1S7VB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 15
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7vB00
3DBXB 3IDJB 3EOBA 3ARYA 5C07A 2NY5H 2R0LL 1QSFE 2K7QA 5FYJH 3CMGA 3EOYG 1QZ1A 3ES6B 3SQOH 4Y2DD 5E5MB 4M48L 4MS8C 4O51B 4PJBA 4XP5H 1EEZA 1QFWM 3EKCA 4PP2B 1NFIB 2AXHA 4NQXB 1X4ZA 3G6AB 1J11A 5I74B 4XGZA 2VAAB 3KHQA 1P7KB 2AABH 2NY6D 2H32B 5JPNA 5B22A 4AIOA 2OTUB 3Q5YA 5DK0B 1CDBA 2IC2A 2EEAA 3GFUA 3C6LD 5SX5K 4OM1L 1C5DB 4NUGL 1G0DA 4ORGA 4OQTH 1NGXB 2AXGA 2F5BH 4MA8L 4ZS7L 1W72B 4PJ5D 5H8DA 5L0QB 3D3VD 3QUYB 3ZE1E 4ZFZA 3IU4L 4PTTA 3FZUC 4PJ7A 4DGVH 1HYRC 1NFDA 4OCWL 4U6TA 3GJFK 4RRPA 3C6LC 3DV4A 3C60B 3H42L 2NZ9D 1A6AA 5EO0A 3BDBA 2AK4B 5EUKB 3S96B 5C86A 2QSTA 3I2CL 1FVEA 4ODTL 3VGAC 3TH2T 5DFWH 2CDGA 2YD9A 3U4BL 4WHCA 4G7VH 5KBNC 2OL3B 3KYAA 4L3CA 4OCSH 4YQXL 4JM4L 4KJWC 1P4BH 3RVWC 1JWSA 4HIHA 4PRBA 5KVEL 2R1YB 1OTUD 1UKQA 2XI9A 4PJAF 2ED7A 4PRIA 4G42B 3U9UB 3L5HA 4FG6D 2R2EB 3QDMD 2E7MA 3VW3L 5MENA 4GLRI 3VD5A 4KZDL 3MCLH 4P5TC 4WTXA 1HSAA 1XGUB 1RZJC 1EPFA 4TRPH 5GGRA 5JIPA 3D6GA 3ZDXE 1ZGLA 2UZYB 1NFKA 1T1ZB 2XN9E 2FZ3A 3QH3B 4QOKE 3N85H 2DTML 3R1GL 2CMRH 3K4ZA 3MOAH 2VC2H 4HG4J 4X6DF 1W0WB 3BGMA 2E27L 3HC4L 1EBAA 4K94H 1DBMH 1WIUA 3B9DA 3GI8H 1CG9A 4C56E 4Z76B 2DAVA 1G7QA 2XACC 1U58A 1I1AB 5HHOE 5MHSE 2A74A 3GSRA 3FN9A 2H32H 5D7SH 2LTQB 3RJDA 1FJ1B 4YR6A 3ZL4L 3RBGA 3X3FL 2KDGA 1D6EB 2I60L 3GSNB 5BVPH 1TQCC 5LJYH 4F9PC 2X4UB 1LDPH 4L9LC 1R0AH 4HV8B 4G8EA 1U2CA 1KIRB 1U91B 5C2BL 4XP4H 3DGCR 1GC1H 2VLJB 4GMTL 1U8IA 2DQGH 3BZFA 3D0LA 4JM2F 4ZTPL 1CL7L 4ENED 4M5ZH 1UFUA 4RMWA 5D1QC 2XNAB 4Y8AA 3U30B 4E5XB 1T0NB 1GIGL 2E9JA 3BKJH 1PKQB 3KPOA 5BRZE 5IW6B 4UT9L 2E7BA 2R2BA 2FEDD 1JHLH 3LDBC 1X5ZA 3EJZD 5DJ6A 5CBAB 4KVCL 4S11A 5D1QD 4QCIB 4X9BA 2VMFA 1RZ8B 1BEYL 1DVFD 3ARGC 1E4WL 1T0MB 4JY6B 3ULVE 2AEQH 1FL5B 4Y19B 1BVKA 4BH8B 3BWAA 2H6PA 4LFHG 3RQ3A 2W9DH 3BJ91 3U46B 1LDSA 4HQQL 3NCYP 5DRWA 2I9TA 3PV7A 5DMGC 1CG9B 4Z76A 2HP4A 1I1AD 5JPMA 4XGZB 1TITA 2FYYA 2VQ1B 4ONHA 4HK0A 1CD8A 2EC8A 3GJFA 4EQ3A 4HPOH 5F7MC 1CGUA 3PWJB 4HZAA 1B6UA 3GHBL 5E03A 1O0VA 5CUSL 3V7MA 4C55A 4DOHB 1MI5D 1ZGLP 4Y16A 3FMGL 5D6DC 1PSKL 3NACH 3DHMA 3JWOH 5A1AA 1H8NA 1OGAA 3BO8A 3D0LB 1MQ8A 3ZO0A 1UENA 4X8XA 1NGWB 5INDA 1UEYA 4FG6C 3NFSH 1P5UA 2ITDB 3JV5A 4W68A 4J8RA 1IGML 4KMLB 2XA3A 5E9DA 1U8PA 4YLQT 3GSNL 2JKXA 5EPMB 4XAKE 3S5LG 1JWSB 1EZVX 4MNQE 3H3BC 4MQ7A 3SDDB 3VRJB 4NT6A 5IB1A 3KPQA 1T66C 2EYTB 4XP6H 3O6MH 5HYSG 1IQWL 2DLTA 4JFEA 1LP9B 3IKCA 1ZMYA 5EWIH 5JO5A 3QUXC 3REVB 1XMWA 1MI5B 1KPUB 1VB9A 1F4WL 3D87B 5FA3A 1VGKA 4HDIB 5IVXA 1IKNA 5J9PA 1I9JL 4V1DD 3KAAA 2W9LA 1DBBL 2EZ0D 1DBJH 1TZHA 5EO9A 5TDOB 1S9XA 1PAMA 5D5MB 5J89A 1HDMA 4LSPL 4N8CH 4Y19E 3W9DB 3QIWB 1W2KT 1Y0LA 4HJJL 4G6FB 2XG4A 2EXWD 3MLTA 4PJGB 4K55A 5FYKL 4NRYA 1EHNA 1A4JB 3FFDB 3VGDA 1L7IH 3MV8A 1T0PB 3SDXF 2R0ZL 4M93B 2R2HA 3CCHA 3KYNB 3SCMC 1IL1B 1LVEA 5KS9F 3OF6D 4ODHH 1PG7L 4Y2DB 3WNOA 1PVHA 3NAAL 1RIVL 5MEND 3P4OB 1IGTA 3S3PA 2D9QB 4ETQA 2BRRH 3LRSA 4CNIA 2AK1L 1T1YA 5EU4B 3S4SB 4I4WA 4OJFL 5CSZB 4M7LH 1FYTB 4HMCA 3ARFA 3U0WL 4OD1L 1K9TA 3E6FB 3LKNB 4IBLT 1EAPA 4YK4B 3MROB 2V9TA 3AREC 1DUYB 2NY7L 2GAZA 5DLML 2X4RA 1BZ7A 4APQC 4XCCH 4NWUL 3QEQB 5HHOB 3P30H 3P40A 2IALA 4PRDA 5C3TA 1MWAL 5L2JB 3HB3D 1WC7A 2ZNWA 1A1NB 1TNNA 4FQLL 4FRWA 4N9OB 3W39A 4HUXB 4JFQB 3Q2CA 4WDIA 4WFGE 4J6RH 4WUUD 3GMPA 4YBQD 1YY8A 5EZJA 3TT3H 2YUXA 3FRUA 2D7TH 5JR1H 1J8HA 3RVXC 2JE8A 3VI3E 2BOBA 2XQYK 5DHYA 4HULB 5JIIA 3LQAC 1DEEB 2VDOL 5DC4B 5D7KD 2GTZA 1CDJA 2DQTH 1MFCH 3MV9B 2CLVB 4OUUB 3X12A 4HGMA 1FL6B 3WD5H 1P9MC 4FP8L 4GG8B 1J0KA 4MB4A 4DUXA 3MUGB 2GQHA 3WEXB 5DQ9B 3HE6D 1BD2D 4N90D 4UT7H 1YQ2A 4LSVH 1IGTB 2ZCHH 2KH2B 1JF5A 3R0MA 4GKZA 3TIEB 4OUOA 3V0VA 1OAQH 2W92A 3VFNB 4CMMB 1KTLA 5JDSB 3RU8H 3TZVA 1DE4A 1NMBL 3SGJA 4BM7A 3E6FA 2OZ4L 4NZUL 5KSBA 4F15C 1OW0C 5CGTA 1ZT4A 1IM9B 1MEXH 4JKLA 4J2XA 1EERB 4FABH 2YPKB 4QXGL 4JFFD 5KTEL 3STLA 3B8YA 3BVNA 5BJTB 5IT2H 2FECL 1UWXH 4S10A 1A21A 3U0TB 3GRWA 3NN8B 2FO1A 3P0VL 4KXZH 1G9MH 5DUBB 2FJHB 5EOCJ 1PLGL 3P0GB 4U1JB 5T3XH 1X5LA 1BJ1J 4OF3A 5H94B 3BE1L 4NQEA 3S37X 4ZUTB 1YJDH 1UA6H 4RMVA 5L2KE 5D4QA 5CLTA 2V6HA 3TM6A 5EC1B 2JB5H 3EDKA 3WO4B 5KG9B 4HKXB 2WMPA 4K3EL 1NQBA 4LPWA 2Y06H 3NA9L 3ILPB 4MNHB 3GSOB 4V1DA 1JFQH 5F9AC 4A6YL 2GSIA 1VEOA 4KI1A 3GDBA 1T5WB 3GI9L 3QUZB 3DUUB 5FM4A 1B0GA 3DUSB 3M8OH 2J8OA 3BXNB 3EOAA 4UOW1 1A7NH 5KVGL 4WO4A 1CFSA 3ESVF 4TQEL 4JFHD 2N1KA 1UH3A 4Q9QL 5ICYB 4ZUUB 5HHMB 5DJZA 2WQRA 5CJOH 3SDCA 1KJ2L 4ZFOL 5D7JC 1KTLB 2OI9C 1EVTC 4ZOBA 1V7MH 4QO1A 4PGEA 3BEWA 3SHSA 4WEBH 4ODTH 3GB7B 4YR6B 1ZVYA 3N9GL 1GGCH 1YPZB 1IGCL 2CDFB 2VAJA 1CLYH 3KYNA 1U3YA 4KMTL 4X6BA 4CU6A 4BZYA 1IC4H 3AGVA 4Y2DA 4Y5XC 4R97B 2R0WL 3IKKA 1E0OB 5EUOF 4WW2B 4IRSA 4RMSA 3DSFH 2X40A 4WW1A 4KZDH 5IGXL 3MCLL 3OXRB 3DROB 4RQQA 3C6LA 3A67L 2OJEA 3LCYA 3ILQD 4P4KD 3MQIA 4WWKA 4DQOH 3L3JB 1T5WA 1IAOB 3B9VA 2H9GA 2P5WE 5CP3A 1KEMH 1U8PB 1VADA 1QPPA 2N4IA 3WIHA 1RZKH 4LEXH 4PJXF 2NY4C 3CLEH 4P46B 2EDDA 1T7VA 1XGYH 3GSXA 3T0EE 4NGHH 5TQ2H 1CTOA 4HD9A 4WFHD 4PJ5B 2BDNL 1ZVSA 3CFJB 1PX4A 5C0GB 1R3IH 1R5IA 5I2IA 4P99A 1AI1H 1SJEA 3FAWA 4F58H 3AU1A 2X4SA 4OIAA 5E1HB 3C2SA 4RA3A 1DTUA 5HHNA 1D5MA 2IAMB 1YPZA 1QLRB 2BY3A 2P5ED 2DM3A 5BVPL 1MLBA 2XN9A 5C9JA 1BIIA 1LD9B 5A2KH 1FSKB 2O5XH 4EIGB 3FQUA 2V2WB 5EBLB 5BVJA 1AGCA 1B2WH 1UWEL 4PGBB 1S7XA 5CZVH 4IRSB 1E28A 3NCBB 3CVIH 3WJLC 3V6OC 2VKXA 4U6YB 1G7QB 2BHUA 3FOLA 1A0QH 5T3ZH 3TJHD 3UAJD 3MV01 1BX2B 1ADQH 2XTJB 1R24B 3S8WA 2OS7A 1VA9A 1JGVH 4H1LH 4LVOC 5F3HA 1BZ9B 1FVCA 1WCQA 4WUKL 5EBMA 4N0FA 3NN8A 3CNKA 3WFBH 4UV4L 1JUFB 2XZZA 3OXSB 4JKPH 1BAFH 3E3QE 4NQED 1KPVA 4R9HA 2NY1D 3H9SA 3SGDI 5D1XC 4NN7B 2YUVA 1A6ZA 3X13B 1WLHA 5M94B 4OKDA 5D1XA 3T0ED 4NO0B 4U1HB 3L1OL 3RL1B 3F7QA 3D25A 4Z7UB 2ZOLA 1U3HD 4UINH 3ELAT 2OSLA 3CVHH 2D3VA 2JB6B 3OZ9L 2PCPA 1MFBH 2NY2C 2XA8H 4ZPVA 5IV2B 3GMNA 2VLME 4UZGA 5EBGA 5HYJE 4G6AC 1MHCA 1KCSL 5M95B 2VQUA 3SDAB 5TDOA 3IT8D 5E8NB 5L2JA 2P8MA 3HLAB 2ZUQC 3DXAE 4V2CB 2ICWI 1AC0A 4P48A 2EE6A 2NY2D 1K4DB 4O2FA 1U8QB 1NGZB 4XPGL 3MV11 5FGCE 3RWIB 3KS0J 4G9FD 2ICES 4PJDE 5IFAH 1GXEA 3HZMA 5A3IC 1K85A 3DGGB 5L2KA 1CIUA 1T5XA 4PBWD 5AAMA 1FCGA 5GQBA 4KJQC 3PWPA 4U6VL 1TTFA 2R1XA 3S3SA 3TT1H 2OJZH 5FFLA 2IANA 2A6KB 5HYJA 5C07E 2H1PL 5ISZA 1BZ9A 1F3JB 1KTKE 3P2TA 4XAKD 5IBLD 2UUDH 2PTTB 1ETZA 1CICC 3ZDYF 1TJIH 1KYOK 3HI1B 2DKUA 3ARQA 5FKAB 3WV0A 4KPHL 4ZFOA 4UDUB 3BWUC 1KCRH 3DYPA 4I0KA 5KVDL 4K23L 1UM5H 4NO0A 2VH5H 5F3BA 4JANA 2VR4A 5L8JB 2ILLA 4MLSA 1FC2D 3GMOA 4GBXC 4HX1A 4MNGE 2EDEA 4K94C 3MRIB 2J88L 6FABH 1LK3L 5JLZB 3T09A 4WHDA 3OB0H 1RMFH 2ORBH 4PRDB 4M9PA 2CRZA 4HKBA 4XNYL 4EI5B 3VI4F 5HPMA 4YHPB 5F1NB 1Y6NR 5IM7A 3KPSE 4HF5L 4IIQA 5DA0B 5HHXH 4TOYL 4N8CL 4OGYH 32C2B 5AYUL 4NQCE 4C4KO 2BSED 1NGZA 2X41A 4TUKH 5F96L 3F7RA 1J8HE 4R4FH 3NCFB 2O61A 1OLZA 3KPRB 5FO8A 4P2RB 1JGLH 4G80B 1GPOL 1HKFA 1W0VB 5IVXB 1CXKA 2NY0D 3CX2A 4A6YB 4PB9H 4NQVA 4XBGB 3TWCL 1F3JA 3QUZA 1XIWB 1NBQA 1CTNA 4PRAB 4WHYH 3NPSC 1MPAL 5F9JA 1E6OH 1G9NL 2X2YA 4HCRH 3IXTA 4MAUL 1V3LA 5FO7A 3QDJD 3HRZA 3BZEA 1FNFA 4ZFOB 2DL2A 3BAEL 4X4MA 3OKMA 4G6KH 4U6HB 5FYKU 5K9JL 1KELH 3BPLB 4BSVB 15C8H 3KJ6L 5E94B 4H1LB 2P43B 5JMRA 4PD4J 5DLMH 4XCCL 3U4EB 4P9MH 1YPZF 2MPAH 4JB9H 4ZUWA 3T0BA 4A2MA 2MSPA 1T21A 3SO3C 4AM0B 5CJQH 5FOBB 3PUCA 3CFEB 4FFWC 3ARGA 4Q97A 2IQAB 4FQLH 1RZJL 3UYOD 1IAKA 1N0XL 4LVNB 2Q3AA 4A2LA 5C8JB 4NRZB 3JV0A 3QWQB 4QKXB 2E9BA 3HUJB 2FWOB 4HW6A 2WINA 4EZMA 4NQDA 4K07A 4F7TB 1M05B 1A2YB 3MNZB 3RNKB 4PJ7F 4JVUA 1MCBA 5I6XB 4CW1B 3VGBA 4O5LH 2CIKA 3NFNA 5EOTB 5KS9B 1FIGL 4HBCL 5K59F 1QFWH 3P11L 4Y4KD 4L4JA 3HAEG 4UT7L 1X5XA 3O11A 1ULVA 3DV6B 4RFNC 2D03L 3LKOB 3OHXB 2UWEB 5IEHA 2EYTA 4MJ2A 1J10A 5C2UB 3ALXA 2DLGA 2ATPB 3HZMB 1PYWB 2A2QT 4ERSH 2NY6C 3H9ZA 5EBWB 2VSCA 3QHZH 4HGKC 4TPRL 2OXHA 1IEHA 3TBTB 3QG7H 1HHJA 1A3RL 3DMMB 5AZEL 1CE6A 5I66B 4HK3J 1QSVA 3BQUA 5C0CB 4NO2A 1S7QB 2QQKH 1KYOJ 1KIQA 1WZ1L 1FFQA 4GBXD 1QFPA 3ZTNL 1D6EA 1EJOH 4O00A 4XPTH 3BUTA 5C0AE 1R5VA 4ZXBA 4QRPB 4XWOD 1A5FH 1TTUA 1NBVL 4YHIA 5J1AB 2NX5B 1AJ7H 4ZFZB 3QPQD 3EBAA 3LD8C 2KQNA 2DBJA 1T4KA 3HNSH 4Q2ZA 5D2NA 1JPFB 3HE6C 3TF7C 3VI3F 3DV4B 6CGTA 3MLZL 4HFUL 1S7SB 3CSBA 4C56D 5DGQA 1INEH 1GGTA 5EG6C 2H26A 2D0FA 1I1YA 4OZGE 4M1GH 4GG6A 4CKVX 4UIKL 3GMQB 2P24B 1RULH 3D39A 4WNQB 3RKPA 5ADOH 1QSFB 1V3KA 1IEBB 2V7HA 2UZXB 1JZ2A 5CJOL 4AG4L 4YHOH 2C3GA 3QUMB 2WBJB 1A47A 4LAQH 4FQIL 5KSVB 4AQOA 2FBJL 4UU9A 4PRPD 5F8RC 1S7RA 3E0GA 3EO0A 4RGOL 3W2DH 1CE6B 3N9GH 1L0YA 2B1HL 4FZEH 2HJLB 1IC4L 3ZHKA 1ZGLB 3BKMH 3G6JF 3D0VB 3TNMB 4ODWB 3K1DA 3ARFC 4M48H 4WHTB 2ARJA 2VDMH 4WI8A 3RA7H 3PQYB 5I76A 1QACA 3ARBD 1HWGB 3OJMB 2N7AA 4LARL 1N7ML 5GJTH 3RPIB 2FR4B 3K81A 4YE4H 3GIZL 1D6VL 2RR3A 4NN6B 4X6BB 3MUJA 3HPLB 5HDBE 3V95A 2VLKB 1SBSL 3WFEL 5J13B 4FFYH 3EJYC 2ED8A 4XBPB 3EO1B 4NO5A 4OFYA 1MCKA 4N5EC 3IU4H 4I3SL 2NW2B 5F89B 2VN4A 4UQ2A 4WFED 4PRHD 2V7HB 2FWOA 3ZKNC 5F7DA 5TE4L 3T1FA 3QIBB 4JQVA 4PJGE 3BYTA 4PBXA 4PD4K 4C83B 2SEBA 4NQSB 1AI1L 4X80L 3MRMA 3D18B 4LSSH 3LEYH 4NM4L 4WWKB 5D2LF 3T4AA 4LU5L 3WE6B 2QADB 3QNYA 4TNVF 2ZKHL 1QQDA 4I48A 4ZD3H 2RCSH 4FXGA 3WJJA 4GUPA 3I9GL 5ETUA 3HE7C 2RGSA 1NDMA 1INQA 1WTGT 1N4XH 5DJXB 3LZFL 2GY5A 3HZVB 4UIMA 4PJIB 2AAVA 3LIZL 4D9QD 2CSPA 2DMKA 4FS0A 3WYRA 4U1SA 1P4LA 4XNMB 1T22A 2EECA 3RHWK 4DVRL 1KENL 3VD7A 5CSBA 1UYWH 2GJJA 3ARBB 3CDFA 4YHKH 1TJHL 4Y5XA 1P6AB 2PUQT 3TFKC 4N1CA 4J3XA 3ALPA 2LE9A 2VE6A 5ACMA 1LO3H 3RTQA 1CGYA 1JI2A 1J0HA 1U0QA 5MHSD 3FT4A 4O9HL 1KN4L 1H3UA 3IXAA 3WUWG 1IC5H 3DVNB 1I7ZA 4DCQA 3GZKA 4OZFB 4UDUA 4PREB 1C08B 3VXUD 3MLYH 3QQ9C 4QYOB 1MLCA 3LQZA 1WEJH 4HC1H 1B0RA 1HH6B 5GRVK 1FORH 3V5HB 2X4RB 1OCWH 5M7QA 4J3WA 4BFIB 2XWJA 1KCSH 3DRQB 4ZOEA 3VWKB 1GZQA 4J8RB 2KZ1B 2BX5A 4ZPTB 2IH1B 1FZMB 4CDGC 2A0LC 1GC1L 1VDGA 3KPMA 4JHZA 5IVZA 2ZOKA 3IS0X 3MSPA 4KAQL 3VFRB 2MCPL 1QBBA 4WW2A 3QQ3A 2A83B 5JW4R 4QHUA 3BIKB 3RL1A 4CJ0A 4NNPL 4F9LA 4CAGA 4M7JL 1M05A 3IRPX 4PJBE 2AJYH 2Z31A 4FQCL 1OAUL 1KJ2A 5F88B 2LU3A 1AGEA 1F2XK 1Q38A 2OJZL 3QIUD 2DQIL 3CSYA 2EICA 5DFVC 5CJBA 3ZHLA 4OLUL 3T3MF 2LFGA 4I2XB 3ARUA 5D9SA 2X1WL 5CGYD 1RUPL 3FO0H 2LAGB 1E4WH 4OI7A 1ZT1B 2ZSWA 3TCXA 3VD3A 2R9HC 5CZXD 3IXTB 4HIEA 3MOQA 3VGGA 3CUPA 3TBYB 1WWAX 1WBZB 3QXUA 4JY6A 1RVFH 3DGGA 4G6JH 1DN2A 3BWAB 5FK9A 4KY1H 4X7TA 4D0BB 1Q1JH 1OY3B 3CVHB 3QBTB 4XNUH 1U8JA 5F7LB 1DLHA 2OK0L 4XI5C 5C0CA 1BQUA 3V0AC 5EUOE 4U6XA 5E6YA 1YC8A 2YD2A 3I75B 3RUGF 2YSSA 3GBML 1EUTA 1F4XL 1P2CA 1OGTA 5F1IB 5DZNA 4WHYG 5FKAA 3WNPA 4EXKA 4ALAH 5CP3H 2PYEA 3DTXA 4EUPG 2OR8A 1U8LB 3FO9A 2F53B 2GITA 4R4FL 4M8QB 1NC4A 3WFCH 2Z93B 1QKZH 3G04B 3NTCH 4Z7NF 3E3QC 4Y88A 3LKSA 1FO0H 2AV1A 2MWCA 5HHOA 1AE6H 5EZIH 2DICA 3O9WD 4JR9H 4R26L 1PQZA 4NO3B 4I9WE 2R69H 2DS4A 1ND0B 2HG5B 3SJVA 4ZYKA 5J6HB 5FV2A 4HWEL 4QRPD 1KT2A 4KDWA 2CLRB 3C6SB 4L4VB 1YY8B 5EZJB 4HXBL 5EWIL 3ZMRA 1L9MA 5FUCC 2HMID 2K3TA 2NY3D 3UO1L 5T33H 1N3NB 4XC1H 5I66A 4I2XE 3MRQB 3VXSD 3HTLX 2RFXB 1INDH 5HYIA 4Z9KB 3N50A 2CDFA 3PDDA 2HKHL 3N06B 5ITBL 4LGSB 2PYFB 4PP1D 1WQVT 4LLMA 2FD6H 4FQJL 2VJXA 4RDQF 5MEPA 4S0SD 3ZSSA 3VFMA 4Z0BH 3OAZH 1QBLH 3BO8B 2NY0C 5I76B 4Z7VA 4AZ8A 4WVRA 3FTGA 1OTSC 4QRUA 4JFFA 1SYSA 1UB5B 1P7QD 3LQAL 2CPCA 4RNRA 1KIPB 2GFBB 3CJJA 5F9WC 3U4EA 3IDXL 4WV1A 4POZC 3KPNB 2VDQL 5ACZB 4PJDF 5C0AD 4MCYB 5INCB 1XGTA 3MPCA 1I7UB 4GT7A 3BZ4B 5DYOB 5JXEA 4BUHA 4NKIL 1FBIH 2V2TA 5CS7A 2YXMA 4JVWA 3RKDD 2WINB 3K8MA 5BMFH 3CH1B 4KXZI 2QSCL 3S4SA 2FBOJ 2NXYB 4EUPA 3TVMC 3QCTH 5IVNA 1ZHLA 5I75B 2CD0A 1YEGL 4WJ5A 3FONA 3TIDB 1I7RB 3QJHB 2FEDC 4KTEH 5A16B 5KSAB 1GJIA 1WTLA 5CBEA 3TH4T 1QBAA 4MJIE 4L5FL 4YK4C 5GGQH 3U9PL 4OZIA 5BS0A 3BESR 5DJ6B 3GSOA 4MZ3A 5B38A 3VXME 5IHZB 1CLZL 4OI9A 4PRPB 2BSRA 1ZA3B 2DI9A 2PYFA 4H0IA 1JWMA 3O9WB 3ZLQC 4HWZA 1BVKB 1CD9B 1NPUA 3CUPB 4NJ9H 3TBYA 2D31A 2X4QB 3LKPB 4PV9A 3E6HA 1E28B 4LDEB 4IMLB 2BOBB 1X5HA 1N8ZB 3G5VB 3MGTB 5CHNB 1F90L 2O5ZH 1MIEH 4OLZH 4JPIB 1YYLL 1AGBA 1N5AA 4G80A 5IK3B 1UJ3A 4HK0B 1A7OL 5TE6H 3H9YA 3DARA 4LCUA 4JDTH 4F7PB 4LHUA 1H3VA 4LBEA 5ADOL 2F5AL 4I0PC 4Z7WA 5FKPB 3MUZ1 5DK2B 3VFOA 4O58H 3MV9E 4JGJA 1RUKH 4N0YH 4Y0GA 3FOMB 1JPSH 1NGQL 4TUOB 4EI5D 2LQRA 4Y5YC 5KAQG 1A8JH 2EDHA 3Q5OA 3PHSA 4LAQL 2GT9B 3BW9A 4U1IB 3IAPA 3QDHA 2H3NA 3ARDA 2ITDA 2E9WA 3G04A 3VXNB 4LKCA 2Y36H 3TN0C 1F8TH 2OR9H 1ORQA 2YS4A 1P6FA 5TF0A 5GSVB 3DMMD 3MOBH 2NY1B 5HDQH 3QEQD 4IS6B 4JY5H 4J12A 2QQNL 4MXVE 5F8QC 5H94A 4JN1H 3WIIL 3CXDL 2J7LA 4G9FE 3P77A 1S7UB 5I1LA 2KUTA 3MV7A 1X9QA 1CZ8H 1F4YH 2Y06L 3NA9H 4HAGA 4PP2A 3MRNB 2BY1A 1PKQE 3C09B 4RGNC 5BRZB 4HUWA 1JK8B 3L95B 3IFOB 1LK2A 3EO0B 3HPJA 3V8OA 5HHQB 3S6CA 3ILPA 1YEFL 2XN9D 3M8OL 4HS6A 1AKJA 1XCQA 3CXHK 4L9LA 5E8OA 5B38G 3HRPA 4AQ1B 4UB0H 3LHPH 4P5KB 2Z35A 1DEDA 3OBAA 5FM8A 4ZXBC 4MXVF 3NGBC 2YR3A 3VE0A 4JZJC 4MD0A 1XH3B 3ARSA 5E99L 4U1KB 4PJEF 1C08A 2XQBL 4H88H 3MBEB 1IQDB 4GAJL 5E6IA 5IOPA 1U8MA 3BH8A 1NSNL 5L88L 4X5WA 2UZIL 4GRLA 4APQA 2FATL 2BMKB 1CLYL 5IMLA 5GGVH 1JI1A 3STBA 5GS1B 3LB6D 3BPCB 3GO1L 4NM4H 3MNVB 5HDBF 5HHPA 4KJYA 3I9GH 1JYVA 2MQ0A 4NKOA 2F58L 1LE5A 3AM8C 1U8HA 1HI6B 3T8XB 3MJ9A 4ELMB 4RSVA 4NQDE 1FYTA 3JBG7 1MJ8H 4WI6A 1IRAY 4FQQA 2NX5D 5IG7B 3TBWB 1HH9B 3UTQB 1MAKA 3C5ZA 2XFXA 4FQ1H 4PJGF 1NLBH 4YIQB 5T3XE 5I0ZA 3O0RL 1JPGA 1MCRA 4RMRA 3RVTC 3NZ8B 4XP9H 4JO3L 5C0RL 5L9DH 5IHBA 1UM4H 3T4AB 5IBTH 1UYWL 4U2ZA 3WE6A 1MJJA 4HPYL 4GXUM 2J8HA 3QWRA 4MNQB 5GS0L 3IDIB 2DWEB 2MTPA 2MQ3A 3OMZA 1INQB 4N68A 2XWTB 1KN4H 4KV5E 5ID1A 4NGHL 1JNHB 1J1PH 4BZ1H 1KV3A 3O2WL 4U1KA 2BVYA 1CXIA 3ES6A 3UBXG 3G6JE 1B6DA 1YUHB 3QFDB 4O51A 4PJBB 4NDMB 2JJTA 5DJCB 1T22B 2HJKB 5FHBL 5CHNA 1U8OB 1WVZA 3MCKA 3NFPA 3WNKA 1OCWL 4XP5L 1NC2A 4L8BA 5SWSD 3LPGA 2PYEE 3QDGB 3GNMH 1IFHH 4H5SB 1PG7X 4N9GB 4P2YA 2IPUK 1E6JL 5B4MD 4W4NA 5KVFL 4NNPH 2X42A 3WUZA 3WLBB 3K7UA 1F2QA 2Q20A 4YXKH 1TCRA 4QRRD 3BT2L 4KI5C 1TVHA 3BW9B 1FGNH 1MVFA 5ESAB 4U1NB 3RWDA 3UYRL 5FHAH 4PR5B 1YYMH 1A6UH 3REWA 1KNOA 1J9CT 5C6TL 4LLYB 3PWUB 2CDEB 4ODUB 2NW2A 2PXYC 2VZ1A 5E7FA 3OJVC 1BOYA 2VLRA 1HHGA 3TA3B 3TO4A 2NX5E 4G3YH 2GK0A 4BK4A 2P48B 4MDJB 1EHLL 4YQXH 4UINL 4PJ5E 4G6JL 2R0KH 2F9BT 3RX7A 5D1XB 4PJFE 5C9KA 3DLQR 2YK1H 1M6OA 4NPYA 1NCUA 4F7CA 2VWEC 2YZ8A 5IW1B 4AENB 2F54A 4W4OC 4ZTOL 1XIWD 4IOIB 5A16A 5KSAA 3ARFD 4LF3A 2WBJD 1TETH 3QZWA 2IANE 3HPJB 3RL2B 3QAZB 5K9OB 1QRNB 3QI9C 2QLVB 4X98A 1J5OL 4PJCA 5E8DL 2HLAA 5IFHL 7FABL 35C8L 5CCKL 3SDAC 1RV6X 4XPBH 5F9JB 4MD0B 2YC1A 3QXWA 3AY4A 4ALAL 2BC4A 3DUHA 5IIEB 4ZSOA 4LHJB 1KB9J 3DXAA 1YNKH 4ZQKB 2DTMH 3R1GH 3RWJA 1CFVL 1VHPA 3VXUE 5IESH 2BRQA 3V52L 4LASH 3NIGE 5E94A 4Z0XA 1JHKH 3BKYH 4MD4B 3KPTA 4HAFA 1ADQA 4WGWB 4MA7L 4MHHI 3W5MA 4QXUL 3S34L 2V2TB 3F65A 5HTSA 3UTSE 5T1DL 3BD3A 1A6VH 3WIFA 4MQ7B 1HHGB 3K74B 5E2TL 3H9SE 4YWGL 2BY0A 2FB4H 1OSZA 3GSQB 5I17A 3T3PE 2XQYG 1MF2H 5D93B 5AUMB 3IGAB 1T04A 3C5SB 2Z8RA 3L7FB 2X4OB 2WNGA 4XC1L 3GMNB 2ORBL 1UWGH 3ARDB 3VRIA 2IBBA 4EQ2A 3NIDF 4XNYH 2ICEB 1WIOA 1IARB 4HWBH 2DWDA 1YEKL 3FB6B 4M5ZL 3OKDA 4FTVE 2PW2B 1U8KB 1D9KD 3BIAX 2R39A 5AYUH 4XH2B 3T0VA 1S3KL 3NPZB 1JWMB 1HNFA 3HI6H 4LPTA 4TNWF 3OB8A 3GSXB 1TNMA 4BQBA 5IW3A 2AJUL 1A3LL 4H20L 1NFIA 4HT1L 1X3DA 1MCIA 1NCDH 3VWJC 4P4RB 1GGBL 2GTWA 1BEYH 1A1OB 1ROWA 2PN5A 1NGYB 2NZIA 1X44A 3HAEH 5EBWA 1UJ3B 3MRQA 1PY9A 1D5IH 4XVSL 1QNZL 1CT8A 1MPAH 4CRPA 1MRFL 4ELKA 4KK9D 5C1MB 5GISH 5BOPA 3C5ZD 4HUMB 3PHOA 1SY6A 5BVJB 2FHCA 1R5VB 4LMQE 4W81A 4C57C 1AXTH 2VLJA 4GRMA 1JHTB 5K9JH 3AMLA 5CSZA 1OAXH 2DIJA 5FO7B 3GKZA 1MQKH 3V0WL 4NFCA 5TQ0H 4U3CA 1DQMH 4MNGB 2IH3A 3DURA 3IGAA 1VKXA 5ELIA 3BGFB 4WV1B 1RJCA 4I0PD 4XVJH 3OJDB 1PFCA 3F5WB 1PKQA 3KPOB 3L3GA 4XVTH 1MH5A 4DOHE 1RZJH 2I25N 2P8LA 3VFVA 4HKZA 3RUGA 5GSVA 2NW3A 3V8CA 2CDEA 1MHEA 4WFEE 5D1ZB 5DEFB 4JKWA 3P3YA 5JW4Q 1H8SA 1S5HA 3H9SB 3CH1A 3VMPA 5B3NA 3TA3D 4XWGL 3VRJA 4F7EB 5MENB 2ZPKL 4E41D 3UZEA 1LEGA 4N0RA 3NMEA 3ZE1F 5BQ7A 2B4CC 3NCMA 4Y4FB 1CK0L 3DYMA 3KPRA 4MMXC 2MMXA 5I6XC 4M7LT 4RWHA 3P4MB 5F9DC 3GJFB 1AIFA 1BF2A 5KJRH 1JTOA 1S7RB 4FTVB 2DD8L 1N0LA 1NLDH 1U8NA 4ZUSB 5IQ9A 4QRRB 3IDMB 4MVBD 3EAKA 1TQBC 3VD4A 4MWFA 5DFTA 2D03H 4KROD 5D2LA 2B5IB 2HLAB 3NH7L 4F57L 3GUTA 1QG3A 4GJTB 2JF1A 4HGWA 4YDVB 5T5NF 2VXSL 4I3GA 4ERSL 1EEZB 4M6MH 4ZUVB 2LV4A 4BFGA 5EH1A 4ZO8A 5JXEC 1HZHH 4XPHH 1JP5A 2EDRA 4CMHB 4OD3H 2MFNA 3F58H 2Q8AL 1H5BC 1FNGA 3W11D 2DQFB 3W82A 2HT4C 4S2SB 4P4KB 3BVNB 4CVZA 3I02A 4IDJH 5BJTA 4BA8A 1ZLSL 1XGRB 3PGFL 1KLFA 1X4XA 5CD5C 4IHOA 2KZWA 2X4NA 3NOIA 1MCFA 3RZWA 1R3KA 4LLUB 4PRHA 4FFVC 4H5SA 4HK3N 1OD9A 3U6RA 3CFIC 3KPQB 4OI8A 5EB9A 3CXDH 1UT9A 1JZ6A 3E2HB 3MLRH 5E0QA 5C09E 3KJ4B 1BGXH 4MNQD 1ZSDA 3S4SG 2AKRA 1FZJB 2XTJE 1EGJA 4X7EC 4OB5H 1WFUA 1O7VA 2VDNL 4JFED 4LHUD 4XCNA 1KPUA 3TEUA 4NWTH 2X4OA 1XGQB 1MHPL 1Q0XL 2OCFD 4OD1H 2X6MA 3TZVC 1BOGB 3I85A 2AK4E 4N8PA 2XWBA 5FOJA 5JMOC 1W72H 4EN3C 1SEBA 3DI3B 3TZVD 1CD1B 3AAZA 3TN0D 4OBSA 2IGFH 4GAJH 4R3SA 1KBGL 1CDGA 1CF8H 1MRCH 3IDNB 2DN7A 2IJ0C 2EDLA 4HUWB 1CGXA 5EZOH 4X7TB 2B2XH 2F54B 5HBBA 4JFFE 4U2YA 3DX6B 1JGDB 4JZNB 4KTDL 1H9VA 1PZ5B 1URLA 4Q9RL 1NCCL 1CFNB 2DQTL 1CLOH 3M1BA 3VCLA 3O2DL 5HGAA 1NUDA 1EFXA 1NMAH 2V5YA 3JV4A 4XNXL 2ZUYA 5H35B 5LAXA 1SQ2N 2YPLB 1FP5A 1SHMA 4MAYA 4ODXA 2Q7YB 3CXHJ 4NKMA 3ARFB 4NZJA 1AO7B 3N1GC 3QQ9D 3V0VB 3K8LA 3GSVB 4KRPD 3VXOA 5LVEA 4FNLL 1JPTL 1WZKA 4Y89A 5EOCL 3O0RH 2XTJD 5HYEA 4QHKJ 3GIZH 1U41A 4JEGB 4M8QA 3FB5A 1N5AB 1AGBB 2A74B 1IM9A 4PS4L 2Z91B 2PNDA 5DGRA 5MEOB 1N6VA 2CR3A 1HEZA 5LQBH 4MA1B 1QYGH 4FFYL 1P7HL 4XNZB 2R2HB 3D85B 4DGYL 5BRZD 1I3GH 2EYRA 3GSUA 1UG9A 4R8WH 1MEXL 5DK2A 3QXDB 3VFOB 4Z7UE 1A22B 5EDXA 4NM8H 5E6ID 3TA3A 3TO4B 1I8KA 3BQUC 5TE4H 1J1PL 4BZ1L 3DO3A 2ZOKB 4NZTH 2F19L 1IC1A 1L0XA 2BXZA 3QUMH 2C4XA 3HG1E 4RGMB 1AD9A 3BP6B 4L3EE 4R3SB 3RI5K 5C09D 5T3XL 4AK1A 3QG6A 1QEWB 1RD6A 3QIBC 2CLVA 4OUUA 3X12B 1UZ6F 4LLWB 3ZE2E 3NFNB 4OT1H 5EOTA 4YX2L 3MZGB 3CDYA 5DR5H 4L8SA 4QHKI 2ZKHH 5BV7L 4TVPE 1NDGA 4D9LH 1GZPB 4V1DB 4JN2A 3WHXB 2V17L 4JHWH 1YEJL 4MXQC 3D0VA 4CU7A 5SWSB 1V7NL 2QADC 4PJCE 4PLOB 5IEHB 3MXWH 5J8OA 5GXBB 5MEPB 1MI5E 1SYVA 5I18H 1DCLA 4ZUUA 5KVFH 2DQEH 2N7BA 2DLEA 4I5BA 3PGDB 1G7JA 3LS5H 3HE7A 1QO3A 2I07A 1U8OA 3SN6N 3TBTA 5CEZL 2AGJH 5AZ2L 3O3DA 4OCXL 3T0XA 5AD0B 3TBVA 1NBZA 3CCHB 4YPGB 2H8PA 5IB4A 4O02H 3UAJC 3VGEA 1VPOH 3DOSA 4IHOB 5DQJA 3ARBC 4GRLC 4X5LA 1FL3B 1ZHNA 4ODBD 4LCWD 3QXDA 1DQDH 1LP9E 3PHOB 3JUYA 4PJEA 4HXAH 5T3ZD 2AEPH 4PGDA 4PJAA 2WUCH 5J11B 1JNLH 3VFNA 4CMMA 3O6LL 4HZLA 3FRPG 4H0HB 3OTTA 4M3KB 5E8EB 3V4VL 2DBLL 5GGSB 3QUXA 1KC5L 2AKRB 1DDHA 5GRJH 4DKDC 3PG2A 4PGCA 4MJIB 3MRMB 3F12A 1Z5LB 1MFDL 4JO1H 5F6IB 3LVEA 3C60D 3I6GA 4HIIB 5I71C 5ANME 4DZ8B 4XXCC 3CLFH 4KKCD 1KB5A 5E8DH 1UXWA 4HIJB 5FYKE 1MJUL 4NC1E 2IH1A 2NW3B 3OAUH 4M43L 4HUXA 4JFQA 1OLLA 3W9EA 4NT6B 1VADB 3T4YA 4NC2B 5D7LE 3CZJA 5EU3A 5TE7L 2H45A 4LKXA 3SGJC 1VACB 3QIWD 5IMMA 1QRKA 2HVJA 4I5BB 3LRGA 1KEML 1T89A 5CIPH 2WP3T 1CFVH 2DQIH 1S9YB 1GOHA 4LEXL 3REVA 3MLVH 3RX5A 1OF2A 1J0YA 5C0NC 3UDWC 1N6QL 4BYHA 4E0RA 1BLNB 5IR1B 4D0CA 2M26A 3S34H 4JRXD 1R3IL 4QNPF 2YZ1A 4G7VL 3H9SD 1UVQB 4QF1A 4LSTL 5DT1L 1JGEB 3D2UB 3QO1B 2VXUH 4GW5B 4XAWH 1HSBB 3FO1B 2P44B 3THML 2EXYC 3IVKA 5IKCB 3FTGB 4WTZG 2F8XC 3H9HA 2ED9A 1IM9D 2JCCA 4R4BA 3TFKD 5H2BA 5H37H 1B2WL 4ZAKC 2V7NA 3JV6B 4QRQB 4OZFG 3BYYA 4CVZB 4NNXA 1I3UA 1A0QL 5T3ZL 3DXAD 4TRPL 4U0RC 5JIHA 2YSSB 1JJUA 3EYVB 2FX8H 3B4NA 4KJWD 4RDQG 4UQ3B 4UMGA 3CFDA 1U6AH 1EGJH 1K6QH 3BN3B 4KGJA 1I85A 4BZ2L 4KUCD 4QNPE 1BAFL 4KDTC 4X6CA 3N85L 3IETB 3BD4A 3T0EC 2L7JA 4AY0A 4DJMA 2E27H 3HC4H 4Y4HA 2VL4A 2ZUUA 1ORSB 2YD7A 2X4SB 5F7EL 5C0JA 3T3ME 1MREL 4WCYH 4X5XA 4JN2B 4HWEH 5CAYB 2MOVA 3GI8L 5D7SL 3RBSA 5E2UH 4WO4B 4QOKD 2FDBP 5SX4H 1AXTL 2OQJA 3WDJA 1A6TB 5CEXA 5JW3L 3VDCA 3NIDE 2X1QA 1OSPH 3VJ6B 4MJ5B 2P5WA 3HG1B 4P2OC 3UCRA 4U1GB 5E6IB 2ERJB 4GMTH 3CU1A 1D9KC 5GRZA 3CVHA 1HQ4B 3PJSB 2R1XB 4XP4L 2VIRA 3V6OE 5T3XD 2HTKD 4GS7B 1A9BA 4EOWH 3NIGF 1CL7H 4LLUA 4JG0L 3GJEB 1U9KA 1N64H 3I3EA 4NOBA 1KIUA 3MLUH 5IBLC 1IGFL 3B9KA 1AXSA 2J12B 1LWRA 3HMWL 1C5BL 3UTOA 4YNYA 4CDHA 3LOWA 1TLKA 1YMHA 2DYPD 3MRFB 3BUYB 4KVNH 4TVPH 5DD3L 1KIPA 5C08B 1NL0L 4NYLA 4OLEA 4KPHH 5F9WB 1KB5L 1A7PL 1IJ9A 3O3AB 4MXWH 5EIQA 1H0DA 5EFIA 3BEVB 1MHEB 5BMFL 1UXWB 3RDTA 2CLRA 3C6SA 3DV6A 4G7YL 4PJ9A 2VXSH 5E5MA 25C8L 4OCYL 3WLWC 3U9UA 1V3MA 4KTEL 1BQLH 5KS9E 2Z31B 1S7UA 1IGYA 3T65B 2BJMH 4NDMA 2OSLB 4DN3L 2EKSB 2B7DT 3STZB 4GAGL 4JJ5A 1CGVA 1TDQA 3AB0B 2EE9A 1B90A 3VDBA 3QI9A 2WIIB 2ZSWB 4LLMB 3MBXL 1FH5H 5IHZA 1YECH 2LABA 1MIML 3DVGB 5DJZB 4HCRA 4NQDD 3WNLA 3GM0A 5BV7B 3QDMB 4LEOA 2GSGA 5T5NG 1H8OA 2O5ZL 1T2QH 2DJUA 1T2JA 4KKAD 1QO3B 4XP6L 5DMKB 2Y23A 4H1LA 1Q9LB 5HGDA 2VXVL 2CDGB 1QRNE 1I1CA 3KNBA 4JQIL 4YUEL 3SOBL 4H1LG 2F5AH 2HRPL 3Q3GB 1RPQA 3QJFA 2FLRT 4GLRH 4AMKH 3KVQA 3TV3H 1FFRA 3OXSA 1IE5A 2ZG1A 4LLYA 1JPSL 3RZCC 1WISA 1UCBL 3BPOB 3MRRA 5DD0L 4J4PD 3U2SA 4XT1C 1FZOA 1JF1A 3ARXA 3EYQD 3D3VB 3QUYD 4LSPH 5I19L 4YDJB 3CH8A 3INUH 4Y5YB 1VKXB 5E8EA 1N0XH 3RNKA 3HNVL 2AI0H 3IJYA 1S7WB 3MMEB 1W0YT 1TZGH 3C6LB 4J4PC 4OGAC 3VMNA 2DLFL 1IAII 5EU5A 1I7TA 3VGAB 1KCLA 3MLPA 4HJJH 2VLLA 4DK3A 1L7IL 5DA4A 2P46B 5JOFB 2HTLD 1CDIA 3QFJD 4KK5D 3IDIA 4PRBB 3N1FC 5F7NC 2NY3C 4PJHB 4WHTA 1P7QB 1QSED 3V4UH 1NBYB 3F7VB 4E41B 3EYUH 1OM3H 3SCMB 3IJHA 4JO2L 4KKBD 5C6WH 5L6YL 3HG1A 4XTRD 3RWJB 1K5NB 4X6EA 4LVHC 4Z7VF 1S9YA 3SDXB 2WK2A 2Z0BA 2OYPA 2ZJSL 3O41B 1KN2L 4DKAA 4M7LL 4X4ME 1Q0YL 1FHGA 5IQ9B 5K9QG 1U2HA 5I1EL 3B9AA 4HKJA 4WFFD 5T5FH 4Z7QE 3EO1A 4NO5B 1A3RH 1DFBL 1T1WA 1AGCB 4ZXBB 4NWUH 3U4AA 5BZWA 2ZNXA 1NFDB 5HGBB 1PD6A 4RFEB 5JHDE 4AIXA 1PEWA 1U93B 3OKNA 1EJOL 5E4EB 3LKQA 4KHTH 5C0EA 5GGVL 1QFUL 1BJMA 3CMOH 5ADPL 4LQ1A 4J6RL 5IW6A 1LO4H 1T6WA 2X09A 1BZ7B 1CBVL 1XR8B 4HFWB 2V17H 5EIIA 3EO9H 5GS1C 3MBED 3B6SA 4KTYA 4Z77B 5HPMB 4FP8H 2HYMA 1SY6H 4NJAH 2FHBA 5GS3A 5EUOA 2J3SA 1TQCB 1UQSA 4U1MB 2W60A 3M45A 1MCOH 1W8OA 3L3DB 1OOAA 2XT1B 2BVEA 1VFUA 4MYWB 1L6XA 2WBJA 2Y9RT 3QA3A 2B8OT 3GBNL 1A7QH 3H6JA 4LFHD 2PCPB 3RVXD 4J3VA 2KKQA 2GTZB 4OCXH 2E7LC 3FQNB 4AG4H 1HIML 1H15A 4X4XA 1XGPA 4MD5A 3MRLA 1VPOL 3ETBF 4FA8A 2BVQB 4YDLC 3ULVC 4OFYD 2XWBB 3CX5K 4P2QD 3G5ZB 2XY1A 5F7HA 2YMXH 1RIHL 1GL4B 4L8DA 3H7BB 1AQDA 5JHLL 4Z78A 4LIQH 5ESQA 2B1HH 3SY0A 4BQCA 5ISZE 3O6LH 5IOPB 2FX9L 3P0VH 2ZWLT 4GQ9H 1J1XH 2NNAB 1EVUA 3ORJA 4W4OA 3SE8L 5B21A 2DQUH 3RPIA 4JZOB 3GSWA 4YXHL 1MFAL 3GNML 3VXSE 3CLFL 5HHPB 4NNXB 4DVBB 1S9VA 4PLNC 1T1XA 1MJUH 3MREB 5KW9H 2GHWB 5FKPA 2EIDA 5C8JA 4TYUA 3L5WA 3BKCL 2NYYD 4NQCD 1W72A 4KROB 4OLXL 5JZ7C 3HUJA 1X5FA 5EU7C 4RA0C 2V2XB 4PTTB 4BH7A 1P84J 2GIYA 2W60B 2E8ZA 3ULVL 1D5BA 1KXVC 1EV2E 4JFZH 3QULB 5DI8B 3VXRB 2IBZX 2EDOA 4ORZC 5D2NB 3R8BB 4GMSL 5C3LD 1KJ2H 3KYMA 1IM3B 1IGJA 4KRMB 43C9A 3OPZH 2ICWJ 5FECB 5T1MA 2C1PB 5B8CB 3JTTA 3EHBD 5E24E 3ARGD 1OAKH 3BH9A 5J57B 5DVKA 2P8PA 32C2A 1WWCA 5D7JA 3OJ2C 5E56A 1JPST 1IEBA 1HOCA 3DI2B 3MODL 5TDNA 1ZANH 1X5AA 4OM0L 5DD5L 5I1LB 4I18A 4UDTB 4H25B 1ZLVK 1JNJA 5DJCA 2R0WH 1CQKA 3SQOL 1N4XL 2YD3A 1J5OH 1YJDC 4QWWD 1FIEA 1MRDH 1S9WA 4XC3L 4DN4L 3UBXB 4RZCA 1I8MB 1XGRA 1S9VB 4KHXL 3QI9B 3O4OC 4PRAA 4XPBL 1KPRA 5F89A 1TZHB 5EO9B 3S36X 1Z3GH 4GFTB 1P2CB 3IDGA 1UB6B 3QT2A 2CGRL 2V2XA 4X7CC 5MEQB 2R4RL 2RHEA 4XB8A 2E6QA 4NUGH 1SBBA 4X7SH 4P3CH 3QR2A 4KQ3H 1MCWM 2YKLL 3X14B 4DGVL 3QIUA 4DTGH 5C71A 4G8IB 4O4YL 1MREH 4IEFB 4OQTA 5FECA 5KOMC 2BNQA 5FXCH 5CKAA 2NY5C 3VXRD 1JVKA 1HQRA 3ULUE 4GSDL 5K59E 3RWFA 1DSFH 5IJKC 4JFHE 3FQWB 1RUAL 3O45A 3GEWB 5LGJA 1MCLA 4I4WB 2WANA 3OAZK 1Y18B 1CL7I 5ECJE 1UWGL 1JCKA 2EIBA 5AUMA 1NCWH 5D93C 1LP9F 1RFDH 1HXYA 3WO3B 2JJSA 5F88A 3UPRB 3UZVB 2ADGA 1OAZL 1YEEL 1G7MB 3L3KB 4JJHA 4M7JH 5B3JF 5B39A 1S3KH 2CUHA 4FTVA 1XGPB 4MMZC 4XMLL 2KQMA 3QNYB 4OGXH 3HMXL 5I73B 2EH8H 1S9XB 3B2UC 1JGVL 1RZ8A 4ONFL 3DUSA 1ZT1A 1DZBA 3WFHB 4JPKL 1A3LH 4YGAB 2A6DB 2X89A 5KANG 4PP1C 2QQLL 2WLZA 4LVOB 1GGIL 3UP1A 4Z7VB 3RGHA 1J87A 3GHEH 1BVZA 1I1FA 5DRXB 1AHWA 1RVFL 2FSEB 4NSKA 1OP9A 3WN5B 1AGFA 1X5JA 3U7YH 4PYGA 5CILL 3L1OH 1J8KA 3U48A 3BDYH 4XBEH 2W0PA 2XA8L 2VWEE 2OTWB 3ZE0E 2P5WD 4KUCF 3D39E 1V8HA 3FT4B 2PW1B 5ENWA 3F6LA 3V0WH 1M7DB 3B5GA 4UBDD 25C8H 4OCYH 2NY2B 4PY7B 4WU7A 5ERWA 4K7FB 2A73A 1WZLA 5D7LA 1KJ2B 2Z8SA 5BW7C 5C2BH 1FZJA 3NZHL 3TIDA 1AFVL 2HKFH 2RAMA 1G6VK 2J1KA 5T1KD 1SJVA 1OPGL 1P9MA 4D3CH 4PLKC 2YWZA 4YBLB 3VXSA 3EJJX 3B2VH 4HLZG 4IRJB 1I85C 3PNWA 1U3HB 4WNQA 3WHE1 3EYSL 1FZMA 4NP4L 2P8MB 2BSRB 1UJTA 1NANH 4G8FB 4K3JL 5E1AB 1V3JA 5D1ZC 1FVDB 1LEKB 4P23B 3RVUD 2VN7A 3KPSB 2A6DA 4RISH 3ZE0F 1PEZA 4DWHA 4PJFA 4AENA 5I15L 2WW8A 1J1OH 1NGYA 1T5XB 1N8ZA 1OTTD 2XPGB 4YO0B 5JDJA 4XTRC 2NTSP 4DW2H 1I3RA 4YUEH 4HXBH 1TTGA 3GGWA 4YC2B 4IMKA 1S9KC 2H2SD 6FABL 1T89C 5C0CD 5ICXB 5ICZB 4MWFB 4PYHA 1TQBB 5DD0H 3FFCD 3C8KA 2J88H 3QDGD 1NGXA 2PW1A 2YEZA 4UI2A 1MLCB 5HHME 2QKIB 2XKNB 1AR2A 2P5EB 1M7XA 1I9IH 4EI5C 1A14L 2V5MA 3P4NA 7CGTA 5DTFA 4B5EA 1OGAD 5I1CL 1QBLL 2P42B 5L7XH 2ID5A 2X7LB 4QRTA 2DQJL 4HIIA 1JV5B 5I8CB 3I02B 4X8JA 3LQAH 1UACH 3LY6A 2HG5A 2Y1VA 3RUGE 1UZ8A 4PB0H 2K1MA 4OGZA 1QUNA 2GJ6A 4OD2A 2EIZB 3MRJB 5E9DD 5GRXG 3U7WH 3VXMB 4WW2C 4FMKA 4N0UB 3E2HC 2PXYA 5C0GA 1N3NA 2GITB 1RHHB 4NQSA 2ZJSH 5FDWA 1G9NH 4HCRL 2QSCH 1LO2H 3RWGA 2ESVA 1F13A 1IQWH 1KULA 4UTBL 4CUCA 4QRRA 2FLBT 3B2UD 3GGWB 1MFEL 1H0DB 5I1EH 3OKOA 15C8L 3LN5A 3KJ6H 5EORH 5F21B 2FZ3B 2LVEA 4N90E 5CJQL 4YAQB 5ICYA 5BS0D 4Z7OF 3PXJA 3X11B 4ZG1A 1RURH 3W0WB 3QO1A 1HCVA 4GW5A 1MVUB 2HTKC 4R0LA 5TDNB 2NY4B 3VG9B 5D72H 1ACYH 4P4RA 4TVSa 4XMKH 3B43A 4MCZB 2BNUA 3IDYC 3WBDA 2X9YA 3BMVA 1FL6A 1P7KA 4OAWB 5SWZE 4KUZL 5DMIH 1NCCH 1CGSH 1NBZB 4LAJH 3RDTC 5DC0A 3RWEB 5EA0L 1QLRA 3LB6C 1QFWL 2IAMC 1RJYB 3QCUL 1KG0A 4GKZB 4B41A 4EDXB 3DETC 4URTB 5IJVB 1RJLA 1KIRA 5D6DA 5LBSL 4TTGA 5F1SA 3B3IA 3KR3H 3CFDB 4F9PA 3UJIL 4V2BA 4D0DB 3UEZA 4IRSC 3L3IB 1ZEAL 3C60A 2FL5A 4L29B 3DX8B 2WSKA 2G75A 1HIMH 5ACLA 1R3HB 1PDKA 2YUZA 3RVUC 1C16A 5JZ7D 4E42A 5EIIB 1BMGA 1NAKL 3VXSB 4KKLD 4Z5RA 3RVTD 2DYPB 4LPVA 1TPXC 3S5LA 2H9GB 4P5TD 3QG7L 4MA1C 1T80A 5AZEH 2XZAH 4XNZC 5GS2H 4HKBB 4HIJA 2FX7H 2C3XA 3N1MC 1LNUB 5DHVA 2Y36L 4LRIC 3L3DA 5E1AA 2AEIT 4KKLC 3VFPB 2OR9L 4F3FA 3DMMC 1CCZA 4UDTA 3MV7E 4Y5YA 5EC1A 1GCFA 4JO4H 3MV8D 4XPTL 4JY5L 1HINL 3O6FD 5DJYA 3RGVB 2AJXL 4G5ZL 1AP2B 4LLVA 4JN1L 2W38A 1UH4A 4AEIL 1NBVH 1A4JA 3FFDA 3GM8A 3UPRA 1EO8L 4PJ8C 4RZCB 2WV3A 1X6NA 1CZ8L 3TPUA 5KW9L 1AC6A 5TGBB 4Z95L 4O2CB 3QDGA 5C7XH 1VGEH 3V79C 1BM3H 3FQUB 4G8GD 3JWOC 1FG9C 4OLWH 1RULL 5ESQB 5HDLA 3SY0B 3UJTH 3B9KB 1XF2B 3VFUA 5E2VH 4UIKH 4PJHF 1E27B 3LS4L 5I30H 1F4AA 4CVWA 3L3HA 5AZ2H 4JFXA 5DJ0A 4N8VB 3W0WD 2ICWB 1M4KA 3WHE0 3DRTB 4YHOL 1GGYA 4C56B 4PIRF 5C08E 4JZOA 1NCBL 1RSFA 2MQCA 4YH6A 2GAZB 1AHWB 1L0QA 4J7RA 2ZCLL 3D85A 2BNQB 1ORQB 1F58H 4P3DA 4U6XB 2X4NB 4TN9A 4RFOH 2FO4B 4WFGD 4OFPA 4F7PA 1RK0A 3ULUF 4OLYL 1A64A 2FATH 3PWUA 3K2MC 2GJ6D 3KPRE 4LCIL 4NKOB 1HHIA 2A6JA 3DX9B 4FZEL 4YXLH 3SDDA 4NOFA 4NN5B 3WKML 1J88A 4L4TB 4TULH 2DJSA 3QG6B 2BFVL 3ZYOA 3OV6A 2ADGB 3T0AA 1EUUA 1YN7B 3MFFA 3RWGB 3MGOA 1NKRA 3I6GB 2JB5L 3T77A 1EFQA 2BNRB 4M43H 4OLVH 3TJEL 5I1AB 2DLHA 3FQTB 1D6VH 3O3BA 4CGTA 3PL6A 1NAMB 4YE4L 1HDMB 2CGRH 1C1EH 4KK6C 5D70L 1CFBA 1G7JB 1XF2A 4LKXB 1A7NL 1SBSH 1CXFA 1BREA 4UILH 4P3CL 1DE4B 4Q9QH 2VAAA 3MRNA 3L3OA 3CC5A 1V7ML 3ZKMD 1G7LA 3QJFB 2IAMD 4LSSL 2FJFB 5I1JH 3C8HA 3THMH 1PY4A 3BHBA 4LGRB 4M7KH 2PO6B 1QFOA 4LU5H 4K71C 2R23B 2HT2D 4Z7VE 2AQ2A 3Q6FA 4HSQA 4NBXB 1OAZH 1YEEH 2R15A 3F7PC 4LSRL 4L4TD 4I13B 4UAOC 4PLKD 5INCA 5MENE 4ZAKB 2ENYA 3MNVA 5E8PA 3VFTB 4YHPA 4PJIE 3DUUA 1ZKAA 3D39B 1Z9LA 4YHKL 1YC7A 2Y25A 4PJHE 1MCPH 1LEKA 1U3JA 4LIQE 3MRJA 3SE4C 1AD9B 3GMMA 3VG0H 4FQQB 5C6TH 3PP4H 1VFOA 3UTQA 2HVKB 5CD3B 4Y5VA 5D8JH 1D3CA 3AXLA 3ULVD 1L7TL 4PGEB 3FT2A 5KSVA 1Z0NA 1XGYL 3ZDZF 5BXFA 1OP3H 3NCJH 1X7QB 4ONHB 4WCYL 3UTSA 3MGAA 2QADD 1RUMH 5CILH 1CE1H 3WS6A 4RCAA 5AWNH 1MJJB 4G9FB 4JDVB 3NABL 5BCAA 1XIWA 3ZKSD 2H2PC 1ZHBB 5DS8B 3ZSTA 5FYJU 4W6XB 2UWEF 2FH6A 4NUJB 3ZTJG 2F8VA 4WO4C 1MUJA 2HJFA 2RB8A 2X4QA 4UNVA 4MX7B 4XHJD 1FLRL 1RK1A 1KTRL 2P47B 1JRHH 3OKMB 2DJ4A 1JPFA 3G6AA 1RZFH 5EOQH 5INDB 1S7SA 1BD2A 4JGUA 2ICWA 4Q6IB 1ZHKA 5E6IC 2ERJC 1Q9LA 1T3FA 4HJGB 1YN6A 3CFEA 3FFCE 1YNKL 4GRWF 3HPLA 4BSWA 3EYSH 1QSFA 5DHVH 3SPVB 1AGDB 3FN0H 3F6IA 4ZS7H 4R90L 3VXTB 2NR6D 3LRSB 4OSUL 4UV7H 2NLJA 3FO0L 3EZ8A 1YA5A 4K7FA 1PJ9A 5KZCB 1CDCA 4UV4H 3TO4D 3PQYD 3WMSA 4PJEE 3QHFH 1EFXD 1P4IH 1LP9A 3O8XC 2RJMA 5I15H 5BQ7B 4JM2B 3FO2A 5SX5H 1YEIH 1K3ZA 2J4WL 12E8H 1XZ0A 5E2TH 3SKNB 1K2DB 4Y2OA 2VR9A 1EO7A 4PJCF 2HJLA 4JM4H 4KK5C 2DWDB 4WUUE 4XNUL 2MHAB 4R2GC 4P57A 2P24A 5DFVD 5HYQB 2ADFL 1Q1JL 5DJAA 4ENEC 4BKLA 5DEGB 4YDIH 5DVNA 3AFLA 1FV1B 2VLJD 5HGGS 3ZTJH 3W0WA 4ISVB 4L8DB 1BBJB 4IDLA 4AEHH 3VW3H 4LSUL 2EE2A 3HG1D 2HVJB 5F9OL 1SJHA 1T7YA 2VERN 2I9TB 1C7SA 4JHAH 4QGTA 4PGJA 3X3GL 3RGVA 2WWKT 1SM3L 4HS6B 3CC5B 1GYAA 4S2SA 4NQTA 2J8UA 3QUKB 5JORA 5IJKA 3TT1L 1XEDA 5EBMB 1S7VB 4GAFB 4WTZA 3JUZA 4LRNH 4KU1A 2Z92B 3BPNC 1QBMH 3ROLA 1QNZH 1P84K 1HSBA 1EK3A 1A6WL 2APTA 4XB7A 3U7WL 3K2UH 1FAIH 1TJIL 4JQIH 2DQCH 4Y4HC 2G75B 4JRYB 4KWUA 1JN6A 3CPLA 3GMRB 5SWZB 1LO5B 2VH5L 3FL7A 4NHCL 2X7LA 4QRTB 3TYGH 1V5JA 3ZL4H 1J05B 1N2RA 3ABZA 4ZMAT 1WC7B 4EDWL 5KSUA 4Z7WF 1LK3H 4CVUA 3RIFK 5CINL 3K3QA 4P2RD 5FYKD 5KAQF 4OD2B 4N5UA 5GZNC 1KTDB 3D69B 1NUFA 2E3VA 5ITBH 3FN3A 3BPOC 1CXLA 1INDL 4PV8A 4F7EA 4LDLB 3HFML 3RWIA 4OGYL 5FDWB 5CD3A 4NKDA 3Q1SL 5J6GB 2X44D 5BXFB 3PGCB 3RRQA 3UYPA 3TNMA 1REIA 5AG8A 3MLXL 4GUPB 3OKKB 4FXLA 3P0YH 4PRID 3SO5A 3T0DA 3U83A 3WJLA 1OM3L 4M6OH 2VDQH 2BC4B 3QDMA 2ZCKL 4HUNB 3VFUB 3OKLA 5L6YH 2VKWA 5DUMH 1NGPH 3QNXA 2CRYA 4K8RC 4Y4KA 2WWKO 3MLTB 1T83A 1E6OL 1LGVA 1TENA 4FQHA 4TSCL 1CS6A 3KNBB 4LVHB 1NC2B 3EJYD 2YHGA 3RIFF 2LU4A 2YN3A 3VWKA 1NKOA 1NH6A 4LOUD 2Q6WB 1N26A 1ZT7A 4Y16B 4DKFL 4KKAC 3U2SB 1XCTA 1PSKH 5FUZL 3HCVA 4QHUB 4N1HB 4NNYA 3PGFH 1J7VR 1QFUH 4PREA 3ZKQD 1VESA 4XMPL 4NJ9L 2ZOLB 3FQRB 4JFPA 2AJXH 4G5ZH 4M1DL 3RVVD 2JIXA 2APFA 4HWNA 4PR5A 3SKNA 5IUSA 3U82B 1IZJA 4LMQI 4ODVL 3FB6A 4ESKA 3GSNH 2CJUH 1BOGA 4R4ND 4J3OC 1F90H 3EOAB 5EC2B 4H8WC 1YYLH 4OLWL 2VISA 1A7OH 1FV1A 5TE6L 5IB3A 5FUOL 4U1MA 3MLWH 5E2VL 4M6NL 2ENSA 3CIQA 3MV9A 1P4LB 3WKNA 2HH0H 1F4WH 1M71A 2EC9U 2VITA 3C5JB 1X7QA 3UTSB 4U05A 1Q8MA 4KK6D 1EEYB 4DKEH 4TPRH 2IBGA 1TMCB 2DKSA 4WI3A 2FEEL 2DI7A 4WUUB 4GG6E 4LIQL 1HKLH 1DQQA 2VDRL 4P2CG 2AXGB 5ENWB 1CFQB 1MUJB 2HJFB 4L1DA 4ODXB 5D2NE 2AJZA 2NY5L 2R0LH 3VFGH 4Y19D 5FV1L 5FYJL 4UTAL 3MFGB 1QSEB 1OTUC 2A38A 2AJ3A 3LPWA 3KWWB 3I84A 2Z91A 3SKOB 3IFLH 3K4DA 3RVWD 2DTSA 2PF6A 4ZS6D 1FFPB 2FJHA 4P9HH 1NMCB 4JHBA 4W70A 4Z8FH 4PS4H 5EUOB 1FNHA 3L5WB 4RGNB 3RP1A 2BY2A 2R1YA 4P59H 3VFWA 3LRHA 3RI5F 3KPLB 2Q76B 4GRWH 3P77B 1DBKL 4L8SC 5MP6L 1NEZA 5FYLH 5DHXB 5BZDB 3OPZL 4JM2A 1HSAB 2F19H 3RY4A 2NXZC 4YHLH 3SDAD 3MGOB 3P30L 3H42H 1OF2B 2FRGP 1E4XI 2Q8BL 1HWHB 2V9RA 2PTVA 3RPKA 3WHXA 1KIQB 4NQUA 2UZIH 1EXUB 1XF3A 3PWLA 5HPOA 4PJHA 2CO7B 3OKKA 1UVQA 5BV7H 4D9LL 1EMTH 5HVWA 4PJXA 3F7VA 4E41A 4ZUVA 4PJIA 4MA3A 5JXAL 2LTQC 3RDTD 4HUVB 3N1PC 3T2PA 1DEEA 4BSJA 2B20A 1MRDL 2F58H 2X10A 2N56A 4PY8I 3WD5L 1I75A 2APVA 5DD1L 4LSRH 5SWSE 1R3LA 1CDYA 1Q9OA 3ARBA 3OGCA 1WFTA 1Q9KB 3S7GA 2GY7B 3BZ4A 1QLFA 1IT9L 2APWA 3RTQB 1NLBL 5GJTL 2ZCHL 1XFPA 5ESVA 1ZT7B 2AGJL 4JO3H 1I9RH 4F8TA 3U30C 5D96C 1OAQL 1YEDB 2YPLA 1G0YR 5IBTL 1C5CH 3U7AA 5F6HI 3TC9A 4ZOCA 3IJSB 5HVGB 1WV7T 3TBWA 5IFJB 1MWAB 2OZ4H 3VXOB 5DMJB 3R06B 3AMKA 4F7MA 1S8DA 2CRMA 2JELL 4R6UA 2QHLA 3ZYJA 4IRZL 4HXAL 3KGRA 2QBWA 4J1UB 4JRYA 4JFOB 2WUCL 3R0NA 5B4MC 2MCG1 4I77H 5GZOC 1JZ8A 4LP4A 1J0IA 1T2XA 5HYSA 4LCCA 1A02N 1PQZB 4NO3A 1QTYT 5GRJL 1I7UA 1DVFC 5C0FB 2GJ6E 2YD4A 3AREA 3CK0L 3DBXA 2WAHA 3IDJA 3LEYL 2D7NA 4KKCC 5FEBA 4BQ9A 4X9IA 4YAQA 2GJZB 2OMNA 2QSQA 3EFFB 2QTEA 1V05A 3GIVB 4MJ5A 3WDIA 5JW5A 5EOQL 1ZVHA 2VZOA 2IBZY 5I75C 2YRLA 4HKXA 1WK0A 4MJID 1KFAH 3P4MA 3GK8H 4IJ3C 1UXSB 4HLJA 1E6JH 2CK2A 5AG9A 1YEHL 3DJ9A 4AJ0A 4G6ML 5GRVL 2PTTA 5GGTA 2FH8A 4AL8L 5I1IH 4P2QB 3PL6B 1FGNL 1CD0A 5C0BA 4WUUA 2QQLH 3ZDZE 4N8VG 3FOMA 4UV7L 4U3XA 1KJMA 4S1QH 4YDVA 2Y6SD 3V6BR 5IJVA 3EYOA 4JANB 2XKUA 4GOSA 4J3TA 2EH7L 1QSEA 3GMRA 5C70A 4K8RL 4DZBB 3ZKXC 5D7IF 3WDHA 5C08A 3BDYL 4OZFH 2WUBH 5I1KH 1IGCH 3TA3C 4B0MM 4MDIB 2FCBA 5J3HD 1RHFA 1FG2A 5HVHC 4LPUA 3QEGL 3MV9D 2CK0H 4I0PB 1XCTB 1K4CB 4D94A 4EUPB 4QXTB 4RBPK 2PYEB 3QDGE 2PXYD 3KHOA 1F6FB 3MV7B 4B50A 2HKFL 2E6PA 3KYOB 1I7RA 4KAQH 2MCPH 2ESVD 3TCLB 3WLWD 1NEZB 5GGRB 4CL7A 4Z7UF 3T2NH 2XNAA 2VNCA 4LLVB 5E5UB 2JTDA 2ESVB 5C09B 4FQCH 4XBGA 4D0CB 2RIKA 1I8LA 1FDLH 3QFJE 4OQTL 4KDVA 5EN2B 3TN0B 1LE9A 5CBAA 2PYED 5DJAB 3HLAA 2YD6A 3V52H 4ZDHA 1U3HC 1WCBB 3PABA 4LASL 1IGMH 1MHHA 3BZEB 2EIEA 5T1DH 5DQDH 3I2CH 5CGYC 3FB7B 4QXUH 4JLRA 4QWWC 4MA3B 4MS8D 3VFSA 3U46A 1AXIB 1MCWW 1I1FB 1I1AA 3KLSA 4JFXB 5DUPL 2C9AA 4KDTA 1MF2L 2BNUB 3BOVA 4R96B 2R29H 1KXTB 3BPCA 3SCMD 4PJ9C 1JGDA 2XG5A 1Q72L 2GUOB 5HHQA 2NMSA 2WM0A 3LSOB 4G8GE 1MSPA 2E7CA 2O5XL 4NZDA 2YPLD 5CP7B 4ETQB 3HCVB 2OK0H 3P9WB 2IMNA 4NKMB 3EFDL 5FA4B 3NGBB 3D5OF 1JGEA 2VDKH 4JREB 4WI7A 4OIIL 1A2YA 4KK9C 1JZ7A 4PUBH 3KYOA 5I1CH 2J5LB 3MLUL 1NGWA 4HEPG 5LXGL 5SWZA 3MRFA 3QUYC 3HMWH 3MMEA 4D8PA 2CUMA 5DTFB 5KSBF 2PTUA 3MX0A 4DZ8A 4GXUN 5EU5B 2A9NH 1XGTB 2BSTA 1Y6KR 2C3HA 2CMRL 4UBDC 2CIIB 5D9SB 4HIHB 2Z9TA 4JKPL 4I48B 1QQDB 3L7EB 5EU6D 3P0YL 4WU5A 1A6TA 5CEXB 1IAIH 3OQ3B 3O45B 2X70A 5LGJB 1ZTXL 4P23A 1D5IL 1PX3A 4XVSH 4JR9L 4M4PA 3PQYE 1NGPL 4MB5A 3HZVA 4UIMB 1UCTA 3QUXD 3FO2B 3MJ9H 4KGLA 2C4FT 3BEWB 1MFBL 5HI4D 3U0WH 3F62A 2ESVE 3QQ4B 5C0DB 1MFEH 5A40E 4LF3B 4LGPB 1DQML 3O3UN 3VGFA 4JVPA 1A9BB 1U8JB 4POUB 3RL2A 3UO1H 1MQKL 2VUOA 3ZT5A 5J9PB 1GHFH 5DJDB 4TSAH 3AY4C 2BK8A 4M7ZB 3FCTB 3WFHA 4XVJL 3L6FA 4XPGH 4XVTL 1DL7H 1NFDF 3U36B 3VH8B 4MB3A 1BWMA 3BHBB 5K9KB 4YFDB 2YC1B 5HSFA 4KH2A 1I7ZB 4JRYD 4PJBF 3VJ6A 4U6HA 1U8MB 3BH8B 4QRSA 3KPPA 3BKJL 2MKWA 3QSKB 5HD8D 3VG9C 3GRWH 1CIDA 4HEME 3MRCB 4M1DH 3HR5B 1HHHA 4YPGA 5EA0H 2HA1A 5HGDB 4YGVA 1TZIB 3IDYB 1D7FA 3REWB 3O3AA 5JA9A 5HI3C 2ZSVA 2R4SH 2AV1B 3QCUH 4L8BB 3O8XD 5EPMA 5E2WH 1F3RB 3MJ7B 1C5DA 3TJHC 5EU6E 4HV8A 1G7PA 3QEHA 3QCVL 3WO4C 1HHIB 1ED3A 2A6JB 2GK0B 3I50L 4U0QB 3WIHH 4LSVL 4F7TA 2DD8H 1KF9B 5F7DB 4XHQA 2CKBH 1OL0A 1MWAA 2RQ8A 1G6RB 2HVKA 2HRLA 5A2IH 1JN6B 1FO0A 4M6ML 3TCLA 5LGHH 1P5VA 5J0BA 3FQNA 4BUGA 1HZHL 5JNYB 5DJ8B 4HIXH 4X4YA 4EI5A 4FABL 2R56H 4HF5H 5HHXL 3NACL 3HAEB 5I1AA 2WBWB 1ZLSH 4RGNE 3T4YB 3F58L 5IWLA 2Q7NA 2VLRB 3KLAB 5D71L 3ULUC 1OTTC 1H5BB 3DO7B 3SKUD 3RTQD 4GW4B 4QTHB 3VFGL 5L8KB 4UTAH 1GAFL 3RX8A 4MJ6A 5DRZB 1YJDL 5I8OH 2YN5A 4QHLA 3HS0B 2BVOB 3JTSB 2DL9A 4LLDA 3V4UL 2BSSB 4JG1H 3RGVC 4PB9L 1AKJB 1BLNA 5IR1A 2I9LB 1DLHB 4DK6A 1BGXL 5CEZE 5IF0A 2GK2A 1CICA 4Z8FL 3UJTL 4KC3B 1ZWIA 2GCYA 4TUJB 3RIAK 4PJ8A 1O7SA 3O6ML 1AXSB 1H3GA 3T08A 1MHPH 3FO1A 3IXAB 4X6DA 4WY7H 5L2KD 4TQEH 3B9KC 3TZVB 4ONGH 1IAIM 1RUKL 3D25B 4N0YL 1A1MA 3K46A 2ZCLH 3OXRA 2IAND 1D5XB 3QEUB 1W72L 4JFDA 2ICEA 5T1LD 1IEAA 5DK3A 1KNOB 2OJEB 4S1SH 2B2XL 5CMAB 2AXFB 4KHTL 4YZFE 5HY9B 5EU6A 5GSRA 5BW7A 2UY6A 3EGSB 2I27N 5EZOL 5FGSA 4XPAL 3J7HA 3HAEA 1GGCL 1JBJA 4HS8H 4ODSH 2C3VA 2EYSA 4CADA 4MDJA 4AIZA 1VFMA 4CN1A 4U1LA 2BFVH 3T2QA 4PV9B 3KLDA 5BZDA 4NJAL 4YEFA 5J56B 4Y5VB 2IADA 2VZSA 1AR1C 4F9LC 1RIVH 2HLFD 5TDPB 5DQ9A 2A6KA 2GSIB 1JPTH 4L4TE 4MAYC 1JYXA 2BERA 4DGYH 3G5ZA 1I3GL 2VB5A 1RU9H 5KN5A 2VZ3A 3LHPL 4XCYB 4JM2D 4ELME 2H6PB 1WBZA 1AO7D 2IPUG 2W59A 4PGBA 1NCTA 4OCWH 1WFOA 5E99H 2YMXL 4IOFC 1E4KA 1HQ4A 5D7KE 2EXWC 4X9FA 1A6AB 5EO0B 5EUKA 3S96A 2A6IA 1UC6A 3O4LD 3QIUB 2D0GA 3BQUB 2NQCA 3CZFA 1FNGB 3U0TA 1U95B 1FVCB 4MHHG 3ZTNH 3VXRE 1WBXA 5CMAA 3PXHA 5FUCE 4BSWB 3BP4A 1OQOA 3ZHDA 2W65A 2FJFA 3TVMA 4EDXA 1A5FL 4M93C 5MERB 4Z18A 1VENA 1B9ZA 3S36L 2CKBB 3MV7D 4JY4A 3PWNB 1X4YA 4WW1B 1YEJH 3R06A 5TF1L 2NTFA 4L29A 4OLXH 2B4CH 3JVGA 3V4PH 3SQBA 1AO7E 3LS5L 4YHNB 1I7TB 4EN3D 3BGFC 4WV1C 1YEHH 2R8SL 3TBSB 2HMIC 5DJ8A 2HFGL 3G08A 4B7LA 4M5YH 3AREB 1C7TA 3O3BB 1B4JH 2NY4D 3ULUD 1BFVL 3VG0L 4Z78B 2C3WA 3IFPB 4Y16D 4ZNEE 1UQSB 1X5YA 4JRWA 3VGHA 4Q7DA 1L7TH 1CU4H 3IKCB 4LQFL 4K94L 2CO6B 2JCCF 2EKSA 3ZDYE 4OCLC 4PGZA 2AV7B 4DGIH 8FABB 1G9ML 3NABH 1CT8B 4D9RD 5JA8B 1WBYB 3OZ9H 4OQ1A 2EE3A 1DQLH 1OARL 2Z4QB 5DZLA 2B5IC 4V1DE 1JRHL 3BRDA 4XPFH 2Q7YA 3EYOB 3WUWB 1JNNL 3FO9B 3DHJA 2NZ9C 3FHQA 2ARJQ 1Z3GL 4OKVB 2VDPL 3FZUD 3MYZA 3Q5TA 5K33A 4X6CF 1HHKA 5ANMA 3ULUH 3NZ8A 5KS9A 2Q86A 3RWCB 1JMXA 1MJ7H 3PDGA 3UTTA 1A7RH 4GBXA 4YZFF 1JHLL 2YRZA 5JHDB 2E8YA 2YKLH 4P4KC 4F15B 1N6QH 4LCWE 2E6JA 3QIBD 1QR1B 3HZYA 3VA6A 5IB5B 3O6FC 5EC2A 3ZYIA 1YYML 3VXTA 1P4IL 4PJAE 5TPWH 2D2OA 2AEQL 3MUHL 1QSEE 4L9DA 4U1LB 5DT1H 3GKWL 2W9DL 2I5YH 1LILA 2BVPA 3BIBX 1G6RA 2DIBA 1EHLH 4LSTH 3ZE2F 3ULSB 4YO0A 3NPSB 4JM2C 3NFPB 2DI8A 2YK1L 1LK2B 4KRPB 2ICCA 2A77L 3WCYA 4YDIL 3AC0A 4KZEL 2YD8A 2E7HA 4JPWH 3QH3A 1RMFL 4R2GB 3UX9B 5DEGA 2Y5TA 5DD6A 5GIRB 1AO7A 1DBAH 1GGUA 7FABH 5DHYB 2D31B 3LKPA 4X6FA 5TJWK 4L4VD 5F7KC 4ONFH 1VSCA 2VZUA 1U6AL 1QP1A 4JKKA 3KPNA 1HEZB 2ZSVB 3WEXA 2DQHH 3GBLA 2VE6B 5ISZB 3LSOA 2BNQD 1JGLL 5JHDA 4NZRH 4P2QA 2Z8WC 1JHKL 3GHEL 3SDXE 4FFZL 1GVIA 1A6WH 3S88H 3MO1B 2ITCA 4OGAD 2HFFA 1HILA 2BDNH 4APQD 1NAMH 3BPNB 2JJSC 2WWMC 1ZHLB 5D1XD 3T0EA 2DQCL 4Z7UA 1WEJL 5GJSL 4R97C 3MJ9L 5JW3H 2EKJA 1XR9B 4JFEB 4LP5A 3G9AB 1RHHA 3FB5B 4Z7NE 2H3NB 1OAYH 4RFNB 3LKRA 4Y4HB 5BS0B 4EDWH 3VXNA 1P53A 5ALBH 1J05A 4ZFGL 3NZHH 5HYQA 1EH9A 1N5YL 4GQPH 3B5TA 3CFCL 3CVIL 1G1CA 1YEKH 4HWZB 3BN9D 5TFSH 2UWEA 3ZKMC 1D9KA 2LAAA 2HT3C 5J1TC 1R5WB 1U3ZA 1CGTA 1N64L 4K3JH 5DRWB 4CVXB 5IK3A 1U92A 4FQ2H 3CSYB 4IMKC 3MR9B 4PJXE 3D48R 1D5MB 3QNZA 4DEPC 5IF0B 2R0ZH 5IMKA 5DD3H 1LE9B 2DQDH 1ETZB 3TGXA 1VFAA 3PWJA 5H35A 2Z92A 3GJEA 3P11H 3NAAH 5ESVB 1M7IB 4G9DB 3OAYK 1NCAH 4P0DA 3BSZL 1D5ZA 4NFBA 5LGKA 1SYVB 4MXWL 3UC0H 3WUWA 4HS3A 2AK4A 1ODAA 3MLSH 4MQXD 3S97C 3MRKB 1A6PA 3JZ7A 1CDUA 1XAUA 2DQFA 3GSWB 3P4NB 5ACZA 3HMXA 3CSGA 3O3DB 2GUOA 1H3PH 3BDXA 4FZ8H 2OL3A 2OBGA 1JTPA 1RZGB 4L3CB 3ROOB 3UTTB 1HQRB 3S5LB 2OLDA 3GBMH 1WBXB 3PWVB 2BJML 3RWFB 2Y07H 4G8FA 3W9EB 3IU3A 4DN3H 4LNVA 1IC7L 4F2MB 1WZ1H 3X13A 3A6CL 5F7UA 4QRPE 1FZKB 3DTXB 4XMPH 1BPVA 3TT3L 1MIMH 5J11C 1A7BA 2YBRB 5JW5B 2AS5M 3KYMB 1T66D 4ODVH 1JYWA 4UNUA 1K8IB 1W0VA 1F6AB 1Z5LA 5DURD 2VZVA 2CJUL 1ORSA 1AE6L 3MLZH 1GC1C 2CIIA 5F6IC 4HDIA 3TPKA 5GGTL 2HLFC 5ICZA 3G08B 1IILE 1FGVL 3OKOB 4IRJD 3SOBH 3I6LE 2J8UF 2HRPH 4X99A 4CJ1A 1BJ1H 4K23H 1I4FB 2VXVH 5KSBE 3HR6A 1PW3A 3DWTA 3GMLB 2Y5TB 5DD6B 1DLFH 4GRMB 3RNQB 3NBNA 3MZTA 4MJ4A 2ZUQB 3UTTD 1NMBH 4FXKB 2OTPA 5DJ0B 2XPGA 1RURL 3TBVB 1P1ZB 5HI5D 2VOTA 1CXHA 2VIRB 1BVLA 4JDZA 1TZGL 1QA9A 2G9HA 2FBJH 5IQ7L 3VWJD 1F42A 1MLBB 2XN9B 4WWKD 1N59B 2Q8AH 2FD6L 3JSSA 3UMTA 4PJEB 3ZKND 1CGSL 1WAAA 4UQ2B 2E9IA 3WIFB 4M1CC 5IG7A 1JRHI 3G5XB 1MCHA 43CAB 3S35L 4WWKC 1B0WA 2ZUTA 4M03A 3EYFB 2ADJB 1CI5A 4PGCB 1R3JB 4D2NA 1FAKT 2FL5B 4HJ0D 1F11A 3FFCB 3ZT7A 1CICD 2M1KA 2VXTL 3LKRB 2NY3B 4XRCB 1MCEA 3SBWA 5HY9A 1JFQL 4A6YH 5IHLB 1FBIL 1JV5A 4GBXB 4OF0A 3GI9H 4FQXB 2DM4A 5GPRA 3D9AL 1I3VA 5C0FA 4P2OA 4DFIA 4HIEB 1Q0YH 3QHTC 2VLJE 2OL3H 3SGKA 5H37G 3LEVH 1EO5A 1EEQA 1G7IA 2Q76A 2XZAL 5E7BA 4BJLA 1HN1A 2MJWA 1IGYB 4JB9L 4L8SB 5ILTL 4B53A 5DJYB 3SDXA 5GRWA 4HUUA 1E4JA 3BI9X 3OX8B 3OKEB 3LQMA 1MCJA 2DRUA 1HK6A 1BFTA 4RWYH 1G7LB 5LCVL 5EU7E 5J12B 3EDDA 5HHVH 3DIFA 3SJVD 1EDQA 1T20A 1KG0B 1KB9K 4O2CA 2IFGA 1LO4L 4BQ8A 4YPJA 1W0WA 4S1RL 1SY6L 4DCQB 2AJZB 1T4KB 5IWLC 4XNXH 3G9VA 5DXWA 4HBCH 5JUEL 1BM3L 5GGUA 1AY1H 3SKMB 1CLCA 1SMAA 3SKJH 1I1YB 3RWDB 2H8PB 5IB4B 2FR4A 1E4KC 4AYFA 3RWCA 4F37F 1R3LB 3ESUF 4JFDE 4BFIA 2PR4L 2DDQL 2R2CA 4LHQB 1IGIH 2FO4A 4GS7C 3ROOA 2HFEB 4QLRA 1QYGL 2CKBA 1TJGH 4JY4B 4JPVH 3S35X 4C54A 4NQEB 4R8WL 1SEQL 1WZMA 2NXYD 3MXVL 3FQRA 4JFPB 2DMBA 5DDHA 5DSCB 4IOIA 3F12B 1T04B 3C5SA 1NFDE 3STZA 5CWSB 3WKMH 4LKCB 3CDGA 4LCWA 1QPXA 1F8TL 3TVMD 2IQ9L 5C09A 5F1OB 3CK0H 1OQXA 3SE8H 4OT1L 4YX2H 5C0AB 1EXUA 3PWLB 3PWPE 4P9HC 3V6FB 1J1XL 4JFYB 2J8UE 3VCLB 1X5KA 3BX7C 3KPRD 2D7MA 3O6KL 4HFUH 3NCEB 3FRUB 2IG2H 1TVBA 2AXJA 2BHYA 3SDCB 1EBPA 2HN7B 5GGSY 3SCMA 4MCZA 3MRDB 4QY8A 5JIKA 1F6LL 3BZDA 4A6YA 1XCQB 5E8OB 5KOVC