1S95A

Structure of serine/threonine protein phosphatase 5
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
324
structure length
324
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the catalytic activity of human serine/threonine protein phosphatase-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine protein phosphatase 5
total genus 115
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1s95A00
1S95A 3JYFA 4I5LC 3N5UA 4UT3A 1Z2XA 2QJCA 2Z1AA 3THOB 1FJMA 3IVEA 1U32A 3EGGA 2Q8UA 4FBKA 2BDXA 3H66A 5JJTA 4FBQA 2BQ8X 3K7VC 4MP0A 1S8EA 4M0VA 2A22A 5DNYA 2USHA 3H63A 1S3MA 4H2GA 5GTUA 4IL1A 4XPNA 1XM7A 1USHA 3ZTVA 2NPPC 1UTEA 3QFKA 2WDCA 2HY1A 2Z06A 4I5NC 3PSNA 1AUIA 3H68A 3QG5C 4V0XA 4ORAA 1WAO1 2DFJA 3C5WC 4OR9A 3IB7A 2NXFA 5IOHA 4ORBA 4FBWA 3GVEA 1XZWA 3E7AA 2IE3C 4YKEA 3DW8C 4FCXA 4V0VA 5F3WA 2HYOA 2QFRA 2XMOA 3IB8A 4DT2A 4JA9A 3AUZA 3DSCA 1TCOA 5HPEA 1II7A 2Z72A 2IAEC 3PSOA 4KKZA 5J28A 2WDDA 4V0WA 3HVQA 1SU1A 2O8AA 4HD0A 4LTYA 4F0ZA 2BCDA 4J6OA 3H67A 4IYPC 1IT6A 4H2IA 4UT3B 3DSDA 3CK2A 4LU9A 1QHWA 3T1IA 1Z2WA 2JOGA 5INBA 1T71A 3EGHA 4JA7A 4DSYA 4H2BA 2NYMC 3RL3A 4ZVZA 5B8IA 4O5GA 4O4KA 3FGAC 1V73A 2NYLC 4H1YP 1QFCA 3V4YA 3H62B 3H61A 2HYPA 1G5BA 2KKNA 3KBPA 3K7WC 1HPUA 3THNA 2YVTA 4H2FA 2P6BA 1T70A 4WWLA 4TUGA 2IE4C 3H60A 3RQZA 4LACC 5JPEA 1HO5A 3LL8A 1KBPA 4UWQA 1OI8A 2WDEA 3TGHA 1HP1A 1S70A 2ZBMA 1M63A 1JK7A 2GJUA 3C9FA 4O43A 3ICFA 1W24A 1OIDA 4UT2A 4DHLA 4MOVA 4TUIA 3E7BA 3IVDA 3QFOA 5C1VA 2QFPA 1MF8A 3ZU0A 1S3NA 3AV0A 4ZX2A 1S3LA 2CV9A 3H64A 3P71C 4H1SA 3QFMA 3QFNA 3RL5A 5EQVA 4KBPA 4MOYA 4ORCA 5JPFA 1NNWA 3RL4A 1OIEA 2O8GA 4O24A 2AHDA 4Q7FA 3H69A 1UF3A 1WARA 2WDFA 4NZVA 4B2OA 4G9JA 2R17A
chains in the Genus database with same CATH superfamily
1S95A 3JYFA 4I5LC 3N5UA 4UT3A 1Z2XA 2QJCA 2Z1AA 3THOB 1FJMA 3IVEA 2DXLA 1U32A 3EGGA 2Q8UA 4FBKA 2BDXA 3H66A 5JJTA 4FBQA 2BQ8X 3K7VC 4MP0A 1S8EA 4M0VA 2A22A 5DNYA 2USHA 3H63A 1S3MA 4H2GA 5GTUA 4IL1A 4XPNA 1XM7A 1USHA 3ZTVA 3D03A 2NPPC 1UTEA 3QFKA 2WDCA 2HY1A 2Z06A 4I5NC 3PSNA 1AUIA 3H68A 3QG5C 4V0XA 4ORAA 1WAO1 2DFJA 3C5WC 4OR9A 3IB7A 2NXFA 5IOHA 4ORBA 4FBWA 3GVEA 1XZWA 3E7AA 2IE3C 4YKEA 3DW8C 4FCXA 4V0VA 5F3WA 2HYOA 2QFRA 2XMOA 3IB8A 4DT2A 4JA9A 3AUZA 3DSCA 1TCOA 5HPEA 1II7A 2Z72A 2IAEC 3PSOA 4KKZA 5J28A 2WDDA 4V0WA 3HVQA 1SU1A 2O8AA 2YEQA 4HD0A 4LTYA 4F0ZA 2BCDA 4J6OA 3H67A 4IYPC 1IT6A 4H2IA 4UT3B 3E0JA 3DSDA 3CK2A 4LU9A 1QHWA 3T1IA 1Z2WA 2JOGA 5INBA 1T71A 3EGHA 4JA7A 4DSYA 4H2BA 2NYMC 3RL3A 2DXNA 4ZVZA 5B8IA 4O5GA 3FLOA 3FGAC 4O4KA 1V73A 2NYLC 4H1YP 1QFCA 3V4YA 3H62B 3H61A 2HYPA 1G5BA 2KKNA 3KBPA 3K7WC 1HPUA 3THNA 2YVTA 4H2FA 2P6BA 1T70A 4WWLA 4TUGA 2IE4C 3H60A 3RQZA 4LACC 5JPEA 1HO5A 3LL8A 1KBPA 4UWQA 1OI8A 2WDEA 3TGHA 1HP1A 1S70A 2ZBMA 1M63A 1JK7A 2GJUA 3C9FA 4O43A 3ICFA 1W24A 1OIDA 4UT2A 4DHLA 4MOVA 4TUIA 3E7BA 3IVDA 3QFOA 5C1VA 2QFPA 1MF8A 3ZU0A 1S3NA 3AV0A 4ZX2A 1S3LA 2CV9A 3H64A 3P71C 4H1SA 3QFMA 3QFNA 3RL5A 5EQVA 4KBPA 4MOYA 4ORCA 5JPFA 1NNWA 3RL4A 1OIEA 2O8GA 4O24A 2AHDA 4Q7FA 3H69A 1UF3A 1WARA 2WDFA 2ZOAA 4NZVA 4B2OA 4G9JA 2ZO9B 2R17A
chains in the Genus database with same CATH topology
1S95A 3JYFA 4I5LC 3N5UA 4UT3A 1Z2XA 2QJCA 2Z1AA 3THOB 1FJMA 3IVEA 2DXLA 1U32A 3EGGA 2Q8UA 4FBKA 2BDXA 3H66A 5JJTA 4FBQA 2BQ8X 3K7VC 4MP0A 1S8EA 4M0VA 2A22A 5DNYA 2USHA 3H63A 1S3MA 4H2GA 5GTUA 4IL1A 4XPNA 1XM7A 1USHA 3ZTVA 3D03A 2NPPC 1UTEA 3QFKA 2WDCA 2HY1A 2Z06A 4I5NC 3PSNA 1AUIA 3H68A 3QG5C 4V0XA 4ORAA 1WAO1 2DFJA 3C5WC 4OR9A 3IB7A 2NXFA 5IOHA 4ORBA 4FBWA 3GVEA 1XZWA 3E7AA 2IE3C 4YKEA 3DW8C 4FCXA 4V0VA 5F3WA 2HYOA 2QFRA 2XMOA 3IB8A 4DT2A 4JA9A 3AUZA 3DSCA 1TCOA 5HPEA 1II7A 2Z72A 2IAEC 3PSOA 4KKZA 5J28A 2WDDA 4V0WA 3HVQA 1SU1A 2O8AA 2YEQA 4HD0A 4LTYA 4F0ZA 2BCDA 4J6OA 3H67A 4IYPC 1IT6A 4H2IA 4UT3B 3E0JA 3DSDA 3CK2A 4LU9A 1QHWA 3T1IA 1Z2WA 2JOGA 5INBA 1T71A 3EGHA 4JA7A 4DSYA 4H2BA 2NYMC 3RL3A 2DXNA 4ZVZA 5B8IA 4O5GA 3FLOA 3FGAC 4O4KA 1V73A 2NYLC 4H1YP 1QFCA 3V4YA 3H62B 3H61A 2HYPA 1G5BA 2KKNA 3KBPA 3K7WC 1HPUA 3THNA 2YVTA 4H2FA 2P6BA 1T70A 4WWLA 4TUGA 2IE4C 3H60A 3RQZA 4LACC 5JPEA 1HO5A 3LL8A 1KBPA 4UWQA 1OI8A 2WDEA 3TGHA 1HP1A 1S70A 2ZBMA 1M63A 1JK7A 2GJUA 3C9FA 4O43A 3ICFA 1W24A 1OIDA 4UT2A 4DHLA 4MOVA 4TUIA 3E7BA 3IVDA 3QFOA 5C1VA 2QFPA 1MF8A 3ZU0A 1S3NA 3AV0A 4ZX2A 1S3LA 2CV9A 3H64A 3P71C 4H1SA 3QFMA 3QFNA 3RL5A 5EQVA 4KBPA 4MOYA 4ORCA 5JPFA 1NNWA 3RL4A 1OIEA 2O8GA 4O24A 2AHDA 4Q7FA 3H69A 1UF3A 1WARA 2WDFA 2ZOAA 4NZVA 4B2OA 4G9JA 2ZO9B 2R17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S95 A;  3JYF A;  4I5L C;  3N5U A;  4UT3 A;  1Z2X A;  2QJC A;  2Z1A A;  3THO B;  1FJM A;  3IVE A;  1U32 A;  3EGG A;  2Q8U A;  4FBK A;  2BDX A;  3H66 A;  5JJT A;  4FBQ A;  2BQ8 X;  3K7V C;  4MP0 A;  1S8E A;  4M0V A;  2A22 A;  5DNY A;  2USH A;  3H63 A;  1S3M A;  4H2G A;  5GTU A;  4IL1 A;  4XPN A;  1XM7 A;  1USH A;  3ZTV A;  2NPP C;  1UTE A;  3QFK A;  2WDC A;  2HY1 A;  2Z06 A;  4I5N C;  3PSN A;  1AUI A;  3H68 A;  3QG5 C;  4V0X A;  4ORA A;  1WAO 1;  2DFJ A;  3C5W C;  4OR9 A;  3IB7 A;  2NXF A;  5IOH A;  4ORB A;  4FBW A;  3GVE A;  1XZW A;  3E7A A;  2IE3 C;  4YKE A;  3DW8 C;  4FCX A;  4V0V A;  5F3W A;  2HYO A;  2QFR A;  2XMO A;  3IB8 A;  4DT2 A;  4JA9 A;  3AUZ A;  3DSC A;  1TCO A;  5HPE A;  1II7 A;  2Z72 A;  2IAE C;  3PSO A;  4KKZ A;  5J28 A;  2WDD A;  4V0W A;  3HVQ A;  1SU1 A;  2O8A A;  4HD0 A;  4LTY A;  4F0Z A;  2BCD A;  4J6O A;  3H67 A;  4IYP C;  1IT6 A;  4H2I A;  4UT3 B;  3DSD A;  3CK2 A;  4LU9 A;  1QHW A;  3T1I A;  1Z2W A;  2JOG A;  5INB A;  1T71 A;  3EGH A;  4JA7 A;  4DSY A;  4H2B A;  2NYM C;  3RL3 A;  4ZVZ A;  5B8I A;  4O5G A;  4O4K A;  3FGA C;  1V73 A;  2NYL C;  4H1Y P;  1QFC A;  3V4Y A;  3H62 B;  3H61 A;  2HYP A;  1G5B A;  2KKN A;  3KBP A;  3K7W C;  1HPU A;  3THN A;  2YVT A;  4H2F A;  2P6B A;  1T70 A;  4WWL A;  4TUG A;  2IE4 C;  3H60 A;  3RQZ A;  4LAC C;  5JPE A;  1HO5 A;  3LL8 A;  1KBP A;  4UWQ A;  1OI8 A;  2WDE A;  3TGH A;  1HP1 A;  1S70 A;  2ZBM A;  1M63 A;  1JK7 A;  2GJU A;  3C9F A;  4O43 A;  3ICF A;  1W24 A;  1OID A;  4UT2 A;  4DHL A;  4MOV A;  4TUI A;  3E7B A;  3IVD A;  3QFO A;  5C1V A;  2QFP A;  1MF8 A;  3ZU0 A;  1S3N A;  3AV0 A;  4ZX2 A;  1S3L A;  2CV9 A;  3H64 A;  3P71 C;  4H1S A;  3QFM A;  3QFN A;  3RL5 A;  5EQV A;  4KBP A;  4MOY A;  4ORC A;  5JPF A;  1NNW A;  3RL4 A;  1OIE A;  2O8G A;  4O24 A;  2AHD A;  4Q7F A;  3H69 A;  1UF3 A;  1WAR A;  2WDF A;  4NZV A;  4B2O A;  4G9J A;  2R17 A; 
#chains in the Genus database with same CATH topology
 1S95 A;  3JYF A;  4I5L C;  3N5U A;  4UT3 A;  1Z2X A;  2QJC A;  2Z1A A;  3THO B;  1FJM A;  3IVE A;  2DXL A;  1U32 A;  3EGG A;  2Q8U A;  4FBK A;  2BDX A;  3H66 A;  5JJT A;  4FBQ A;  2BQ8 X;  3K7V C;  4MP0 A;  1S8E A;  4M0V A;  2A22 A;  5DNY A;  2USH A;  3H63 A;  1S3M A;  4H2G A;  5GTU A;  4IL1 A;  4XPN A;  1XM7 A;  1USH A;  3ZTV A;  3D03 A;  2NPP C;  1UTE A;  3QFK A;  2WDC A;  2HY1 A;  2Z06 A;  4I5N C;  3PSN A;  1AUI A;  3H68 A;  3QG5 C;  4V0X A;  4ORA A;  1WAO 1;  2DFJ A;  3C5W C;  4OR9 A;  3IB7 A;  2NXF A;  5IOH A;  4ORB A;  4FBW A;  3GVE A;  1XZW A;  3E7A A;  2IE3 C;  4YKE A;  3DW8 C;  4FCX A;  4V0V A;  5F3W A;  2HYO A;  2QFR A;  2XMO A;  3IB8 A;  4DT2 A;  4JA9 A;  3AUZ A;  3DSC A;  1TCO A;  5HPE A;  1II7 A;  2Z72 A;  2IAE C;  3PSO A;  4KKZ A;  5J28 A;  2WDD A;  4V0W A;  3HVQ A;  1SU1 A;  2O8A A;  2YEQ A;  4HD0 A;  4LTY A;  4F0Z A;  2BCD A;  4J6O A;  3H67 A;  4IYP C;  1IT6 A;  4H2I A;  4UT3 B;  3E0J A;  3DSD A;  3CK2 A;  4LU9 A;  1QHW A;  3T1I A;  1Z2W A;  2JOG A;  5INB A;  1T71 A;  3EGH A;  4JA7 A;  4DSY A;  4H2B A;  2NYM C;  3RL3 A;  2DXN A;  4ZVZ A;  5B8I A;  4O5G A;  3FLO A;  3FGA C;  4O4K A;  1V73 A;  2NYL C;  4H1Y P;  1QFC A;  3V4Y A;  3H62 B;  3H61 A;  2HYP A;  1G5B A;  2KKN A;  3KBP A;  3K7W C;  1HPU A;  3THN A;  2YVT A;  4H2F A;  2P6B A;  1T70 A;  4WWL A;  4TUG A;  2IE4 C;  3H60 A;  3RQZ A;  4LAC C;  5JPE A;  1HO5 A;  3LL8 A;  1KBP A;  4UWQ A;  1OI8 A;  2WDE A;  3TGH A;  1HP1 A;  1S70 A;  2ZBM A;  1M63 A;  1JK7 A;  2GJU A;  3C9F A;  4O43 A;  3ICF A;  1W24 A;  1OID A;  4UT2 A;  4DHL A;  4MOV A;  4TUI A;  3E7B A;  3IVD A;  3QFO A;  5C1V A;  2QFP A;  1MF8 A;  3ZU0 A;  1S3N A;  3AV0 A;  4ZX2 A;  1S3L A;  2CV9 A;  3H64 A;  3P71 C;  4H1S A;  3QFM A;  3QFN A;  3RL5 A;  5EQV A;  4KBP A;  4MOY A;  4ORC A;  5JPF A;  1NNW A;  3RL4 A;  1OIE A;  2O8G A;  4O24 A;  2AHD A;  4Q7F A;  3H69 A;  1UF3 A;  1WAR A;  2WDF A;  2ZOA A;  4NZV A;  4B2O A;  4G9J A;  2ZO9 B;  2R17 A; 
#chains in the Genus database with same CATH homology
 1S95 A;  3JYF A;  4I5L C;  3N5U A;  4UT3 A;  1Z2X A;  2QJC A;  2Z1A A;  3THO B;  1FJM A;  3IVE A;  2DXL A;  1U32 A;  3EGG A;  2Q8U A;  4FBK A;  2BDX A;  3H66 A;  5JJT A;  4FBQ A;  2BQ8 X;  3K7V C;  4MP0 A;  1S8E A;  4M0V A;  2A22 A;  5DNY A;  2USH A;  3H63 A;  1S3M A;  4H2G A;  5GTU A;  4IL1 A;  4XPN A;  1XM7 A;  1USH A;  3ZTV A;  3D03 A;  2NPP C;  1UTE A;  3QFK A;  2WDC A;  2HY1 A;  2Z06 A;  4I5N C;  3PSN A;  1AUI A;  3H68 A;  3QG5 C;  4V0X A;  4ORA A;  1WAO 1;  2DFJ A;  3C5W C;  4OR9 A;  3IB7 A;  2NXF A;  5IOH A;  4ORB A;  4FBW A;  3GVE A;  1XZW A;  3E7A A;  2IE3 C;  4YKE A;  3DW8 C;  4FCX A;  4V0V A;  5F3W A;  2HYO A;  2QFR A;  2XMO A;  3IB8 A;  4DT2 A;  4JA9 A;  3AUZ A;  3DSC A;  1TCO A;  5HPE A;  1II7 A;  2Z72 A;  2IAE C;  3PSO A;  4KKZ A;  5J28 A;  2WDD A;  4V0W A;  3HVQ A;  1SU1 A;  2O8A A;  2YEQ A;  4HD0 A;  4LTY A;  4F0Z A;  2BCD A;  4J6O A;  3H67 A;  4IYP C;  1IT6 A;  4H2I A;  4UT3 B;  3E0J A;  3DSD A;  3CK2 A;  4LU9 A;  1QHW A;  3T1I A;  1Z2W A;  2JOG A;  5INB A;  1T71 A;  3EGH A;  4JA7 A;  4DSY A;  4H2B A;  2NYM C;  3RL3 A;  2DXN A;  4ZVZ A;  5B8I A;  4O5G A;  3FLO A;  3FGA C;  4O4K A;  1V73 A;  2NYL C;  4H1Y P;  1QFC A;  3V4Y A;  3H62 B;  3H61 A;  2HYP A;  1G5B A;  2KKN A;  3KBP A;  3K7W C;  1HPU A;  3THN A;  2YVT A;  4H2F A;  2P6B A;  1T70 A;  4WWL A;  4TUG A;  2IE4 C;  3H60 A;  3RQZ A;  4LAC C;  5JPE A;  1HO5 A;  3LL8 A;  1KBP A;  4UWQ A;  1OI8 A;  2WDE A;  3TGH A;  1HP1 A;  1S70 A;  2ZBM A;  1M63 A;  1JK7 A;  2GJU A;  3C9F A;  4O43 A;  3ICF A;  1W24 A;  1OID A;  4UT2 A;  4DHL A;  4MOV A;  4TUI A;  3E7B A;  3IVD A;  3QFO A;  5C1V A;  2QFP A;  1MF8 A;  3ZU0 A;  1S3N A;  3AV0 A;  4ZX2 A;  1S3L A;  2CV9 A;  3H64 A;  3P71 C;  4H1S A;  3QFM A;  3QFN A;  3RL5 A;  5EQV A;  4KBP A;  4MOY A;  4ORC A;  5JPF A;  1NNW A;  3RL4 A;  1OIE A;  2O8G A;  4O24 A;  2AHD A;  4Q7F A;  3H69 A;  1UF3 A;  1WAR A;  2WDF A;  2ZOA A;  4NZV A;  4B2O A;  4G9J A;  2ZO9 B;  2R17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...