A6KA 2AXGA 4FN0A 1P4LA 5BW7C 1I3RB 2H32H 3AB0B 4TULL 2ADJB 1CN4A 1U9KA 4NQDE 4O5LL 1FIEA 5AD0B 4QXGL 2E27H 1JK8A 4TQEH 4GS7B 2RIKA 4PY8J 5FUOH 5JA8B 2ZJSL 4I9WD 1Q0XH 1U58B 3KPMB 1P4IL 3BT2H 1LK2A 2R23B 5F89B 3MUY1 4MS8A 3DX6B 3IFLH 3PQYB 5SWZD 3AS0A 1OL0A 4JDZA 4U3CA 1FBIL 4M4PA 3MRLA 5GGTL 1OD9A 2A73A 4DOHB 4HPOL 4WJ5B 5TDOA 3FMGH 1R3LA 3IDYC 3P4LA 2OP4L 5J1AA 1IM3B 4LP5A 1EEZB 4NQSB 3H2WA 4JFQA 5CGTA 3LKQA 5BCAA 3FQNA 1KB9K 5FM4A 2HJFB 4JAMA 1YYMH 2CDFA 2VLKE 1SHMA 3HMXH 3QNYB 2BVOB 3QCTH 1RUKL 2OZ4L 4FFWD 3DXAB 2HT2D 4HFUH 2G2RB 1V7ML 4QYOA 4JPIB 2MQ3A 3UTSA 3L3HA 4WFHD 5KSBB 4AQOA 1F4WL 3WLWD 1BD2B 4LCCB 3QEGH 4N0FB 3IKKA 2MMXA 4U1GB 4Y4HC 1BOYA 1V3KA 4YHMH 5F71A 4JZNA 3SKNA 3FFCE 1A6WL 1FNAA 2FO4A 2BOBA 1GC1L 1LO2H 3Q6FA 4QT5A 2PTUA 3BWUC 2OI9A 3MRFA 5D1QD 2G5BB 5IVZA 3MLPA 4Z7OE 3RL1B 3EYUH 1LO4H 3TVMA 1OTTC 1A1OA 2HWZH 3LRSB 1D9KC 1BPVA 1KJMA 4Q7DA 3QFJE 4RBPK 1U8NA 5DJ0B 2BVPB 1T2JA 3LPWA 3T0BA 3HG1B 3SKUD 3WKNA 1RU9H 3QJFB 1F45A 4KY1L 3WIFB 2VLLB 2FECL 1ZT1B 3HE7B 3KNBA 5FCSH 1ND0A 3TIDA 3BEWA 4PJ9D 4GT7A 3RY6C 3ARRA 3HPLA 4WHYG 3BPLC 3LHPL 1P2CA 2P46B 4HKBA 1I85A 3BGFC 5DRXA 5TJWK 3QIUD 4S1DD 4WVRA 4YHOH 2ICWB 4M1CC 3MOBH 2ZKHH 1N5YH 2Y6SD 4TUOA 5F72S 2EICA 1AXTL 2X89A 2DQHL 3DPBA 3C9NA 3C08L 1EJOH 1RUML 1NANI 2A6DB 4DKFH 4RGMC 5L2KA 3ULVE 1CK0L 5E08H 4M7LT 5ID0B 3UTZA 4YXHH 3RPIB 1CDUA 1I9IH 5E00A 1FJ1B 4PRIA 4OZIB 3QUMH 1QFUH 3DV6A 3TO2B 4OSUL 4DCQA 1XGYH 4HDIB 5D7JC 4KTDL 2KDGA 5HGAA 5BRZD 5E6IA 1F58H 4P23D 2AJXL 2DQCH 2YMXH 4LPXA 4MHHG 3GMQA 1YEKH 1TETL 5IB4B 4NO0D 3HZKB 5D8JL 4Y5XB 1I7RB 3KWWB 2XA8L 4RNRA 1YYLH 4HT1L 3ES6A 3O2WL 2AK4B 3ARDB 1NBQA 2DQIH 2IH3B 2ZUUA 1FN4B 3P0YH 3ECBB 1IAMA 4CKVX 5D5ME 3RX8A 4YX2L 1T4KB 2DTML 1B6DA 1DBBH 4MNQB 4RX4A 1FO0L 5MEQB 1RD6A 3BKYL 4X8JB 3UROR 1BHGA 1BJ1H 4OCSH 1BMGA 3VWJA 2VABB 1A5FH 3ROLB 2DQGH 1KT2B 4JQXC 4HGWA 5ELIA 4PJHA 5FOJA 5C0BB 1G9ML 1UZ8A 1WFTA 1WSST 1IAIH 4OF6A 2XTJB 5D93C 1Q1JL 4HG4J 1T7YA 4ZDHB 3LIZL 4O51A 3D87B 4RGNB 4PJAA 5KJRH 1EFQA 4CMHC 1CFVL 3BFOA 5ACLA 3KPSD 3LY6A 2V2WA 1MCBA 4HAFA 1QYGH 1NQBA 2B1AL 2ZZUT 2VDKH 3HNVL 3WFDH 5HI4C 5J3HD 3BQUC 1NCUA 1T3FA 4MJIB 1KPRB 3ULVH 1WWCA 1QOKA 4IMLA 5FF6A 1NMCB 1FAIL 1PX4A 3KVQA 1KTDB 2MJWA 3CFEA 2OJZH 3ZDYE 4F7PB 3VRIB 3X11B 5TE6L 3VMNA 4HV8A 1XH3A 4Y4FC 5IVOA 4KJWD 2ZP0T 4NC0B 3KG5A 4OZHA 5IVXF 4KDWA 4FFVD 1FE8L 3DX7A 2C1OB 3IFPA 2VDPL 1S7WB 1UM6L 5K93A 5CJXC 1PKOA 4Q9QH 3WNNA 1JHLH 3TT3L 4Q9CA 3UTPE 3MV7A 4Y1AE 1TPXC 2EECA 4FTVD 3L9RA 4XVSH 3RU8L 1JZ6A 3T77A 1KB5H 4U1KA 4F37K 4F3FB 1NL0L 2YPKA 5GISH 1FGNL 4PD4K 2ATPB 1RK0B 2YPVL 4WUUA 4OQTL 3SCMA 4QRPA 4PJDE 2JJTC 4UV4L 2GTWB 4LDLB 5HYFA 1RJYB 1NKOA 5EOCJ 5T1LB 3QCUL 3N85H 2H8PA 3K80A 1Y0LB 2QKIA 2E7BA 3O6FD 5L8JB 4APQD 5J11C 3ROOB 4HULB 3ARBB 2NY1C 2D2OA 3HZVA 2Z8WC 4OCLC 3D2UA 3V6FA 4HBCH 3IU3B 1NDGB 3FN0L 4FOMA 2EIZB 2XQYG 2MKLC 2Y7QB 5BW7A 5KZCD 5DQJB 5JIHA 4OI8A 1BEYL 3MLWL 5EU6B 4PGCA 2P8LA 2VB5A 1LE9A 4K7FA 1P7QA 2X5PA 4HIEA 4MJ5A 5HVHC 5I1EL 1EK3A 4J6RL 4Z95H 1MJUL 2ESVD 2GFBB 1ZXQA 2Z92A 4RFOL 3VDAA 2X4QA 3EDJA 5C9JB 2SEBA 1HH9A 2WQ8A 1JJUA 3TPUE 5EIVA 1KNOB 4MD0B 4V1DE 4U3HA 1TZIA 2VZOA 1MF2L 5I1LB 1NGXA 3H3BC 1FFPA 3G6AA 5JHLL 5IMMA 5D7LE 4KHTL 3W2DH 3ZKMD 1F5WA 3BN3B 5HVFB 3A67H 4IJ3C 3OBAA 4MS8D 3VW3H 1KXQE 3SDXB 4NO2A 2CRYA 4M6NH 2BCKB 5IMLB 5KSVB 3GIVA 1A4JA 1DEEA 2F54E 3E2HB 4UUJB 3UX9B 2HRPH 1UWEL 2X1PA 5BV7H 4WI2A 3RL2A 3NIFF 4X6CE 4JDTH 3ZKNC 4NQEB 2YD9A 1IZKA 2PR4L 4TVPL 3QUYC 1UYWH 5I9QB 5FCUH 1NDMB 3PHOB 1MCLA 2D7OA 5CHNA 4QHKJ 3P4OA 4Y4HA 2ZG1A 3DO7A 3PGDB 2FL5A 3L6FB 3UTSD 4ORGB 1C12A 5C7XL 1M7XA 3EO1A 2X4NB 4P2QB 1WAAF 4Y16C 1MCWM 4PJEB 1YY8A 4ZAKB 4FQIH 4I2XB 4EJ1C 2DS4A 1DANU 4N8VB 4YC2B 3TJEL 4KKLC 4XGZB 4EOWL 1N59B 5LCVL 4I8DA 1XCQB 1X7QB 5FM5O 2H2PD 2XOTA 3MJ8A 2YUXA 4FG6D 1XF2B 3I6LD 3LB6C 3RFZC 4JVWA 3ZL4L 3RY6A 2AEPL 3UEZA 3EFDL 3I6GA 4QXUL 4KZEL 1NBYB 5JXAL 1WIOA 3QO1A 3QPXL 2BNQB 1XZ0A 3CDGA 3LEXA 4HXAL 3GUTA 1OAKL 1BBDH 3VG0H 4YFLF 4LOUD 5E1AA 4QGYA 2C1PA 2H45A 5HHMB 2X10A 1IJ9A 4OF5A 2R4RH 1WBXB 3AAZA 2EXWC 3I9GL 5BO1L 5K9KB 1HZHH 4GKZA 5J8OA 4Y2DC 1GGUA 2QBWA 4HWUA 1UB6B 4JPKH 2CXKA 3T0DA 5TGBB 1KJVA 2YRZA 4JN2B 4K8RD 3NFNB 4NRYB 1CWVA 4PRID 4EEEA 3AMLA 4M9OA 4ACPA 3BAEH 4KDTC 4MWFB 2V2XB 1LK3L 2XIDA 4NRZA 4NIKB 5IGXL 2VDLH 4QTIH 5T1DL 3WE6A 4GRWF 4Z77B 4JHBA 4V2CB 4P3DB 5GJTL 1XGUB 1S7RA 3GMLA 5CSZA 2NXYC 3MOQA 1X5JA 5KVGL 3Q0HA 3IAPA 4P49A 1MJJA 4JFHD 3GFUA 4W6WB 1BVLB 4JRYD 1D5BA 2XG5A 3H9SB 4G8FB 3OKEB 1CT8A 5D2LB 1FSKC 3Q6GH 3FHQA 4RX4D 3HFML 4YFLI 2XWTA 4M7JH 5M7QA 1R3HA 3UBXA 2Z31C 2IBGA 1WZLA 1N6VA 4XBGA 3VWJD 4JO4L 5B3JE 3OKDA 4MXWL 4AL8L 4S2SB 1FRGL 5DRNB 1NPUA 3MRMB 2YUWA 4U6VH 2O26U 1YNTB 3V6OA 2W9DH 4CRPA 4OAWA 3JWNC 5IQ7H 2DQEL 4JFFA 3S36H 4YDIH 5I74B 3BI9X 3HCVA 5EU4B 1EEYA 1FHGA 5CEYA 1KG0A 1Y6NR 3PDOA 1N0XL 5DD1L 5JW3L 3C8KB 5F70A 1GIGL 5F7DA 1UH3A 3GJFA 2ZUWA 3S37H 1BQHB 3BPNC 3O4LB 1AKJA 5GGRA 3ERYA 3VXSB 1JFMA 4YUEL 4H20H 1XGRB 5MHSD 4U6HA 1FNHA 5B4MC 1T22A 4UIMA 4Y4FA 5FO7B 4M7KL 4XHJC 1BJ1J 4MDJA 3SE9L 1SYSB 3OZ9L 3RI5K 3K2UL 1ZEAL 2CD0A 3VGHA 5JW4R 4OGYL 4EDWL 4N0UA 2Z8VC 1S7VA 2VE6A 3DECA 2NZ9D 5H2BB 5E70A 1B4JH 2W0FB 3FO9A 2QLVB 4FZEH 3CLEL 3FQRA 1TZHA 2WY3A 3QFJB 4BH7B 1EO8L 5D4QA 3VXTA 2GCYB 3OKNA 1D6VH 1IAOB 3VGAC 3AGVA 2AP2A 4KTEH 1CTNA 4R7NA 3BH8B 4IRJC 4X5XB 5FM5M 3P3YA 4LLWA 3IDUA 4GJTB 4LKCB 4NDMB 5E99L 5T33H 3MV7D 1J8KA 4J7RA 1RJZA 1J8HE 2OJEA 1OT1A 5ID1A 3O6ML 4LRNH 4UAOC 2DQTH 4ZNEA 2JF1A 1HHJB 1QKZH 5DHVA 4WUUD 4U1SA 3SCMD 4QRPD 3SBWC 2KZWA 4EQ3A 5TQ0L 1BGXL 5I1KH 4Z5RB 4OV6F 1C5BH 1YEEH 4G80A 4LQFH 1BIHA 1RHHB 1NSNH 3V79C 1PG7L 5I1HL 4JM2C 2R1WB 2R0LH 1PW3A 3D2UD 4YE4L 5HJ3A 3M8OL 5MI0B 4OB5L 3T08A 4YLQT 4PJIB 1QHPA 3OL2A 1OAXL 3DETD 3GRWL 5LAXA 1I8IA 1B9ZA 4EDXB 2YPLE 2AJVH 4WU5B 4LHUA 5SV4A 5DURD 5C0AE 4OLXL 3CFBA 2ZCKH 1P7QD 4UU9A 3ILPA 5FHAL 3SGJC 2DQUL 3T3PE 1F8TL 3EOBB 3C60C 4HMCA 2D7PA 4JDVA 3A6BL 1B3JA 3MNZB 3GBMH 5EZLA 1CFQB 5E5UB 4NUJB 3DUUB 2R0KL 5FXCH 5IROA 5HPOA 1NFDB 3KPPA 3E6FA 3TBWB 1JFQH 4NKDB 4A6YH 2FATL 2JCCE 3RWFB 3L95A 2HN7A 5IR1A 1UJ3C 2M26A 3ARFA 3P30L 1T1WB 4Q2ZA 4JFYA 2IAMD 3K74B 4Z7QE 1QR1B 4XVUD 2BY3A 4L3CB 3U4BH 5DD0L 3RWHA 1KLUB 4NNXB 1CXHA 1JNJA 3C5ZA 5KW9L 3S36X 4PJ8C 5L2JA 3NTCH 1EPFA 2J88L 3B9KC 4LSVH 3S5LG 1LP9E 3G9AB 2D0GA 3KPNB 4YXKH 1INEH 2H26A 3NZ8A 4Y19B 3QXWA 1KN4L 2WLZA 2H9GB 3T65A 3FAXA 1A64A 3S37X 3NCFB 1MELA 1ZSDB 1A9EA 3LKOA 1QPXA 2BSTB 1ODAA 4QOKA 4Y16A 3ULVF 3MO1A 4I13B 3GSVB 3FFDB 4Q6IA 3HC4L 5ADOL 1A6UL 3TNNA 1EVTC 1T80A 4K3JL 3KDMB 1AXSB 1QZ1A 3K8MA 5B39A 3TBYA 4LSQH 1H15A 5DDHB 4RAHA 1A8JH 2WIIB 4TRPL 1KTLA 1YEGH 4KK8D 4ZFFB 2B0SL 2JB6A 5AUMA 2BSSA 1VGEL 3D0LA 2D0HA 4A2LA 3F7VA 1OB1B 3C2AH 4XC1L 5JOPE 1S7TB 4UDUB 2FO1A 1MREH 3DX9A 1U3YA 1HSAB 3BXNA 4PV8B 2Y4SA 4U2YA 5D5MF 3W0WE 1MCOL 1SJVA 4LLUB 3LDBC 1HDMA 5C08A 4DUVA 1MUJB 4R8WH 3CFDA 3TPKA 1U91A 2H1PH 3MRKA 2OX5A 1SEBA 2YRLA 15C8L 5C1MB 3M07A 3RAJH 4JKMA 5D1XA 5HHXL 5EZIH 4TUJA 1ITCA 2J6EH 5DJZA 1KFAH 2FHFA 3MFFB 1MRDH 5I8KL 1JZ2A 2EE3A 2C26A 4Y2DA 3H9YA 5ALCH 3B2VL 2BRQA 5KSAB 3E3QE 1AO7E 4KAQH 5IF0A 2EKSA 4HS3A 3E6HB 1A14L 1HINH 4ZOAA 4XAKD 4F7MA 1YUHA 1D5IH 4MB5A 4WV1C 5HHNB 1A6AB 1KPVA 4KDTA 3E1F1 5DJ8A 3RY4A 3RUGB 4ERSL 4GG8A 3KYNB 1JPTL 3IDIB 2KQMA 1QBAA 1SJHB 1P1ZB 4KJQD 3RWDB 4M7LH 5IM7B 4YDVA 4XNQB 1AP2A 4GLRH 2YD4A 5EOQH 4ZUSB 5JHDA 3DTXB 1G7QB 3FT2A 3HUJB 3PABA 3CK0L 3PWLB 5EN2A 4O2CA 4QO1A 2NTFA 3L3OA 4JVPA 5ESVB 1YPZE 1DBML 1BBJB 5EU3A 3O6LL 4HK0A 1A6PA 3BE1H 2F53A 4WFHE 4EBQL 1DFBH 4H1LG 1N5AB 1O7VA 4M1GH 1I7ZB 2B2XH 2OTWB 1J1OL 2YD2A 5EFIA 4KROB 5KSUB 5ICZA 4P2OB 1WTGT 2HTKC 3HPJA 5E2VL 3QDGE 3WXWH 5DJDA 3VH8B 1MFNA 3V4VH 2VDML 5SX4I 4AIXA 5IB5A 3UP1A 4YGVB 5F7LB 3WNMA 2XT1B 3NIGE 5C2UB 4MD4A 3LN5B 4CADA 1T20B 1WCBB 3JSSA 3P11H 2V5MA 3P9WB 3LH2H 3MRNA 2A77L 4PJXA 3VXMA 1I8KB 4OLWL 4JFFD 4PJDF 4WDIB 1EUTA 25C8H 2HFEB 2Z9TA 4H5SA 1YEDB 4NSKB 1W72L 4JG0H 4BK4A 4LOUC 2YA0A 2VYRE 3VXRA 3PGCA 4OLYL 4KRPD 3QFDA 4OZGE 1FG2A 4PJ5E 4JRWA 5E2UL 3VJ6A 2L7JA 4F15B 3HC0B 4KK9C 4XI5C 5DMGD 2YZ1A 1MHPL 1AKJD 3BIKB 2ZSVA 4ODHH 4ELME 4PP1D 4ONFH 3GM8A 4H0HB 1GH7A 2WP3O 3I02A 3WFCH 1HH6A 4L5FL 4XPBH 3ILQD 4LCCC 5J4MA 4U1GC 3R0NA 5C0DB 1ZVSA 1JWSB 3T4AA 1FG9C 4FQCL 1H0DA 3EOTL 3QA3A 1NAMA 4QHNB 1GGBH 4FXKB 5M95B 4WWKD 1KUMA 4HWEL 4ENED 1FL6A 5BRZE 4IRJA 2OR7A 5JUEL 1GZQA 5F93C 3GHBL 4MGXA 3MV8D 2EYTB 2PYFA 2X2YA 2CK2A 4OUOA 2L7UA 2NY6B 3QRFM 4L4VE 3MLTA 3OAZK 5A43C 1EUUA 4M7ZC 4FQXA 4R0LC 4XVJL 1WWWX 2VR9A 5E4IA 2DI7A 3ULUD 2XN9A 2BK8A 1OOAA 1A0QH 4HCRA 4MA7H 4LCYB 4PRNB 4P5TA 4UDTA 5CJ5A 1DUZA 1MIEL 3OGCA 3O0RH 4K9EH 4P48A 4BZ2H 3IJHA 4NQXA 1W2KT 4FA8A 2NNAA 3MRHB 4JFEE 2HVJA 4XPAH 4I1NB 4PR5A 3MV01 1QSEB 1TLKA 3IDXL 4PJ7E 1HYSC 3IDGB 1CE6A 4X6CF 1NCAH 1WUNT 2Q8BL 4X7FC 2B4CL 5HHOE 2VDQL 3LQAC 1S78D 3H42L 4R90L 5F8RC 4X4YA 1J0IA 4F58L 2XKNB 4XCCH 1CF8L 3GSWA 4NOFA 5H37G 3V0AC 1A3LL 3GM0A 2DYPB 4O2FA 2P5EB 3KPSE 2ICES 1SEQL 2DKMA 2OL3H 1HIML 2R2EB 2P8PB 2E7LE 2MCPH 4MSWB 5C07B 5GRUL 2ED8A 4Y5XC 3T0EC 2DLTA 3FTGA 1MCJA 4KKBC 2XACC 3GHEL 2BNRE 4DVRL 3WO3B 5H37H 1T03H 3ARDC 3LCYA 5C0RH 2ADIA 3UPRB 3OGOE 4DN4L 1T0MA 1BOGA 5L88H 1QQDB 4YIQB 1LD9B 1QLRA 2HFFA 1KOAA 2FH8A 1JGVH 3HS0B 5GS2D 3PWNB 4R26H 1BVKB 3U4EB 4OI7A 1ZHLA 1S9VA 2XWBA 3BZDA 4JGJA 1PQZA 4D9RD 4PJ8A 2EEBA 3UTOA 2YN5A 3U46B 3SN6N 1J0HA 1S7QB 4NQCE 3ARFD 3MRPA 3UZEA 5TF0A 4L1DA 2QSTA 5C0CD 3ME0A 5T3ZE 3QB7C 5L8LB 2XTJC 3QUXB 4NO3A 3FB6B 3C5ZD 2BVYA 2NY4B 1FGVH 1M6OA 1HHIA 2V5TA 4LPYA 3KPLB 2Y07H 3KPOB 2RQ8A 3BKJH 4ZS7L 1MCRA 5KANG 5TDNB 1G0XA 1LHZA 5BOZG 3L3JA 5DJXB 2O5XH 1QLFB 3O2VL 4CW1A 4NNYB 4KGLA 3SE8H 1HOCA 4QOKD 3GK8H 3HR5A 3REVB 3EHBD 4HUXA 3L3IB 3KJ6H 1OCWH 4LK4A 4EI5D 3MCLH 3SPVA 3WDIA 1MRFH 2LTQB 1M4KA 3RVUC 1ORQA 4LLVB 1VENA 1NMCC 1JNNL 3LKPA 1I1FA 3T0XA 4YHPA 3FO0H 4NCDA 1YJDH 4UIKL 2X7LB 4RSVA 5FUZH 4UV7H 5FOBA 3MLXH 3L1OL 4MLSA 2HKFH 2C5DC 2GUOB 4HZLB 3RWJA 2J8UA 4LKXB 1G0DA 2ZSWB 5JPMA 4JM4L 4OCYH 4P9HH 2IPTH 4NO5B 4NBYB 3F7RA 5C08D 2ESVE 1CLCA 3D25B 1H8SA 1Y18B 3HE6A 4KI5E 1OWRM 3Q2CA 3B6SB 4ZXBA 5D1XD 4YK4B 3U7AA 5B3JF 2UY6A 4WV1A 1HWGB 3BJ91 1T5XB 1KN2L 4HHAB 4LSRL 2X4PA 4P3CH 4IRSA 4JHWL 1MWAL 1IC1A 1T04A 4PLKC 3T8XA 1W72B 1D5ZA 2FR4B 2EC9U 3O81A 4HIXH 4LF3B 5DO2D 5DJ2A 5CIPB 3WS6C 1NMAL 3Q5YA 2EDNA 2MHAA 4XVUC 5HYSB 3Q3GB 4GG6E 2CGRL 4IM8A 2A74B 1MQKH 3ARBC 2AEQH 4S1QL 1CDGA 2XZQH 1MFAL 3QQNA 1A7OL 2GKIA 4HJGA 1CLYH 3TJHA 2D0FA 2VIRB 1I3RA 5GZNC 2YSSB 1IFHH 2ADJA 3OHXB 1N6QL 1YA5A 1CVSC 5AD0A 3FO1B 3RWEA 1GC1C 2FZ3B 1RAMA 3QXDB 5CCKH 4X7EC 4AH2B 5DMJB 3CUPB 1YNKL 3QXTA 5DZLA 2EDWA 2AXFB 1BQLH 4KKAC 5EOCL 1U58A 5GRJH 3KPMA 3UTSE 1IKFH 2F53D 5BMFL 4MAYB 1H3XA 3B5TA 2R23A 3BGMA 5F89A 3DX6A 3PQYA 4L4TB 2AJYL 4R4ND 4M03A 3OWEA 2A9NL 1ZANH 2DDQL 3GJEA 1K4CA 2HJLB 3HC3L 2VWEC 2FBJL 4MAUL 5KVDL 4WJ5A 3RVWD 4OLZL 2X42A 1MCKA 1CBVH 4U49A 1EEZA 1B90A 3G04B 4JCMA 4OF0A 1OQOA 4M5YL 5GGSB 2GJJA 2YRPA 5L9DL 2WANA 2HJFA 2Q8AL 4GAJL 3NA9H 5IHZB 3QNYA 1EGJA 2BVOA 3LN4B 4OJFL 4I4WB 1U92B 3IYLW 3DXAA 5F97E 2BRRL 2NW3B 3VXMD 4ELKB 2G2RA 3UTTA 2PO6C 1F90L 1W8NA 4JPIA 4XBPB 2Q3ZA 5KSBA 2JB5H 1MVUA 4MD5B 1E6OH 5I9QC 4XP6L 4IS6B 1BD2A 4LCCA 4N0FA 4HQQL 5I71C 2UZIL 5K9QG 4XP5H 1CI5A 2HG5B 4UILH 1J1PL 3SHSA 1UQSB 1J7VR 1I1CA 2X9WA 3U48A 4K2UL 5D1ZB 4I3GA 3SDYH 4Z7WB 2G5BA 3WS3B 2VXUH 5L2KE 4W68A 3LRSA 4ZAKC 3U7WH 5ABDE 1CU4H 2FGWH 5DJ0A 5IW3A 1INDH 4YC2C 1YMMD 4D9QD 3T3PF 3KGRA 5C71A 4CUCA 4U1LB 3W11D 5TFSL 3HG1A 1URLA 3N1GC 5D2NC 3QJFA 3NFPB 4W4NA 1A1MB 2PXYB 2VLLA 2E27L 1ZT1A 3HE7A 3TA3B 3WIFA 1FZKB 4TQEL 4X4ZA 5FUOL 3IJSB 1DVFA 4LFHD 4GBXC 5ETUA 4HUWB 1Q0XL 4WHDA 1IM9A 1MCSA 3X13B 4FQXD 3SE3A 2XN9D 3NPSB 3IFLL 2BFVH 1G9MC 1GL4B 5J13B 3CXDL 3TESA 2JCCF 2JTDA 2QSCH 1J1XH 4L3AA 5CD3B 3RIAK 4P5TD 2X41A 1TJGL 4Z7QF 3RWIA 3FMGL 1I9JL 5EIQA 2A6DA 4HH8A 4D8PA 4ETQB 4QRUB 5ID0A 1FJ1A 5AEAA 1LP9F 4LPVA 5FGRA 3TO2A 4PJHE 3HMXL 3VE0B 3QCTL 1OP3H 2VXTH 1G7JB 5I8OH 3LMJH 4S0TD 1WIUA 5IB4A 2AI0H 4ODVL 3HZKA 3JTCA 1GZPB 4Y5XA 5HYEA 1LWRA 1X4XA 1I7RA 3KWWA 3NPZB 4JANB 5IMOA 1EO7A 4DFIA 3WNKA 3U9UA 5IFJB 1QRKA 3PDDA 4P9MH 2AK4A 3CFKA 5JW5B 2IH3A 3VFSB 1FN4A 3QEGL 5DMGC 4YHML 4NHCH 3FQTB 4BZYA 2VL4A 4K3DH 1EA9C 1MAKA 4MX7B 4LSDA 1LO2L 5DK2A 4PJCB 2EC8A 4K8RH 4MNQA 5MEQA 1UGNA 4X8JA 1ED3B 4MDIB 2I07B 5IW1B 5MHSE 3WSQH 1IZJA 1H3VA 1Z6JT 3EYUL 1LO4L 2VABA 2W9EL 3ROLA 1KT2A 4YQXH 6FABH 2XKSA 5C0BA 4WWKC 5EBGA 1JUFA 4WEMB 4JREC 1OSZB 4TSAH 4CL7A 1H3GA 4G42B 3D39B 4HJJH 2ZUTA 3MJ7B 3WKML 4ZG1A 1JV5B 1G9NL 1UH4A 2MWCA 1R3JB 4Q0XL 5DK0B 3H0TB 4OCXH 4M9PA 5DSCB 4U6XB 1DUYB 1JF1A 4YHOL 1CDJA 1XR9B 3SJVA 3GMOB 2ZKHL 2APXA 1KPRA 4LCIH 4XPFH 3SDDA 4FQJH 3MRRB 3OR7B 4OZGB 1EJOL 1OW0C 2QADB 1QSZA 1U2HA 4J12A 5E08L 1KTDA 5C6PB 4QRPE 4U1JA 4LHJB 1UWXK 3DV4B 2X4UB 4ELMB 3GSOB 3QUML 5CUSH 3X11A 3VI4E 4FQQB 1TMCB 2K7PA 2O5ZL 4NN7B 3C6LB 1F58L 1DEDA 2W0PA 2DQCL 3BIAX 2DWDB 1YEKL 1CICB 2EH8H 1WF5A 1X5AA 1X5IA 1YYLL 1S7WA 4X6DB 4MCZB 1YPZF 2DQIL 4E41B 2N7AA 4OKVB 3GSNH 5GGTA 3UPAA 4HWBL 3P4NB 1ROWA 1DBBL 3QEHB 5LXGL 4J3WA 1PY4A 2DF3A 4F3FA 2MOVA 1ZA3A 2ATPA 1RK0A 3CFIC 3HB3C 4RISH 3HE6D 2BNUB 4OCSL 2R15A 1BF8A 5GRVL 1NGPL 5IOPA 1A5FL 3UAJC 3O2DL 4ZXBD 2DQGL 3WS6A 3WUWA 1RJYA 4OM1L 1EAPA 5FYLE 1KENH 3OJMB 2OZ4A 4IRSD 3VWKD 2DLHA 1Y0LA 1KC5H 2YC1B 1IAIL 3ROOA 4I5BB 2VSCA 3ARBA 5F9WB 3NN8A 3P9MB 4LVOB 4ODWB 1NDGA 4MJ6B 4WI3A 5KJRL 2EIZA 5TPWL 2Y7QA 3DX8A 2XICA 5D96B 1ZLVK 5EU6A 4K7PH 1M7IB 2VDKL 3AU1B 1TCMA 3WFDL 4W6XB 1TTUA 1ZVHA 5EZOH 2FJFB 3UDWA 2IALB 3ULVL 2GFBA 1J12A 3HMWH 3MV9B 4ELMF 3HNTH 1BFSA 1IT9L 3EKCA 3TJHD 5C9JA 5DTFB 3ZYZA 4G6MH 5ERWB 3P0GB 2WMPA 5C0GB 1KNOA 4MD0A 2OJZL 3QIWB 5I1LA 2H32B 5CP7B 3KXFA 1LEGB 3G6DL 3GB7B 2IQAA 3EOAB 4L8SC 2Q1EA 3BZFB 4TULH 3H6JA 3F12A 2GQHA 3PQYD 3SDXA 4POYA 2BCKA 2R1YB 5IMLA 3QR2A 2VOTA 5IBTH 3VXUE 3E2HA 1GOGA 2ID5A 4UUJA 4E9LA 5CILH 4LLDB 3CXHJ 5LGJB 1P4IH 1JHLL 3EOYG 5GSRA 3B9DA 3MBXH 4S10A 4NQEA 4AT6B 1PAMA 1KB5L 3NZHH 5GISL 4C56B 1NDMA 3PHOA 4PGBB 3JTSB 4HAGA 1RZ7H 3STLB 5F7YC 3BMWA 5D7IE 3PGDA 5JOEA 5DJ6B 3UTTD 5C8JB 5MENB 1JGUH 1KXTB 4PJ7F 4EKXA 3L6FA 4ZPTB 4RAUB 5F1NB 3S3JA 2X4NA 4I48B 1BD2D 1WVZA 3UYOD 1NCDH 4XAKE 3QSKB 5HYJA 1CXLA 3IRZA 4Y4KC 4ZAKA 4HBCL 4I2XA 1V7MH 1O7SA 4N8VA 1KCRH 1AY1H 4FHBD 3GKWL 4XGZA 3EIFA 3VXNB 3TNMB 1F4WH 1QA9B 5C09E 1MJ7H 1X7QA 1XCQA 3F8UB 1AGDB 2VZ1A 5F88B 1EFXB 4J1UB 2BY2A 1XF2A 4Z95L 1J86A 1GC1H 4LASL 5HXMA 2HT4D 5K9OB 3QZWA 3HG1D 1F4YH 2GITB 5C0NC 2BNQA 2V9TA 4YDJB 3ZE1E 1DVFD 2VLJB 2V2TB 1IM9D 2CRZA 3W2DL 4G6JL 2BP3A 3OAYK 4HXBH 5HHMA 3A67L 4J3XA 3VW3L 4HK3N 4KY1H 1JCKA 2YWZA 4M6NL 3FRUB 4UT6H 2H3NB 5K9KA 3U82B 4LSSL 5DUBA 3TZVB 3VFPB 1R24B 4QLRA 1UB6A 2HRPL 2WSKA 3QQ4B 5TGBA 4JN2A 3IXAB 3O3BB 4NRYA 1NGYB 5EORH 4JDTL 1NGWB 4X5LA 3WNOA 1K3IA 2NY3C 1G7IA 5FCUL 3QUKB 2DQHH 3DUSB 2GJZB 1XGTB 3V6OE 2CXGA 4P57A 4U0RC 3EGSB 3QUMB 5GHWH 5BS0B 5FUCC 2R9HC 3SY0B 2XRAL 4JFFE 4UTBH 5D70L 4FQHB 4AEFA 1CIUA 1ZTXH 3BSZH 2PN5A 3OJDA 4PJGB 5FIEA 3SDAB 4Z77A 4NFCA 3S96B 4P3DA 1XGUA 2AK4D 4RZCB 3G5ZB 4L3EE 2AJXH 3WJJA 3JWOL 1TETH 5FA4A 2Z93B 1VEMA 1EDQA 3H9SA 5EIIB 4G8FA 2VUOA 2XA8H 3OKEA 5D2LA 1JRHI 4MNQD 1X44A 5B8CB 3O2WH 1WK0A 4MVBA 5T5FL 2DL2A 4KROC 2VZ3A 4Z7UB 1XGPB 1OM3L 1AR1D 4S2SA 4PJFB 3RWGB 4LGPB 5GGVL 5DRNA 5HDBE 1BWWA 1YNTA 4JY4A 4KVCH 4N0UE 4MMZC 1AI1H 5L6YL 4KI5F 3UBXG 4WW2B 5FYKU 3NMEA 4WGWB 1OGAB 4RGND 4HKXB 1BBDL 1P53A 4L9LC 3VG0L 3OB0H 1TJHH 2G9HA 3X3GH 4WI6A 1RV6X 3KLAB 3C8KA 3RVVD 1OW0A 4MXQC 1RZJH 2Y72A 2Q6WB 3O4LA 4LSTH 3RGVD 2WINB 2YHGA 3SJVD 3H7BB 3LS5H 3R06B 3VXSA 1HZHL 4IDJH 3SDDD 4ZNEE 1XGRA 1Q72H 4HUNB 4JPKL 5FO7A 2P42B 4F2MB 4HC1H 4GG6F 1SYSA 2JJSA 4JVUA 1LEKB 4X4ME 1AGBB 1JPSH 3PXHA 4H25B 1DE4B 5CBEB 1PZUB 3GMPA 1YY9D 3CX5J 3BAEL 5E8OB 1I3GL 5H2BA 3IS0X 1FL5B 2CUMA 1UB5B 1T66D 3TN0C 3JTTB 2ITCB 4D0DB 4QTIL 5KN5B 4R4BA 3QFJA 4BH7A 3V4UH 2GCYA 1G6RH 1IAOA 2ZCLH 2VKXA 3BH8A 4X5XA 3OKMB 3QDHA 3T04D 4NDMA 4LKCA 5IW6A 3MLYL 2DQFB 4GKOA 2GJ6E 4JRXB 1IGJB 1ZGLB 1HHJA 3Q6GL 3GZKA 4M7JL 3K81A 5EU7C 7CGTA 5HY9B 1KB5B 5BOPA 4Z5RA 4XPGH 4G8GE 4O02L 2Q7NA 4ZUWB 3ZDZE 2A83B 2NTSP 1NL0H 1RHHA 1FGNH 2W9DL 2Y36H 3QI9C 4LGSB 4U1NB 5IQ7L 4OQTH 4HUVB 2VJXA 2R1WA 2R2BB 3S36L 5JPNB 3V4PL 4YDIL 1BZ7B 3ULUH 4EUPG 4PJIA 3G6JB 1RUAH 3ZE0E 1RI8A 1MH5B 3D18B 1MEXL 4U7KA 4JFDB 2X4OA 1KJ3H 3TBVB 5EU6D 5IQ9B 5I75B 4I0CC 2XTLA 4M8VA 5C0FB 5K59E 1N0LA 4OBRA 4R96B 4R2GD 4RMTA 1HSBB 4WU7B 1A6VH 4EUPH 3T2NH 4J3VA 4NZTH 1MVFA 1BEYH 1HI6A 2NY0B 3MNZA 1IEHA 4MJ4A 1CFQA 1MRCL 4NUJA 3B83A 1NJ9B 1AE6H 3DUUA 4MLIA 3KXFD 3U2SB 4J6RH 3K7UA 1NFDA 1RUQL 1ZS8B 4QWWD 4RFOH 3TBWA 5A3ID 1B4JL 5DEGB 3KYOB 4NKDA 4FZEL 1J5OH 4P46D 3LKSA 3RWFA 5GRYA 3R8BB 1MF2H 1OVZA 4MZ2A 1QR1A 3WFBH 4KTEL 2NY2B 4XBEH 5JHLH 3CJJA 1KLUA 5E7FA 4NNXA 5T33L 2WM0A 3D85D 3BW9B 4TUKL 3KPNA 4NQED 2DQTL 5BZDB 2NXZB 1NMBH 5BV7B 2H9GA 3WHXB 1Q0YH 2VZUA 3VCLA 2W91A 1J0JA 4UOJA 3QUXC 3QPQC 1UXSB 1ZSDA 2BSTA 5GS2H 1R3KB 3GSVA 1OSPH 5I1KL 1J9CT 2H2SC 1C5BL 1DQJB 3L5XL 3KDMA 1YEEL 1AXSA 4PRHD 4LQFL 2CUHA 4PJHF 4JCLA 4PG9B 3TF7C 1NSNL 2WIIA 3FB5B 1MIMH 2IADA 2R0LL 4UBDD 3RZCA 1QBBA 5HYJD 4ZFFA 5HD8D 1S9YB 1KLGB 3ARPA 1IGIL 3MC0A 1P7KB 1OB1A 3OKYA 3V8CA 4UDUA 1WZ1H 3V6ZB 1E4KA 1HSAA 4PV8A 2OM5A 4JR9H 4KK6C 1T0PB 3HTLX 4CN1A 1MUJA 2N4IA 1REIA 4ZODA 3GBML 1FH5H 2AV1A 5AZ2H 5LCVH 1I7TB 4Y5YB 5JHDE 1D7FA 4ODUB 3RY5A 3MFFA 5FYJE 5DLMH 3CDFA 2B7DT 1AC0A 2J12B 2HMID 2A38A 4MZ3A 2X4TB 5KSAA 2AEPH 1JFQL 5A40E 3E6HA 1U8HA 1IGCH 1F6AB 4KZEH 5SWSE 1G0YR 4YK4C 4WENB 5I1JH 1UKSA 2AQ1A 3CZFB 1QUNA 5HHNA 1ZLWH 5T1MB 3LOWA 4XCEB 1N26A 5CSBA 1R3IH 1NEZB 5EDXA 3RKDC 3TO4A 1X5HA 3BISA 3U7YH 3NTCL 3IDIA 5T3XD 4LMQE 4LSVL 1SJHA 1CGVA 1KJ2L 1P1ZA 3RWDA 5IV2B 4AENA 2L0DA 5IM7A 4XNQA 1UZ6E 5EO0B 4RGOH 2OK0L 1DLFL 4ZUSA 5FFLA 2EZ0D 4M8QB 4NJAH 2CRMA 1G7QA 3HUJA 4L8CB 3IDMB 3VXME 1HE7A 5ESVA 5H35B 1BBJA 4PRPD 2CO6B 3VI4F 4LSQL 3VXRE 5CD5C 1BIIB 1I7ZA 1OP3K 2OTWA 4NQDD 5I1DA 1LK3H 5KSUA 4P2OA 3O45B 1RUPH 1YEGL 2F5AH 3U0WL 1E4WH 2FB4H 3H9SD 3C2AL 3QQ3B 3O8XA 3FKUS 3VH8A 2KZ1B 2ZUQB 3IF1B 4MVBD 1MREL 5CEZE 3WMSA 1U3HB 4YGVA 5KVGH 1B2WH 1U2CA 3PJSB 4HIHB 5F6HI 1D9KB 5J12B 5AYQA 4G6FB 5F7EH 3L7FA 3LN5A 1A02N 4DN3L 1WCBA 4R8WL 4Y8DC 2HT4C 1IRAY 2H1PL 4EN3C 3RAJL 5EZIL 1I8KA 1KCVL 4PBXA 2J6EL 3BKMH 4WDIA 1KFAL 4G59A 2HFEA 4JO4H 4YR6A 4NSKA 4MXWH 4AL8H 2XQBH 5ALCL 4BSWB 5E8DH 2CDEB 2VLKD 2VSDA 5IK3B 1HINL 4NHUB 5GSVB 1D5IL 3QNZB 2DQEH 1CGTA 4XPHH 2IGFH 3VXSD 4LPUA 4XPTL 3U36B 1RSFA 4OZ4B 1KPUA 1MPAH 1VFMA 3ZKQD 1GIGH 2EO1A 1LEIB 1QFHA 1JWSA 4L29B 1Y6MR 3D9AH 4TSCH 3CPLA 1HHGB 3CSYB 3FFCD 5I8CB 3CNKA 4QHNA 4PLJD 4PP8C 4FXKA 4K55A 4M7LL 5D1ZC 3MJGX 5JZ7D 4NC1C 4AEEA 1RIHH 5I16B 1LNUB 5D7JB 5EOQL 5C09B 1IGYB 1QEWB 1U8OB 1CXIA 4N0YH 4M4RA 2EYTA 5KVEH 1U8LA 1CLZH 3K2UH 1ZEAH 3QFJD 3OJVC 3B2UD 3LSOB 1QR4A 5ICYA 4OGYH 5I15H 3BE1L 3BZ4B 3SGEH 1DFBL 4M1GL 2B2XL 2CKBB 4NN6C 3FB8B 2DIBA 3TA3C 1PLGH 4KKCD 3ZLQC 4HF5H 4LCYA 4PRNA 2P43B 3LKRB 5B38B 3VFOB 3BZEB 5F1IB 1LVEA 3WXWL 2NR6C 3KYKH 3MRHA 3SGDH 3HA0A 3MUJA 4YHIA 3T2OA 2X4SA 3D3VB 3V4VL 5J13C 2DJ4A 4CGTA 2FEEL 5JNYB 2F15A 3IDGA 4N5EC 3O6MH 2DKSA 3DROB 3MA7B 3PHQB 3P11L 2XKNA 4YZFE 3RVXD 1J0KA 4PTUB 2BSED 25C8L 2Z8SA 5D7IF 3UJJH 5TQ0H 1PY9A 2X1OA 4JG0L 4A2MA 3RX7A 5CZXC 2DYPA 3DRTB 3WV0A 2P5EA 4Z0BL 4CMHB 1CGUA 1A4KB 1BX2B 5DS8A 4KMTL 3EJZD 2R2EA 2P8PA 4JN1H 1PG7H 2CUIA 5FB8B 4MSWA 3BQUB 2OSLB 3N1MC 1PKQB 3M8OH 1RZGB 4XPBL 1BJ8A 1SY6L 1XIWB 5DD3H 4L3EB 1AQDB 4H8WH 3ZYIA 1QQDA 4QRSB 3VDCA 1IILE 2R4SL 4YIQA 4BA8A 1FVEB 4ZQKB 3QWRA 2I27N 4UNVA 5GPRA 1YY9C 3HS0A 2DQUH 2A6IB 4I18C 3O11B 2BJML 3TBTB 3U4EA 5FM8A 4EQ2A 2ZPKH 3TFKD 4Z78B 3RTQB 4XP4H 3WJLC 1UG9A 3U46A 1S7QA 2VR4A 1H5BC 3I6KB 5HI3C 3VXPB 2YUVA 1PG7W 4I0PB 3ZE1F 4A6YB 5D6DC 2PW1B 1INQB 3QUXA 4EI6B 2I9LB 1A0QL 3FB6A 3IFNH 5EZJB 3MRGB 4U7SA 1DBKH 2BVTA 3CSBA 3KPLA 3KPOA 2J8OA 4ODBD 3FCTB 5EBLB 3P30H 4HEME 2IPUK 4K9EL 5TDNA 1L7IH 1U8QB 5DJXA 3DMMC 1QLFA 1TENA 3MLSL 4OZFG 5J6GB 4NNYA 2P5WB 4XPAL 4TNVF 3REVA 5KVFL 3L3IA 1QVOB 2BHZA 2VLRE 1YMHB 4OD1L 4NRXB 3T1FB 1NCAL 2J88H 5E6YA 1L0XA 5LGHL 2AW2A 5CGYD 1RZIB 2ADFH 2WLYA 3P4MB 4CVUA 2QADC 3VFNB 1S7XA 3RDTD 4P2RE 5J11B 4H26B 2LV4A 1F3DH 2X7LA 3RZCD 1JN6B 4OZFH 5IJVB 3DVIA 3S5LB 4RA0C 3MBED 2X70B 3D1MC 1A6UH 4L4JA 4NN7C 1J0YA 2HJKB 3MUZ1 4XMLH 4F57H 3IDJB 3V0VB 2GUOA 4HZLA 4JPVL 3T3ME 3RIFK 1CICC 3MMEB 4LKXA 2MCPL 3PIQB 4OIAA 3GMNA 2F58H 4NO5A 1CR9L 4R2GC 1Q9LB 3L3DB 4S1RL 5IFHH 4B5EA 1T03L 1VGEH 1LILA 1Y18A 5C0RL 3RBSA 3JV4A 4J8RB 5L88L 3EYFB 4Z7NE 5LBSH 3UTPD 3B6SA 1E28B 3EUUA 1KYOK 4Y1AD 3WN5C 1JHKH 3ESUF 4WWID 1JGVL 3QHZH 1M05B 4NFDA 3W5NA 1T5XA 1FCCA 4MA1C 4HHAA 4Q58C 2HFTA 1YEHL 5HDBF 5KSAD 2EXYC 5IEHB 4P46C 2FR4A 5ENWB 1LO5B 2UWEB 4KGJA 3PQYE 4LF3A 4JZJB 5CIPA 2YN3A 5I8KH 5HYSA 1Q9WB 2EIBA 3Q3GA 5HGDA 1K3ZA 4H0IA 4XXDB 4NT6A 4DOHE 5BVJB 3TO4D 5F9WC 5HDQH 1F02I 1QRNB 2EDJA 4EIGB 3QDJB 2Y07L 2EEAA 3BKJL 1DQQB 1WZMA 4JKPL 2ZUSA 2NYYD 2VIRA 2O5XL 4KUZH 2YSSA 3QUYB 4GW5B 3OHXA 2YPLA 1NGZA 3MUGB 4MNHB 3FO1A 3QUZD 3SE8L 1PG7X 4FZ8H 2FZ3A 3GK8L 1CD0A 3QXDA 3RHWK 4R4FH 3KJ6L 1OCWL 3MGOA 3DXAE 4AH2A 4M43L 3MCLL 3CUPA 1G7HA 2GTZA 1MRFL 4HH9B 2AXFA 1DR9A 5HVWA 5KSBE 4MAYA 1NANH 1DTUA 4BSVB 4L4TA 1YJDL 3MR9B 4V1DD 1ZHKB 3QIWC 4P2OD 1MQ8A 5CP3A 5FUZL 4UV7L 3CK0H 4YNYB 3VFRB 4O2EA 2JJUA 3MLXL 4ZYKB 5D7LD 2HKFL 2HVKA 3O8XD 3L5IA 4EBQH 3JUZA 5J0BA 3R0MA 3V2AR 3G04A 4ZS6C 3KYAA 4OCYL 4G6AD 4P9HL 5HDLA 5GGSA 5CMAB 2IPTL 2ERJB 1JRHL 5INCB 4FFEX 5IHZA 4NZRH 3LN4A 1MJ8H 1U92A 3HG1E 3QNXA 2NW3A 1LP9A 2VDMH 4XBPA 1XF1A 3ELAT 1ZA6A 5ITBH 4P3CL 4XCYB 4MD5A 2ED7A 3ZDZF 3O9WD 4DEPB 2YKLH 1CGSL 4GO6B 4IS6A 1SBBA 1K8DB 2BC4B 2VL5B 1MCDA 3LQMA 3SGKC 4NNPH 2HG5A 1T1XA 3JUYA 5SWZB 4OLWH 1U8JB 1UQSA 3OB0K 4DUXA 2HAZA 3ZE0F 4ZPVB 4Z7WA 1MQKL 2W07A 1KF9B 1IQDB 3X14B 4GW4A 2PETA 1CLYL 1EGJH 5K59F 4OZIE 5F9AC 5MEPB 4XH2B 4F9LC 4IOSD 1A7RH 3O4OC 1FNSH 2PXYA 4HUUB 1CGYA 3TA3A 4D9LH 5CCKL 4HWZB 1LO3L 2ADGB 5HI5C 5KAQG 4FQCH 2XKUA 3IJSA 5B3NA 4M61B 5GRJL 1BQLL 4KXZI 4F33B 4ONOA 3X13A 1IKFL 1HHHB 2QHRH 5EOTB 4Z18A 3IS1X 2AK4E 1IKNC 2DTSA 4OBSA 4UT9H 3PGFH 2XA3A 4N9OB 1QNZH 4JQIH 1UCTA 1ZANL 2DBJA 1F6LL 1WFUA 5CD3A 2JIXD 4N5EA 3I3DA 3E3QA 1AO7A 5SV3A 4MNQE 5D1QB 1CBVL 1WEJL 5IBLD 2FEDD 4J3UA 5GS0D 4ETQA 4QRUA 2E9BA 5TE7H 1G9NC 2EDFA 2HTLD 4L9DA 1M1SA 2BY0A 1UT9A 5C0BE 3QULB 3UYRH 1TVHA 2BOCA 3SEPA 3VE0A 3TYFB 4DKDC 3BUYB 3EYVB 2XTJE 4LLMB 4ZNCD 4IMKA 2OQJA 1XMWA 1GZPA 4YFDB 4JANA 4X7CC 4RGNE 2JB5L 5IFJA 2B4CH 3MYJB 2DYPD 3H42H 5JW5A 1TNNA 3KLHC 2VLME 3VFSA 3V5KB 4DZBB 3MRQB 4XP5L 4PREB 4X7TB 4LLYB 3BPNB 5BXFB 4UILL 4MX7A 3OAUH 4XP1H 1K85A