1S7QA

Crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7qA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7qA01
4KKAD 1OAQH 1V3MA 1CZ8H 4M7LH 3MQIA 4HAFA 3TF7C 3L95B 2YA2A 3LN5B 2F58H 5H2BA 4OV5B 1KCRH 1ES0A 5JXED 3AB0B 4JFFB 3ARFD 4NJ9L 1W72A 2AEPL 5KVGH 1JTOA 2J8HA 3RKPA 4LHUB 4KRPB 4OFDA 4ALAL 3T2OA 4MDJB 4JR9H 1FE8L 4UUJA 2BJMH 1RK1A 4N5EC 4MS8A 4OQ1A 5GZNC 4FQLL 4PJBA 3DWTA 1HH6B 2IQ9H 5FYLD 3BPLC 2VZVA 4XCNB 4Z78B 1HHJB 1OHQA 1F4YH 3C08L 5D5ME 4GKNA 4KWUA 1CE6B 3DVGB 4Y4FB 3VH8B 5I8EA 4BZYA 5FKAA 3MSPA 5FCUH 3WE6B 2JCCE 3MGTB 2E9JA 5T5FL 1GPOH 4QRPE 3A6BH 4CJ0A 4LP4A 1DEEA 3QEQB 1E4KA 1IM9D 5D93B 2JIXA 3ZL4L 2VITB 4GAJL 2DI7A 1DEDA 5DHYA 5ELIA 5IQ7L 2ED8A 4QXUL 2CSPA 4I48B 2Y7QA 2IFGA 1GGIH 4X5WA 4RDQG 3CVIL 2FO4B 3S96A 1GZQB 4PS4L 1UCBH 1V5JA 2Z9TA 2X1WL 3RVWC 2EDHA 3MCLL 1FJ1A 4G8IB 1U91A 5F7DB 1D5XB 4TPRL 1HILA 1QBMH 1T04A 3TJEL 2NY3C 3VFGH 5F3HA 3GB7B 4UIKL 2WNGA 1XGPA 1GIGL 3SO5A 4XC1L 5TQ0L 2EC9U 3L95A 5BVPH 5JORB 4KI5E 3VDAA 2G5RA 4OV5A 3SDAC 3VE0B 3BPNC 2X4RA 4S2SB 3HCVA 4JFFA 4KHXL 4ZUUB 3U46B 2ED9A 4QRSA 3C5SA 1EFXB 4FNLL 3E2HA 3CLFL 4ZNEA 4PGEB 3PL6D 3TO4D 4JRXB 2EEAA 1JBJA 4L9LB 4V3EB 2Q86A 2VIRA 3LEVH 4HZLA 1MLBB 1AGBA 1JP5A 4ZD3H 4F37K 4P2QB 3TBYA 3F6LA 4G8FB 8FABA 1LD9B 3P9MB 2G75A 1RUPL 4OCNC 4ODXA 2W9EH 1I8LA 3EO9L 1M6OA 1QFWI 1CE6A 3DVGA 3FOMB 5DDHB 3RTQD 5MEPA 2DM2A 1TZGH 3ARFB 3B2UC 5DA4A 5CEZD 4HH9B 4MAYC 3VDCA 4ZO6A 4WJ5A 1KG0B 3TBVB 3WNNA 4QY8B 2YD3A 5D5MF 5BZWA 3RBGA 1C16B 2VKXA 4U2YA 1U42A 2QTEA 3RGVC 5EU6D 3OXSB 3QEGL 5IROA 3O2DL 3G08B 1CGSH 3EDFA 1WT5C 4O5LH 2HAZA 3ZE1E 3O3UN 4D9LH 3NACL 4LHJB 4X7DC 4H8WH 5J3HC 4C55A 3GUTA 3FFDB 3H0TB 5C0NC 2FB4H 2PYFA 5HI3C 4XNMB 1DANT 2FLRT 1P53A 2YRZA 3CDCA 4D8PB 2H8PB 3GGWB 4Y1AD 2H6PB 2KKQA 4PJXA 3U7AA 5T3ZD 5HGBA 5D6DC 4I3RH 3Q5YA 2J4WL 5A2IH 2OK0H 1LGVA 1QEWA 3V8CA 4EN3A 3VE0A 1P69B 1KPRB 5EOTB 1YYLL 4XP4L 5FYKH 4F80A 3V6FA 3S8WA 4FOMA 2QQKH 4OD2B 4KI5F 3GMMA 4PGEA 5FOBB 1GGCL 2RHEA 3O3DB 2BNRE 3GSVB 5TE6L 1MLBA 1M1SA 1OTSC 5IT2H 4OUOA 2XXMB 3GJFH 4P2QA 2AVGA 3O81A 5LBSL 3RU8L 1CFBA 5T1DL 3C5JA 5AAWA 4PGCB 5KSAA 1MCNA 4LAQL 2HKFH 1K4DB 4LSDA 4M1CD 2YD8A 1U8QB 2ITDB 4WGWB 1LQVA 1KG0A 4QY8A 5GISL 1S8DB 1M7DB 3PL6B 3TO4B 2MQ0A 3TPUE 3WD5L 3QJFB 2XFXB 1LO5A 3L5XH 1PKQE 5HHPA 3TEUA 4LRNL 3RIFF 3BKCH 3HRZB 3IGAB 5C09E 4K23H 5SWZA 3T2PA 3BQUB 1MCWW 3VFTB 3RTQB 3TV3H 5DUBB 3MGOB 4DGIH 5ID0B 1CCZA 1CGUA 1CQKA 1LDPH 3BO8B 1P6FA 4QTHA 5FA4A 2WAHA 1MJ8L 4TRPH 1A1OA 4OLWH 5IHZB 3HR6A 2XXCB 3WYRA 3P30H 3TFKD 4P2CG 4FMFA 5EU6B 4D8PA 3WJLA 3B3IA 3GSOB 3VXME 5I1CL 1NCNA 3I3BA 1T7ZA 5JHLL 1AFVH 1J86A 4RDQF 2VL4A 4LASL 2DIJA 1MH5B 5DD1H 5ESVB 4UIMA 4EUPA 2VQUA 1AO7D 1I3RA 1ACYH 1N0XL 2AERT 4PB0L 5ERWB 3GI8H 3KYMB 5I18L 4O02H 3VJ6B 1A3QA 5TQ2L 3V0VA 3SE8L 2GITB 4U05A 4CVUA 2HJKB 5FYKE 4NRZA 3NCJL 5BJTA 1AQKH 2HT2C 4JGUA 2ZNXA 1FQ9C 4QHMB 4J23A 3SE4C 4F7TA 1CDBA 2WUCH 3GSRB 1MCRA 4ELKA 4PGCA 3RHWF 5EZOL 4HFUL 3D85A 1G7JA 1K4DA 2Y1VA 2IH3A 3BAEL 4OM1H 4PREB 1YEGH 4XB7A 4X4MA 1VGKB 5IVXE 3AGVA 2UY7A 4QRPD 1VESA 2EDKA 3PGFH 1D5BB 4QTIH 3WFCL 1JCKA 3OXRA 1II4E 4C54A 1S8DA 1JGVL 1EAJA 3EBAA 2PTUA 4IJ3C 4XP5L 1RZ7L 4LLDA 2XFXA 4LCCB 3ROOB 4X80H 1DBBL 3OKDB 1S5HB 1FZKB 2BMKB 1B0RB 3HRZA 5C2BH 5IGXH 4LKXA 1NGPL 1YQVH 3BQUA 3DUUB 3UDWA 1AIFA 4HJ0D 4ZUTA 3QHZH 4P9HH 5GGTA 5HYIA 3HI1A 3V8OA 4NRXB 4F9PA 4G9DB 2X4UB 1YEKH 1V3LA 4ERSH 4I8DA 3CMGA 1UZ8A 1XH3A 4Y16A 4Y5VC 5EUKB 2YPLA 4ZTOL 5K9QI 1BP3B 3BHBA 3CFEA 2DQIL 4KI5D 1IFHH 3NCFB 4XNUH 2GJZA 1KENH 3K2MC 1MH5A 2WUBH 3ISWA 5ESVA 1HK6A 3OKLB 3D1MC 3HNTL 4ISVB 5ERWA 1MVUA 2YK1L 4HIHB 2YOCA 4NN6B 4OKDA 1PYWA 2JTDA 4O4YH 2R0LH 5EU4B 4EBQH 1EUTA 3MA7A 2GITA 3MOAL 4M6OH 2QBWA 3ARVA 3QXAA 4HUMB 2O26U 3GSRA 3D69B 5LKNA 4LGSB 1KEGH 5IWLC 3IFLL 1UJ3C 3V6ZA 1JYVA 4HKJB 3FT3B 1AO7B 3QUMH 4NHCL 1P2CA 1I3VA 1VGKA 3B5GA 4L8DA 1PBYA 5HHME 5CS7A 4DN3L 3DYPA 3VCLA 5IG7B 2OJEB 3U2SB 2Y06H 43CAB 4LCCA 5ACZA 3ROOA 5IVXF 3UMTA 5LGJB 1FZKA 4FXLA 1H3XA 2BMKA 1B0RA 4LMQI 5HYQA 2NZ9C 5C70A 4GXUN 1F90L 4X0KA 3QCUH 4YXHL 3UTTA 1OP5K 1GAFL 3OJMB 5BOZG 4NUGH 4MA7L 4H1LH 4H1LG 4LSVH 5TE4L 1C5BH 3DO7A 4QRPB 3MRJB 2R0KL 1BEYH 4WO4C 1WAAE 1BIIB 1DFBH 3MV11 3OJDA 4JHWL 2EDXA 3E3QA 5C07E 4HWBA 5F7LB 2FX8H 2D03H 3B9KC 5F9OL 4R4BB 3T0EB 1EDQA 4JO1H 2FZ3B 1IAMA 5F7YC 3KNBB 3QUZB 3K1KC 4ZQKB 1DQDH 5HYEA 4DCQB 4TULH 5HBBA 4JREB 3W39B 2MSPA 5EU4A 3L6FB 5D2NC 2L4OA 1JYXA 5DMIL 1JNHB 4YXKL 2GSGA 1U92A 2A77H 2E27H 5KOVC 1KT2A 2YS4A 5ICZB 2BX5A 4HT1H 3CSYB 5F6IC 1YNLL 4NQVB 2I9LA 5I1IH 1F11A 4M6ML 4AL8H 4DUVA 2OI9B 1NUNB 2AGJL 4I18A 3REVB 3OB8A 4DVBB 4HKJA 1T22B 3FQTA 1JNJA 3EYFB 4ODWA 4P9MH 5IP4A 4X4XA 4WNQA 2OJEA 4M9OA 4DUXA 5CEYB 1A3LL 4BH7B 1X4XA 4HBCH 2FSEA 1WBYB 2PYEE 2IGFH 5LGJA 2VXSH 5C09D 1PDKA 4YAQB 3GSQA 4DVRH 4UT9L 1FFNB 4IMLB 1T1YB 2ICEB 1GHFL 5DEFA 1MFBL 5SWSE 3QNZA 3NIGF 3VW3L 1H9VA 4XPFL 1U36A 2IANA 4NQDB 5F70A 2DL9A 4XVUD 3Q6FA 2DWEB 4EXPX 3ARXA 5F21B 3CU1A 5EORH 2YR3A 3VWJB 3FO1B 3MLZL 4KROD 1BIIA 4R0LA 4P4KC 2QQLL 4XPAL 1NDGB 2NY2D 4TOYL 1PZ5B 4ZS7L 4ZOAA 4R4BA 3T0EA 1WAAF 4ZPTB 2FO1A 1QR4A 3I6GA 3GSNL 4XNQB 1Q9KA 1A64A 4ZQKA 1DUZB 1SMOA 3FO2A 1IKNA 4L4VE 4N0YH 4NNYB 1EVTC 5CP7A 4U6HB 3K74B 5HVGB 3UTSA 5CFHA 4HWNA 3REWB 3T77A 2NY0D 5F1OB 5FYKD 3L3IB 1HSAB 3SDCD 1JNHA 3O4OB 3MYZA 3BGAA 4QYOA 2F54D 3QIUC 3MJ8B 2ADJB 3CSYA 3F8UB 4R2GC 4S0SD 2UYLB 4I3SH 1U95B 4HIEB 5E7FA 2ZUQB 4E42B 2ZPKL 2R1WB 2OI9A 4DEPC 5ITBH 2R29L 4LLAA 5CD5C 3KLDA 1DL7H 1KJVB 1T22A 2C9AA 3MOBL 4L4TE 4FFYH 3U9PH 5DQJA 4PJEA 2YBRB 2ZOLB 4BH7A 1MFAL 2XN9E 5ISZE 2NXYC 4OQTH 1Z9LA 5B8CB 1LDSA 2YD4A 3RVXC 2QADD 1KJ2B 1U9KA 4YAQA 2XA3A 5J0BA 1HWHB 5F9WB 1QSZA 4DGVH 4NOFA 1T03H 5EOQH 1RI8A 4F58H 1RZ8A 3L3JA 2Q87A 1KCSL 2APXA 4GS7C 4NQDA 4AMKL 4DKDC 2P4AB 3LEXB 4G6ML 4JFEE 4KUCF 2NX5B 3B5HA 3ILQD 3FO1A 1NEZA 3MRHA 1TFHA 4JJHA 4MJ5B 3QPXL 1PEZA 4H20L 3VGAB 3O8XD 1QG3A 4V2BA 5HI5D 4FS0A 1TMCB 4EKXA 4W6WB 4XNYL 5DYOB 2YZ1A 3DUHA 3D0LA 4PG9B 3ZYJA 4JB9L 3DYMA 3CFBA 4MXQA 4NQCD 3WSQL 2IQAB 3REWA 3I02B 2VKWA 1R5IB 4P2OC 4KROB 2R2CA 4ZYKA 4FZ8L 4XCFH 4XCEA 1AHWB 1BBDL 1JJUA 2NY2B 5GS0H 4F2MA 1C7TA 1J8HB 3TNMA 2E7BA 3BPOC 5TGBA 1NMAL 1OP3H 1U8HA 2R1WA 4CN4A 3S3SA 5E8EA 5E08H 3KPLB 4ZOBA 1ZVYA 2MPAH 4TSCH 4JQVA 5HHOE 1TITA 1NPUA 4HUUA 4R4NC 2R8SL 1E27B 3TIEA 1G7MA 2C7UA 1GSMA 4GAGL 5IFHL 2VZUA 2YBRA 1WBXB 2NY0B 1JPST 5C3TA 3SDCB 3QI9A 1AXTH 3MLWL 3GO1L 3W5MA 2F54B 5IEKB 5JW3H 4JM2A 1S3KL 5E6IA 5FO7B 3UJJL 1Y6NR 1FORL 4GRLA 4LOUC 4L5FH 2KPNA 4Z18A 4YK4B 5GS1C 1MIMH 2A9ML 4WW2B 1IAKB 1FH5L 1BPVA 3C2AL 5KSBE 5CZKA 4OF6A 5IVXB 3DX8B 3NPSB 1OD9A 3G5VB 3CAFA 4K3DL 4EI6B 4F33B 2NX5A 4FZEL 1T89A 3INUL 4H26B 1IEHA 2J7LA 3GNML 4MJ5A 3TCXA 1YZZA 1NGQH 2AXFB 2XICA 3IDMB 4Z7UB 1XF5B 3U7YL 2YUVA 1QRNB 3U82B 3DURB 1JZ8A 3WKNA 3BD3A 1F58L 3NIFE 1AI1H 4J3WA 3MRBA 1QKZL 5SX4H 1FLRL 1N5AB 4OGXH 4ODHL 5C1MB 3UZQA 1IAIM 5GRXG 4MA1B 2ZG2A 3NCBB 4PG9A 3PXHA 3OKEA 1BWMA 2Z0BA 5ADOH 3I02A 4UTBH 2CO6B 3H8NA 5IFAH 4G5ZL 2UVEA 3O8XB 4K7FB 3IDIA 4LSTL 1FDLL 4OZGB 4Y5XB 5FYLL 1KV3A 2XA8H 3EYOA 5L2JB 5C0AE 5EU3A 3L3KB 3VWKA 3I3EA 5INCB 2IALB 3ZKSD 3KPRB 1ZT1A 2BDNL 5DJDA 4NDMA 2Q76B 1FYHB 3RKDD 2IC2A 3C6LB 4NQCB 4KU1A 4JY5H 1G1CA 1H8SA 4MAUL 5HHNA 1ZHBB 4M00A 4XNXH 2XPGB 3EYVB 1Q9OB 4XC3L 2CRYA 4UBDD 1X3DA 4E41E 4KUCD 5FGBA 3G6JA 4L3AA 1AY1H 4PRHA 4Y4KC 2UUDH 4GG8A 3QCTL 1DVFA 1WTLA 4LLWA 5DLMH 3GM8A 4ZTPL 1KACB 4PTTB 2EYTB 4Y4HC 1VB9A 4DKAA 4ORGB 2E3VA 2NYYC 1SJXA 2XOTA 4FMKA 1B0GB 4OZIE 1K9TA 2VXUL 3G5VA 3ALPA 1JNLL 5EBWA 5E2VH 2R9HD 3AMKA 3OQ3B 5KSBF 1V7ML 4Z7UA 2IPKA 1QRNA 4XWOC 1PQZB 5EC2B 1QA9A 2D0GA 1RZGB 3VRJB 4LFHG 4KV5E 5DJXA 1MUJA 4BYHA 1JNNH 3ARDA 4OI9A 1C5CL 4WWKD 5DGQA 4F7EA 1UWGL 1VENA 4IHOA 4MD5B 3EGSA 4L4VD 4YHLL 5FIEA 4R6UA 2IADB 3KDMB 1NL0L 3NIFF 2GQHA 1HH9B 4HGMA 4YHYB 3FKUS 3MLSL 5C0IB 5FO8B 1T0MB 2DM4A 5D1ZC 5B39G 3RJDA 3AVEA 1H3GA 3LKRB 4X98A 3OBAA 2ESVA 2RAMA 5DRWA 3WMSA 3E6HB 4A2MA 4OZGA 4QRUA 2VJXA 4KJYA 1VFUA 3BI9X 5GGQH 2CK2A 1NFDA 2BOCB 5L2JA 3L3KA 3WIFA 4L4TD 1Q94B 3HC3H 3KPRA 4Q9RH 3AC0A 4JRYD 2VAAB 3VFPB 3C60D 1ZHBA 3L7EA 5CP3A 2OJZL 2XN9D 3WL9A 1ADQL 1OTTC 4UV4L 1Q9OA 3HHRB 2AJSL 2VE6B 2PO6C 5EIIB 5D70H 2ZUVA 5EZIL 2YA0A 2Z35B 4NQTA 3GKZA 4F9LC 2CIKB 4X6BA 4OGYL 5GGRB 3V4UH 3S88H 3GRWH 1MEXL 1Z2KA 5IHLB 1OCWL 3HZKA 1UM4L 4GW1B 4IRZH 4O58H 4PTTA 2YSSA 5CAYB 3QUYD 4JFED 1JK8A 4MZ3A 3C5ZA 4C58B 4LBEA 1K8DA 3MBXL 1F97A 2A83B 2Q7YB 4QNPF 4UINH 4Y2DD 5K93A 3J8F7 3KJ6L 3M8OL 4NQEE 3H7LA 3G9VA 5EC2A 3R0NA 3I9GL 3CXHK 3DMMD 1HKLL 4R7DA 1FVDA 3PWLB 4X5XB 2XZAH 4IIQB 3WFEH 3WO4C 3S35X 1FNSL 2ZZUT 3LIZH 3FB7B 5D72H 2AK1L 4NPYA 4W68A 3WN5B 2NY6D 1HH9A 1TETL 3N1QC 4KV5F 4QHKI 3QG6B 4G3YH 4H1LB 5CUSH 5FO8A 2VQTA 1T0MA 2O5YL 4CAGA 2NY4B 1RIUH 1SJHB 3NABH 1DE4B 1H15A 5J12B 3RZCA 1A9EA 2V9QA 1IZKA 3WIHL 5ID1B 2IMNA 5GGVH 3HI5L 3W2DH 3OHXA 2V5RA 4WWKB 3O0RL 3WLWC 4PJCA 5CSBA 5DUPH 5KSUA 1HHIB 3WIIH 4LCUA 4PJ5D 3D9AL 4K94L 5D6CB 4J4PA 5L8LB 5JW4N 5IJVB 3HC4L 4YFLI 1FO0H 1S7TA 1KN2H 1NC2D 3OB0H 1JZ6A 1CLYL 1M4KA 4MJID 4NZTH 5HGDB 2GTWA 4IDJH 2VISA 2JELL 4NWTL 4ZMAT 2CIKA 3WBDA 3SDXA 4L3ED 5GGRA 4JPWH 3OPZH 4GW1A 5C6WH 4WFHE 4L4TB 5D2LF 4KHTH 2P8MB 2E8YA 4Q6YA 1JN6A 4JRYB 3LEYL 1FNEA 2MFNA 1RJLA 3O2WH 3C60B 4POUB 3RIFK 1E4WL 2DOCA 3R8BB 2OYPA 5SX5K 1P84K 3UO1L 4ZNCD 2VL5B 3AREB 4OIIL 2UWEE 5CZXD 2HRLA 3SKOA 4MGXA 5C8JB 4NGHH 3TT3L 5BQ7B 4X5XA 4HWEL 2BY3A 5A16A 1Q72H 1MRFH 3KPMB 3QUYB 4WCYL 1G6VK 3P0VL 5E4EC 2I07B 4MS8C 3TLRA 1RJZB 1YEEL 4XBGA 2ZUSA 3TZVD 1BVLA 2ARJB 1IGCH 3O3EB 3MRFA 4K71C 2ZJSH 5E7BA 4NFDA 3TH3T 1KXQE 4YE4H 4Y2DB 1JMZA 4MWFB 1SJHA 3DVNB 4LCIH 3JTCA 3EW3B 1A6AB 4PJIA 4ZAKD 5I1EL 3Q48A 4EEEA 5D7LB 1INQB 5GS0D 5E8DL 5FA3B 5C0AD 4UOJA 4MNGB 1E4KC 1KTDA 4UZGA 1A3RH 1WSST 5EOCH 4YDLB 4ZDHB 4FTVE 1UH3A 1JZ4A 4BSWB 3FO0H 2NY6B 1CDIA 3N85L 3RHWK 1B2WH 3CDYA 1A47A 1T3FB 3Q5OA 4P5TD 4E41D 1S5IL 3CC5A 1X5JA 4Z77A 4X9IA 2HT4D 3FB8A 4ENEC 2WBKA 3MRLB 3CVHL 2LU4A 3HS0A 4EI5A 1XF2B 4PJ5B 4N8VB 4HIXL 4X7SL 1NCWH 4KUZL 1FRGL 4ONOA 4BQ9A 1ZLSH 1OSZA 4Q0XL 4QF1A 3BP5A 5EOCJ 4PJ8C 4YFLF 4GQPH 1QSFA 2VDLL 2JF1A 4MJIB 2I60H 2VL5A 3AREA 4PP8C 4O51B 4WEBH 4YHKL 4ZXBD 4NM4H 4G6AC 4RQQA 1JGDB 1AKJD 3E2HC 2BNQD 4L3EB 1CL7I 1KNOA 1ZHLA 25C8H 3EYUL 3O2VH 5F3BB 3IETA 1RIVL 1CZ8L 1JRHL 2DJ4A 4M48H 2UWEF 2Z93B 3K3QA 2I07A 2F58L 3U9UA 1SVZA 4LLVA 5L0QC 3TA3B 2E7LE 2YKLH 4N9OB 4V3DB 2ZUWA 1VPOL 1VGEL 3ULSB 1I8LC 3KXFE 3I50L 2W92A 4LSQL 5DHVB 3EO1A 5J13B 1AJ7H 4DN4L 3P3YA 4H88L 5FEBA 3DVNA 1AXSB 3HMXH 3CFCH 2F5BL 3UAJD 1A6AA 3GSNA 4OLEA 2QQQA 5E95B 3CZJA 1KELH 3QULA 4JEGB 4TUKH 2BJML 1JGLL 4FQCH 5KJRH 5HDBE 3WNOA 5J6HB 5GRVK 4KJQD 5IROC 4ZDHA 3MACH 4GBXB 2DQTH 1N5YH 2AEIT 3TZVB 1F4YL 2GSIA 2VDPL 2EICA 2WLZA 5HGAB 1LK3H 5FB8B 1X5ZA 4R97B 1L7TL 2RJMA 4GMSH 2KZ1B 1GPOL 1QSEA 5F1KC 1DQMH 4ZAKB 3V5DA 3MRLA 1IC1A 3L3GB 5C0AB 1QLFB 4M1GH 3GJFK 3TNNA 4U1NA 1XF2A 2VXTH 1YMME 2J8UE 2P8LB 5MENE 5F1NA 4C59B 2EIEA 3T0DA 1FC2D 1MREH 4RIRA 1F5WA 5GJSH 1FIGH 1UCBL 4V1DE 4EN3C 1D5MB 2PXYD 1AP2B 5KS9A 4HW6A 5LGHH 3PDOB 1ZGLM 4NQED 4P5TB 4ZODA 4E41B 2XWBA 5KTEL 1ZVHA 3FONB 1K4CA 3EDJA 2WIIA 3MRNA 5I74B 3MMEB 5JOPD 2X2YA 3HMWH 2XTJC 4NKQB 4RAUB 4JFOA 1DQLH 5CLWA 2X09A 1P4BH 4FQ1H 1F6LL 3X12A 5FYKU 2Z31C 1H0DB 2FD6H 4Y88A 3TA3A 2V5TA 3HE6D 1ZLWK 5KSAC 1KJMA 2X42A 1EMTH 3RUGA 5MI0C 4U6VH 1OLZA 5AUMB 1AXSA 4PD4J 4ZXBB 1Y0LA 4BFIB 3ARGD 2R4RH 1NFIA 2C3XA 1AKJB 4ZD3L 2BNQB 3DXAD 1SJEB 2Y36H 1G9MC 2OSLB 3JV0A 1CE1H 3RIAF 2CJUH 4GBXA 1BECA 3QDGA 2W9EL 1ND0B 5C6TH 1MWAH 3IJSA 2WBWB 3U7WH 2NXZD 2D0FA 3S7GA 5GRYA 5FB8A 4KY1H 1S7WB 4LVNC 4AJ0A 3MROB 3FT2A 1TLKA 1K3ZA 3K8MA 3KYOB 1PLGH 3BVNB 4X7FC 5A2FA 3QFDA 2MQCA 2FHFA 4WFHD 5BXFA 5T5NG 3E8UH 3K1DA 4PRIB 1CGSL 2L7UA 3CPLB 4O5LL 2BXZA 4H8WL 2DN7A 1FC1A 1AGCB 3ARBA 3PWPA 1NAMB 1KC5H 4MVBD 1G7QB 1UVQB 4QRRD 1AP2A 3WUZA 2CDFB 2P7TB 3JUZA 4P23A 4PJFA 5D2LB 1BQHG 1Z0MA 2J8UF 4IOIB 4KKLC 4N0UE 2EH7H 2PCPA 1QOKA 4XPBL 3DROB 3ZKXB 3MODH 1R3JB 3BUYA 3MMEA 1EEYB 2VDKL 4PTUB 3IDYC 3KHQA 2JKXA 1A6UL 5FYJD 1YEJH 1YY8A 2OL3H 1NC4A 5T1MB 1E4JA 2EDRA 1TJHH 5IK3B 5C0DB 4NO3A 2FEDC 3PDDA 3PJSB 4KKBD 5AUMA 1LO4L 5F88B 2PETA 4U0RC 5C0BD 3C87A 2XWTA 3V0AC 1G0XA 3P9LB 1AE6H 1U2CA 1IM3B 2P5WE 2XZCH 3NAAH 2NW2B 5D8JH 1OSPH 4IOFC 5GS3A 5LAXA 1ND0A 5L2KE 2HKFL 1CGYA 2GUOB 2W91A 5AD0B 4OCMC 3UDWC 4HULB 4QRQB 3JV4B 3IXTA 1QO3B 5EO1B 4WU7A 3KYOA 3CSPA 4P2RA 4F9PC 3MRCB 3BVNA 3QA3B 3SKUD 4PLNC 2HRPL 2NY1C 3HUJE 3DXAB 3L5XL 5HXMA 1T1WA 2FHCA 4TTDD 1BFSA 1HQRB 2CGRH 3SO3B 4Z6AT 4Y16C 1SEQH 1IC7H 4K23L 4Y19B 5ECJE 2GYSA 3MV7A 3FQNA 1RUAH 3DRTB 3MNVA 5C9JB 5T1KA 1AGCA 5FF6A 1X5IA 3HLAB 4NT6A 1T0PB 2NXZB 1IM9A 4BSVA 1G7QA 3ARQA 4TVPL 4HG4K 1XGTB 1QFUH 3OGCB 4D0BB 3VFSB 4M93C 4TRPL 3V5KA 4OLWL 1KFAL 5CBEA 5HY9B 4E0RB 5IFJA 2M2DA 1MELA 4K8RH 1UXSA 5HD8D 3SKNB 4YIQB 5L7XL 1I7UB 2W0LA 3BSZL 4NYLA 1FL3B 1HZHH 4QHNA 1M7XA 1T83C 1I1AC 1YDPB 3EJZD 2D4DA 3N9GH 3ARRA 1M7IA 5AZEL 3KXFD 1TVHB 3V4VH 3QYCA 4OF7A 3SGKC 4QRRB 5EZLA 1CBVH 3PJSA 4G8EB 2XV6B 2YD7A 3GI9L 3GMLB 4O02L 1NGWB 2P5ED 3K0WA 4DOHE 1HHGB 2AV7B 1O0VA 1AQKL 3LHPL 4NCC2 5BCAA 3NFPB 4JKKA 1XGQB 2NW2A 2WUCL 5KVDH 4RRPG 1GCFA 3BXNB 4N0CA 3ALXA 2KQMA 3IJYB 4XP1H 3BZEA 4CN6A 2V6HA 5J6GB 5DK0A 4KPHL 4NC0B 4PJ7E 3WO3B 1IEBB 3JVGA 4PRNB 2BY1A 3W5NA 2GUOA 3TN0A 4LAJH 4QRQA 1OAYH 1YEGL 4G8GB 1P7HL 2K7QA 5IMMA 2J5LB 1XGRA 2AXGA 4UT6H 3OMZA 4NSKB 4RGOL 1GRWA 1X5YA 4ZFOL 5C0BB 2XT1B 3WKMH 2CKBA 5JW4R 4X80L 4JO2L 2KQNA 3QDJD 4OLUH 4Y19A 5IB5A 1WVZA 2ZUUA 5IGXL 5MEND 1QYGH 4FFZL 1ADQA 3HLAA 4C56D 5J06A 3DIFA 5DSCA 5IBLC 3FRPA 5EFIA 5GRJL 5C08E 5FECA 5JHDE 2DDQL 5CJ5A 3QHZL 4XHQA 1G6RH 2XY2A 3HFML 2VDOH 3OKOB 5JXAL 4TNWF 3LMJH 2AXHA 1OAZL 1PG7L 4JLRB 5D1QA 5T5NF 3O45B 4E0RA 5TDOB 4OZ4B 2DBJA 1SM3H 3T3ME 3SKNA 3ZT6A 5IB1A 3V2AR 1RIHL 4LQ1A 3NTCH 1F3JA 5DEGB 3CFKB 4XNUL 2RIKA 4WY7H 3S36H 1YDPA 3QIWC 2WUBL 4CDGC 1TVHA 3CUPB 1LEGA 1NEUA 2X70B 4I18C 1CXKA 1T2QH 1I7TB 3QUXA 3O6FD 2O61B 4IRSA 4O4YL 1XIWC 3TBTA 1HHGA 5H35B 4OF3A 2AV7A 1R5WB 4CADB 1D5ZA 4GRMA 4HK0A 5FUCC 2BC4B 3T3PE 4A6YL 1FZOA 3NFPA 1A6WL 1BVKB 3BDBA 1RVFH 1UEMA 2I25N 1AR2A 1JGUL 3IJYA 5CCKH 1HHHB 3S4SA 3ULUH 5ANME 4MQ7B 5DFWH 1XGYL 1ZA6A 1KN4L 3P11H 2WWKO 4EIGB 4PRNA 1CR9H 1MHCB 2HFTA 5F7EH 3LPFA 4G8GA 2X89A 2NLJB 4X4YA 5DC4B 3HPLA 3WIHA 4YDIH 3IFPB 4AEHH 4HCRL 4PJ7F 2P5EB 3MV8B 1D9KD 2EE3A 2B1AL 2Y06L 3HNVL 3K80A 1WCQA 1T21A 3GIZL 1KTKE 4R0LC 2XQBL 3NGBB 3JWOH 5ITFA 2DQGH 5IW3A 4G9FB 2FGZA 5GIRB 3QISA 1MCQA 1CQYA 1BX2B 3DVIA 1YUHA 3FB6B 4U33A 3QNYB 1JHLH 3O41B 4YBLC 2YD6A 3BISA 1IKNC 3C6SA 3I6KB 2M26A 4JLRA 4JM4L 2F74B 1XR9A 5E9DA 1NSNH 2V9RA 3PHOA 3ILPA 4OZ4A 1WLHA 3SEPA 2W9DL 2IG2H 3UTQA 2FX8L 2D03L 1CU4H 4XBPB 1FN4B 3X11B 5DEGA 3QDJB 4HS3A 4MHHG 3T0WA 5MENB 1J88A 1FGVH 3C09C 4HD9A 1YEIH 3W0WD 4C56B 4H25B 1LILA 3T3MF 1OPGH 1PG7W 2GT9A 1VHPA 1Q9WA 4Z7VE 1A7PH 2NY7H 5FKPB 5GGUB 2RBLA 5EZJB 3MRGB 4OD1H 1N3NA 3BN3B 4F7PB 4MCZA 3FQUB 5FV1L 4Q9QH 5H35A 3BDYH 3S98A 1R5WA 2B4CC 4CADA 4RGMB 4URTB 4PR5B 5E2WH 5E1HB 3EO0A 4WUUA 3QEUB 4P2YA 4N5ED 5L2KD 5DQDL 5I1IL 1DLFH 4QCIB 5GZND 3RWJB 4PY8J 4DZBB 3BD5A 1GGYA 1A6PA 4GW4B 2CQVA 1XF1A 3RWEA 4JHAL 4RZCB 5IB3B 2EEBA 1IARB 3BIAX 5E6ZA 5LCVL 3D39B 3WDJA 3ULUE 4NN5B 3LD8C 3O6FB 4I2XB 4R3SB 4J1UB 3SE9H 3A6CH 1DBKH 4Z5RB 3T0XA 3MBEA 4X9BA 2JCCA 1R3KA 2IGFL 3QG7H 4MJ6B 3V4PH 4ETQB 3SQOH 5IB2B 5KVEH 3AAZA 4DVRL 4WI9A 5CEXB 1Z5LA 4UDUB 5GIRA 3BH9A 4X6EA 3JUYA 4CVXB 3KLAB 3U79A 1B3JA 2W60B 4PBXA 3SGDI 5HYJD 4P59H 5KG9B 1HXYB 3FB6A 1WFNA 2DTML 3EJYD 4M7ZB 1CXLA 5JO5A 1EGJL 5EU7C 3RVWD 3UP1A 5I16A 4M8QB 3L3DB 3CVHA 4DZ8B 1D9KB 3PNWA 2R56L 4FQIL 4MXQC 5SV3A 5T3XH 4MHHI 3QQNA 1T6VN 2O5ZL 2XKUA 1FN4A 3X11A 4HWZA 3VG0L 4U1MB 4BH8B 4PPTA 2VH5H 4H25A 1EO8L 4S1SL 3X13B 3SDAD 4GH7B 3VXOA 5FKPA 4QHUA 1HWGB 1FYTB 4N0YL 3BP6A 3MRGA 4JQVC 3M17B 4JFZL 4F7PA 2AJZB 2O5XL 4WHTB 1N6VA 2ADFH 3KYNB 2ZOKA 1J0JA 2FR4B 3QI9C 2M8XA 2PW1A 2VOTA 3QEUA 5K9KA 3FRUB 4I3SL 4WTWA 5EIQA 2ZCHL 4JM2C 5HYSG 5E6IC 3RWJA 5JPMA 1F8TH 1NLDH 1NAKL 4GRLC 3W0WB 1CTNA 3HAEH 3HAEG 4RMUA 1K2DA 1DL7L 4RZCA 5IB3A 3K2UH 3BKMH 2BVQA 1JPTH 3D39A 2WBJA 1MCSA 3HG1E 3RL2B 3U9PL 3B2UD 1H3UA 4R3SA 4J1UA 4KKCC 4MAYD 1B4JL 35C8H 4Z5RA 3VFVB 1KLFA 3OR7A 1T89C 2WQ8A 5I1HL 1UKQA 1NCAH 3ULUF 3RGVD 3VXRE 4JG0H 1VKXA 4KMTH 1BGXH 5FM8A 4PJAA 4XX1G 1BZ9B 2VDNH 1HHKB 3JTSB 2I5YL 5JHDD 1WFOA 3KLAA 3QUKB 3BPLB 5B38A 2VLRD 1A6TA 1WQVT 3FL7A 3O6MH 2COQA 5I8KH 5J3HD 4ONFH 4RBPH 1MJ7H 1A1NB 1ZWIB 1RK0B 1D6EB 2FWOB 5HI3D 1WICA 1DQQB 1I85A 4N1HB 4NRYB 5L88H 2HH0H 4LDLB 3FHAA 2YPKB 1AQDB 4LSSH 3LRSA 2BVOA 2IMMA 2W38A 5T3XE 3OG6B 4ZFFB 1G7IB 3MRDB 4NM8L 5HYJB 5ENWA 1FZMA 3NN8B 3D5OF 3M17A 3VWKC 4XBEL 4WHTA 2ICWJ 3W9DB 1XT5A 1MHHA 4FFWC 4XCFL 4UV7H 3LY6A 3QWQB 2OZ4H 4GUPB 3ARSA 2NY3B 43C9B 1FNGA 4N8CH 3FRUA 1H8OA 1RZJH 4X6FA 3ZO0A 5L6YH 2BNRA 1CT8B 1JPSH 1BBJA 3MUY1 4J8RA 2ERJC 4YPGB 3QAZC 5E08L 5FGBC 2MPAL 5E2UL 3BT2H 3RBSA 4JANB 1KLUB 1RURH 3SDAB 1I9JH 2AS5M 1DVFC 2EXWC 3BPNB 3DX6B 2ID5A 1GGBH 5BMFL 4DOHB 4OJFH 3QFJE 4OM0H 3TWCH 4H0GA 5HVHC 1ZK9A 2FDBP 4HF5H 3MJ6A 1PEWA 4OB5L 1JIBA 3TPUA 3CH1B 4PJ7B 4Z0XB 3GBNH 3JTSA 4S0UC 1YN7A 1PKQA 4HC1H 3ARDC 3CDGB 3VGGA 3VMNA 3V0WH 1SY6H 4XX1E 1ZWIA 4MAYB 1BIHA 4M61B 4NO5B 2DD8H 1I7RB 4U1JA 4FRWA 3LV3A 4WI2A 4Y5YC 5F6HI 1RHHA 4OD3L 4NKMB 4MA3B 3WDHA 4M4PA 2Q6WB 1Z9OA 1AI1L 5IVOA 4XVTL 3VXMA 1ITCA 2Z92A 1G7IA 2VLRB 4OGXL 1FGNL 2D7QA 1A1MA 2CLVA 4XZUA 2FECL 2DQDL 5ADOL 2OR9L 3AS0A 1VCAA 3DV4B 1J87A 1A5FH 3F7RA 5F71A 2AJUH 4PIRF 3GJEB 2XTLA 3MLRH 3OR6B 5C0RH 3TIDB 5JNYB 2HT2D 3GK8L 2IPUK 3DSFH 4RGNE 5K9JH 1E28A 4PRAB 4YPGA 1SEBB 2Z8WC 3TCLA 5IM7B 4JANA 4M03A 4U1KB 1C08A 3NOIA 1L4IA 3ULVC 3ULUD 2DQUL 4RAHA 3DX6A 2EE2A 2BY0A 3C5ZC 1RQ5A 4XNXL 4YEEA 3N06B 2QKIA 1EJOL 1L7IL 3QHFH 2BHUA 4RCAA 1HNGA 3X14A 4JZNB 1S7VA 4X8JB 3CXDH 4AG4H 3I3DA 1YPZE 3CH1A 2VDMH 1CFVH 1JF1B 5JMOC 4RISL 3UPRB 4OSUH 4HFWA 5ETUB 3PWUB 4ZFOB 4R26H 1UGNA 5BO1H 4EDXA 1CGXA 1U6AL 1UB6B 5F9JA 5TE7H 1VDGA 4U2ZA 1SMAA 3VU2A 4M7JL 3OB0K 3L3HA 1I7RA 2E6QA 3MOQA 3IDNB 1CS6A 4G43B 2YUXA 4R90H 4YHOL 1JGEA 1T4KB 3KPQA 3RZCC 1BQUA 3TPKA 1FVEA 4U31A 3V6OE 5TDNB 2IBZY 5DJ2B 1XR8B 1M71A 3DGGB 5ESQA 1MLCA 1EBPA 2DLFH 4YR6A 4MNQE 4J4PC 2VQ1B 3IJHB 1CXEA 1KB5H 4HHAB 1U8LB 2AJ3B 4RAVB 3GJEA 3MGAA 2VNCA 3RVVC 5JNYA 2NTSP 1NCDH 3EOAB 3EYSL 2V2WB 3OKNB 5D6DA 5LGKA 2V7HB 4J3VA 5BV7L 4YQXH 5DZOA 1SEBA 1JVKA 1ZHKA 2F9BT 4U1KA 5FHBL 3MFFB 4UT7L 5LQBH 5FGCE 5FM5O 4JZOA 3FO9A 1ZLVH 1HQ4B 4Q9RL 4PJGE 3MLXH 3RIAK 4D94A 4A6YB 3VFMA 4ZSOE 4J3XA 4ESKA 3X3GH 3VXRD 5D70L 1I8KA 5HHMA 1LE5B 5GHWH 3OF6D 4MQXD 1KTLA 3S88L 2NZ9D 4XAKD 1LMKA 4O58L 4F7CB 2GJ6B 3VI4E 4HUVB 4ZFOA 2H26B 3WHXA 2WWMC 2W9LA 4LEOA 2V2TB 3WUWG 4QLRA 4APQA 5FK9A 3BP7B 2CLZA 5AWNL 4Y7MA 3RZWA 3ME0A 5HHVL 4WO4D 2NY5L 3IDNA 1ZGLB 4IJ3B 2XKNA 1T4KA 1F4AA 5T3XD 3B9KD 1UZ6F 4JKMA 2XZAL 4HS8L 5C07A 2W0FB 5JLZB 3LIZL 2G60H 4WFFE 1LO3H 1TJIH 4XP6L 4Z8FH 5TH2A 4CMMA 1BD2E 5EUOA 1NCCH 5CUSL 4B5EA 3PABA 3NCEB 3ET9F 3PHQB 1U8LA 3B9AA 1D5IL 1CFNA 5DS8B 1I75A 4Y5VB 3QH3B 5F97E 3LKOB 5IVZB 2F5AH 2YMXH 1AD0B 3FTGA 4QWWD 1ZVSB 3W2DL 4G42B 3HZYB 4OCWL 4R96A 2DLHA 5DUPL 3PGDA 3WIIL 3U4EB 2HKHH 2F53E 4EI5C 3QFJD 5E24E 4GSDL 5FDWA 1A7QH 3GHBH 15C8L 4NZTL 3V9FA 5C0EB 4IDJL 2FJHB 4OZHB 3WXVL 5F1SA 4YLQT 2Y6SD 3MRRB 3QUMA 3H3BC 1DN0B 4JPWL 5CIPA 3SCMA 1S9KC 2GJ6A 2PYEA 12E8H 5CWSB 1UJ3B 1CLOL 4KHTL 3LKNA 4FXGA 4HCRA 2RFXB 4ZUVB 3OZ9H 3BP7A 5INDB 3U0PB 4FG6C 1FNFA 5SWSA 2GW5A 1YECH 3VI4F 3ARPA 4HKZA 1T5XA 3BJLA 3ARYA 1VSCA 2NW3B 2FJFB 4RSVA 1S7UA 5BRZE 2H2SC 5GSVA 3IXAB 1IGMH 1IT9H 2RQ8A 5HPMB 3L7FA 3H9HB 1Q72L 3SGEH 4I0PA 3TBWB 1MFEL 3MCKB 4BFEA 3BW9A 2DQCH 1MRFL 4YHIB 1ZT7B 4D0DA 1JWUB 3TT1H 3NIDE 2WP3O 4MA8L 3MLTA 4EOWL 1A4KB 4U4BA 1XZ0B 2DYPD 2ZJSL 5HDLA 4KZEH 2GI7A 4WO4B 1JL8A 2X7LB 4P5KB 4AENB 3QH3A 3QIUD 4RGND 3I84A 1WITA 4MCYB 5MHSD 3B9KB 1AD0A 1WF5A 3FN0H 3ZDYE 1ZVSA 5E00B 3FZUC 3MREB 4G42A 4OLZH 5DK2B 2AEQL 5EOCL 5IW1A 4DGYL 3P4LA 5MEOB 4NBYB 3ZTNH 1TZHA 1UFUA 3QZWB 1MHPH 2WM0A 4HS6B 5AZ2H 5I71C 4IRJD 2XRAH 1LK2B 4OT1H 2LV4A 1QHPA 1IRAY 1EHLH 5D2NB 3RDTD 1X5KA 5C0EA 3QO1A 5HDQH 2OBGA 4OZHA 4K3JH 2H32B 1FFOB 3ZYIA 3BGMA 1LP9E 2NXYD 2HFFB 3F62A 3QJHA 3RVXD 2BVPA 5F6IB 5EBLB 4ELMB 2XN9A 3RVTC 5J8OA 5ISZA 1JHTB 5IWLA 5KN5B 4MNHA 3H3KA 2R2BA 3H9SA 2V5SA 1WCBA 5IHBA 1NCWL 2Z91B 2CMRL 4KVNL 1N6QH 1ZLSL 3HAEB 4JPKH 5JDJA 5EA0L 3OX8B 1AXIB 5D7IE 3DI3B 1A7RL 1BAFL 1ED3A 5I2IA 2D7TH 3BRGC 1W72H 3QXDB 4YX2H 4P3DB 2FX7H 3SGEI 2HWZH 5GGVY 2DQFB 4PGDA 1ZMYA 4TNWK 3CLEL 3RAJH 2GCYA 3F58H 3OG4B 3TBWA 4AK1A 3RX7A 4YGAB 1MCOL 1EGJA 4P57A 3GM0A 4MNQD 4EJ1C 4HPYL 5E8NB 4JFDE 1XZ0A 1KCVH 3X17A 3H3PH 2AI0H 5F9AC 5FGRA 3ZE0F 3KPSD 1AJ7L 4P2OD 3FFCB 3CFCL 4P4KB 1OQXA 1QLRB 3B9EA 4GKZA 1IC4H 4QOKE 3VFOA 1XCQA 3WFBL 1KELL 1LEKA 2R0ZH 5E00A 4TUKL 3R8QA 4Z7OE 3QQ3A 5C0FB 3D48R 4U6YA 4LCWB 32C2B 4R4ND 1N5YL 5F96H 3QZWA 5DJ6B 3I2CH 3VD4A 3ZDYF 4OLXL 5HHOA 1LK3L 3NZHH 3ARBC 4XNZC 5D2NA 2MCPH 4FQXA 1J5OL 4OCYH 3EYQC 1JTPA 4N68A 4ZS6C 3QIUB 4NKIH 1DQML 2OTWA 5GJTH 1N59B 3S97C 4P23C 3PWJB 3T2NH 4R2GB 1NC2A 2FH6A 1U8MB 4ELMA 2DMCA 4MQSB 4LOUD 1DANU 4M1GL 3SJVB 4DEPB 3AUVA 1I1RA 1A21A 2VXTL 4NNPL 5CSZA 5SWQB 2W65B 1A7NH 1LP9F 4YWGH 3WS3B 3HE7C 2ZCKL 3PIQB 4XCYB 2OP4H 2ZSWB 3OX8A 1MREL 3KLSA 2CK0H 3KGRA 3WNLA 5GRUH 1UC6A 1S7SA 3BZDA 4LIQL 3QXDA 1RZFL 3B83A 4P3DA 4LHUG 4GG6F 4YGVB 3OWEA 4KKAC 3VXUE 3KWWB 2NXYB 2AJYH 3MLVL 4ONGL 1PSKH 3D2UD 1MFCH 5DZNA 3CFJB 1H3VA 2XWJA 1G9EA 2AABL 1JV5B 1BJMA 1MIEH 2LAAA 4O2FA 1ETZA 2ZNWA 2YXMA 1P4BL 4GS7B 3SDDA 4LPTA 1B6DA 3NBNA 1JUFA 2ZKHH 4BKLA 2FD6L 1MHEB 1KULA 3FN3A 2AAVA 3VH8G 1JWSB 1GC1L 4PFEA 1EMTL 2Q1EA 2B5IC 3DHMA 3FFCA 1F4XH 4K3EH 1HOCB 4UILH 1QLRA 4JPVL 4HPOH 2VDRL 4Z7WF 1CDGA 3LS4L 1TQBC 3DARA 2VWEE 3DX7B 4LCYB 1CDJA 2F53D 4XVJL 4R7NB 4LCWA 32C2A 8CGTA 3MRMB 3EAKA 4WW1A 4RX4D 5C6TL 1UH2A 1NUDA 5DJ6A 4YXLL 1GZPA 2EDNA 4Z7OF 1EJ6A 4ZOCA 1NUFA 2G9HB 2BRRH 5GGSB 3KPSB 1FAIH 5T1LA 1WFUA 4P2OB 3GMQB 3V6BR 1IGFH 2KDGA 1S9XB 1WFTA 1IZJA 3PWJA 3HPJA 3BUTA 1PY4A 3BPOB 4AIOA 2VLKE 1BOGB 3E8UL 4Y4KD 3SJVA 1YN6A 2Y4SA 1MAMH 5I8OL 1CGVA 2FH8A 1KC5L 3RVUC 1SHMA 1A14L 1CTOA 3MLYH 2Y07H 4GAYA 1ZSDA 1J0YA 4PRDB 4KQ4H 4OZIA 3QNXA 3UJIH 1U8JB 3FAWA 5BRZD 2EH7L 3KWWA 3BJ91 4U1SB 1P9MA 4NQSB 4JFFE 4XWOD 1FV1A 1HEZB 4JCLA 5DA0B 4GT7A 3M1BB 5BS0D 2HFEB 5E1AA 5GS1B 5DTFA 4ZNEE 4XI5C 5EBMB 4XXCC 1YEJL 2HFGH 3DI2B 2OL3L 4D3CL 4N0CC 4HJGB 4JQIH 5EIVA 1F4WH 5IHUH 1YEFL 4PGBB 2CDGB 3ZMRA 1JWSA 2E5EA 5F72S 3JVGC 3VFUA 3BEWB 2A6JA 5IMKB 3TN0C 1X7QB 1KLGB 3VRLE 1G9MH 1PG7X 4Z9KB 4LCYA 1IGIH 4PJBF 1BJ1H 3BKJH 1A9BB 4NNXB 1CXHA 4O2CB 3BZFB 4L29A 3MFGB 4MD4A 5D8JL 1TVBB 1U8KA 1OSPL 4LHQB 3VXQB 1CK0L 3MYJB 2HYMA 2DQHL 2AK4D 4RA3A 5J9PA 4NOBA 5B4MC 3DV6B 3MZTA 4G6KH 2A2QT 4C4KT 1OTTD 4JDTH 2PO6D 4EVNA 1S9XA 5A3IC 1IKFL 1M05A 1W0WA 4PJDA 3T65A 1J0ZA 4S1QH 5E6YA 1FBIH 2BSSA 4ODSH 5D1QC 1BOGA 1S7XA 2CGRL 2GJJA 5DMKB 1W0VB 1SEQL 1IC7L 2DL2A 3GMPB 1RUAL 3FCTB 4OFYA 1BLNB 3MA9H 1KXTB 4EUPG 2Z8SA 4EUPH 5F7HA 2QQNH 5CJQH 2HTLC 3VXNB 4CW1A 1N8ZB 4YHZH 4EDWH 4GLRI 2ATPA 1VFAA 3EFDH 1ZEAL 5F7FA 3QUXC 3LRGA 4U1SA 4NQSA 3QSKB 4IRSC 1G7HB 1FZJB 4K8RL 5JOFB 4Y4KB 1FG9C 2FLBT 4NQEA 5FFLA 1MJUL 4JRXE 5EBMA 1MPAL 4JFDD 4Y4HB 3HB3C 2IPTH 4P2QE 4PGBA 3SHSA 5MEQA 1NCBH 3AS2A 4XPGL 2V17H 1DTUA 2ORBL 3PWVB 3G6AB 1CFSA 5IMKA 4NQXB 4QOKD 4IS6B 4L3CB 5ICYA 4TTGA 3HC0A 5JR1L 5DD6B 1S7QA 1XF4B 2UZIL 3BWAA 3MLUH 4OUUB 4XTRC 1DDHB 1I8MB 2KZWA 2ZSVA 5BS0B 1OD7A 1NDMB 4NNXA 5KVDL 1LE9A 3BZFA 4KGJA 4K7PL 4K94C 3V5HA 4XP1L 3WLWD 3BWUC 3VRLF 5IOPA 3MYJA 5DD5H 4XP9H 2BSTA 2DF3A 3PQYB 1JTTA 1JPFB 5CEZH 4N90E 4OFIA 4L8CB 3FQRB 2LQRA 5D1ZB 3D0VB 1H8NA 1R5VB 3F7PC 4JFXB 4HQQL 1I3UA 1ZANL 5D71H 3KYAA 5C6PB 4GQ9L 3UBXB 4TQEH 4OLUL 1P4IL 4PUBL 4YC2C 1BLNA 3V52H 2BHZA 3MUJA 2AK4B 5FUOH 4QT5B 2F19L 3K4DA 1G6RL 3H6JA 1SBSH 2VDOL 3IDXH 1QLEH 4HXAH 3VXNA 2A74A 3VA6A 1VEPA 2PO6B 4PJXF 5DWUL 3THMH 4NZRL 2OR7A 4YDVA 9CGTA 3LN4B 2UWEA 1BM3H 1YYMH 4WY7L 3S36L 4GG6B 4Y4HA 1BWWA 2YN5A 3F12A 5IV2B 2PW2B 2NNAB 4JDVA 1U3HA 1SYVA 4TN9A 2H9GA 5IKCB 2IFFH 2ADIA 5I76B 1YC8A 3RQ3A 1N2RA 2W59A 4IS6A 3S34H 4LLQB 5DD6A 2N7AA 2FYYA 4ODVL 4OUUA 4FQHB 3GSXA 4X4ME 1LO0L 1FHGA 1RVFL 1NDMA 5AYUH 2VXVH 3MBEC 3WO4B 1I9IH 1EFQA 2JIXD 4Z7WB 3O3BA 3P4MB 1ZA3B 3IF1A 3T4AA 1IEAB 3WFHB 5GZOD 3GSWA 2IF7A 3VA2C 1I9RH 3PQYA 1BREA 3UPCA 4N0RA 4FTVA 4YDIL 3O9WA 4G6JL 4NCDA 4BQ8A 1P5UA 3D0VA 3LKQA 4NN7C 3EIFA 2DJUA 3QDHA 4HDIA 3VFWB 1X4ZA 1CD8A 2VLKD 5CEZE 5DC0A 5DJZA 1N26A 3LAFA 3UBXA 1OF2A 4YH6A 2Y72A 2IAMA 2YPLE 2GFBB 5DJ0B 3G5XA 4OKVB 1GH7A 1K8IA 1LNUB 1YJDH 4HKXB 5I73C 4JVWA 2AV1B 5DHXB 4M62H 4JFFD 4GFTB 4KI5C 3P0YH 4PP2B 4UQ2A 4F9LA 4G6AD 4I5BB 3LQZB 1R0AL 4OTXL 4KRPD 4XMKH 1J1PL 1UM5L 1CU4L 3JTTA 4XMPH 5KW9L 3E6FA 3NA9H 3KYKH 2VLLB 1G84A 3R06B 1FGVL 4WHDA 5IB4A 5IV2A 2NNAA 2X6MA 2NY7L 5E2TH 5CILL 3R4DA 4CRPA 3OAYK 4RBPK 5I76A 1HXMA 1ES0B 1HKFA 1TQCC 2WBJC 4Q9QL 2E7LA 4DW2H 3PV6A 5I66A 1W72B 4XPHH 5EO0A 2BOBB 1G9NH 3BKYH 5TFSL 5JIHA 3AXLB 1QACA 5DMGC 4UUJB 4BELD 5E4EB 1IVLA 3WFHA 1RK1B 4DAGH 1CG9A 4M6NL 3PP3H 4PJBB 5BW7C 4K71B 3H42H 3UEZA 5IMOA 1HCFX 1NLBH 4XT1C 4HWUA 2CRMA 3S35H 3NPZB 4UAOC 5TF1H 3VGBA 3LDBC 3LQMA 4GKNB 4PGZA 2NR6C 1DBKL 1INEH 4UNVA 2J88H 2OS7A 1TNMA 4JAMA 4S0TD 1P7QA 3V4PL 1I85C 1VA9A 1DEEB 4YDKL 2JIXB 5DRZA 3RFZC 1OM3H 3E3QE 4HGKC 5DJ0A 4DUWA 1TJGH 2P8PA 4P59L 1LNUA 4DTGH 1YC7A 2Y7QB 3CZFA 5F89B 1YMMA 2AV1A 2EH8L 1DCLA 1AC0A 4HMEA 1WWBX 4PJ9A 5T3XL 4PB9L 1W2KT 1NJ9A 4V1DA 3VFRA 1JZ5A 3LQZA 3MXVL 4Z7NF 1FJ1B 4JRXD 2EKSA 1U91B 3JWDL 2VLLA 3G5ZA 3R06A 1HILB 3EZ8A 2XTJD 5F1IA 4P2QD 4K9EH 4NJ9H 1JPGA 1XGPB 2AEPH 4D2NA 5KSAD 4PJ8B 2OR8A 5ESAA 1X5AA 2X4RB 2ADFL 3OKKA 3HCVB 3MRKA 1MCPH 4LPCA 1AO7E 1CN4A 3GKWL 4QRSB 4CUCA 3C5SB 2BOBA 3E2HB 5FUZH 3AXLA 2Q86B 2VIRB 2B4CL 2YD1A 2X9YA 4HZLB 3C08H 4JPIA 1AGBB 1T7YA 3IFOB 4UDTA 1JYNA 1CXIA 4JFYA 3TBYB 2HN7B 8FABB 5DGRA 2G75B 3K2UL 5T5FH 4N90D 5L0QB 2LTQC 1CVSC 4ODXB 5SWZD 4DWHA 1M6OB 2DBLL 3RL1A 2D31A 1RUKH 3ZL4H 5MEPB 5SX5H 5IQ7H 1NCAL 1QFWH 4WJ5B 4JG0L 3BESR 1PX4A 2AJXH 3H9ZA 4KMTL 1BGXL 2YPVL 4U3HA 4XMLL 5BZWB 3CVIH 5IEHA 5CINL 4H8WC 2BXYA 4PS4H 5E56A 2WSKA 1YNTB 3BZ4A 1OTUC 5I8KL 4GW5A 1MJ7L 5F89A 3T0EE 4TPRH 3CU7A 3TJEH 3GUTB 2ENSA 4RFOH 2GHWB 2HMID 4UIKH 1W0YT 1WISA 4KKLD 1GIGH 2VZOA 5DD0L 2PYFB 5CKAA 1MNUH 1T6WA 3UTSE 4N0UA 1P84J 4C83A 1A8JH 1J10A 2VR9A 4KHXH 4MD0B 1ZTXL 2JB5L 4PJXB 5HGBB 5DMYA 2BVUA 4KTEL 1IC5L 4FNLH 3CLFH 2AEWA 4PJ8A 1QEWB 2FEDD 1BFVH 5C0GA 4LSRH 4EN3B 3D85D 1NKOA 5EN2B 2C4FT 5T33L 3V6FB 4YZFE 2H41A 5HJ3A 5ADPL 4KI1A 1RUPH 2OZ4L 4TSBH 3GMMB 4N8CL 1RZJL 3LN9A 1KJ2H 1NBVL 2XTJB 3IFOA 1EZVY 3T1WA 3BOVA 3K8KA 3BT2L 4Q2ZA 4IOFD 2HN7A 2P5WA 1RURL 1DR9A 2Z31B 3IRPX 3C5JB 5KSAB 3BQUD 1FFPA 2QEJA 3VDBA 3GHEH 4OJFL 5MI0B 2QADC 1EEUA 3QEGH 3BFOA 4OM0L 4PRPB 3TWCL 5K9OB 3O2DH 4NQDE 5E0QA 3UCRA 1V7NL 2JJWA 1CFTA 5I75C 4HF5L 4XHJC 5CJOH 1N6UA 2XNAA 5DR5L 4Y16D 2D2OA 1LO5B 3GBNL 2YPLD 4LARH 3HUJA 5HHPB 1YNTA 3ILQC 4LPYA 1RZKL 2XZQH 2DI8A 2OM5A 4HC1L 1I3GL 2B1HL 5SWZB 3V0WL 2L0DA 3JSSA 2Q3AA 4M5YL 4LVNB 1ZLVK 2PUQT 3G6DL 4KJPC 3BYYA 3QHTC 4UU9A 1G0YR 4JN1L 5HHXH 3MCG1 3AS1A 2J4WH 1CGWA 2HJFB 4QTHB 5FA4B 5BZDA 4X99A 1ITBB 1A1OB 4Z7QE 1INDH 1YYLH 3ARWA 2XY1A 4ZPVA 3N1MC 4MD0A 3B3IB 2A9NL 4HIJA 4GXUM 1BQHA 2GK0A 3VXTA 4EUPB 4UIMB 5EN2A 4F3FA 1I3RB 3O4LB 4RFEA 3RU8H 5T1DH 5C0RL 5C86A 2OL3A 3V0VB 3DSFL 1FL5A 1XCTB 5K9JL 1N64H 4NRZB 5BJTB 1Z3GH 5DFVC 4YUEH 2JJUA 4YZFF 1CLCA 4F7TB 3IDYB 3BP4A 4O9HL 1URLA 2Z31A 5IUSA 4ELKB 3EFFA 4PJEF 2CR3A 4TUOA 3D85B 1EHXA 1G7JB 2AQ3A 3UTTD 2IH3B 4PRPA 5K9OA 4APQC 4LRNH 4U0RB 1J7VR 3QHFL 4NC1E 5GSRA 3OXRB 2NX5E 1BHGA 3CXDL 3D3VB 4AG4L 2L7JA 4YHPA 3GSUA 4WDIB 4I4WA 4LLDB 2PR4H 1MFNA 4KDTA 4W6XB 4OSUL 4P9HC 3RPIA 5GRZA 4LKXB 1QFHA 5BO1L 5HGHA 1MJ8H 1ZLWH 4DKFL 1AIFB 4ZUTB 1L9NA 4NKDA 5C08A 4P4RA 3HI1B 1V05A 1MQ8A 2FEEL 2HJFA 3IS1X 2NY1B 1T2XA 1C12B 4Y16B 1UZ8B 1XH3B 2YPLB 1N0XH 3BHBB 3CFEB 2QLVB 4LF3B 1J8HE 2V2XB 5I18H 3B6SA 5K9QG 3FQWA 2GJZB 4Z7QF 3SE8H 4FN0A 4NJAL 3GIVA 1KB5L 1EHAA 3O4LA 1MVUB 4M93B 1PYWB 2ZUTA 4MX7A 4OAWB 3MA7B 4MXVF 1XCTA 5CD3A 4HFUH 3M45A 3QXAB 3TVMA 1KJ3L 4K3GA 3RKDC 4FA8A 2F54E 3RA7H 4O00A 1I1AB 2V5MA 1D6VL 3WFCH 3SCMC 4PG2C 5ANMA 1JGVH 4GXVL 4PRHE 1F3RB 3ZKMD 5K33A 2Y25A 3V6ZB 3TESA 1P4LB 4U6TA 2IAND 3F6IA 1P2CB 3ULVL 1DBBH 4JM2F 4FFEX 1EH9A 4L8DB 3BGFC 3VCLB 1NGPH 3D3VA 4WDIA 3PGCB 4D9QE 3KG5A 3LKPA 3BMVA 5ACZB 4UTAL 3MXWL 4XVSL 4S1RH 4WUKL 4Z7UE 5I15L 1FSKC 1ORQB 1QRNE 3STLB 4HEME 5HYQB 2HJLA 3T0ED 1Q1JL 4I0PC 5GGSY 1P7KB 1T1ZA 4X0KB 3QUZD 3UTTB 3PWNB 5I1AA 1L0YA 5CBAB 1RFDH 1CLZH 5I6XC 1T0NA 3DO7B 2X1XR 3UTSD 4HZAA 1C12A 4QHLB 2APBA 3OJDB 3CDFA 1G6RA 3HNTH 3MUGA 5E99H 4LF3A 2YK1H 2V2XA 4YFEA 4KK8C 4AEIL 2ESVE 2R23A 2G60L 3KPOA 5JW4Q 3IVKB 4OZGE 3MOAH 1TJIL 4Z8FL 1CYGA 1UYWL 2K9UA 1MAJA 1Q9LA 2B2XL 4Z7VA 4XPTL 3KPRE 4OV6F 2R2EA 4OAWA 4LVEA 4NQCE 1S78D 2BSRA 3IFLH 1QSVA 2F5AL 2GSGB 4K55A 1U92B 3G9AB 1KT2B 3QCVL 5I30H 1T83A 1I1AA 4NZJA 3QIWB 4DN3H 2VDQL 2I9LB 1F11B 2YD2A 2R1YA 4J6RL 3SGKA 4I18B 4U6XA 1A6VL 2P42B 2VSCA 1OB1B 2A0LD 2VUYA 1P4LA 1KGCD 3ZT5A 4HUWA 4WFED 4NQDD 3FQTB 1Y18A 4ODWB 1XIWB 2PF6A 3F7YA 4X4XB 3TH4T 1X6NA 3ORJA 3VWJD 4KTDL 4WNQB 3UC0L 1F90H 3D87B 3PGCA 1E4XL 4YXHH 4WW2F 2FSEB 1GAFH 5A43C 4MA7H 4S11A 3NIGE 1C7SA 1A2YA 4W4OA 1ORQA 3STLA 1TZIA 3CIQA 3K81A 1QFOA 1VFBB 3GSQB 4LPXA 1QR1B 1P7KA 2YEZA 2X4OA 4OCSH 5DEFB 3PWNA 3QNZB 4Z7UF 2IANB 3Q6FB 5CBAA 3DMMC 4MXQD 3VXSB 4HG4J 2DM7A 4JFPA 4LMQE 4QHLA 1BZQK 4LVOC 4R0LB 1YNKL 3AU1A 1IGML 1IT9L 3F5WA 4I77H 4Q58C 4X5LA 1WZ1H 3A0OA 2EIDA 2PNDA 1FP5A 1NBZA 1ROWA 4R8WH 1VADA 5KSVB 1KIPB 4G7YH 3IVKA 5KVMC 3I6GB 5DMIH 3U30C 4YXKH 2JB6B 3P4NA 1Q9KB 1YQ2A 2ZG1A 3FO2B 2DLEA 4YBLB 4KZEL 4F15C 2GTZA 5CP7B 4LNRA 5CZVL 3UTSB 1RZIB 1WIPA 1AGEA 1SBBA 4M6MH 3IKCA 4OZGF 3T77B 5D1XA 4FQXC 4RWYL 3QI9D 1NFDF 3FN0L 4QYOB 3RRQA 4OLZL 5E6ID 4G80B 2VMFA 4Y89A 3QIWA 1IGYB 3C09B 4GRLD 3B2VL 5I1KL 3ZTNL 1A3LH 1B90A 1SQ2N 1OB1A 3NFNA 2XRAL 4KDVA 3SY0A 4OT1L 5CMAB 4KKCD 1RMFL 1EHLL 1XIWA 4CN1A 3PG2A 1RY7B 5HDQL 2NX5D 4K3JL 2E7HA 3HG1A 1R3IL 5DQJB 4PJEB 2ZP0T 4UT9H 2ADGA 5DO2C 2EIBA 1GHFH 5E5MA 1MFBH 1K5NA 4FQQA 3IDGA 4JZJA 4X9HA 4OF0A 3U0TA 1IMHC 4KRMB 2DLGA 1VFBA 3NFSL 4ODBD 1QR1A 3JV5A 3MLZH 4N0FA 5I1DA 1N6QL 3TO2A 1RZ8B 3L3JB 1EO5A 2QQLH 3LD8B 3BDXA 3SDDC 3P73B 4TOYH 4ZS7H 1EPFA 3ESUF 1IBGH 3TYGL 5DJ8A 4PV8A 3VXSA 2CRIA 5IESL 1ZGLP 1NEZB 3MRHB 4KAQL 3QDAA 1MRDH 5BVJA 5TDPA 3GSNH 3QO0A 3FOLA 2CD0A 4WI7A 1QPXA 3F58L 1J8HD 5F7UA 4ZUWB 3ES6B 5GS2D 1PGRB 5KSVA 1KIPA 1LHZA 3GBLA 3Q6GL 2APFA 2VO5A 4GRWH 1JE6A 1PFCA 1MI5B 5A1AA 2JB6A 3BPCA 1UA6H 1N7ML 3VWKD 2AI0L 4PRBA 4AIZA 2HG5A 3D0LB 1X9QA 3CFBB 1RZIA 4HIIB 2WQRA 2ZPKH 3LPGA 5DVNA 3DLQR 1YMHB 1A22B 3U6RA 4ZYKB 1F45A 4XCEB 4PJCF 1CVRA 5LXGH 4F2MB 4G80A 4N1EA 1IGYA 3TNMB 2MWCA 3ROLA 4HSQA 4N8VG 5FCSH 4FQPA 1QZ1A 5TGBB 1U8HB 2HTKC 4PRHD 5E8EB 1OGTA 2WMPA 1DVFD 1T1XA 2D4FA 4XGZA 1BZ7A 5CMAA 2H2PC 2HT4C 4HUUB 3NZHL 2MCPL 3EKCA 3TIEB 1P5VA 5HYSA 1G7MB 2C7UB 4JRYE 3QXTA 4NKIL 4D9QD 3WEXA 4B7IA 3T2NL 5C0CA 3QI9B 4OBSA 5IW6B 1KCSH 1R3LA 1QSFE 3P2TA 4AMKH 1S7RA 4JM2B 1P9MC 1EBAA 6FABL 1QRND 5E6IB 4G6MH 4GRLB 5FOJA 1ZLUK 4NWUL 2OP4L 3ARDD 3W9EB 3QPXH 1NGXA 3P73A 4H20H 5DT1L 3QR2A 3G04A 4ZO8A 5DHVH 1GOFA 2EECA 1U8PA 1FNHA 5F9DC 2X4SA 2ICWA 4BUHA 3VRIB 3EOBA 4F57H 2A6IB 1T66C 1QNZH 4ZUWA 3ES6A 2ESVD 1HDMA 4XAWL 1HIMH 1MIEL 1EEQA 2JE8A 4LK4A 1OAUL 1KIUA 2VYRE 3MRBB 1RHFA 2EDOA 5D7LE 5EWIH 1MI5A 4FZ8H 3GFUA 4OZFA 1BBDH 4MNGE 3FB5A 3KPRD 3OKEB 3KR3L 4Q9BA 4U1GC 2X10A 3C6LD 4GRWE 1XGUA 4HIIA 4K3EL 1GXEA 1YMHA 1BFOA 1PAMA 5F44A 1XF3B 4MJ2A 1ZV5A 3ELAT 2OCFD 2J6EH 4WVRA 2N1KA 1QBAA 5E8OA 4CMHC 3WDIA 2QSCH 4AEFA 3IDIB 4GAGH 3QWRD 3NMEA 1H5BC 3WV0A 3EYOB 3H7BB 2H1PL 1BMGA 3MLWH 4CU8A 5EU3B 5DJAB 2OZ4A 3VWKB 1J05B 3UJJH 1ZT1B 3C5ZD 4PJ5E 1ZHNB 1FAIL 1MF2L 1TCRA 3NCYS 4NDMB 4U1HA 5DJDB 4WI6A 4XCCL 1BQSA 2IH1A 1AGFB 1IGFL 5HHNB 2YC1A 5D7JA 1B4RA 3MR9B 2LU3A 4KMQA 5IW6A 1FH5H 3C2AH 4LRIA 4MJIE 2XKSA 3RNKA 2ERJB 1WEJL 5DI8B 3QAZB 3IT8D 3G6JB 1MAML 4FZEH 1CDCA 5AEAA 3INUH 2PXYC 1YPZA 4PRHB 2FL5A 4GG8B 4L3EE 1DVFB 3GNMH 4LLWB 5JW4M 4K7PX 3LZFL 1H3WM 3W9EA 3KLHD 4FQ2L 4P48A 3MLYL 2Y07L 2BVEA 3U7YH 3WLBA 2JLLA 2B8OT 3UJIL 5EBWB 4MJ4A 5HVHB 3AM8A 5DRNA 1QKZH 4JKLA 1FLRH 3Q1SH 3VRIA 4HC1A 4ODHH 5E8PA 2IPKB 5LG1A 2A6IA 2H45A 3HE6C 1QA9B 1F6AA 3OAUL 5DJXB 1MUJB 5K59E 1F4WL 3ARDB 5IHUL 4F7EB 3RY5A 1HSBA 3V6OA 4IHOB 1KTRL 3EGSB 5TF0A 3ARGC 5JIPA 4J4PD 1OGAA 1MCHA 2OTUA 2FIKA 1FDLH 4Y5YB 3SDYL 4JN2A 1XF3A 4AIXA 3BIKA 2P24A 5BV7C 3CSGA 4NBZB 1IGIL 4N9GA 4X98B 4YO0B 2D3VA 3U0WH 1ERNA 2XG4A 4K07A 3D18A 2ESVB 4GRWF 2FX9H 4I9WD 5DRWB 2MJWA 3T1FA 1KPUA 3HZMA 3SBWA 3RWCA 3TJHA 4QRUB 4KJYB 2RCSL 3H7BA 5DVOA 3TP4A 1IAOA 2UY6A 1NAMH 1NFDB 4XC3H 3S36X 5DJAA 3WIFB 1J05A 5EO9A 3I75B 1ZHNA 5IQ9A 4MMZC 4ETYA 1FVCB 1AGFA 4PJGA 2DLIA 1NBYA 3L7EB 1I8IA 3MR9A 3WL9B 4ZSOA 4ZTPH 4S1QL 5FO9A 1QP1A 4RNRA 1NMBL 4PJFE 5DI8A 1MOEA 5JW5A 1JNLH 2ZCLH 4X6BB 1XMWA 5J1AA 4H0HB 4KC3B 4QNPE 5EPMB 3HZKB 2D9CA 5KS9F 1V7MH 2WWMD 2YSSB 1X44A 1LEIA 1JK8B 1KPVB 3C5ZB 3WXWL 2NY5C 4LBEB 4EDWL 1K8DB 1U3HC 5B21A 5CGYD 3EFDL 4HLJA 3QBTB 1C5CH 2IWGA 5FM5M 1JF6A 2NY4D 2XG5A 4YHLH 1IQWL 3ZKNC 1NL0H 4HV8A 1H3PH 2DM3A 1E6OL 2FNBA 4R7DB 2I9TA 1FVDB 3BEVA 2BNQE 3IU3A 3MLSH 3HR5B 2IPTL 5CHNA 3RUGF 3HZVB 1NCBL 4CVZA 4RMSA 2V17L 4KK9C 2D0HA 4NPYB 3MNWA 3T08A 2VLJB 4Y5YA 5K59F 4JKPH 4TSAH 1BD2A 1AH1A 3O9WC 2DTSA 4Q6IA 5DRXA 2GY5A 4YO0A 2EDJA 1H15B 3JWNC 3RZCB 1A9EB 4QXGL 2QV2A 4KK6C 4Z76A 4L8SA 1KB5A 4BZ1H 4KRNA 2DIBA 3OHXB 5DD5L 1ADQH 1CIDA 4XP9L 4UV4H 4EI5D 4PJCB 4JO4L 2AJSH 5KSUB 4LCUB 4PRIE 2CKBL 3OJVC 4NBXB 4CNIA 3I75A 4YDJA 5ALBL 5CEZL 2IAMC 3RWGA 4P5MA 4NC2B 1FVCA 4NHUB 1AD9B 1S7TB 4OGYH 3LQAH 1QSFD 1OCWH 1UM4H 2GTWB 5JOEA 2VISB 3ARED 5D2LE 3MZGB 4TQEL 1JMXA 4NP4L 2JK5A 3PF2A 3SDXB 4PP1C 4GKSA 3JV6B 3LSOA 3V52L 1IGJB 4QHKJ 3LRHA 1G7PA 5EPMA 1AGDA 5FUOL 2EXYD 2NCMA 3KJ6H 1V8HA 2R1XA 4PJFF 3M8OH 3PP3K 1SBSL 1KPVA 3IFNH 1TXKA 4FG6D 1QPPA 4LDOB 1BQLL 1JN6B 1DBJH 3I9GH 2ZG3A 3P4OB 5HD8C 1NBQA 1FNEB 1KIRA 1RJLB 2A6KB 2GAZA 1MCFA 2HLAA 5H37H 5H37G 1UWEL 3THML 2BK8A 2H2SD 2E7LC 4AY0A 2IPUG 3OSKA 5T3ZL 4R4FH 5JDSB 3SKOB 1BM3L 2AK1H 2YUZA 1TETH 5D7LD 3DX9A 2FBJL 5FYJH 3HR5A 2O5YH 3DO3A 5A16B 3KPNA 2FATH 3HZVA 5JOPE 3SOBL 4XBGB 5MERB 3WIHH 1BVLB 2YWYA 4AM0B 3MRFB 2VLJA 1KCKA 3HI5H 3MV9B 3O0RH 4HK3J 4ODUB 3D9AH 4K94H 2Q20A 1EERB 2VXVL 3HC4H 4PJIB 5JQHC 2Z4QA 3S6CA 4Q7DA 1NGYA 3RWFB 3DXAE 5I0DA 2X4TA 3BE1L 1KTDB 1CICA 4U1IA 1HI6A 1I9RL 2JELH 4NWTH 1X5LA 4Y19E 1RUML 4NHUA 1AD9A 4K3HA 4OIBA 3ABZA 1KIQB 4QGYA 1DZBA 1P1ZB 1DUYA 5IMLA 3B9VA 4QKXB 4PJ9C 3CC5B 3ESVF 4Z77B 1RAMA 3FB8B 3RVTD 4HX1A 2J3SA 2EDLA 3JV6A 1E4WH 1IGJA 3HS0B 4ORZC 4EI5B 3UO1H 3UPAA 1CXFA 1A6ZA 1KBGH 4NO2A 2PN5A 3P4OA 1OSZB 4M62L 3TA3D 2A6KA 4QF1B 3BP5B 4FFVD 2YN3A 2FJGB 5D7IA 1QSFB 1EA9C 2VN4A 3P0YL 4JO3L 5CJBA 3T0VA 4QRRE 4JG1H 4WCYH 3P0VH 4XMPL 4XMKL 4NO0A 2X1PA 1YEEH 2APVA 2R0WL 5JDSA 3KYKL 5CSGA 4RQQB 2XYCA 4YBQC 2KH2B 1KNOB 1ZHLB 2ZUXA 3IETB 4I0CC 5C0JA 4GBXD 3GMRA 1CL7H 2W07A 4L8BA 3U9UB 5I19L 5FYJE 5MERA 5I1EH 4AM0A 4LLVB 5E8DH 3LS5H 3MV9A 1FNAA 2OMBA 3ZT7A 3EO1B 4G8GE 4ODUA 5D7KE 4WI4A 2XACC 4NKOB 2VR4A 4RMRA 3GSNB 5C0BE 1RULH 2ZUYA 1P6AB 3QULB 3N85H 4QOKA 5HI4D 2HVKA 5F93C 3RWFA 1VACB 2VTFA 4MYWB 3RX5A 1WBZA 3H42L 5HHQB 1S5IH 1NLBL 2DWDA 4GRWB 3ARBD 5TF1L 3PWPD 1U58B 5AG8A 4A2LA 2GSIB 2MHAA 3R1GL 1KIQA 3CVHH 3EZJB 4M7KL 1P1ZA 3MO1B 2J88L 4ZS6D 4BSJA 2AQ2A 4P23D 5JMRA 1QSEB 4HIXH 4X7SH 5MP6L 1FRGH 3S5LA 2NTFB 3V5DB 4M43H 4Q0XH 3QWOA 2VERN 2VDLH 3MNZA 4FP8L 3TNNB 1CIUA 4U1NB 1MCJA 2R15A 5I71B 1UT9A 1IAIH 3CFDA 1J1OL 1SVCP 4JDZA 4JKWA 1NC4D 5F1NB 4RIRB 4JY4B 2FJGA 3EYUH 3MRIA 1QVOA 5DUMH 4PGJA 5KS9B 1RIVH 3QIBA 1JRHH 1EEZB 2XWBB 3DTXA 4J3SA 1K4CB 3VXUA 3G5YA 4ZFGH 3MJGX 3OTTA 1S9YA 2WIIB 4X6CA 1VPOH 2W0KA 1VGEH 1TTUA 4HMCA 5LWYL 3MRNB 4K9EL 3I50H 1OAQL 4LSQH 4WUUE 4M7LL 5JA8B 4DN4H 2QSQA 4H88H 4JFOB 1GC1C 1X5GA 5DEZA 2F5BH 3SQBA 5A2JH 1KCRL 1NCUA 5D9SA 3X12B 1K3IA 4BUGA 2EZ0C 3WHE0 1MCPL 1KJMB 1JGLH 3RP1A 4Q97A 3RUGB 1G7LA 5KVGL 4P46A 2GKIA 4NKOA 3QDMB 1Y0LB 4P2RD 5FUZL 1JYWA 2P5EE 1NFIB 1EHNA 2JJSA 3MV8E 2VDPH 4JR9L 1EXUA 1L7TH 1VACA 4PRID 4UB0H 5B38G 2EDQA 4QRTB 1IL1A 5HHQA 2IQ9L 3MV7D 4LEXH 3QDGB 1U3YA 1WTGT 4CU7A 5T1KD 3IJSB 5KBNC 4Z95H 4G9FE 1U58A 3MJ7B 3ZDXF 1RUKL 3UTZB 1JI1A 3MO1A 5FCUL 5IJKA 1JFQH 3FT2B 3CH8A 3FMGH 1QFWL 4HAGA 4TUJA 2HA1A 4LSUH 3A6BL 1HYSD 2AJXL 2NTFA 3QFDB 1IAII 2IEPA 2YA1A 4LQFH 3EJYC 5BXFB 5E4IA 3UTPE 3WHE1 2VLKA 3TC9A 1KB9K 3RVUD 3QDJE 5KTEH 1GGIL 4CJ1A 3F7VA 1JRHI 3ARBB 4U7KA 1DQJB 4XNZB 3PWPB 4RFOL 4C56E 4JY4A 5DVKA 2FBOJ 1EEZA 4P23B 4PJFB 1MNUL 3K4AA 3LN5A 2PCPB 1TNNA 4EXKA 1QBML 3VFGL 4XI5D 3KS0H 5JIIA 3BUYB 3HE7B 4N0CD 4LHUA 4U3CA 5BVPL 1YY8B 2CUIA 1BFVL 1NC4B 4LSRL 2B39A 4MDJA 4X9FA 4HJJH 4F8QA 4L1DA 4NO3B 3TN0D 1O7SA 3D39E 1HH6A 4TSBL 4I2XE 3QDMA 4XCNA 1KJ2L 4Z78A 1WWAX 1TPXC 1HHJA 2XWTB 3LEVL 4HMDA 4Y4FA 1MFDH 3U4AA 3VH8A 2J12B 1CD9B 3WE6A 3MGTA 4QRTA 4Y19D 2X40A 5LAXB 1WZKA 4KMLB 4KDTC 3KS0J 5B4MD 3QEQA 4PJAE 3GHEL 3MJ7A 3UYPA 2B5IB 2VITA 2BVYA 3UTZA 1TZGL 3CX5K 2JCCF 2VRAA 5A3ID 4I48A 3IXTB 1TQBB 3DOSA 4WU7B 5CJOL 5L8JB 4P2RB 4P99A 5D1QD 2FO4A 1GZQA 3HN3A 2O93L 5KVFH 4LARL 1T1WB 2XZQL 4D9LL 3MV7B 3FQNB 4G8IA 3MNVB 5F7DA 5T1KB 1D5XA 3DECA 4XPBH 5FF6B 2HTLD 1DQJA 4NT6B 1IM9B 4BSVB 3GB7A 2NQCA 2FB4L 5HHXL 3QUXD 2VDKH 3A67H 4K8RC 1FYTE 4ZOEA 1O7VA 3O6LH 4IRSD 5JORA 1A6UH 1MRCH 2HLFC 4GKOA 3V5KB 5CBEB 5IFJB 1INDL 1DN2A 4S2SA 4ZUUA 1UXSB 3U46A 5IBTH 5J11C 3HE7A 5GRVL 3ZHLA 3HB3D 4Y8AA 3TVMC 4I3RL 1EO7A 1EFXA 1LO4H 4YHMH 4NYLB 3VI3E 3BN9D 2OK0L 4QHNB 4JRXA 4L9LA 1M7IB 3L3OB 3W0WE 5FYKL 4G8FA 1LD9A 1OAXH 3P9MA 4G8GD 5EZLB 2QQKL 2X89D 5D7KD 2ITCB 2CR6A 4XTRD 4PJHB 3IRZA 1KF9B 4JVUA 1N64L 5L9DH 4YPJA 5DJCB 4X6DB 1Z3GL 5IT2L 3FOMA 5DDHA 4YUEL 5JXEA 2C4XA 3ARFA 3Q0HA 4HH9A 3OGOE 3TBVA 3BZEB 2QHLA 5DK0B 1F13A 3N1FC 1C16A 3L5JA 2HRPH 3OXSA 3TN0B 3G08A 1MCCA 1G0DA 4HUXB 5IMMB 4AZ8A 2FHBA 3W11D 1XGRB 2AXGB 3FQXB 1MCDA 4PJAF 5E9DD 4TVSa 4LNVA 5HVFB 3FFDA 5L8KB 5GPRA 2MCG1 2CKBB 4MSWB 4TVPH 3H0TA 2PR4L 1KOAA 3ZE1F 2B20A 3BKCL 4XNMA 5IB5B 1C8PA 1KFAH 3DIFB 5DSCB 5EFIB 3MUHL 5CLTA 2H8PA 3GGWA 5FECB 3QXVA 2H6PA 3TV3L 5KAQG 4DGIL 1ZS8B 5HYJE 5L7XH 3BSZH 1LDPL 4WWID 4JVPA 4GMTH 1FLTX 5D1QB 1KPRA 3PE9A 5EOTA 5AZEH 3P30L 4BJLA 4LPVA 5IB1B 4WUUD 2R4SH 1AFVL 5EH1A 1F3JB 1NMCC 4OD2A 3GI9H 5FOBA 3O3DA 3GSVA 3QP3A 5E70A 5DD1L 3L3OA 3LHPH 1LEGB 4Y1AB 1ACYL 3B5TA 3HI6H 3IDUA 3GI8L 3QUXB 3VI3F 4M3KB 2ITCA 4IRSB 3VMOA 7FABH 3DBXB 4PJHA 4KPHH 3MV8D 3TBTB 3ULUC 2Z8RA 1D5ZB 4GRMB 4HK0B 4X6DA 5DJCA 3MBED 1FZOB 3RA7L 4XXCA 1U8QA 2ITDA 3T4YB 3S4SB 4RGOH 1M7DA 3PL6A 4G9FD 4LDEB 3TO4A 4W4OC 1ZA6B 3QJFA 5A2LH 2Y9RT 4OM1L 5FHAH 1GOGA 4JO2H 4HUXA 4X4YB 3LB6D 3HPLB 3O3AB 3IGAA 3OKYA 3PGFL 4QTIL 3FQXA 3JWOC 4FFZH 4MB4A 3IAPA 5GRJH 3VFTA 3RTQA 2DDQH 3KJ4C 4MSWA 1T21B 5DUBA 3MGOA 4OGZA 4S1RL 3UTPD 3HFMH 5ID0A 5JXAH 4M5ZH 3BO8A 5ITFB 5C2BL 1OAZH 1PG7H 1YQVL 2VLME 5IHZA 2YXFA 1A7OH 4TVPE 4WV1C 5EU6A 3GSOA 3UROR 4P9HL 1RIHH 2VLRE 1YUHB 1ZS8A 1RFDL 1CLZL 4MMXC 1BF2A 1VFOA 3C6SB 1J9CT 1YEKL 1XR9B 4RWHA 5E9DB 1UACH 1PJ9A 3PHOB 3ILPB 4ERSL 5D1XC 1L0QA 1Q0YH 5E99L 4YC2B 3UTQB 4HGWB 1IFHL 4HS3B 3KYMA 3VJ6A 4WI3A 3ZTJH 1KENL 3ZTJG 2HJKA 2HVJB 4GJTB 3WNMA 5KZCD 4A6YH 4Y1AA 1A6WH 2GT9B 2MNUA 1Q9WB 4QHMA 3D39D 2WBJD 1JGUH 3TM6A 1N3NB 4MCZB 2R0LL 4EBQL 3DBXA 1XGYH 1U8OB 1KN4H 4M6OL 1VFMA 1OP9A 3EO0B 4WUUB 2X5PA 5DMGD 4PREA 5I30L 5CIPH 3T4YA 3PXJA 5C92A 1KEGL 1D5BA 4MQTB 4WI5A 4HCRH 4JZJC 3RWEB 5AYQA 2B1AH 4MDIB 3HNVH 4KFZC 3FHQA 3QUML 4KVCH 4OFPA 3GIZH 3OKDA 1S5HA 2XQBH 1CWVA 3UJTH 2NR6D 4MQXC 3O3AA 2DIAA 3DUUA 5D5MB 1Y6MR 2MQ3A 3MBEB 2JCCB 1R3KB 3UXFA 4NRXA 4G9DA 2FGWH 2X4UA 3AAZB 4JM4H 1Z5LB 4OCSL 3BH9B 4X6EB 3QCUL 4X8XA 5EUKA 4NUGL 4LSVL 2W9DH 5JZ7D 1F4HA 1FYTD 1C5BL 2E7MA 4NN7B 3STZB 5EDXA 5JO5B 5I16B 3SGDH 1BEYL 1E0OB 3JWDC 3CVHB 3NH7H 5EUOE 1DFBL 3BH8B 3OKLA 3PNWB 4I77L 5DD3H 4JRWA 1WZ1L 4ISVA 2VABB 4HGWA 1RU9H