1S7QA

Crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7qA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7qA01
4R90H 1JMXA 3X3FL 5FYLD 4U6YA 4KRPD 1N3NB 3MYZA 3OKLB 5DRNB 3ULVC 2I07B 4KK5D 3O45B 4JN1L 2FEDD 3GRWH 5F88A 4CBPA 4IMKA 1EHLL 1RZFH 1XH3B 2Z31B 2BOBB 4JFPA 2MCPH 5LAXB 3TH4T 3VXSD 3EGSB 4PDCE 1DE4A 1I8IA 2GITA 2HLFC 4NQCD 4AENA 1EFXA 5IG7B 1JGDA 4MB4A 1A64A 4P99A 5IROC 3HLAB 1MPAH 2ADFL 3LQMA 1NBZA 4GS7C 3MV8B 4ORGA 3QZWA 2ZCHH 1KSRA 3BP6A 3SGEH 2D7MA 2XTLA 1MRCL 1S9XA 5CS7A 5I71C 1AXTH 2YRLA 5HJ3B 4PV8B 3RVWD 1HWGB 4JM2B 5KBNC 2OL3L 4YUEL 4X5WB 2V5TA 4R7DB 3MLZH 2YHGA 4DGVL 4QTIH 3EOAA 1JGVL 1K3ZA 1XR8A 2HN7A 2I9LB 5ICXB 4FMFA 3ARWA 5KSAC 1P4IL 2OR8A 1MWAB 5CBAA 4PJAA 5EUOF 3RHWK 4OZFG 1FNAA 2EEDA 4R3SA 3VXMD 5ESQA 5JW4N 3QG7H 4BKLB 2EDXA 1FFOB 3BD3A 3MA7B 1RUPH 2JELH 4QGYA 3SGKA 5DUMH 2FEDC 4RFOH 2AI0H 1U0QA 2R1WB 3UTSB 4YQXL 2D4DA 2VLJD 1J18A 4WW1A 5MEQA 1AGDA 2YD7A 3N1FC 3SDXF 3BZEA 5F89A 5AZEH 4WV1B 4NC2B 2F53D 4FFWD 1G7IA 2Y23A 2H9GA 4NRYB 3O11A 4RBPH 5MEOA 1IC7L 3V4UH 4ZFOB 2Y5TA 1GAFH 4OFYD 5SWQA 1NCAH 2EIZA 4UDTB 5LWYL 4YXLH 2AEIT 2KKQA 3ZHLA 3RZCD 5I8OL 1J1PH 3KPQA 4JFFA 4ETQB 1KXQE 4RAUA 2DQJL 1E27A 2AABH 5E0QA 1BD2A 3RVWC 1RVFL 1ZAGA 4W4OA 1D5ZB 1MFAH 2FD6H 4Z7VA 4OZIB 2GT9A 4R0LC 5CJQL 5ALBH 5EO9A 3T4YB 4H88H 2VABB 1YMHB 4ZUUB 3MREB 1NSNH 4ELMA 3WN5B 5HYQB 3HC0B 3L3IA 2ZPKL 3RY5A 3DX8A 3WFBL 2GJZB 1HH6B 5CEXB 3M17B 1CLOL 4GW4A 4H20H 1FZJA 1CD1A 4HK3J 5B39G 3DIFA 1NGYA 2P24B 4LLUB 2GFBA 1F3JB 2VR4A 3WO4B 1P7HL 3BZDA 2OTPA 1X3DA 2V17L 2CDFB 2MWCA 1YA5A 4L4TE 3AM8C 3VD3A 1O7VA 4R7NA 4QOKA 1IGFL 4YBHA 3O2VH 5JA8B 2APWA 3G04B 3UO1L 3K8MA 1JRHH 3IF1B 2I60H 3VDCA 2J5LB 2BCKA 3GBML 1HXYA 4ZODA 2WUCL 4KZEH 4JHWL 1D9KB 3BP7A 3LAFA 3NGBC 3BRFA 2VERN 1U3JA 1DBJH 1J11A 5GGUA 1RUML 5IBUB 4MXQC 3M8OL 1MNUH 4R2GD 2AJXL 1Q0XH 5FYKH 4AL8L 2J6EL 3EJYC 4ZO7A 4EIGB 3RKDC 1K6QL 3O2DL 5GGSB 2OI9B 4NHUE 3MODH 5E8EA 1BEYH 4YHNB 1RJZA 4M4PA 1PG7L 5DJ6B 3L3OA 1CFTA 4XAKE 1FV1A 3EYQC 2P42B 4PUBH 5KSUA 1ZA6B 4L3EA 2OM5A 5A40E 4LSPH 4QRQB 3BFOA 2X1QA 3QXDA 2P48B 3DETD 3TYFA 5HDBF 2HH0H 3GNMH 3SE9L 4NZUL 4K9EC 1R3LA 1MUJA 1X44A 5LGKA 1IGIH 5HYJD 3AXLB 1VENA 3LRGA 4IJ3C 3EFDL 3I3EA 3RI5F 2BDNL 3RA7H 4YHIA 3ZDZE 3P73B 2NW3A 5I1EH 3HAEG 5I66A 2IQAB 3G9AB 1ZOXA 1YEHH 1AXIB 5CAYB 3P11L 1BFVL 3V8CA 1EK3A 5IHUL 1EMTH 3MO1B 2D7PA 5CMAA 4NQUA 3QHFH 5DVLA 5B8CA 4ODSH 1N6QL 4FQ2H 2ADGB 3PDOA 4TVSa 2NY3D 4ACPA 5C8JA 1A3LL 3FB6B 3QUYD 2WIIA 3GMMB 3HR5A 2HVKA 4UNTA 1T5XA 3G5ZA 1UA6L 3NCCB 3W9EB 1W0VA 4KGLA 4EI6A 4MYWB 5IB3B 3ARXA 4JKPL 5J89A 5FYKE 1MCJA 3C09C 2IANB 4D3CL 5BRZB 4LBEA 1MFNA 4FQ1L 3CCHB 2FGWH 3RGVD 1HHGA 2R29L 2CLRB 1U8OA 3BISA 1MCNA 4J3XA 3OKNA 1WK0A 3QO0A 1YEJH 3NCFB 4W81A 5E6IB 4JO2H 4L4TD 2H3NA 1NL0H 1TLKA 4N0UA 1DCLA 2R2BB 3QDGB 1A6VH 1ZA3A 1U3YA 5CILL 15C8L 1WJ3A 1GPOH 4M1GH 4XBEH 2DKSA 3KYMB 1F02I 1PDKA 1P7KA 3BVNB 1FNLA 1W72B 2HJKB 3L3KB 1MIMH 4KDTA 1CFQA 5DRZA 4XMPL 4IOIA 4FQIL 4I77L 3NN8A 1IVLA 2NY3C 4MJ5B 3SE8L 1R5WA 5FA4A 4D0DB 2FATL 5EWIH 5AG8A 4U1GC 1RUQH 2FECL 3QNYA 5MEPB 1SJHB 1T3FB 1HQRA 1K8DB 4HIEA 2YK1L 4JO4H 5GS1A 4YH6A 1NANI 2HTKD 4XAKD 1XGUA 2AJUH 1P6FA 4GRLB 1A7OH 2NY0C 5IB5A 5GSRB 3H6JA 5H8DA 3UYRL 4D8PB 2A38A 1H5BC 1LEKB 3U9PH 3BHBA 5HHOE 4MJ6B 4PP1C 1UC6A 2YRPA 1MJ7L 4M00A 4YZFF 1ZANL 4OZGE 1U3HD 4YDKH 4IHOA 4LQ1A 1CT8B 2P8PB 1AR2A 1C5CL 1YPZE 4LMQI 5KSBB 1T7VA 2BNQB 2A6KB 4U1NA 5D7IA 1G7HA 1F58L 3IXAB 4MA3A 1DZBA 5F9OL 1I1YB 3UYPA 1IAOB 1SM3H 1KCGC 1IEBB 4C4KO 3G6AB 4MJID 4MLIA 5DJZA 3QEQE 5J3HD 2IALB 3OXSA 2EDOA 4NNPL 5CZXD 1Z9MA 4XBGA 1LWRA 1CTOA 4ODTL 1U41A 3MOQA 3T1FB 1A2YA 2JJTC 3AU1A 1FNGA 5EZJA 1XGPA 4L8CA 2PW2B 2WANA 4HK0A 5D6DC 3VFWA 1F90H 3ZDYF 3MOAL 1U8PA 4HJ0D 3OGCB 4UV4L 3BDBA 4APQC 3ELAT 4J3VA 1T1WA 1KJ2B 2HKFH 3C5ZD 4HF5L 2FWOA 4FQXC 4OI7A 2QR0A 4YDJA 1NBQA 5DMYA 4NZTL 4KV5E 3HPLA 2F5BL 3IDGB 4QXTA 3GMPB 4XP5H 4HC1A 4A6YL 4Y2DA 1FL6B 3QEUB 1AR1D 5CWSA 5IMOB 4PBXA 2RFXA 1U3HC 1AJ7L 1I7TB 4QRUA 1A9EB 4MNQA 3VXUB 4C57C 1WBXB 4PRPA 5EOTA 5AUMA 4MD4A 3U0PB 4OV5A 2VR5A 1JGLH 5I1LA 2WQRA 3IS1X 1BQLL 5HGHB 4PRDB 1KT2A 1TMCA 3RNQA 1F3DH 2YUZA 5IQ9A 1S8DA 4FN0A 2YKLL 5KN5A 2MQ0A 3RWCA 1QSEA 3FT3A 5IEHA 5CCKH 2DQFB 1MQKH 3ZYJA 1VGEH 1BAFH 3ZLQC 4LIQL 2KPNA 4PJHE 2P5EB 1RJYB 4AH2A 4CN1A 5ALCL 3S36X 5J12C 3G08A 4WUUB 3F7VA 3STZB 4FOMA 2JF1A 4NJAH 3TPUE 4LL9A 1RURL 4KJQD 2AJYL 2LTQC 4OZHF 3TZVD 5IIEA 2R0KL 4UUJA 3OR7A 3MRHA 3C5JB 1EERB 5D8JH 4M48L 2VL4A 3EYOB 4FQHB 4G6AD 3M45A 3OAUL 2GYSA 4PJ8C 5D1XD 5CIPH 4I3RH 1LEGB 4KPHH 3EDJA 3NCEB 3D25A 2YBRB 3BQUC 1FN4A 4JY6A 1JHTA 3TP4A 3BJ91 4YDIL 1KCUL 4JFQB 3MV9E 5I8CA 5JIPA 1NEUA 3TESA 4LLVA 3QUMB 3D2UD 4OQ1A 5INCB 4M03A 3WSQL 2NXYD 1PLGH 5D72H 3BPOB 1X5AA 3HMXA 1RIHL 5AG9A 2NZ9C 2BSED 3P9MB 2A9ML 2GSGA 5JOFB 5EU6A 5HHPA 1LP9E 3O8XD 2P47B 5FUOL 3HZYA 3DUUB 3MNVB 4HS6B 4BUHA 4NQVB 5IJVA 2X4PB 4KMTL 2AJ3A 3K74B 4NKOB 4C83B 4PP2B 3OB0H 1EFXD 3I3DA 3MRPA 5T3ZE 4WWKA 4L3CA 5TDNB 3LN4A 5C6TL 4D9QD 3TO4A 1K5NA 4G80B 1YEIL 5F97E 3N85L 5E24E 1AO7B 4L4VE 2DDQH 5D1XC 3L7FB 4W70A 1VEMA 5DSCA 4BQCA 3ZSSA 3I6GA 2WLZA 3OBAA 3QNXB 1IGJB 4PR5B 5D7LB 1PEWA 4RA0C 3LY6A 4AIZB 3PL6C 5TQ2L 2K9UA 4I9WE 1J8HB 5JZ7C 2I24N 3LIZL 5IF0A 4U7SA 4EBQH 2AGJH 2QKIB 4Z5RB 2VOTA 5DJXA 3P77B 3QQ3A 2CIKB 3LKRA 2X4SA 1G1YA 4LSRL 3K81A 2ZOKA 4M5YH 3T0VA 4XPAL 1I3RA 3BEVB 1PFCA 2OJEB 4F58H 4YX2L 1KUMA 5GZOC 4LPTA 3UBXI 2E9IA 1NMBH 4YHYB 1NJ9A 3L6FB 3MR9B 1QBAA 2V7NA 1CICA 5F1IA 1UJ3B 1T4KA 1NLBL 3DSFL 2CKBH 2D7OA 4NWTL 3WBDA 1SY6L 4Z0BH 5EA0L 5J13B 1CXEA 3IDMA 1SYVB 1AKJB 5EO1B 3VWJC 4JFFD 2IPKA 4BSJA 2Y7QB 3Q3GB 4NJ9L 5DUPH 4N8VB 2EDJA 4U1SB 1BD2D 4NUGH 2JJWA 3HUJE 5DJDB 3DO7A 4U1MB 3OPZH 2RB8A 3FHQA 2Q86A 3HB3C 3PHSA 2CGRL 2ERJB 4ZUSB 2CO7B 1MIEH 3MV9D 1QACA 1MCKA 1U91B 1JN6B 2Z92A 2ICWI 2B39A 4JEGB 3DGCR 3L3DB 1B4JL 2XZCL 3QZWG 1QLFA 4LDLB 3MRDB 1ORSA 4GBXB 4PJ7A 3ZE2E 2V7HB 5CD3B 1HQ4B 2A0LD 4LLWA 3OL2A 1F11A 1FFQA 1LE5B 2NNAB 1DFBH 3EZ8A 4LASH 4F9PC 5J1TC 1HHJB 4I0KA 3V6FB 4XGZB 1LK3H 3EZJB 1YDPA 3KPRA 4FQCH 3MJ8A 5MHSE 1S5HA 5C0EA 2VUYA 1KTDA 4MLSA 3TVMB 4NZJA 4BFIA 5T3ZD 4AIOA 5LXGL 1PSKL 1I7RB 1YECH 5F7FA 2YD1A 2IPTL 2UZIH 1NUNB 5IW6A 2YC1A 1WAAE 4LCYB 3L5IA 4PLKD 3UPAA 4L4VD 3U7YL 3O9WA 4C54A 4QHLB 1T03H 3SKNB 5E99H 3PDDA 3TT1H 4S1DC 4BUGA 3LPWA 4LPCA 3UTZA 2Y07H 2AJZB 4ZS6D 5FGBA 2NZIA 1T21A 5I1GL 3T8XA 3LKSA 4WW2C 4GXUN 4NN7C 3MXVH 4MS8C 4O2EA 5E2VL 3WYRA 1DLFL 4TYUA 3F7PC 4GMSL 4N0CC 4XXCA 1CVSC 3V2AR 2FR4B 4Z8FH 1P2CB 3WJJA 5F44A 1H3XA 1IGYB 2WWMD 3MX0A 5D2NE 3QPXH 4L3ED 4XWGH 1T04A 2R0LL 4RCAA 1YEGL 1F42A 4LLMB 3V7MA 3H9ZA 4I3SH 4OLZH 1KLGA 4XVSL 3ULSA 2CPCA 4U0RC 3DMMB 5EIQA 3D5OF 2BOCA 4HFUH 4MXWL 4UT9L 1OLZA 3HR6A 4CVXB 3KPOA 3B43A 2V2WA 1IFHL 3JWOH 5LQBH 3QUXC 2VQ1B 1R5VA 3BPCA 3WIHL 3BH9A 3QEGH 3TNMB 3FT2B 2EDKA 1F5WA 5TF0A 12E8H 2D9CA 2CLVA 3UTTE 3MBEB 2CMRL 5JHDA 4PLKC 1MAML 1ZTXL 1PJ9A 4U3XA 2AEQH 4KK8D 4YC2B 1N0XL 5GGVL 1U8LB 4PD4K 3TA3D 2PCPB 4J7RA 3T2QA 1KCKA 1Z6JT 4Y88A 4KAQH 4ZS6C 1FSKB 5DJ8B 1J0HA 1MCPL 4WHYH 3TYGH 2H6PA 4K2UL 2A73A 5C08E 1GGCH 4X6DE 1VCAA 4M7KH 2VO5A 3P0YL 1B4RA 1OGAE 1NDGB 5I1DA 1KNOA 4OM1H 1HXMA 4ZFZB 4B0MM 2QQNL 4RSVA 3LDBC 1TJGL 4J4PA 4LNVA 1U6AH 4XP9H 1UGNA 4M8QA 3B9KA 1B90A 5DRWA 1S9KC 3UTQB 3V0VA 1UWEL 3DGGA 2CQVA 3GI8H 2YUWA 5IGXL 2B1AH 2FBJL 2BNRE 4IRJA 5IJKA 5E5UB 1MCWW 1SJEA 4P3WA 5BXFB 1ZXQA 3QULB 3VD7A 1J0IA 4JFHE 5C0ND 3OXRB 1EEYB 2F54B 5FGCE 2A6JA 1TCRB 35C8H 1YEDA 3IJYA 1OAYL 5F3BB 4P3DB 1FRGL 5DMIH 1GGTA 4TUOB 2NTFB 3CLEH 2DOCA 4X4YA 1FBIH 3TA3C 1HIML 5BZDB 2X4TA 5E2WL 4NRZB 1QSEE 3PGCB 2MSPA 2E7CA 2WBJC 3X17A 3BRDA 4U6VL 3MYJB 2E7MA 3D3VA 4OLUH 2VKWA 2C3WA 1ZK9A 3C6LD 4ERSH 4PJCA 3ZYZA 5DI8A 5E1AA 1XF4A 4YXHL 3HNVH 3DRTB 3L1OL 5IB4A 1QSFA 5TE4H 3BN9C 2BRRL 3AC0A 5LG1A 5IQ7H 4FXKA 7CGTA 2JJVA 1DQQB 4PJHF 3D0LA 1YNTA 3CPLB 4HHAA 3R8BB 3STLB 4DTGL 5I1AB 2DBLH 5B3JE 3O6KL 4HXBH 4G6ML 4PJ5A 2GJJA 2OR7A 1QLRB 4AMKL 5I73B 4M93C 5DHYB 2VLRA 3M1BB 4PLJD 4PBVC 2EH8H 3MLPA 3WKML 3GSWB 4V1DA 4IOFD 2ZUTA 4DUVA 3KPMB 4YDLC 4GAFB 3MMEB 3MCLL 4XHQA 2K7QA 4TUKL 5C0IA 2EYTA 4EDXB 1ZSDA 2NR6D 5IFHH 3DLQR 4ONHB 5IR1A 2XACC 4Z7VF 1JNHA 4TSBL 3ILPA 4PY7A 5T1KB 5JUEH 4F7EA 1CFNA 3HZKA 4I13B 3PP4H 1PYWB 3C6LC 2ZG2A 4MA1C 1BZ7A 1UYWL 3PWPB 2HT4D 3GM8A 3H3PL 3HTLX 5D2NC 1UXSB 2O5ZH 3ARFB 5DEGA 4EOWL 3P9LA 4P9MH 1NMAH 5C2BL 2XKNA 4NZRH 1DUZB 1UWXH 3CFKA 4KROD 3MJ7A 1EPFA 1IQWL 1DBKH 1HNFA 5D70L 5ANMB 2FJGB 1G7QA 2EDRA 4IEFB 3OKMA 4MA7H 4Y1AE 1S7XA 1OPGH 5ESVB 3ROOB 3PV6A 4BJLA 4MNQD 5TGBA 5EU3A 3GSXA 4HDIB 3SBWA 3SKOA 3QA3B 3VFMB 3ZE0E 3BZFB 4JFHD 4BK5A 4WENB 2HVJA 3FJTA 4K8RL 3ARDA 2HFGH 3GBNL 1IEAA 1ZV5A 2QHRH 1L7IL 1TENA 3MGTA 1QSZA 4OIIL 5CEZL 1K8IA 3FQUA 1EEZB 5C7XL 2N1KA 4GS7B 4XNUL 4DKAA 2EXWC 3ZKMD 4XCFH 1TVBB 1QA9B 4H25A 5IVXA 5DK0B 4MAUL 1QSED 2YPKB 5F7KC 4ZO9A 1NH6A 4X6CB 2XWTB 5EC2B 3MOBH 3DARA 3HRZA 4L9LC 3VGEA 4F7MA 2KQNA 2JCCB 3T0EE 2ATPA 5CBEB 2H32H 4YLQT 4YFLF 1FAIH 3HKFA 5KSAB 3A6CH 5IB1A 4IRSA 1WBYB 5E00A 2DM7A 3FB8A 5FYJU 3OR6A 3KPSA 2H1PL 4HKBA 5DJYA 3GMRA 4U1HA 4AEIL 4ZS7H 1BP3B 4WFHE 5KS9E 3F8UB 3DXAB 3NA9L 4LNRB 5JW4M 4KJYB 1EGJH 3IDNA 2O61A 4XZUB 3S3PA 1GZPA 1F97A 4FQJL 4JPIA 1KLFA 1JV5A 5ICZB 1OVZA 2NPLX 4PRAB 1FH5L 4DVBB 3CSPA 4Z7OE 3RZWA 2AXGA 3JWOC 3SKMA 3IAGC 2H26A 4Y4FA 1IAIH 3DTXA 3KPNA 5EBLA 5EC1A 4Y5YC 3HFML 5EUKB 3ZKMC 1CLYH 3D9AH 1KC5H 1KJVB 4A6YA 1VADB 2YD6A 4HT1L 4PBWD 2WY3A 32C2B 3LZFH 1DSFH 3LEVL 1U8NA 4EJ1C 5GGTL 3ZE2F 4R0LB 1BVKB 4ENEC 5AEAA 1QFOA 2AXJA 5IM7A 2AK4E 4Q0XH 5M94B 2BMKA 5F72S 1MRDL 4WWKD 4D9LH 4LDOB 4YIQA 5E8NB 5HGAA 3TO4D 2ZUUA 1XIWC 4GKZB 4Y1AD 5D9SB 5HVHC 4Z7UA 3H9HA 4NP4H 2DMCA 1H3TA 3HCVB 1S3KH 3P30H 3RHWF 3C6SA 3QCTL 2IAMA 5T5FL 3QJHA 1WC7A 1N64H 3KHQA 4XVUD 1DL7H 4FQLH 1QSVA 1RIVL 2VC2L 4TPRH 3ZHKA 5FO8A 5CSZA 2W65B 4ZAKC 3HN3A 1HI6B 3W5MA 4GXVH 1MJUL 5BMFH 1A1NA 1EXUA 3RWGB 5MENA 2NX5B 3S35X 4ODVH 1YQVH 3T65B 4OI9A 4Z0XA 1IBGL 4HZAA 4XCNB 3T0BA 3QDJA 1ORQA 4OT1H 3QAZC 1BQHB 3UDWC 2MHAA 1W0YT 4G8EA 4XRCB 1UB6B 2D3VA 1A14L 1CU4H 3VXQA 1BLNB 2LVCA 3QIUD 1CDBA 5JOEA 2FIRT 2VIRA 4W68A 5DHVA 3LKQB 3R06A 3DV4A 1I1AC 2ADJB 1PEZA 2ZZUT 5JR1H 5J1AB 2GY7B 3PG2A 4KJPC 4ZXBA 4OAWB 3CLFL 4UU9B 1UQSA 1DUYA 3E8UH 5JIHA 1TVDA 4U6XB 1CICD 4F15C 5FKPA 3K1DA 3QDME 3RU8H 3E2HC 2HT3C 5GGRB 2Q3AA 2VITB 1S7SA 3UZQA 4OB5L 4KKLC 1RZ7H 1UT9A 3WLWD 3MRQB 2AS5M 1CG9B 5HVFB 1VPOL 4UILL 5CP7B 2APBA 5D7IF 4NWUL 3NAAH 5LGHH 1DN0B 1BBDH 2UYLB 1E6OH 3FOLA 5EO0B 4X83A 3SN6N 3CXDH 3BEWA 5CJXA 4Y4KA 4IJ3B 3P4OA 4M6OH 2W0KA 3GSOA 4NQDA 4DW2H 1R0AL 1I75A 3MRRB 3RJDA 5DD3H 4AYFA 1AGBA 4K94H 4JRXE 5FM5M 4K55A 1NKOA 5D7JD 3QIUC 4OCXL 2A74A 2VE6A 1IZKA 2O5YL 4GH7B 2DMKA 4M9PA 1MREH 3UYOD 3VFUB 4RZCB 1BOGA 4CW1B 4S0TD 4X6DF 2QTEA 4GJTB 3CMOH 2B0SL 3E6FA 2G75B 5D93C 4WI8A 3KPRD 4DGIL 1ACYL 4WUKH 5DK3A 3VCLB 4NKIH 5C6PB 2BVQB 3T0EC 1R3KA 2RJMA 4P5TA 5GRUH 3JTCA 2PNDA 4OCNC 5AYQA 3C09B 4MCZB 1IAIM 5GHWL 3DBXB 4HCRH 4OLVH 4XP1H 4XMKH 3JTSB 1U93A 3X13A 1XF3B 2VDKH 5GS2H 1JK8B 5E8PB 3O9WD 1QNZH 4OCSH 3MRJB 1I85A 3ULUC 2XQBL 3HC4L 2ARJB 5IESH 1AHWA 4OLEA 4LKXB 2GW5A 4MNGE 5DGQA 4Z77B 2YPVL 3HA0A 4HWZB 3FFCB 5HGBA 3VMNA 3SDAD 1N59A 4QRRE 1KELL 4FZEL 5IHZA 3BXNB 2X10A 5EOCL 3NFNA 5TDOB 3CDCA 3KLAA 3U0WL 4LVOC 3MLUL 3F6LA 5J6HA 4KUZL 1MJ8L 1MCFA 1KB9J 1I4FA 5D7JC 4LCWA 3IKCB 3RTQD 3G6DL 3QI9B 1AI1H 1PKOA 1CE6A 2AQ3A 3U6RA 3RPIB 1RQ5A 3MRLA 4GG8B 3SQOH 4F7PA 4JFYB 3C9NA 4U1GB 4LLAA 4P46C 1XT5A 4X99B 3DX7B 5LCVL 4H0HB 1WUNT 1I8LC 3WO3B 4Y5XC 1CN4A 4XPBL 5HHXH 5SX5K 4PJBE 5FM5O 2NY0B 4JO1L 1GGUA 5FDYA 3RKPA 3PWJB 1Q9KB 5JHDD 1H5BB 1TJHL 3L3GB 1RZIA 5ID0B 5I1HL 4CL7A 5IW1B 2PYEE 3S88L 1CD8A 4NRXA 1NC2B 2HRPL 4Z7QF 1T22B 4JLRB 5HD8C 5I16B 2ZJSH 1DQDL 3SDAC 3IJHB 5DMKB 2FSEB 3MRFA 1QBLL 5E8OB 1LDPL 3LPFA 1ZGLB 4YBLC 4Q6YA 4PRBB 3LKNA 2PW1B 2DTML 1QRNA 4QT5B 4OLXL 4J4PD 1ZLWK 4CMMB 5DMGD 2VXSH 3RTQC 3B9KD 3AY4A 4N1EA 1T2QL 1P53A 4J6RH 1N3NA 1Y6NR 3OKLA 5DRNA 3O41B 4EN3C 2DTSA 2IJ0C 4IRJD 3O45A 4NHUB 4KC3B 1PKQE 3WFCL 4YAQB 2AJSH 1F45A 5E4IA 3WS6C 1F3RB 1XH3A 2CRIA 5GSVB 4APQB 3B9AA 4U6HA 3OZ9L 2BOBA 1L6ZA 5LAXA 3RNKB 4HUUA 4MAYC 3EGSA 1Q8MA 4FQXB 4KDVA 5JDJA 5IG7A 2YMXL 1VB9A 4C56E 4Y16C 1CK0L 3LKOB 4OLYH 3B8SA 3HLAA 5TFSH 1T1XB 5GJSH 3ZE0F 4FTVE 2R0ZL 4XPGH 5HHME 2VZTA 3MV8A 5A3ID 1A9BB 3Q5OA 5DZLA 1V7ML 3O3DB 1HDMA 4BA8A 5L0QB 2C7UB 3R0MA 5HJ3A 5HHVL 4M6NL 4PV8A 4QRRD 4GAGL 1JHLL 3BAEL 4FXLA 4JM2A 2W91A 1DQMH 3SO3B 4S0UC 3BOVA 4ODHH 1NFDE 3CSYB 5H35B 2OMBA 2ATKA 4R7DA 2NY6C 2DQDL 3FO9B 3MRNB 4MB5A 1H9VA 3VFPB 1QSFD 1NQBA 2I9LA 5ICXA 4RMSA 1B2WL 1ES0B 4G9DA 4NQXB 4O9HL 5DC4B 4XI5C 2YUVA 3PP3H 5CGMA 1MWAA 4WHCA 4CDGC 3QQ4B 4QLRA 3UEZA 1MCDA 4R96B 5CP3A 2DQCL 4BKLA 3BPNC 2DWDB 4OGYL 1FFOA 3ECBB 5KTEL 4PJ5D 3ARQA 3MA7A 2RCSL 1AGFA 1H3PL 1OTUC 2HMID 3EO9L 2PN5A 1BVZA 2R1WA 3EAKA 2VLRD 1OAUL 4WWID 5J12B 5BZWA 3VXPB 1RULH 4HAGA 4WCYL 4V1DD 4WV1A 4WY7H 3RWDB 4RWHA 4XP6H 3VFNB 2LTQB 5BW7A 3D69B 5ESAB 2MPAH 5K9KB 2FB4H 4UDTA 1F8TL 1LO4H 5A3IC 4JHAH 4NPYB 4PJ8B 4ETQA 3R1GH 3CIQA 1OSPL 3W0WE 1HILB 1TTFA 3MUHL 4PJDB 4JE4B 4N8CL 3BQUB 3B2VH 4MMZC 5D4QA 1D5ZA 4OD1H 1BGXL 3HZMB 4GSDH 4OZIA 2ZUSA 1G6RH 3NBNA 3IU4L 5FM4A 3T4YA 2VABA 4HJGB 4ZUUA 1VESA 3MREA 5L2JB 3U2SB 1F3DJ 4QHKI 1MCWM 1IAMA 3WN5A 4F8QA 3HC0A 3GSVB 2EC8A 3MLSL 3GHEL 1OP5K 2DD8L 5FOBB 2GJZA 1J10A 1HH6A 4I18C 3ORJA 4JFOB 1JPSH 3M17A 4OJFL 4K94C 1EO8H 4YHKL 3QIBD 4LHJB 5IVNA 4LLUA 2P24A 3BKMH 4Z95H 1F3JA 2GQHA 1XGQA 3LS4H 4E9LA 1CQYA 4NT6B 4RGNE 3MJ9H 2W0LA 2CDFA 3ARDD 4S0SD 5F93C 2EZ0C 1I8KB 4C56D 1T7YA 4JFEE 1LO3L 4KQ3H 3G04A 2JIXB 1K4CB 3IF1A 5HHOB 2Y25A 2R23B 5HHMD 4XTRC 4OZGB 1E4KC 4OZ4A 1D9KA 4O00A 3GIVB 2IQ9L 3V6OC 3WL9A 2FGZA 1U58B 1RFDH 4JPVL 1YPZB 4G9FE 4P2QE 3WD5H 1K4DB 4F8TA 5E03A 4JDZB 4HIHA 4I2XE 3N1MC 3VDBA 3PL6B 1NDMB 2PKDA 1CDUA 3QEQB 4Q2ZB 1A6UH 5DDHB 4IRSD 4YFEA 3MLVH 4YHNA 4XCCL 5ADOL 5TPWH 1IRAY 5DJ6A 2R1XA 3KPSD 1KBGL 2F9BT 4XAWL 3FO0L 2DQEL 5C0BA 1FLRH 1Q38A 3AS0A 4WGWB 1OAZH 2EE2A 1OSZB 1MF2H 5L9DH 2QQLL 2VZ3A 3CSGA 2DLIA 3KLDA 4EDWH 3OG6B 3VXTA 3DVGB 1LD9A 1N8ZB 1DVFC 5C0FB 3AXLA 3IDYC 1RZKL 4M43L 1V7NL 4FA8A 4LSVL 9CGTA 1GXEA 3LRSA 5FK9B 2P1YA 1UZ6F 3P73A 1UKSA 4LAQH 3DV6B 5EPMB 2IQAA 3VWJB 4ISVA 2G2RB 1HEZB 5TF1H 4DK6A 2J8UE 3MO1A 1E4WH 4RGOH 1FIGL 3FB6A 3QRGL 5INDB 1MCOH 4HBCH 1C5DB 1MJJB 3W9EA 4KVCH 1UH4A 3QG6B 3WXVH 1L0XA 2AEWA 1FCCA 2RIKA 4EKXA 1TJIH 3VI3E 2IANA 1OW0C 2M1KA 3BKYL 1RIUL 3IAQA 3GSUB 3P2TA 4POYA 2LQRA 3CCHA 1D7FA 2CLRA 2IAMD 4G5ZH 4ZTPH 2AP2A 4DCQB 2VDNL 4KGJA 3C8KB 5GIRB 5E6IA 5HHQB 1FFPA 5HXMA 5FHAL 4YWGH 3MRCA 5BVJA 5MEND 3MNWB 3QDGA 2P43B 3EHBD 2C4FT 3MZTA 4YE4H 5C6WH 1JBJA 3QDJD 1Q1JL 3CD4A 4OFDA 5F8RC 2B4CH 1CZ8L 3KYMA 1Z9OA 4GAJL 1YYLH 3MA9H 5E2UL 1Z5LB 3BVNA 2XWBB 1DBAL 1W72A 3KR3H 5KZCB 3L3KA 1S9YB 1C5BL 4ZNEE 1RZJL 1I7UB 4M1CD 3VWKC 4ZXBD 4X7SH 2PXYA 4YEFA 1T7XA 1XGYL 5ERWB 3MRKB 2XPGB 4KKCD 3X14B 1DBML 3CAFA 4NN7B 4WW2B 5C0RH 5MEPA 3FQXB 3GK8H 4L8DB 2CLZB 2OZ4L 4UQ3B 1SJHA 5D2LE 1T3FA 1K8DA 4RRPA 4GXUM 5KAQG 4HKXB 2OR9L 1I1FB 1QR1B 4BFGA 4I0PB 1LK2A 1JMZA 1WISA 2FHCA 2JB6B 4D8PA 3GSQB 1G1CA 1JNNL 1JNLL 1LP9B 3C08L 4O02L 3V4PH 4U1JB 4KTDL 3GJEB 1INEL 4FFZH 4HGWB 3MXWH 4MB3A 5I9QC 43CAA 4S1RL 2GK2A 5C09A 2P8PA 4RGNC 5I1IH 1S78D 4QRPB 2W9EH 3CK0L 3H7BB 4I3GA 1A6ZA 4Y4KD 1DANT 3QUXB 4MX7A 5KSBA 1I3GH 1QQDB 2Y9RT 3GSNB 2BNQA 4X6FB 3WFDL 3EDEA 5K59E 4TNWK 4PGJA 4NQDD 4NHCH 1JZ4A 2UWEA 4HJJL 2Z35B 1IAOA 3GHBL 2NQCA 3T2NH 1IEBA 3G6AA 1QFUH 5EBMB 4X80H 2IALA 5DD1L 3AREA 5FYLL 4YBQD 5F71A 5JO5B 4HEME 4LSQH 4ZPVB 4B7IA 3JXAA 3T1FA 2Q7NA 3PNWA 3TBTA 3HE7B 5JQ6H 2ZSWB 4MXVE 4KKCC 1CFVH 4P5TD 2J4WH 2IGFL 1D3CA 3OGCA 2X42A 2AVGA 4XWOC 1Q9OB 4CGTA 1JTOA 1S7WB 4ONGL 1KJ2A 1GGBL 4HLJA 5E9DE 5AWNL 3LDBB 2D03L 3MLXH 3GMPA 2DIBA 2FX7L 1FL6A 2RR3A 3QEUA 4OCWL 2PTTB 3LEXA 1T20B 3HE6C 5IP4A 5IMOA 4HSQA 4ZQKB 1OWWA 2ITDB 1A9EA 3WIFB 5J8OA 3VFSA 1WBXA 2DM2A 4UBDD 4YHMH 4XC1H 5FYKU 3GEWB 4GAYB 1CE1H 3VXRB 5E94B 3NCJH 5IVXF 1NAML 3QEHB 2UY6A 1RU9H 5F9JA 5ID1B 5HGHA 2EXYC 4PRDA 4HS8H 3RDTC 4LCWD 1A7QL 1UM5H 1N26A 3IDJB 3FFDB 4OTXL 3HUJB 1CR9L 1NFDF 4WDIB 1GVIA 1PG7W 3QNZB 1F00I 2Q8AH 2WBJB 2X4OB 3B9VA 5BJTB 1UWGL 3UTSE 4R4BB 3O6LL 2P5EA 1RJYA 4EI5C 2P5WE 4S10A 5SV4A 4WUUA 3STZA 3QB7C 1MCQA 4H5SB 5HGGS 4OSUH 4FQPA 1WIPA 2YD2A 3H9YA 3TN0C 1KN2H 5JHLH 1C1EL 3MLWH 1N5AA 3IYLW 3UC0H 5I1KH 2BVPB 3EYOA 4FQHA 2VDPL 1NUGA 5ILTH 1LEGA 1T0NB 2DIJA 3QQ9D 4M93B 3MNZA 4ZUVA 2YBRA 5IW3A 4RAVA 1YJDL 3E3QA 1CGSL 1JPTH 2UVFA 4JFQA 4LOUD 5GS0H 4YDLB 2BVOB 2JB5H 3QUMA 1QRND 3OGOE 3RAJH 2CKBB 4PB0L 4JY5H 5GJTH 3VXOB 3J7HA 1OAXL 2VH5L 3FOMB 4F37F 1P4BL 2VDQL 1BOYA 1IILE 3I85A 5H37G 2WWKT 5JOFA 3JSSA 3UJJH 3Q2CA 3OF6A 2R69H 3HMWH 4Y4HC 4K3JH 3DUUA 4K9EL 4HS6A 2Z31D 4KHTL 4NQVA 5D7SH 3JV4B 2X4PA 4MA1B 5E4EB 2VLKE 4FXGB 4NKOA 4C83A 4PP2A 1FL5B 2Z0BA 5D2NB 3C8DA 4LQFL 1VGKB 4ALAL 4M6ML 1KTRL 1I3UA 5TDNA 3O0RL 5E1HB 3MV8D 4G80A 2VXTH 2XY2A 5I6XC 1CL7H 5BOPA 1WVZA 4NGHL 4CJ1A 1RMFL 2VLLA 3L7FA 1U2CA 2J7LA 4JM2D 5KOMC 5D5ME 2FX9H 3QNXA 2CXGA 1IGJA 4NO2B 5D7LA 3UTTB 4LOUC 2WQ8A 4JQVA 4UIKL 2E8ZA 1J8HA 2I26N 1MRFH 4LSUL 3UZEA 2DQUL 3RPKA 4F9LC 4QRTB 2B4CC 2QKIA 4Z5RA 3P77A 4ZUWA 4PG9B 2YPLE 4MQXC 3GJFH 5C1MB 4L9LB 3UTSD 5C08B 2CK0H 3JVGC 3AROA 3BEVA 3GRWL 1OGTB 3MLRL 4PG2A 3U0TA 2IMMA 5BV7L 4YHLL 1OGAB 3BP4B 3L6FA 4AY0A 3MR9A 5TE7H 1U42A 5IFAL 3NA4A 3VI4E 1X5IA 3PGDB 4RISH 4R4NC 2Q87A 1P9MC 1SYVA 3EUUA 1AKJA 5EO1A 2NLJB 4KI5E 4RDQG 1WGOA 3KNBB 3Q3GA 5FECB 4PJIE 2BNRB 3GDBA 4JN2B 4N8VA 2ZCHL 5T33H 4MSWA 1WZMA 5DJDA 3QWRA 4U1MA 1MFDL 4ZUSA 4JZNB 5T3XH 2CR3A 3BSZH 1U91A 2J8UF 4M7ZB 4EQ2A 4LARH 1NCTA 5JOPE 1TVHB 3L3DA 4GW1A 1ETZB 1FE8H 3MRDA 1UZ8B 4N1CA 4Y5YB 4GBXA 2IANE 2Q3ZA 2QSCL 2CIIB 3Q6FB 1KACB 5HDQH 1CDCA 5CD3A 2A1WH 5BRZE 1EUUA 1P6AB 4XNQB 2CK2A 1UFUA 2NNAA 4GLRH 3PWLA 1U9KA 3QG7L 2VWEE 3IJSB 1HHJA 4NFBA 3V6FA 1RUPL 4J3WA 5T1DL 3TJHD 5KJRL 4RFOL 5C3LD 1TNNA 2FZ3B 5DK2B 3QDGE 1WT5C 1I7RA 1XIWB 4P2OA 4RMVA 5HVHB 5IMMA 3L7EA 1D9KD 3QPQD 3FT4B 2HWZH 4PRIA 4YXLL 4QHLA 3TCLB 4RFNC 4W6XB 3VFVB 2W0FA 3H0TB 4KVNH 1SJXA 1WFOA 2AJZA 1PD6A 4ZAKB 3VMOA 5L8LB 1EJOH 1GGYA 1M05B 2XOTA 2XQYG 4R8WL 1ND0B 4LHUB 4FABL 1GHFH 1TZHB 3U36B 4PLOB 2DMBA 3TWCH 3QAZB 1AC6A 2FR4A 1II4E 4DFIA 3LB6C 2G9HB 2BZDA 1IGYA 4KK6C 5T3XE 5GS0D 3SKJH 1NSNL 1DEDA 1I9JH 4LLMA 1PX3A 3X3FH 4WRLA 3HS0B 3DMMA 1I1AB 3NACH 2V5SA 2UV3A 3BMWA 2H2PD 4R26H 2M2DA 1IL1B 2EC9T 4NNXB 3D85B 4P3CH 4JN1H 4H20L 4Y19A 5B22A 3V4VH 2XIDA 4IS6B 2CJUH 2VQ1A 4Z9KB 4YFDB 4X4ZA 5BOZG 4JGMA 5EZLB 3TNMA 5I0DA 3FT2A 1JF1B 3E2HB 5A2JH 3O2VL 1YC7A 5CJOH 1GH7A 4N90D 3C2SA 3SDCC 5DD5L 1LILA 5CKAA 1Y6KR 4OM0L 4LSSH 3QIWC 4LCCA 1MRCH 2PCPA 3OSKA 5IWLC 2OL3H 4AK1A 1IE5A 1MNUL 4OZFB 6FABH 4K8RD 5JOPD 2OI9C 1EZVY 4DAGL 4NBZB 4DGVH 4QHUB 2A6IB 1JFQL 1SQ2N 2IAND 3X12A 4X5XB 3MODL 1LVEA 1T89A 2OXGA 4PJXE 4CJ0A 5IEKB 1P4IH 5BRZD 5HGDA 4YK4C 5GS0C 1QBBA 1NDGA 3QBTB 5F7WC 4MXVF 4ZFZA 4YNYB 2NY2B 3BGFC 1M7DA 1JGUL 1CDHA 3ARPA 5A2FA 4LGPB 5D93B 3MPCA 3UTQA 5EUOA 5E6ID 3QJFB 4G7VL 2ENSA 3T0EB 3VXUE 4HMDA 3GNML 3QDGD 5BXFA 1DTUA 2B2XL 3QULA 1M7XA 5F96H 3F58L 1CGYA 3ZYIA 2XT1B 3OXRA 4XH2A 1EEYA 2F54A 1IC7H 2F58L 2XWJB 1TCRA 5KS9B 4JDVA 4KI5C 4WO4B 4YPGB 5LWYH 1F4XL 3O3AB 1JTTA 5F3BA 4P3DA 4HQQH 5TJWK 3LQAL 2IBBA 3PWUB 5I8OH 3KYOB 4JM2F 4TUOA 2NTFA 1CGXA 1JIBA 4H8WL 2DQJH 2IWGA 1PG7X 1ZHBB 3OAZK 1A4KA 1IM3A 3ME0A 1EZVX 5ACMA 1RVFH 3PGCA 4MGXA 1HOCB 3MYJA 3REVB 5D7KD 3RX8A 2ARWA 4TQEL 3RQ3A 3V6ZA 5B39B 1KV3A 4HMCA 4QXGL 4LVOB 4GRLD 1XFPA 1Z3GL 2ZPKH 1CXFA 5JMOC 2GUOB 4LKCB 1DQQA 1CLOH 1TZGH 4NC1E 3CPLA 2VWEC 4LRNL 4HIIB 1TDQA 1LE9A 1FP5A 3STLA 5I1AA 1S7QB 3LEYL 4P46B 2O5XL 2H2SD 5FDWB 1SBSL 3U46B 2AK4B 1QLRA 1YEJL 2V17H 3SOBL 4M7JL 2BNQD 2BY0A 5DHYA 3M1BA 1NL0L 1IGFH 1UH2A 4ZPTB 5T5NF 3TLRA 3UO1H 4X4ME 2MJWA 3GSWA 4DKDC 3SDDC 1CDJA 3KPMA 2H32B 3GBMH 1GPOL 2WUCH 4K7PY 3ARED 1FPTL 2BVUA 3S7GA 1ED3B 2YD3A 7FABL 4HWBH 3U4BL 4ONHA 1BM3L 1NGQH 4NCDA 4OZIF 4ZFFB 2GSIB 1RUMH 5KANG 3BWAB 3M8OH 1C12B 2AJXH 5C9JB 5T1KA 1C08B 2J6EH 4HZLA 1K6QH 1W8OA 3O2DH 4QYOB 1PYWA 3O4LB 3PWPA 2FYYB 3FMGL 1PG7H 4JO4L 4GRLC 4YBLB 1UXSA 3PXJA 5DMJB 4P2RA 5CJBA 2ZG1A 2C9AA 2YA2A 4OCLC 1JPFB 1NCCH 4MD5A 4NDMB 1DUZA 2Q7YB 1GZQA 3H42L 5ANMA 2FJGA 5I1CH 1F4AA 4YFLI 3U9PL 1ZVSA 5HI4D 4LSDA 4EN3B 3HAEB 3T3PE 1SEBB 1AO7E 5ESVA 4MNHB 3VXUD 4HDIA 4NZUH 3VGGA 4DJMA 4P4RB 3VFMA 1CGTA 3QDMB 4WFGE 2OZ4A 3DYOA 4MAYB 3B2UC 5ACZB 1RUAH 4ZOBA 3LH2L 3H9SA 5DGRA 3PQYE 2BDNH 1FO0H 4RIRB 2X4NB 4Y16B 2MOVA 4MVBD 2BVYA 3A6BL 5IROA 3IFOB 3O3EB 4N0FB 4JFXB 1EEZA 2VZOA 3S34H 5DVNA 3P11H 5L6YL 4Z7NF 1BFVH 5IHUH 2IG2L 3LPGA 1QA9A 5IUSA 1S7RB 5DK0A 2YPKA 1N6QH 3EYUL 4X6CA 5EC2A 1U8HB 1CIUA 1WCBB 2X1PA 5CFHA 3VG9C 3OHXB 1UA6H 2P5ED 2WBKA 3KYNB 3EYFB 4XVJL 2NY6B 4WUUD 4JKPH 3BGMA 4JRXB 3U79A 5KSAA 4LF3B 1ZKAA 1RZGB 3F7QA 2BNUB 5FO7B 4DN3L 3KWWB 5F7LB 3MV7E 4FQ1H 2D0FA 4H0IA 1AFVL 1M1SA 4HBQA 3BPNB 3KPPB 2R29H 5DS8B 2BERA 4BQ6A 3DXAA 4B53A 1F13A 4HPYH 2XXCB 4AQOA 4MQSB 3FZUD 1G7PB 4KJYA 1BBJB 4XZUA 4MCYB 5FO9B 1A7RL 3P4NB 1WSST 5JPMB 4EVNA 1I9EA 5CILH 1FYTE 4XX1G 2E7BA 2KBGA 4DVBA 1JGLL 2DJ4A 4MVBC 3V5KA 1X5FA 5I18L 3ZL4H 1YMME 3FAWA 2V5RA 1BZQK 2DICA 4LCIH 1OL0A 1V3MA 4MNGB 5EUKA 5EIVA 1UCBH 4HUVB 2EYRA 1KJVA 1HINH 4FQIH 32C2A 4I77H 5EBWB 1QPXA 4Z76B 4E42B 4AEHH 5KSVB 2FATH 1OTTD 1ZEAL 4PREB 4R0LA 1OTSC 3DNKA 2Z91A 4EEEA 2YK1H 5T3ZL 3SDYL 3U7AA 3V52L 3PE9A 4K7FB 5F7NC 5E95B 4WNQB 3VJ6B 1T1ZB 4I18B 1IQDB 1BWWA 2VLME 5D9SA 5DYOB 1KJMB 1FJ1B 1AO7D 1KEML 3ZTJG 3K3QA 4OQTA 3HCVA 3RGVB 4I3RL 1JJUA 2VLJA 3PHQA 4JO3L 1C5CH 3KPLB 4PJBB 1HI6A 3KDMB 5F3HB 5D7LD 1DQLH 4I48A 3WMSA 2WMPA 1TCMA 3RWGA 4JVUA 1BIIA 1F58H 2NX5A 4ZOEA 2J88L 4BH7B 1QG3A 1J8HD 4CADB 1XZ0B 1QFWI 3W39A 4XCNA 3N9GL 3RIFK 1BQHA 3TPKA 5DFTA 1UB6A 3RZCA 3BPOC 4CVUA 4NNPH 3U4EA 3ZKSD 4PS4L 2PYEB 4ODTH 5D72L 2Q76B 3GMQB 3LKQA 2R2EB 3JUZA 3LVEA 4MXQA 2ADJA 2EE9A 3CX2A 5J1AA 4JJ5B 2PYFB 4OAWA 4UU9A 2BC4A 1J05B 3BT2L 4UV4H 2JJSC 5HYFA 5F7EH 5EOQL 4XPTH 3QWOB 4U6XA 3IDIB 3I9GL 1T5WB 4AZ8A 4BZ1H 1JYWA 4NZTH 1U8MB 2F5BH 4OBRA 1AKJD 1B3JA 2VITA 1V5JA 2R9HC 4JG0L 1HYSD 5KSBF 5I30L 1CG9A 1H3UA 1PKQB 2B1HL 5CP7A 1AJ7H 3QWRD 1G7JA 2UWEF 2UYLA 3VE0B 3ARBC 3D0VB 5J9PA 3JWNC 1DVFB 3UJTL 1S7TA 3IDYB 3K2UH 1BQLH 3TBWB 4FTVB 2NY5H 5FYJD 3MRRA 4GBXD 4L1HA 1G7MB 4RQQB 2EDDA 3ESVF 4EBQL 2YKLH 2HYMA 1G6VK 2AGJL 3PIQB 1LEIB 1CL7I 4CN6A 3VFUA 4RZCA 4CW1A 2R8SH 1PZ5B 2G75A 5M95B 1HK6A 3RVVD 4LIQH 3KXFB 4Z18A 3QH3B 1I9IL 2BVQA 5ALCH 3TVMD 2G5BA 3DI3B 1RUKH 1RK1B 4X8JB 5CHNB 3OX8B 1RURH 4MCZA 5J06A 1TTUA 1NMBL 3DBXA 3BESR 2R0KH 5LBSL 3JTSA 1XF3A 3MROB 1PVHA 1JK8A 5E8PA 3RVTD 1CGWA 2D7TL 3OJDB 3MRJA 5DJ2B 3T3ME 4EQ3A 2ARJA 2ENYA 5SWSE 3FRPA 4W6WB 4LKXA 1NGPL 4AG4L 3S4SG 4HWZA 1MFCL 1K2DB 1NANH 3R8QA 3OPZL 4QEGA 3GRWA 4XC3L 4KTEH 3IFPB 4YDIH 2HT2C 1KB9K 3VGAC 3S9DB 2OSLB 1VEPA 3WFZA 4JG1H 3WSQH 5E70A 4N8VG 4XNMB 1U8QA 4YHOL 4OKVB 3W0WB 3DMMD 3VWKB 3LKPA 4QHMB 3WUWB 4V3EB 5C07B 5KVGL 1BWMA 4JFYA 5FUOH 1DFBL 1M7IA 5DZNA 5IHLB 4KMTH 1N6VA 4JQXC 5C0JB 1P1ZB 5KW9L 3DX7A 3TVMC 4RMWA 2AEPL 4NN6B 2DKMA 1UM6L 3KPTA 3SE3C 2MFNA 3F7YB 4LIQE 1MAJA 3MBED 3PWJA 1Q9KA 5CSGA 5C6TH 3ISWA 4KZDH 4GRWB 3L3GA 2UZIL 2Y6SD 1YEIH 3N85H 2YEZA 3CVHB 4CU8A 3SE4C 5I9QB 1EHXA 3TBYB 1YY9D 4RGNB 1T03L 4KK9D 1X4YA 4HW6A 1T22A 4JLRA 3T0AA 2VSCA 1JE6A 4ZUTA 5I16A 1MLCB 4JFEB 3G5VA 4KQ4L 5TQ2H 3FQWB 5DMKA 1CXIA 2FSEA 3X11A 1UACL 5E8OA 3LIZH 3LHPH 4PRBA 5IVZB 3WXWH 1FZKB 4QT5A 5L88L 3EKCA 4G9FB 4XWGL 4ESKA 1G9NL 3TFKC 2XNAB 3GIZL 4I2XB 3T2PA 3AGVA 2JJTA 4U49A 4DEPC 2A83A 5IV2B 4WJ5B 1ADQH 4LLYA 4XPAH 5D6DA 4NHUA 2YD5A 3N0PB 4YAQA 5E5MB 2Q8BL 4YX2H 2EE6A 4APQA 3TC9A 5GISL 3CSBA 4LMQE 3JWOL 4JFPB 1G6RB 4FQXA 2F54D 2D7QA 3DSFH 4LRIC 4NWTH 1WF5A 3ILQD 3VG0L 3MBEC 4NZDA 1SY6H 2YXFA 3LKOA 4D0BB 1OCWH 5EA0H 1T1XA 2DBJA 3IAPA 2COQA 3MUGB 4TSCH 4LEXL 3TEUA 4YC2C 4NJ9H 1A9BA 3HE6B 3QZWB 3BDXA 3ROLB 1U3HA 2AEQL 1EHNA 2C7UA 2X4QB 4LCUB 2ZKHH 4X6CE 3RUGE 2NW2A 5E6YA 3D39B 2CGRH 1QYGL 4RNRA 3FL7A 2G60L 5H35A 5F21B 1MEXL 5I1JH 1B4JH 2XZCH 2FJFB 2JCCE 1DQJB 3FO9A 3MRNA 4GG6E 4NSKB 5DFVC 3RDTB 1JI2A 4PRHE 1ES0A 4NQXA 1CQKA 2AQ2A 4WVRA 3QQ4A 4PJAB 1N5YL 1FVEA 1U8IB 3MFGB 3TBVB 2DWDA 5FCUL 4P4KC 3MTRA 5C86A 3GI8L 4EI5B 2R4SL 5MEQB 3VXPA 4NO5B 5F89B 3RWDA 3VFNA 1PSKH 4HLZG 2X1WL 4J2XA 4KKBD 3D69A 3TN0B 5DT1L 5ESAA 5MEOB 1F4WL 5DJCA 3HMXL 5K9KA 1D6VL 4GKSA 5SWQB 3U7YH 1O0VA 3QUKA 3SJVE 4NPYA 4PJ8A 5DMIL 3KPQB 3CLEL 4RAUB 1FBIL 1HILA 1TETL 3O6FC 5T1KD 2FEEI 1BMGA 2LU3A 2EYSB 3BQUA 4WU5B 5ADPL 1HKLL 5SWZE 5I1GH 4Q6IC 4OKDA 1JCKA 1J1OL 3WE6B 3HZMA 5E2VH 3PWPD 1KULA 1K9TA 1DLFH 3EFFA 4GMSH 2BY2A 1MY7A 1CWVA 4OFVA 3ARFD 3OAYH 4P2RD 4PV9B 5HYSB 3RIAK 1IEHA 4G8GE 4WFED 3U2SA 2OK0L 3IETA 1FYHB 2ED7A 3HNVL 4ELMB 1YEGH 1FFRA 3GSVA 3SHSA 2NY5C 4XVSH 5FOBA 3DX8B 4Y7MA 3ULVD 5HPMB 4GW4B 4MXWH 4UT9H 5GGSY 4Y4HB 5D2LB 1JPGA 5DJAB 3WNMA 4LU5L 4HXBL 5I73C 5ELIA 3S96B 3CZJA 3MC0A 4NT6A 1IFHH 5DUBB 3UXFA 2HLFD 2KQMA 1IM9B 3WIHH 2XA8L 1I8KA 4R7NB 4QOKB 2PUQT 5FV2A 2JIXA 1YN7B 3CFJB 2F8OA 4QWWC 5HHOA 2R23A 5T1MB 3PJSB 3H3BC 4HH9B 1KG0B 4HG4K 2BCKB 2R56H 4OZGA 4QKXB 5I6XB 1HXYB 1ZTXH 3V0WH 3GIVA 4P23C 1N0XH 5GGVH 5D1XA 1U58A 5CEYB 4UV7L 4QTHA 1AD0A 1CCZA 4PJ9C 1YPZA 3ZE1E 1K4DA 2I25N 1A6WH 4JDZA 3MGOB 1D5MB 5B3NA 5JUEL 3PL6A 1G0DA 1NDMA 5J11C 3QEQA 3PP4L 4Q2ZA 5KSAD 5DDHA 3ARFC 1RJZB 1WQVT 1PY9A 1NLDL 3P0YH 1A7PH 4OCRH 2UZXB 1GCFA 2QQNH 4P9ML 1KCRL 1TJGH 3G5YB 3DXAD 1OSZA 3OB0K 3QXDB 2WZPD 1UWEH 3TNNA 3C60C 3O8XA 5IGXH 4ONFL 1OPGL 4NYLB 2FBJH 5DZOA 3THML 3RGHA 4J3UA 1S5IL 3DVGA 1YEFH 1CDGA 5C0FA 5E9DB 5I17B 2PETA 2BFVL 2R2HB 1H15B 2QHRL 4YHIB 3GKWH 1OAYH 5EPMA 5I66B 3VWJA 4PJGE 3EIFA 2ORBL 2G2RA 1HEZA 3D87B 3P0GB 3LSOB 2P7TB 3ZKXC 3S6CA 1FC1A 5E2WH 1XCTB 1IC4L 4H1LG 4PJFE 2H8PA 3PDOB 5C8JB 4U6VH 3MOBL 5INDA 3QO1A 1C5DA 5CKGA 3QHTC 1MJJA 1OD9A 4PJEE 2VJXA 1T5XB 3FO2B 4J8RB 5HDOA 2QADC 4YXHH 4U7KA 4O4YL 1MCLA 3L1OH 1H8SA 3MSPA 4TVPD 4FZ8H 2BRRH 3TCXA 1FAIL 2DQHL 4U1LB 3QXAB 1ZVHA 4JZJC 2E3VA 1UM4H 3RWJA 1GGIL 1S7VA 3GSUA 1TPXC 2C26A 3U7WL 2C3GA 4G59A 1QKZL 2DQIL 2FEEL 4DTGH 4F9PA 3I6LE 4NQTA 3TV3L 4G6MH 4G6JL 4PJHA 1I85C 3C8KA 5GIRA 5ITFB 2P5WB 4AMKH 5HHQA 3CU1A 5EH1A 1TQBC 3TPUA 3FFCE 2NX5D 3MNWA 2PO6C 3WKMH 1MI5E 3MGAA 3G6JE 5L2KB 3NPZB 1JGEA 1KIPA 2QHLA 3WEXB 1Z5LA 4TUKH 1IAIL 1LO2L 2XWBA 3LV3A 1JWMB 4RFNB 4MXQD 3D9AL 5DRZB 1I7UA 1KC5L 4TSBH 2GI7A 4UQ2A 3EJYD 5E8DH 2APXA 5ERWA 1R5WB 3MRKA 2XPGA 3RKDD 3MV9A 4WW2A 3X14A 5EFIA 5IOPB 3FQXA 4UQ3A 4L8DA 1UYWH 1XF5A 4HKXA 4N0CA 3FB7A 1I1FA 3H3PH 3EYQD 1QR1A 4KMQA 5C2BH 2OX5A 4Q0XL 3Q1SL 5IB5B 1X4ZA 2JB6A 3GSQA 1IQWH 4L5FL 5D70H 2VDOL 4PTUB 1LP9A 4U1JA 1EV2E 4HGWA 3VFGL 2VLKB 4IHOB 4QRPA 3H7BA 3BJLA 5SX4H 2FECI 4ODWB 1DL7L 3F12B 3QUXA 4FQLL 2F5AL 1LDSA 1RHHB 4X6FA 1NCUA 1T80A 4QHNB 1G9ML 5BMFL 4OIIH 1S9WB 3N50A 1YQVL 1D5BB 5C7XH 2ICES 4ORZC 4OT1L 3SDCB 4L4VA 4YR6B 5DJZB 5EBMA 1GL4B 1F2XK 4F2MB 1PQZB 4LDEB 1KTLA 4UIMB 5E2JA 4MAUH 1CU4L 5GRZA 3HPJB 5MERB 3QIWB 5JO5A 3DX6B 1CDYA 4HIXH 4ZPVA 1WZ1L 3I75B 1C7TA 5D5MB 2VR9A 1NAKL 5BQ7A 5CIPA 1NC4B 1UXWB 1I1CA 2UVEA 2ZSWA 3CFCL 4GMTH 3CMGA 1FNGB 4NUJB 4L8CB 1EX0A 1ZLVK 1MAKA 1BQHG 1IT9L 3U9UB 1JF6A 3VFWB 2XN9E 3NCYP 3KAAA 4P57B 2XFXB 3UAJC 3RX7A 1Q9OA 1S7WA 3BKCL 1T1WB 4YK4B 3ULVF 1KYOJ 2H1PH 3RU8L 3BGFB 1T83C 2QR0B 3BH8B 4NQEE 43C9A 3HPLB 2YPLB 3BZ4B 3NA9H 2VXUL 4J1UB 5C0CE 4Y2DB 2RBLA 5K9JL 3KJ4C 4WI3A 2ITDA 3FFCD 4LVEA 3WIFA 4QRUB 2VDLL 4FQJH 4KU1A 4PRPB 3CXDL 4FFYL 5GRXG 4GAYA 2OYPA 5E94A 1MHPL 2HLAB 3IDXH 3UTOA 3QEHA 3OJMB 5ID1A 4X6CF 4PJIB 3JV5A 2Y06L 2N56A 3IDJA 3QI9D 3FFDA 5IQ9B 4HT1H 4NQSB 5DWUL 3TA3A 3HUJA 1KCSH 4WDIA 1S8DB 2GTZB 1KB5H 3LEVH 2JCCF 1FFNB 2WBJA 1KEGH 3CMOL 3GBLA 1AH1A 5GGTH 1T0PB 1ZGLM 4WUKL 4R4BA 2X70A 1CFSB 4FG6C 2GCYB 4NKIL 4PIRF 1VKXB 5DRXB 3BE1L 3U1SL 3ALPA 2NY0D 3G08B 3BWUC 1BVLB 4H5SA 5JLZA 3ZDXE 1HKFA 4PP1D 3EOBA 1WIOA 4HCRL 5EU5B 2E9BA 4XP1L 3MV01 4UUJB 3WJLC 2BHYA 5CINL 1XGTB 1QNZL 4J3SA 3QCTH 1JVKA 3VW3L 1NC2D 1T0NA 3V7AG 3NMEA 4JFDE 1RIVH 1W2KT 1QLEL 1LMKA 3GJFB 2DLHA 4PJDE 3V0AC 1MJUH 2APVA 1ZHKB 3QXTA 4JY6B 3GO1H 1OB1B 2OTUB 3SDDB 2MMXA 1WAAA 3V5HB 2BVOA 2BSTB 1A14H 2CKBA 1A7BA 3VXOA 4CU6A 3FOMA 3QI9C 1FGVH 4K7PL 1AXSB 1AQDA 3ETBF 4HUMB 2GSGB 2WM0A 2FO1A 4KRMB 5EU6B 4I4WB 3UJIL 3SQOL 3CLFH 3VDAA 5HHPB 3HZYB 4APQD 3JV4A 3C6LA 3P4LA 3A67H 4POZC 4ZTOH 2AJ3B 1AQKL 2QV2A 1OHQA 4FQXD 1XCQB 1X5XA 2A2QT 5D2NA 2EC9U 2VZUA 5HHXL 3ZYOA 2FJHA 4KI1A 2HJLB 2WLYA 4XHJC 1U92B 4XNXH 1V05A 4OF8A 3FQTB 2A6DA 1HHHA 4HMEA 4UILH 1B88A 4NWUH 1HYRC 5C0GB 5GZNC 1ZGLP 4WEBH 1FIEA 4X6EA 3ZTJH 3GI9H 1XF2B 3I6GB 4ZFGL 5DR5L 4NO2A 3FQNA 1KCVH 3UTTA 1YY8B 3ZE1F 1KN4L 4OF7A 4UT6L 5TDPA 3B4NA 1U8JB 4QRTA 4OCXH 2O5YH 2WAHA 1M71A 3U48A 2ILLA 3QQ3B 3ARUA 3LKRB 1J12A 3NABL 1MH5A 2E9JA 5CZKA 3CFEB 3VG9B 4DGIH 4J6RL 4L9LA 4TNVF 4KWUA 3QRFM 2Z8RA 5C08A 3O3BA 4X6DA 3WFHB 5FYKD 1UWXK 1CGUA 5TE6L 1WWWX 2AJSL 4PJXB 4JRYE 1OGAA 3BP4A 4RMUA 5GHWH 4ZD3L 4G3YL 1VDGA 4N9GA 3PGDA 4KH2A 4OD3L 4OLYL 1N7ML 4TUJB 1RY7B 5TFSL 2XZAL 2NLJA 2P8LB 4PJ8D 1IKFH 2CKNA 3KNBA 5GJSL 4XPGL 4Q97A 5FECA 3C8HA 2BNRA 5L0QC 3FB5A 2YPVH 1NBVL 3BQUD 3EDKA 3SO3C 4DUXA 1D5XB 3SY0B 1KELH 4FZEH 3X3GH 1DQML 5EOCH 4E41E 4YGVB 5ITBL 3GMOA 5F7UA 4X9FA 1MLBA 1TVHA 1DR9A 5GRVL 3CVIL 3RWFB 5K9QG 3U0WH 1ETZA 2ESVE 3MLUH 1UZ8A 3T0DA 2ZSVB 3DYPA 4Y5YA 1ORSB 4KUZH 3OKKB 2CIIA 1IAKB 2NZ9D 3CZFB 4PJ7B 3TBSB 3CFIC 5EN2A 3G6DH 4U05A 4XXDB 1CTNA 5JW3L 3TJEL 4LLWB 3WIIL 4R97B 2VAAB 3GSNH 1Q0YH 3EO0B 4EXPX 4TOYL 4KRLB 1A6TB 5LCVH 2OL3B 5C9KA 2WK2A 3GMLA 4XPBH 3INUL 4G42B 2FZ3A 4MD0B 5EIIA 5DK2A 2JIXD 1RULL 4CNIB 5HHOD 4UZGA 2A9NL 4WY7L 1QO3B 2FO4A 5I8KL 1XIWA 3WNNA 2HG5B 3G9VA 1TJHH 4OFKA 3FT4A 2AV7B 4JDTL 2FB4L 2F19L 5I1HH 3O9WB 2B20A 1LO4L 3IFNL 3VFVA 5C92A 3H0TA 4GO6B 4ZAKA 1FNFA 1DQDH 2HP4A 2QQKL 4TN9A 5BS0E 3PL6D 2PXYC 1ND0A 4LHUA 5J1SC 3B2VL 1TZHA 4OD1L 3QEQD 3U36A 3U30C 4JAMB 1G6RL 5JZ7D 1QBLH 3UDWA 1RHFA 2G9HA 1VFAA 2DTMH 1PW3A 4WFFE 4NNYB 1T04B 1V3KA 3EO1B 5L7XH 3QFDA 1T2QH 3HS0A 4L3AA 5ENWA 1I1AA 1BFSA 3ULSB 2XYCA 5E08L 4O5LL 4NNXA 1IL1A 2QJDA 1MFBH 3D85A 1RI8A 4OGAC 4BSWB 5CJ8A 3L5XL 3WFCH 4QRPE 3NFPB 5GZOD 4R9HA 4LLDB 4D2NA 2NXZC 4IS6A 3KPOB 3LS4L 3OZ9H 3FN0L 2V2WB 4KFZC 3MJ9L 1Z0NA 1R5VB 3NZ8A 1DEEB 3S3JA 2YMXH 5F9DC 3WNOA 1CK0H 1X5HA 3VWJD 4W4NA 4Y1AA 1CLZL 2R0ZH 3S36H 3L5WA 4RGMC 4WEUD 4XCYB 3B5TA 2HTLC 4XNYL 5B4MC 5HHVH 2NY4C 3HB3D 4M6NH 2C3VB 3ARBB 3N06B 4GAGH 3BAEH 3PQYB 1R5IB 4PD4J 2H6PB 4UT7H 1XMWA 4QHUA 2DQDH 2A6IA 1CBVL 1BIHA 3AS1A 4TTDC 2WP3T 3D48R 4X5XA 5IEKA 2QSVA 3NIFE 4OI8A 3QIUA 2UZYB 4YNYA 1LO5B 3RIFF 2J2ZA 4XT1C 1MHEB 2DQCH 5FUCE 2CXKA 4M8QB 5KTEH 3MCKA 1OAZL 1H3PH 1FDLL 3EO9H 4XBPB 1MF2L 3DGGB 2P4AB 5L9DL 3QJFA 3T0EA 2AJVL 1OAUH 5IKCB 3I02B 4WCYH 3D6GA 5D1QC 1KPUB 3FCTB 4Y5VC 3VXRE 2VAJA 3MV7B 2XWJA 3TT3H 4G6KL 5KS9A 4HIJA 4YPGA 3IJYB 4CU7A 5KZCD 2DM4A 3PWUA 3KYOA 4S1DD 4Z7WE 3ZDZF 4PTTB 2P44B 2APTA 4RGOL 3W81A 1D5IL 1T1YB 5IBTL 1ONQB 1FYTB 4MS8D 5HHNA 1SJVA 1BGXH 2XI9A 1HOCA 1AP2B 1MCOL 3PWNA 1A21A 4N0CD 3D3VB 3BDYL 1YMMB 1X6NA 3VGAB 4BSVB 2KH2B 5B39A 4PJCB 4I0PD 4HAFA 4U33A 3MRGA 3CFBB 3QUZC 4WFFD 1FO0B 2EICA 1FCGA 1NGZB 2I5YH 3ES6A 5D7JA 1A5FH 3GHEH 3UPCA 2DD8H 3V9FA 2GUOA 1FNEB 4K3EL 4XMLH 4OJFH 4HIIA 3I3BA 1YNTB 3G5XB 4XCEB 1CF8L 4QRPD 4ZTPL 4KDWA 4P46A 1E28B 1A4JB 4NKQB 4PJ5B 3U46A 3MUJA 2AK4A 3QUXD 1IGCL 3AS3A 5FDWA 1I8LA 4Y5XA 2W60B 2WINB 3C2AH 3QXVA 4G8IB 3B6SB 4F57L 2H32A 5DJ0A 1DN2A 4J23A 2B4CL 1NCBL 4DGYL 4PJDF 1ED3A 2IQ9H 1ZSDB 4JPVH 3KR3L 2W9DL 5IR1B 2GSIA 3OG4B 2ZUYA 3HE7D 3BWAA 5C9JA 4I9WD 4X7SL 3IRPX 1GIGH 3SDAA 1C08A 3HNTH 3DX9B 5CSBA 1EGJA 2BJML 3HI6L 5C0RL 4QYOA 5IMLB 3O4LA 2FYYA 4I0PC 1S7UB 2AKRB 3TF7C 5F1OB 2IPUK 3E6HB 1KBGH 3V5DA 3FO0H 3KS0J 2DQEH 5TQ0L 1J0KA 2Q7YA 1M4KA 3RTQA 4A2MA 1T2JA 3CFKB 4U31A 3CC5A 1YNKL 3QWQB 1YEKL 4U1IB 2QQQA 2EIBA 4DEPB 1C16A 1SEBA 2QQLH 5DC9B 2VNCA 4MNHA 3PV6B 1RAMA 3WS6A 1LO0L 3K80A 4P4RA 3SKOB 2IBZY 3F6IA 3QDMA 2W9EL 1EFQA 3VXRD 5ACZA 2HVJB 4OZGF 2M8XA 1I3GL 3BKJL 4LSVH 4RIRA 1CVRA 4Y16A 3IFOA 1MWAL 4NHCL 3O3EA 4N0FA 1A0QH 4JFXA 3FQUB 1YPZF 5DVMA 3NIGE 1QFUL 5FKAA 2EDFA 1Q72H 1S7RA 1FIGH 5F6IB 1LHZA 1JUFB 3RVUC 2WBJD 4PP8C 5I2IB 3HE7C 4CVWA 4WTZA 1U8HA 3QRGH 4EUPH 3HRZB 2Q6WA 2ZG3A 4F7CB 1L7TH 3OHXA 3UMTA 5SX4I 4QRSB 1BF8A 3KYNA 1A1MA 2D4FA 4ODXB 1MCSA 5FHBH 4JR9L 1WWBX 4ZFOL 3BN9D 4JRXA 4KKAD 4LF3A 3MZGB 4IRSB 1HH9B 5E00B 3OR6B 2BNUA 3BKYH 5FO7A 5FUCC 5DJYB 3SDXE 2I27N 4U1HB 5C0AE 3KPPA 3MLXL 1AGCB 1QBML 4DK3A 1MOEA 2NY7L 2VDNH 5MHSD 4P4KB 4KV5F 1M6OB 1G7PA 3H8NA 1ZLSH 1BBJA 4MCYA 5FO9A 4U2YA 4K23L 4HX1B 5JPMA 5KANI 1T6VN 4YHML 5GRWA 2E8YA 3QCVL 5DO2C 2X44D 4X4XB 4JCLA 3W11C 4F37K 5I76A 5K93A 3UX9B 3O6MH 3SKMB 4NBYB 2H26B 4Y4FB 4UINL 4BK4A 4BZ2L 3SPVA 3CH8A 5E2UH 1NKRA 3K2MC 5SWSB 3NFSH 3KPNB 4WU7B 4MNGA 3EYSL 5IT2L 1C5BH 1R6VA 2VKXA 4PB9H 1RZJH 5HY9A 1HSBB 5BO1L 4A6YB 2P8MA 1AE6L 4V3DB 3QP3A 3LCYA 3O6FB 5GRVK 5JORA 1NFKA 4Z76A 4E42A 4QRRA 3I6KA 4Q6IB 4G43A 1DBMH 2Q8AL 2I9TA 3W2DL 1D6EB 4OF6A 5KG9B 4U7MA 4PREA 3PP3K 3BPLC 4H1LH 2IFFL 4OGXL 1JZ5A 4W6YB 4BZYA 4K7FA 1H3WM 4KKAC 1VFMA 4WNQA 4DZ8B 4M02A 4JB9H 3LS5H 2OXHA 2Z93B 4HXAH 5TH2B 3VJ6A 4P2OC 3MRIB 4I18A 5DVOA 1JNNH 5DYOA 1JNLH 4O02H 4Z7UB 5I1KL 3H9HB 2EDBA 2AW2A 1INEH 4OZFH 4S1RH 2LABA 3C6SB 3IGAB 3QXUA 3CK0H 3QJHB 2DYPB 4FS0A 5DD6A 4PJBA 3OKEA 4Q9QL 4O58L 3UTTD 2IH1A 4IIQC 5GGRY 4HJJH 3V8OA 1XZ0A 4YXKL 1JPTL 4Z0XB 5GS0L 2EXWD 1VSCA 1ORQB 4RMTA 5IBLC 4D9RE 4DVRH 4HCRA 1E4KA 5DD1H 2MKWA 4P23B 3HI1A 5FYLH 3RAJL 2PYEA 4JY5L 5GJTL 1QOKA 4WW2F 5EZOH 2Q76A 3MUZ1 4QO1A 1BHGA 4PJ9B 3GMQA 2R2EA 5DHVB 3BMVA 3SGDI 1MFEL 5C08D 4P9HL 3FTGB 5E7BA 4ZXBB 4JJ5A 2DRUA 2PR4H 5E4EC 2R69L 3HMWL 4OV6F 2IGFH 4KTYA 1DUYB 5J11B 2R1YB 1ZT1A 1OGAD 3QWOA 5FA3B 4ONGH 3EYVA 5FKPB 1LP9F 3ULUH 2ZUXA 5HDBE 1FGNH 5AWNH 3OKOB 3RIAF 1S7SB 2FX7H 2BNRD 3C60B 5HI5C 1PKQA 3QIBA 3SCMC 2LE9A 4MHHG 3VGHA 3AMLA 3BUYB 3VE0A 2OP4L 1DJSA 3D0VA 1ZWIA 1DVFA 1VFBB 2UY7A 1ODAA 4C56A 2FX9L 3GM0A 1NAMH 5E5RB 1FNSH 4P5KA 4GKOA 3TBWA 4FTVA 1RPQA 5HHMA 1UKQA 4L29B 5DQJB 1E4XL 4GUPB 1G7MA 1A7QH 2DB8A 4RQQA 1CR9H 3ZKXB 1FHGA 3PIQA 3RUGB 2VE6B 1LEIA 1BOGB 1DP0A 3TO2B 4HUWB 5JXEC 3FO1B 1PZ5A 1NFDA 1QUNA 3E6FB 5FYLE 2R2CA 5FUZH 4ENED 5HYIA 1QD0A 1UWGH 1BJ8A 3CUPB 3NIFF 4GG6B 2CK0L 3QH3A 5I15L 2QADB 5C2UB 1NGXB 4PRHB 4HGMA 2GK0B 4X8JA 5CHNA 1XIWD 3BP5B 1T2XA 3CFDA 2AV1B 3VXSE 2PF6A 4JZJB 1W72L 1C1EH 3X13B 4TSAH 4DZBB 2VDRH 1ZT7B 3MROA 1TPXB 4MJ2A 2ZNWA 4JZOB 3OJDA 5DJ2A 5E56A 3ULUE 3ALXA 1R3JA 3ARGC 4PGDA 4ZAKD 2HAZA 2F74A 3L5HA 4N5ED 2ICWJ 2L7UA 1TQBB 2MNUA 4S1QH 4LHUD 1K2DA 2CUHA 4LLQA 1YJDH 5D1ZC 4LEOB 2PO6B 3IFPA 3DPBA 3I84A 2C1OB 4M7ZC 1A6AB 5F6HI 3IVKB 4PY8I 1EVUA 5FF6B 3VFRB 1RSFA 3BD4A 3HUJF 3T77B 4XVTL 4HWEL 2OSLA 4LARL 3SJVB 2VXQL 3KLAB 1OAXH 3HAEH 1FE8L 4FHBD 2DKUA 4OKVA 3W0WA 3KG5A 1I1AD 5HDQL 2FIKB 2DN7A 1P4BH 3VWKA 4X9BA 2VDQH 4QHMA 3WUWA 1SBBA 4N1HB 2ITCB 5SWZB 3D85D 3PHOB 4JPKL 2R4RL 4KJPD 1CE6B 4G7YL 3VH8B 4NKMB 5ABDE 3CGTA 3JTTB 1FZMB 3MRLB 2MTPA 3VXME 3VXNB 3WHE0 3K4AA 4F7PB 4ZSOE 1OP3H 5I19L 5JDSB 3T4AB 2BRQA 5C0JA 4OUOA 1HHIA 4G8GB 4YZFE 4LQFH 1WTGT 4ALAH 3O81A 3CXHK 2HT3D 3F7YA 3O0RH 3VRLE 5GPRA 3RRQA 2F53E 4KKLD 3BIKB 2DWEB 1P5UA 1RZIB 4NGHH 1L0YA 3TBYA 1BJMA 4P59H 4WHYG 4M3KB 4N5EC 1WAAF 1J88A 4NRXB 4KVNL 1MLCA 1URLA 4JFEA 2BSRB 1OAQH 1EJOL 2E7LE 3Q6GH 3A6OA 1KJ2L 2GTWB 1GHFL 3O4LE 3NCBB 2HFEA 5DHXB 5JW4R 3MRFB 1FG2A 4CUCA 2C1PB 4PFEA 2DQUH 4HWNA 2NY2D 3LKNB 4RX4A 4G9FA 4P2QA 3SKJL 4HWUA 1I9JL 4HUXB 4LHUG 2XNAA 4I2XA 3NACL 1RZJC 4R26L 5IV2A 4WJ5A 3WNKA 3T0ED 3GUTB 2QSQA 2VZSA 5KVEL 4P3CL 1UEYA 2XTJB 5E5MA 3MLRH 1XR9A 5BV7H 4YHLH 3V4VL 4N0YL 4U6HB 1JYNA 1N4XL 2CJUL 1G6RA 4HUUB 5IFAH 4QY8B 3EJZC 4WFHD 1NGWA 4WO4D 4XB8A 4D0BA 2QSTA 1KLUB 1OOAA 2NY1C 3ULUD 25C8L 1QEWB 3MUGA 5CJOL 1FVCB 1HCFX 2O26U 4LFHD 1ACZA 3ARYA 3KJ4B 3HE6A 1LNUB 3ROLA 4FNLL 4X6BB 1U95B 2X4QA 1HDMB 2D2OA 4LCUA 4LSSL 1DBBL 1MFDH 1JHKL 2R39A 3NTCL 3D39A 3GGWB 4JPWL 4E5XA 4X7TB 2JE8A 3NIGF 1OT2A 4P2YA 1YN6B 3MJ9A 6FABL 2ATKB 1X5YA 2FJFA 1NFIB 2VISB 1DQJA 4PJGB 5H94B 5ISZB 4NSKA 2J8UA 3RDTA 1QHOA 2QSCH 3V7AE 1S9VB 2NY2C 4F33B 4G9DB 3QISA 4PJFB 3S35H 1SVZA 1VEOA 2XQYK 2R0WH 1U8IA 3TBVA 2XKUA 4KRPC 4XPHL 4P46D 4PJEB 3O2WH 1AGFB 2AK4D 4OZHE 5T1DH 4KK5C 4AQ1B 5KJRH 4WGVB 5CLWA 4EI5A 5CUSL 3UBXB 1HHKA 3IU3B 4NO5A 5BZWB 4R4FH 1U8KB 3QUML 1FL3B 2IH3B 5F96L 1PX4A 5HYJE 4HKZB 3GB7B 3TN0A 2VXVL 3QHZH 4WO4C 2XZQH 2EH7H 3H3KA 1I8MB 3ALWA 3AB0C 5F7DB 4HQQL 1DLHB 1IC5L 4Q9RH 4R6UA 4M62H 5HD8D 1X7QB 4WI5A 2IC2A 8CGTA 4QXUL 1R3IL 2N7BA 2EYSA 3FONA 4WU5A 5A1AA 1JZ3A 4R8WH 4FABH 3WE6A 1MI5B 3G6JB 1N2RB 3O4LD 2ICWB 3RY4A 3S98A 3I50H 1B6DA 1UJTA 4OBSA 4PV9A 4H26B 1KIUA 5HYSA 3DUSA 5J0BA 4LFHG 4UTAH 4ZNEA 4JQIL 4TRPL 2JK5A 1EO5A 3F65A 3SGJC 3RY6C 5D6CA 4EN3D 5EZIH 1AGEB 5HPMA 1TZGL 2BHUA 4Y4HA 5D2LA 4DN4L 5DJAA 3ARVA 1J8KA 4NO3B 2VL5B 3QDMD 3S96A 4MAYD 1XGQB 2ZP0T 1N6UA 5DUBA 2IADB 1IM9A 4BFBD 4B5EA 3AFLA 4Y16D 5B3JF 1IGML 1NBYB 1FORH 1YN7A 3CFJA 2EKSB 4FFWC 1F4HA 5T1MA 3HNSL 3PJSA 3VRJB 4HH9A 1KG0A 5DD5H 4LVHC 2Z8SA 3RZCC 4OZ4B 3V6OE 1IC1A 4OM0H 3WS3A 1ZS8B 1BECA 4HWBL 3WL9B 5AAMA 5CEYA 4BM7A 3IXTA 1NGQL 3KJ6L 2XRAL 1WFTA 2E7LC 4HS3A 3MGOA 3EOTH 1FG9C 2NY6D 4HIHB 1D5MA 3MRMB 1IGTB 4DAGH 2BXZA 1JFQH 4JRXD 1YJDC 5EU4B 4XI5D 4XB7A 5HSFA 4F9LA 2R1XB 1NCCL 5K9OB 1JGUH 5C0BB 3G5YA 3V6BR 1BF2A 1OTUD 2I07A 1C7SA 5I1CL 2DLEA 2XN9B 5ICYB 2Z31A 3JVGA 4NYLA 2MKLC 4G7VH 2P46B 5EORL 1J1XL 2B2XH 3VXTB 3F58H 1OD7A 2V2XB 1LD9B 2EDWA 4DUWA 1P7QB 5E9DA 5I17A 5FYJL 1RUAL 2R2HA 1Q9WB 2F58H 4NQEB 4YEEA 1H15A 1VACB 2ID5A 2ZUWA 1FO0L 3LRSB 3L3HB 1F4XH 1P9MA 1KFAL 5C0CB 4NC0B 3MUY1 3S34L 3LQAH 3P3YA 4H8WH 4ISVB 2NTSP 5I0ZA 3LSOA 4MJIE 2P7TA 1NEZB 4WHTB 1XCTA 1FZOB 4X5WA 4JFZL 4R2GC 3I2CH 3KXFE 2FX8L 4NFDA 3FO2A 4J8RA 4TQEH 1Q9LB 2QL1A 4QXGH 2L4OA 4GRWH 3PABB 1I9RL 1Z3GH 3CVHH 1A7NL 1PGRB 2C5DC 4JM4H 3GJFK 4U1LA 3QXAA 4KXZI 4WTZG 3FRUB 2XG5A 4KHXL 2Q20A 4NM8L 3CJJA 4LRNH 4M7LT 3H2WA 1P4LB 2ZWLT 4BYHA 2DI9A 3UTSA 3DETC 3LEYH 1IKNC 2O5XH 5F8QC 5ITFA 1SBSH 4GW5B 2P5WA 4HPYL 1YNLL 3SOBH 4M7JH 5F6HJ 2EZ0D 4PY8J 5KS9F 1IMHC 1FFPB 1U3ZA 5BVJB 3MRCB 1E0OB 2B8OT 3DRQB 1WT5A 4NRYA 3ULUF 3B83A 4XTRD 4ZFOA 2IBGA 5BV7C 1RJLB 3K46A 4M8VA 5JXAL 1AY1L 5L2KA 1FPTH 3WEXA 2PYED 3ZL4L 5GS2D 1ZHNB 7FABH 1F6AB 2W92A 3BX7C 1T66D 4JFDB 3U4BH 1JWMA 1BM3H 1QR4A 4LCIL 4Z7OF 5C71A 1UCBL 1GSMA 2X9XA 1HINL 5CZVL 5C07E 1OM3H 2PXYB 4AEHL 3QUYC 3DOSA 2VB5A 5IOPA 5EOCJ 2UUDH 3U30B 1YMHA 3FMGH 4XPFL 5HYQA 2DJUA 2VDMH 1K3IA 2W0PA 4DKEL 3JUYA 5CEXA 1LK2B 3CDFA 5GRYA 3H42H 1BFTA 4F7TB 4GRWE 2BSSB 4PTUA 2YZ1A 3RGVC 5E7FA 2VLKA 43CAB 1KB5B 3TJHA 4NCC2 3GZKA 5C09B 3VRLF 1SHMA 3WFEL 2NXZB 4N68A 1DVFD 4RWYH 4ODWA 3F12A 3RL2B 1A6ZB 4UTBL 2G5RA 4MX7B 3LH2H 1UB5B 4PLNC 1RHHA 4RA3A 1L4IA 1DQLL 4K3DL 3VFOB 4QHNA 4Q9CA 4FTVD 5J4MA 3A6BH 3OWEA 1S9WA 4MDJB 2UWEB 4D0CB 5IFJB 1D5BA 3ARRA 1U2HA 3QCUH 1L9NA 2HJFB 1WEJL 2ZOLB 3SDCA 5L6YH 4YR6A 1OARL 2IG2H 4RGMB 4F2MA 5FEBA 1PQZA 1T66C 5KOVC 4UIMA 5MERA 3AREB 3HPJA 3JWDL 3SQBA 1CFBA 3QIWA 4S1SH 3EYUH 3DX6A 2NY4B 3I75A 5D5MA 5IWLA 3DUHA 1ZLUH 3PNWB 1TXKA 3CU7A 3NOIA 3TBTB 1NC4A 1UXWA 3KXFD 1NUFA 5GGSA 4NUJA 4XVJH 2OI9A 1KYOK 4YGAB 2OJZH 4G8FB 3U9UA 5HVGB 4P57A 2Z4QB 5F7EL 2XFXA 4XPTL 2HTKC 1KPVB 5KVDL 3HG1B 1ZA6A 4MZ3A 4DN3H 4BZ1L 5GXBB 4QRQA 2XXMB 2JTDA 3BH8A 1EBPA 1AFVH 2YPLA 3BZ4A 4J1UA 4U0QB 4D9QE 5IB2B 5DURB 2EDHA 3HI5H 3LEXB 1B0RB 4JRYB 2MCG1 1A7RH 3IB4A 3VFSB 2WNGA 3D39E 4M5ZL 5D1QB 4U1KB 4M4RA 3WLBB 4Y5VB 5DLMH 1KF9B 1JI1A 1SEQL 4OCMC 1A02N 2HLAA 4CN4A 4HPOL 5EU7E 3K2UL 5I18H 5JPNB 2EDYA 5JW5B 3UPRB 5F9JB 1MCBA 1INDL 2OTWB 1OQOA 4PJIA 2NY5L 1A3RH 1FC2D 4BFEA 3DURB 2BVTA 3W0WD 4DKFL 2IPUG 5J3HC 3VWKD 3CDGB 4NQSA 2QBWA 2ADGA 2ARJQ 5CZXC 4PJAE 5C07D 1A3QA 2GTZA 3GMMA 1FFNA 2R8SL 1E6JH 4HKJB 4E41B 4DQOH 1ZEAH 5IB3A 5T3ZH 3SDYH 2ESVB 4OUUB 3TIEB 4MA8L 3FHAA 1CFSA 3V52H 4HJ0C 2GCYA 4OLWL 4YHZL 1VKXA 5DRXA 3QUZB 1SYSB 1RUKL 4GRMB 3HC3L 3NH7L 1BVLA 5BRZA 3C5ZC 2IMNA 5EU5A 3JV6B 4OFPA 1N5AB 1KEMH 2AK1L 1XGTA 4M1DL 4IRZL 4L8BB 4RGND 1AR1C 4JFFE