1S96A

The 2.0 a x-ray structure of guanylate kinase from e.coli
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
205
structure length
205
Chain Sequence
QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Guanylate Kinase from Escherichia coli at 2.0 A resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 66
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1s96A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s96A01
5G41A 1N25A 2X1VA 1EWQA 3FVQA 2OBLA 4TMZA 4Q9HA 3AVUA 2WKRA 3B1ZA 5AJZA 2CCJA 5FTKA 4OHWA 621PA 2A5JA 3UIEA 3U7GA 1NL3A 2VHUA 4TTRA 4I1UA 2NG1A 2GXAA 4DCTA 4OHVA 3BGWA 2AXNA 4Z8XA 3U7FB 1UAAA 4HYYA 1S9HA 1S9DA 1VECA 5FUYA 2EU8A 3SS8A 1ODFA 1T9HA 5KSYA 2CVFA 4QJ5A 2EFEB 3AVQA 2A3RA 2QE7A 5LB4A 1ZP6A 3QXHA 2OFWA 4LHXA 2ZS8A 2BKEA 3QSYA 1DAIA 2FEMA 4UXHA 3A58B 5TB5A 2GJ8A 3CF0A 2J5XA 2XXAA 3EASA 5EZ5A 1VYVA 4EPXA 2ONJA 4F92B 1KDRA 1PLJA 1E2LA 2NZ8A 2D62A 3T1TA 1DELA 3B1YA 4ZDWA 4QC2A 1X86B 1DAGA 2QPTA 3ZYCA 2ASEA 3A1TA 2HJVA 2PL3A 3K09C 3GLIA 221PA 1WA5A 1WP9A 2Z5FA 3GJXC 4XTRA 1RYFA 3TMKA 3GFOA 3FYHA 3KJEA 2N42A 1JJ7A 3QOFA 3RRMA 1Q3HA 3AM1A 821PA 3DEFA 4WW0A 1N3BA 5SZKB 3UG7A 4A0HA 4TQAA 5IDVA 4LJ8A 2QP4A 3EA0A 1J99A 1MABB 2VP4A 2HYIC 1IXSB 1NY6A 2HCJB 2UVQA 4LY6A 5D3MB 2WICA 2PBRA 1DAFA 3WHLA 4LHYA 3CX7A 2J0UB 5FPTA 5KO2A 2BC9A 1Q3TA 1DE0A 1XWIA 3JZMA 4F4CA 2QM7A 1GSIA 3THYB 2QGZA 3CPEA 1GIAA 1WCV1 1GKUB 2VIIA 4JLDA 3GJ4A 3A37A 4I4LA 1K8RA 4B6EA 4XH9B 2CNWA 2WMNB 4AYTA 2VHTA 3DO6A 2WJVA 4NONA 4W5JA 1QHGA 2XX3A 2ZEJA 4B2PA 1XTJA 2O8CB 2D3WA 2OEPA 4C0AC 3U6KA 4EPRA 2IK8A 1P72A 3VAAA 5HZKA 3EC1A 4JVMA 3HU3A 3OIYA 1NLYA 4MDEA 4GZMA 4QHYA 2I1QA 4MRNA 4IVQA 5JCPA 5GVSA 4V03A 5B2ZA 4LX0A 4PPNA 1Q20A 1SVKA 1SKYB 1TEXA 4HI0E 1BH2A 4UJ3A 1UPTA 3ZS8A 1S96A 2F9MA 1NRJB 2KE5A 3SN6A 3SZRA 2IYRA 5GADl 2XSZD 5SZIA 2O8BB 3T1OA 4OQNA 2VA8A 1L7VC 1WXQA 1VCIA 1XD8A 5E4FA 1OF1A 1KDOA 1KKLA 4URXR 5FBRB 2FWRA 3WNCA 3PV0A 4GNKA 3EWSA 1Z28A 2JJ1A 1KAGA 1HQCA 1NLZA 2P6UA 5JHHB 3X1XA 4RSGA 4A15A 3DMNA 4B47A 4PHFA 2J7PA 3K0FA 1XXHA 2WJGA 2J0VA 4QBIA 4JBXA 1RJ9A 4A6PA 5JSZB 1Z63A 1RKBA 1SXJB 3L0PA 1SXJE 2CE7A 5HE9A 1X8KA 1YVDA 2IL1A 3L43A 1VPLA 3BOSA 2MSDB 2JCSA 2WJHA 3PUWA 1T8UA 4KITB 3ICQB 3P26A 1G3RA 2EVWX 4FI3C 5CYPA 1N6NA 1U90A 4HUQA 3RSLA 1EX7A 3B5JA 3SFZA 2G83A 2ZYVX 4Q19A 2V3CC 2WVJA 3DKPA 3MFYA 1ZM9A 1GILA 4Q21A 5AR1A 5JHGB 5F9FA 1W0KD 2I1VB 4LJYA 3KUDA 2O0HA 3K0CC 1T3HA 1KHTA 2QRZA 2VQSA 4CEIB 4Q4LA 4TYWA 5AUNB 3CWQA 1UBFA 4RJLA 2WV9A 1G21E 3L0OA 4UQOA 3RS7A 1CIPA 5IK2D 3A1SA 2QMUA 1KY2A 3IHLA 3OFND 5M04A 4XWKA 4TSFD 1ZMXA 1DAHA 3SJZA 2DFTA 4QJ4A 3PEWA 4Q4HB 5FI1B 3WNBA 1N0UA 2GBLC 2YYZA 3OE7A 3OEHD 1N2CE 4R2HA 3SHFA 4RZUA 5DN6D 4PTLA 4UNNA 4LSGA 2A5FA 4Q00A 4DEXA 2P5TB 3CPHA 3V00A 3H1TA 3H86A 2BCJQ 5KOYA 1E2JA 1W49A 4JYCA 1XTSA 4UJ5A 2FPMA 3H84A 3OF5A 3Q7PA 2REOA 4LHZA 1KMHA 4C2TA 1KI4A 4HB0A 5JI3E 3VR4A 1M7HA 3E70C 3HYTA 5IF9A 5SZHB 1YRAA 2J0UA 5KNDA 3O8RA 1DVRA 3QVVA 4V0OA 2HXYA 3UK6A 2VP0A 4OJQA 4W5HA 4DUGA 3GJ7A 3CNOA 4CRWB 2FV8A 3X1DA 2ERYA 4RKFA 3GCGA 4QNMA 4JJZA 5GJBA 1MT0A 3KQKA 3BB1A 4F7WA 5JJIA 1A5TA 1M7GA 3SI7A 4F4JA 2FX3A 5HCIA 5EUQB 3MRSA 1US8A 3IO3A 3UMFA 4FWIB 4N1AA 1A1VA 1U99A 3GEIA 3GLGB 2O8CA 4WZBE 2FA9A 4JVLA 4HLCA 2VSXA 5KDDA 2BMJA 5HZHA 1KAOA 4WOPA 3BORA 1S2MA 3A1UA 3FTQA 5KU1A 3K0AA 4X8HA 2HV8A 4OI4A 4LK2A 4JLNA 4JSTA 1JR3D 4KBFA 5AK0A 4IHQA 4ZIRA 1IAQA 4XVQA 4E09A 1YZQA 1QHNA 3FKSD 2BMEA 2A5YB 4LJ4A 4CW7A 3QEOA 1SHZA 1ZNXA 2QPAA 3PG5A 2QT0A 4ZO4A 1VYUA 5EXXA 2NZJA 1G291 2QBYA 1DARA 1OV4A 3GJ5A 1E0JA 1JBKA 4C0QC 2GZAA 1JR3A 1DAKA 4YONB 1AS3A 4LBZA 1ZINA 1FX0B 1VYTA 1W48A 3K9HA 4LPKA 1KNQA 4QFMA 1Q22A 5L3VA 4HB3A 3KQLA 4LBVA 1ZD9A 4NCNA 4GRAA 1S3GA 1NJGA 1XJCA 1ZNYA 2QY9A 3Q8XB 5FOXA 2V1UA 2RB4A 4UNPA 4TLDA 1H8ED 1XD2B 1XTQA 3CRW1 2QSYA 2GXQA 2ERXA 4NPHA 4M53A 4IOMA 4XSGA 1SVLA 2KWIA 1G17A 1GFIA 1GL9B 2K5UA 4L16A 3GLFE 2ZYWX 3EC2A 3FMFA 4GP7A 3X1YA 3R8CA 3RC8A 1JAHA 1Z0DA 2ODNA 2REBA 1UBEA 2J87A 3K53A 3TQCA 3TBKA 1IY2A 2FPKA 2NQ2C 2W6JA 2ZYTX 1J90A 1KZGB 2GZDA 2YHSA 1E9SA 1NIPA 4KHZA 2EFDB 1PLLA 5P21A 1XFAA 4V0LA 1U0LA 4MQBA 5BYKA 1E0SA 1OXTA 1LF5A 2EW1A 2ZUBA 3HR8A 1TPZA 4EFNA 5HTKA 1NMYA 4Q4JB 3T15A 3AGQA 4GPTA 1KI2A 2FJUA 4TL7A 2B7BA 5FBLB 1EGAA 4HZUB 4ACBA 3BD9A 4Q03A 4ZI3A 4TZ6A 4Q1AA 4MKIA 2O5VA 3ASZA 2REXB 3AV0B 4EPYA 1D2MA 2R62A 1OFIA 1OHHD 5BXQC 4JLVA 2AHOA 2WAYA 4MH0R 3IEUA 2PJZA 2N1BA 4A2WA 2Q21A 2ZSAA 4N0EA 3MJHA 2QT1A 4M1TA 1X8LA 4JLBA 1NN3A 4JIMA 3ZQJA 2ZPTX 1CR2A 1GRNA 1Z6AA 4NE2A 4NYIQ 3MAAC 3TNFA 4F38A 3I92A 1Q1ZA 4NH0A 2RGBA 1NJFA 4BFVA 2CLDX 1EK0A 3ZD6A 5JLJA 1PLKA 2BJVA 4GOXA 4PHTA 3A6PC 1G5TA 3T5GA 1OH6A 2GF9A 5UKDA 2PJRA 2GEDA 2RGNC 3V4RA 2G1JA 1SQ5A 2A2ZA 2ZE5A 3NIBA 5B64A 4LI0A 5LD2B 1D2NA 2QM8A 4YXWD 3PEYA 2P6RA 3EWAA 1YJ5A 1G5PA 4MITA 2I4IA 1XZQA 3QVUA 1M34E 2KSQA 2BM0A 3VR6A 3PEVA 4ASUD 1ZIPA 5EE9A 5FUWA 4KYIB 2J7PD 1OXUA 4LZZA 1S0UA 4EQ6A 2Z6VA 2GKSA 5KNBA 3KXKA 4J0QA 3DKVA 3L0SA 3W34A 1K6MA 1D5CA 1P2VA 4QBGB 4LJ6A 2AX4A 4TYQA 4W5WA 1Z0KA 3MLEA 1AA9A 5G3ZA 2F1JA 1ZM4A 4HAZA 2BVNA 2VP9A 3LW7A 4XIGS 1NVUQ 2D06A 1C9KA 3THXB 5DHFA 4JT4A 4HATA 1E94E 2UZ3A 1QRAA 3P1JA 1IM2A 2CE2X 3AQ4A 2QN6A 3JZAA 2IYVA 1E2HA 2H8KA 2WJJA 5H8WA 3Q5DA 2ZJBA 4DCVA 3H2YA 2OBMA 4WAUA 1L2TA 5CK4A 2Q6TA 4A8JB 4TMVA 1JECA 2PT7A 4GI7A 4RD2A 3BFXA 5L3RA 2WPDD 3VX3A 1E2NA 4E22A 3BH7A 4NHOA 4HAYA 2O8EA 1KMQA 3K9LA 3QXXA 2F6RA 4Q1CA 3GEHA 4A1FA 3W8NA 4JLAA 2PZFA 1CS4C 3X1ZA 3U4QA 1P9RA 4DLWA 4IEIA 1TAGA 4HEJA 3BERA 1BS1A 1TF2A 2RH5A 3IIKA 4PC3A 5AUQA 4Q9LA 3TUJC 4EUNA 1A4RA 2KBEA 2W6ID 2B8WA 5JEEA 1MO3A 3ND8A 1XCPA 2R6FA 1IXRC 3BB4A 1W47A 1RE0A 4B2IA 1XF9A 1HTWA 1G7CA 2C96A 1F48A 4LBYA 2IUSA 4EFLA 1R5NA 1U0JA 3KDSE 3ZQ6A 4RCZA 5F2EA 3MCAA 4A8JA 2FNAA 1ANKA 3F0TA 4X8LA 1Z2AA 2C98A 2EYQA 2OILA 2BHRA 2OO7A 2WOJA 1G20E 3MWLA 3PUXA 3I8SA 4IDOA 3VHXA 4M2LA 2XTZA 1KDTA 3P32A 4B44A 5AJXA 2IYZA 3A36A 4LHVA 1XEXB 4BFWA 3C41J 4B73A 2FN4A 4PO1A 3ZGXA 3CZQA 2ANCA 1MRSA 3B1VA 4FMDF 2ZRBA 4QGFA 5KUTA 2IEYA 2QENA 2WMOB 3TH5A 2ZSDA 1DOAA 3B1XA 4ABYA 3RNLA 4QKQA 5EP1A 2WWHA 2X19A 3GD7A 2QL6A 4B76A 4DJTA 3FKSA 1ZCAA 3N2IA 1Q21A 1KJZA 3UG6A 3WBKA 2FH5B 1OJLA 2RGNA 3LY5A 1XCMA 2OAP1 2QTHA 1FTSA 1NVVR 4MKFA 4YDHB 2B92A 2D2FA 1XB2A 3O47A 4XJXA 1FOEB 4A2QA 3QKSA 1FZQA 3GPLA 4ZIRB 2WBLC 4CEJA 2GCOB 3PFIA 4B71A 2JLXA 3GLFB 2O8FB 3RABA 1W2HA 1N6RA 1HT2E 4D26A 1H8EA 4ZKDA 4D0NA 2DPXA 4URVR 2OCYC 3TJZA 1AIPA 4TLEA 2HT1A 2R6CA 5LPNA 3QPWA 2GETA 1J7KA 5FOUA 3CZPA 3RSOA 4Q02A 4QM6A 4F91B 1CULC 2CLCX 1XZPA 4PPGA 3VTKA 4D0GA 1UKYA 1ELOA 2D4HA 5JMTA 1HEIA 5L3SB 3FKQA 5C46F 2CL7X 5FOTA 2OXRA 4H1UA 3KQHA 4L8GA 4AG6A 3SHWA 4E07A 4JJKA 1YZUA 2H17A 1VKJA 2X2EA 4X8MA 4YMTA 2IS6A 5FR2A 2ZJ5A 1E79D 1LB1B 2EWWA 2GK6A 3DOEA 3N2EA 2N46A 4PAQA 5DGXA 4L5BA 5H1YA 1FPMA 4CT4B 5J47A 5L8VA 3LRPA 3SOPA 3UKDA 1N5KA 2GK7A 1KMHB 4Z1MD 1GL6A 1E4VA 2O0JA 3QKTA 3W6NA 3NBZC 3KQNA 3NHAA 1E2EA 1IBRA 4BFTA 2Q3HA 2D7DA 5CB6A 1C4OA 4PSKA 3NEYA 3RWOA 2ODBA 3D7MA 2RHDA 4NYJQ 4HLUC 3FHCB 1YR9A 4M21A 3R9IA 1KO7A 1R2QA 1XTIA 3EZ2A 2ZJAA 2IYXA 1GRQA 5C4GB 1Z06A 3QXJA 2ATVA 1CKEA 1ONBA 5FTNA 2ZSBA 3TW4A 4G01B 4RKEA 3GMTA 1W4RA 3AP2A 2IC5A 2WSSA 4OK5A 4URWR 1GKYA 5EQTA 1RIFA 2YZ2A 1H8HD 2CL0X 3VR2A 5EP4A 3T35A 1XXHB 1C1YA 1ZUHA 3SC3A 3SYKA 1XRJA 5K8TA 1YZLA 3HU1A 3CRQA 1TU3A 5FTLA 4A92A 1E99A 4OYHA 3FFAA 4WIAA 4YMSA 3K9GA 2B7CA 3C16C 4LJ7A 3G5UA 2G77B 4JKIA 4HAXA 3TQFA 4CIDA 3NHBA 4TQUS 2HF9A 4ZKEA 1OPXA 1Z07A 2F43B 3GFPA 1KK1A 4FN5A 5JZVA 1G6OA 1N5IA 2IS2A 4N3NA 3MGCA 1SVOA 3C5CA 4TN1A 1QVRA 1JQLB 3RHFA 3CNLA 1OXVA 3RS4A 4OQXA 5EXPA 5E7IA 3OIWA 1N0VC 2XAUA 1SVSA 4KVGA 5CM8B 3JVVA 3NG1A 4JYBA 1CR4A 3PEUA 5FH9A 5FL3A 1X6VA 1XTRA 4PFSA 1E2QA 3FMOB 1GNRA 1ZUNB 1CR1A 4B3XA 4EPWA 1DG3A 2JLVA 5KNCA 4BASA 3UANA 2G6BA 4KCGA 2W6JD 1WBDA 3QEJA 4V02A 4RCYA 5BN4A 2HCBA 2IXGA 2RGXA 1GAJA 4BZXA 4V0KA 3BS4A 1JPJA 1LW7A 4PC2A 5AJYA 1M8PA 4JVSB 3KZ1E 5JWOA 1E9AA 4DB2A 2QTFA 1NSFA 4LC1A 1XU4A 2GJSA 1KO8A 1QBKC 1JEDA 4MGKR 1TQ6A 3TR0A 1VIAA 4K46A 5JBQA 1Q57A 3EZ6A 5JJKA 1VHLA 3MUFA 3TE6A 5FOSA 1T6NA 1YRBA 4HDOB 3WNDA 3IPXA 5DHAA 2EFHB 4G5OA 2IT1A 2HF8A 2JATA 3QF7A 3LXRA 3LXXA 2QRNA 1Z0AA 5FPYA 5B58C 4GDFA 3RRZA 1II8B 1E9RA 4MUBA 3T34A 2DFNA 2VHQA 1R8QA 2HJGA 2GCOA 2P2LA 4TL6A 1YZTA 3GLHB 1Y63A 4NYMQ 2V6JA 1FUKA 2WIAA 2VF8A 4BE7B 3LX8A 1KK2A 1U8ZA 3RS0A 4XD7A 1W44A 2V55B 4KO8A 1WBBA 4DT1A 2CHGA 2WWYA 2DY1A 2CK3A 1E2MA 1GG2A 2F7SA 1P9NA 1E9CA 4XVUA 4NCHA 1SXJD 2P5SA 2VP6A 4DCSA 3A1WA 3BC1A 1IN4A 4XD7D 3A4LA 1IONA 3UATA 4LYAA 1NN0A 2HUPA 1JNYA 1A2BA 3GFTA 1XD9A 2V6IA 2EYUA 4OHZA 5FR1A 1NBMA 2Q9AA 4TMWA 5H68A 1XBTA 3UWOA 1HY3A 2CK3D 2CCKA 2JLWA 4C2UA 3MSXA 5G40A 4YXWA 1I2DA 2R9VA 3IIJA 1VTKA 3N5CA 4N0DA 1MR3F 1AK2A 5DO9A 2DFKB 2XSZA 2PH1A 4GP6A 3L0IB 3K09A 1J8MF 1XEWX 4TLBA 1Z3IX 3CIOA 1AQYA 4HDCA 3L2OB 2H7VA 3AB3A 5HE8A 2C78A 2EQBA 4MKGA 2RGAA 2FSIA 3ASYA 3VR3A 4ZPXA 3U7EB 3IILA 1RZ3A 1N6IA 2JASA 1Q0UA 4KYUA 5FFMA 4YMUA 2ZTSA 2G0NA 1N6KA 1E69A 1XMIA 2OT3B 4LUCA 1HYQA 1U9IA 2ZRKA 2AWNA 3LV8A 1TQ2A 2VLIA 3W3ZB 5J4HA 2QORA 2F3TA 3AKEA 4HB4A 1EFCA 4QGAA 1E2KA 1QDEA 2O8BA 4MGZR 1ZJ6A 1ZAKA 2FF7A 1E3MA 2VL7A 1CJVC 2ONKA 4HLQB 1NF3A 4O2RA 4Q7JB 4A9AA 1TADA 1Z0FA 3QPVA 1E96A 2JGNA 5IHPA 3FOZA 2NPIA 2YKGA 4TQ9A 1US8B 2W2VA 4D25A 2FEOA 2XNSA 1F3OA 5KYKA 3AKDA 4DUGD 3GLHA 2ZRLA 4BLRA 5FBQB 3T1VA 2W6IA 3SU8A 2W0SA 3LVQE 5CM9C 1IQPA 1P2UA 4CEJB 3IQXA 1Y3AA 1IY1A 1P62B 2C03A 3DPUA 1P60A 2QI9C 3KKPA 4MYHA 5FUXA 4AG5A 4TT3A 3UXMA 4M9QA 4Q7KA 4ERNA 4IFEA 3FWYA 1OE0A 1W7AA 1T0HB 4B2LA 2UZIR 4BPBA 1F2UB 4I99A 4PAMA 4DCNA 4PQFA 2GXSA 4KFTA 4AC9A 3LFUA 1Z0IA 4G3XA 4OI2A 5G53C 3EPJA 4LPSA 4AYXA 4FWTA 1F2TB 2F1RA 1ZYUA 4KFSA 2OCBA 3R7WA 4B74A 2OESA 3Q72A 1KSHA 3MG9A 2DWOA 2OFOA 4TLCA 4JSYA 2OM2A 4Q1EA 3RANA 4NU0A 1KYIA 5KDLA 2C9YA 3WRYC 1NG9A 4IKEA 2ZRPA 1E2GA 4II7A 2ANBA 3VX4A 2X77A 4B32A 5LBIA 4XSHA 2FDCA 2RKOA 3LQQA 1E0KA 4QHSA 5FPKA 2ZQ5A 2DBYA 3BWDD 1LVGA 2YVUA 3QXCA 1G3IA 3BK7A 3EG5A 1GWNA 2IYYA 4R7ZA 4R2IA 4PAOA 2IXEA 3KKOA 4AY2A 3FGNA 3REFA 3TSZA 5TARA 2QAGA 1GRRA 3CLVA 2A5DA 3OEEA 4MRSA 1OB2A 3AF0A 3SE0A 3AVPA 3PJRA 3SBEA 4EPTA 1UJ2A 2IHBA 1SVWA 1MH1A 4JLOA 1ZM7A 2RGCA 1OKKA 4EQ6B 121PA 4FCTA 1AKYA 1G16A 4D4JA 2GEUA 2VYFA 1XPUA 3OEED 1DG1G 1JEEA 1RRFA 1RYHA 4M9ZA 1RRCA 2PEZA 2VO1A 5DIFA 1CJTC 5A0FA 2C8VA 2ZU6A 2ZE6A 3FMIA 3V9PA 2WKQA 4IOJA 2ZI4A 3THWB 4URZR 1QZXA 2IW3A 2QMEA 4EJSA 4AYWA 1Q1QA 4BUJA 1TTTA 3LAWA 4UNRA 2DFLA 3AF3A 2FSGA 4Z54A 1CEEA 1WDTA 2MSCB 1BOFA 3ZIAD 3BH6A 1ZBDA 3MJRA 3SQWA 3DL0A 4IXNA 4JL5A 3IBGA 4PHGA 4KFUA 1CBUA 4HZUA 4IRUB 5J5CA 4A0GA 1J8YF 4R71A 1OFUX 4IFBA 4OQLA 4WA7A 1RC8A 4FIDA 4P31A 2E87A 1E2FA 2BBSA 4I81A 3SJAA 2F3RA 3QIAA 1KKMA 2RGDA 1DADA 1T5IA 1J70A 2AD5A 3M4YA 1N6OA 3EZ7A 3R9WA 2QPOA 2L0XA 2JJ1D 4LYJA 3U5ZB 5E3HA 3FHOA 1YR8A 4TWZA 4YMWA 1R10A 3OZXA 1M74A 1NMZA 3K1JA 3U4QB 4TYPA 4D2IA 2R6GA 1WB9A 2ZAOA 5C1BA 2VP2A 4Z1MA 4DRZA 1NMXA 4QJ3A 3RS2A 2BCGY 3AF2A 4EJSB 4QL3A 4IVRA 1TEVA 2OZEA 3NH6A 5CIQA 2VSFA 3B9QA 2FFAA 2XZPA 3BIFA 4DLUA 4X8OA 2JLUA 1OYYA 5G3YA 1SXJA 2C04A 2F9LA 4HAUA 4B3DA 3U61B 1CTQA 1HUQA 1G3QA 1W1WA 1T5LA 1V43A 5AWFC 2J7KA 2QAJA 2ZS9A 4KODA 1XD2A 4A0FA 2YJTD 1UEJA 4FCWA 2P67A 3CH4B 2F1HA 2CEAA 1E2IA 4JKYA 2A5GA 4Q9JA 1W0KA 3N70A 3I4LA 1L8QA 1KI3A 4MYUA 2VP5A 4HUQB 1XP8A 3AP3A 5TMPA 4QGHA 3VMFA 4CYMA 1DEKA 4GT1A 4RFVA 4MRVA 4E5UA 4CGZA 1Q1EA 1W36B 2OLKA 3AKCA 2GXUA 3T5DA 3LBHA 4TSFA 2R44A 4Y0AA 2FGKA 4DLTA 5J4VA 3LQRA 5JFGA 4FINA 1GITA 3ADKA 3NEJA 1XMJA 2FPLA 3AVXA 4GMXA 5EP2A 1QHHA 1QG2A 4LYFA 4B6FA 1P7CA 1ZU5A 2ZU0C 3A8TA 1X3SA 3KFVA 3NBYC 3PIRA 1S4QA 2GVDC 3DZDA 1QHHB 4PXAA 3ZZTA 2F55A 1OH5A 1KZ7B 3ND9A 3BH0A 2Z83A 1NN1A 3GJ0A 2DWQA 4LCBA 2VTKA 4Z8YA 2ZRGA 4C7OB 2J1LA 3IUYA 1W2GA 3DMDA 4BFZA 1QG4A 1W0JD 3E2IA 2H18A 5GJCA 2JIZA 5JWRA 4PQRA 1OXSC 1XJQA 4L9WA 3OFNA 1AS2A 2X8AA 4TL9A 2YC2C 2ZVQX 4S2EA 4P4SB 3CX6A 2C2HA 1UDXA 3DM9B 5CYOA 1G7TA 3D31A 4C30A 3HJNA 3OE7D 3IEVA 2FFBA 3KQUA 2H57A 1W0JA 4NCIA 4A82A 2JIZD 1JR3E 2AFHE 4LJAA 1COWA 2NTYC 2WPDA 4KBGA 1Z6XA 3U3OA 4PPQA 4DLSA 3DM5A 2G3YA 2BDTA 4V0NA 1JR6A 1U8AA 4GMDA 2ZRDA 1RRGA 2PX0A 2R8RA 1X1RA 3G82C 3KB2A 5FUVA 4BZPA 1N6LA 2YWGA 4TT3D 2CHVA 1QVAA 4LRWA 3BE4A 2DCUA 1UM8A 3RRYA 1FNMA 1UBCA 4CVNA 4XWAA 3GLFA 3R9XA 1ZM2A 1T3LA 3CB4A 3HP1A 4WXRA 1XPOA 1VCNA 2PMDA 2QEQA 3Q85A 3VR5A 4URYR 4CEHA 5JSZA 5DISB 1XEWY 4I1SA 4KV9A 2GWHA 1QHSA 2JA1A 4AIIA 2F43A 3FMPB 1XPRA 1YR7A 2WJYA 1GZSA 3QENA 2VPPA 1MO4A 2GF0A 3L82B 4M1WA 4QXAA 4S35A 2RCNA 1KSJA 1EFHA 1VG1A 2P65A 4ESVA 2FOLA 4DDTA 4NP6A 3GEEA 4L15A 1E32A 1HA3A 4Q4JA 5IRCD 2HLDA 1G4AE 2G88A 3FB4A 2FSHA 4MRPA 4F93B 5K8IA 3I62A 5L3QA 2AR7A 4WBSA 1RJ9B 4M9SA 1OKKD 2ZAMA 4DIEA 1FQJA 2WOOA 3K0FB 2QTVB 5H70A 3BXZA 2CJWB 2V7QA 2FG5A 3Q9LA 4OK3A 4RY2A 5HCNA 5LD2C 2ZI6A 5EE3A 5FL7A 2TMKA 2PT5A 4DLZA 2FZ4A 1KSFX 2O8EB 1CU1A 2VH5R 4PSVA 4US0R 2GESA 5DSZA 3CUEF 1M2OB 1YE8A 3LNCA 3AGPA 5FI0B 4NCJA 4NKRA 5EJEA 2IUTA 1E98A 5CK5A 1OXXK 3WHKA 4M1SA 2GAOA 3RAPR 3ZIAA 1KO1A 5AUPB 2CVHA 2AKYA 4DIDA 1YQTA 4BEBA 3E1SA 1P75A 3Q3JB 4HSEA 5F9HA 3DVLA 1CJKC 3F3YA 2X2FA 2NMVA 5DYIA 3RVBA 4MGYR 2JLQA 2WWWA 1N6HA 4MRRA 5HKKA 2JEOA 1JXMA 4AWXA 1X8JA 4PX9A 1DAMA 2BBWA 1L4YA 4NL4H 1NBME 3MMPA 4Q66C 4XOIA 3W9YA 1AQUA 4M0LA 2HT6A 5CLLA 5EE5B 2IYWA 1U9IC 1NY5A 4Q9KA 5CJPA 3ZS9A 5KPJA 2ZRMA 3P4YA 4C7OA 3CWZA 1OIWA 4US1R 2ZETA 2NGRA 4POAA 5TV2A 8OHMA 1PV4A 2FFQA 1I4LD 1TNDA 3F8TA 1G7SA 2WWGA 4ZDKA 1KNXA 2WWXA 4M1YA 2P6NA 1HE8B 2DB3A 2WHXA 3K0SA 1T8TA 3RS3A 4OL0A 2ZRIA 3TAUA 1R7RA 1UKVY 2D7CA 4QM7A 5CLQA 2GEVA 2NO9A 2JLYA 3TUIC 2ZRAA 2AK2A 2NPFA 1P5ZB 2BM1A 3B78A 1F60A 1CP2A 2W00A 2RHMA 1VG8A 4U7DA 3NDBB 3FHTA 2A9KA 2FZLA 5B30A 4RD6A 2RAPA 3WMEA 4D81A 2OBNA 1TMKA 4GOJA 1UADA 1UEIA 2YWFA 4G5SA 5TDHA 1Z0JA 4ITRC 3W6PA 2PLRA 4KI0A 5FPSA 3TUZC 3ZZUA 4B3GA 5FBVB 3QG5A 2ODWA 3R8FA 4GOKA 4R9UC 1ZCBA 2QE7D 1R0YA 4KU4A 2OLJA 1E1QA 1KI1A 1P6XA 4RFSA 4ASUA 3AKYA 2NIPA 2V54A 4C0LA 4WZ6A 5FBWB 2Z4RA 2FMXA 2AKAB 4NYIR 3ZVLA 3SFVA 1KO5A 3QG1A 1G3UA 2ZI5A 4B33A 4BFUA 2YV5A 1DPFA 4UXJA 1S1MA 4D4MA 2Y8EA 3VKGA 4B35A 1YKSA 3K70C 3AUXA 1RRPA 4JLPA 521PA 1Z83A 2FFHA 4IDHA 2WIBA 4MGIR 5DYGA 1ZU4A 1AN0A 3KFXA 3LO5A 4B3FX 1DTSA 1G18A 4KFRA 2GCNA 3V4FA 3LW8A 2WTUA 3L8ZA 2QROA 2ZRCA 4JMPA 5A5GA 1KO4A 3B7GA 2BBTA 1ZW6A 1V5WA 3QY0A 2AL7A 2PLFA 1DO2A 4OJKA 4MDFA 5DH9A 1OIVA 1R8SA 1YR6A 2JJ8A 2IX3A 1FNNA 1LS6A 1P3JA 4IW3B 1IY0A 2IF2A 4KXFB 4V0MA 5JRJA 4ZV4A 3CRVA 1W4BA 3UPUA 1GKIA 3QKRA 2LCFA 4MUAA 1SXJC 1YZKA 1ESMA 1LY1A 4AK9A 4P4TA 1P73A 4RD0A 2V1XA 1BKDR 2PX3A 3IKJA 3VR1A 2VSOA 4BFSA 4B43A 5TY0A 3WXMA 3S1AA 2ORIA 1XXHE 4NZYA 4OBEA 2XZLA 3EPHA 4B75A 2GNOA 2XZOA 2V4ZA 3TLXA 3AEZA 5EE0A 3QI2A 4Q7MB 4DDUA 3SNHA 5C18A 3KB1A 1O3YA 4C3ZA 4ZI2A 3KKNA 1NI3A 2GHIA 3I73A 4O2LA 2QP9X 3NC0C 1MOZA 2ORWA 4JLKA 3B82A 3M1IA 4TTQA 3LBIA 3KJGA 2D74A 2ZXUA 3TKLA 2Z43A 3B13B 4LDJA 4AURA 2JDIA 3CBQA 4IDNA 3RYTC 5KSOA 2GCPA 2GJAA 4D0LB 1COWD 4EJSC 1BIFA 2XGJA 3VKHA 2ZI3A 4NYJR 3HWSA 3KKMA 5BQ5A 1TX4B 4D4KA 3KUCA 3U44B 3CKLA 4FW9A 4KSBA 4D6PA 3K0AB 2ATXA 2FU5C 4G5GA 2CNWD 3KKQA 4A2PA 1N0WA 3IIMA 1P61B 2IYSA 3QBVA 4YDSA 4BWYA 5BYJA 5J4KA 3QE0A 4TL8A 1AZSC 3WYFA 1P2TA 3D6TB 1SVMA 5FTJA 3RLFA 1KIMA 5TVKA 4BLSA 4DCUA 5KSZA 4HAWA 1NSTA 1HE1C 2V7QD 2OG2A 1AJEA 1QHIA 3BAFA 4JBYA 1JJVA 4U02A 4BQSA 3C15C 4AKIA 4XTCS 1OSNA 3I72A 2YOHA 1P2SA 1G9XA 3CR8A 1E6CA 1SKQA 3SQXA 4O3MA 4A8JC 3CONA 2WSMA 3ONWA 2AXPA 1ZIOA 2XNDA 3EARA 3AUYA 3U3KA 3ADDA 1KK0A 2WM9B 5IK2A 2IS1A 4DSUA 4EFMA 1I4DD 1FW6A 3TR5A 4BRWA 4HDQB 4MYCA 5CDFE 3S1AB 4QBFA 1VG9B 3SR0A 3UMRA 6Q21A 3ZVRA 1ZVQA 1E9DA 3ZZ0A 1R0ZA 1BYIA 2XNDD 5F3WB 1ZC4A 1W5SA 5FL7D 4TYYA 5JS7A 2PCJA 1XTKA 3PXGA 5FPHA 1DAEA 1Z8FA 5DN6A 1SKYE 1G8GA 3ETLA 2IWRA 4BLPA 2YWEA 4RD3A 1MV5A 4BGDA 3CF6R 4V0ME 1Z6TA 3CM0A 1D2EA 3FE2A 2FSFA 1KY3A 1LV7A 1M1YE 2JJ2A 1E9EA 2W58A 2XTNA 3LVRE 4TTPA 721PA 5JRZA 2IS4A 5ELXA 1ZC3A 4YC7A 3OESA 3C8UA 5EXTA 4DZZA 5JS8A 2ZR0A 3OIUA 3QXSA 3T61A 2QAGC 4G5RA 2YC4C 1Q12A 1U98A 3D8BA 1JQJC 3AF1A 4GFDA 5DI9A 1LTQA 1OFTA 2KBFA 1IHUA 1NN5A 5CDFA 4DC9A 2ZROA 1FTNA 2OCPA 3KJHA 1KDPA 1M6NA 3B2EA 3ZVNA 3LLMA 1X1SA 5AUOB 1N5LA 1UKZA 3WMFA 3WYAA 3QF4B 3QQ5A 3LBNA 4PC6A 1KJWA 1VDZA 2W83A 2OE2A 1XMSA 3B9PA 4JL6A 4K8OA 4XVRA 1VHTA 3VU9A 1WRBA 4FMCB 4BLQA 2Z4SA 2V9PA 3VFDA 3QF4A 5FOWA 4HZIA 5DLQC 1HH4A 3ZJYA 4GZLA 1GOTA 1S1CA 2HDNB 3B85A 3TIFA 1WMSA 2AD1A 3SBDA 4B34A 2DWPA 3QJYA 1I4TD 2G9NA 4E03A 4CT5A 3HR7A 3MWJA 3EPKA 4NYMR 4NDZA 4JLMA 3ECCA 3ICEA 1IJEA 3MD0A 3QUSA 2VHCA 4QGGA 5BW8A 2BKUA 4LJ9A 4OQMA 5JI2E 1AGPA 3U6BA 1IOZA 2IWHA 1KI8A 1Z22A 2ZJOA 2ZREA 3EIHA 4DT1B 2BEKA 3GQBA 1YZGA 2B8TA 2H1LA 3K0EA 2RGGA 2XJ4A 5EP3A 5E7JA 1IN6A 2YINC 3HPQA 4LV6A 3VNUA 4H9GA 2QQ0A 4PR0A 1ZM3A 3I32A 1TUEA 2Q0HA 1GTVA 1MKYA 5A4JA 1W36D 1ESNA 3X2SA 2BMDA 2QNRA 4OHYA 1G19A 3PENA 2CLSA 4DHEA 2ZRNA 2YOFA 2ZUDA 5JCZA 4D80A 4WVFA 4LWZA 4PQYA 1II9A 2BWJA 2PMKA 3HPRA 2KI5A 3X1WA 1RPZA 2C5LA 1G5RA 2J59A 2VHJA 4HB2A 1IN8A 5KTYA 2ZE7A 1GL7A 3OAAA 3A1VA 1P9WA 1LF0A 2ZI7A 1G4UR 2A78A 4EPVA 3BB3A 1SHKA 4UNQA 4PC7A 3T1QA 2AK3A 1UFQA 1XCGB 2NOAA 5ANRB 1XX6A 4M9XA 2XTMA 4M1OA 4QBHA 3Q5EA 1K5DA 1BYUA 3QKRB 4PO9A 5DE3A 3AVVA 3IQWA 1G8HA 1ETUA 2ECKA 4IOLA 4LHWA 4W7SA 3W5IA 2ZJ2A 5K8LA 1VIYA 2GDJA 2LWIA 3C5HA 4LGMA 1G8PA 4Q47A 1CF4A 3PVSA 1JXOA 1MRNA 3EIEA 2ZJYA 4Q7LA 4UXIA 3IBYA 4JT2A 4QOSA 4FMDB 4RD4A 4KLZA 2IYUA 3J81k 1QF9A 4OK6A 1E4YA 2GTPA 4AKGA 4GL2A 1G6HA 2AN9A 1ZD8A 4QHTA 2CXXA 2JDID 1NBMD 4KVAA 5FTMA 2J0SA 1XEXA 3OIVA 4WZAE 4ILEA 1W46A 3ADCA 2R6DA 4NCKA 4OI0A 3CX8A 1KI6B 4ON9A 4RZXA 2Z0MA 1D8TA 4CEHB 2CDNA 2WKPA 5EZ6B 3RRNA 4AI6A 3SDZA 3K70B 1OHHA 2P3SA 3W3AA 3VU9B 4NMMA 4IDQA 2ZR7A 3EZFA 4RFSB 3AVYA 3GLGE 3ZDQA 3AH8A 5FOVA 4BFYA 3NVAA 4AD8A 1YZNA 3ZD7A 2XJ9A 1XJ0A 2OFXA 3O8BA 1ZNZA 2ODEA 2E9SA 3U3MA 2ZJZA 2OSBA 1JPNA 3K8YA 2J3EA 3W8RA 3E5HA 1AKEA 2C99A 4BFXA 3PUZA 5DNYB 4A36A 4M1MA 2YWHA 1U94A 3KTAA 3P4XA 4RVCA 4KSCA 4ACAA 4ZDJA 5CJ2A 1NLFA 1ZD1A 3QKSB 3UMSA 4G1UC 5HR5A 5SZJA 1ZNWA 3L8YA 3G0HA 1Q44A 1M7BA 1Z47A 2D2EA 4FMCF 3T06B 2VEDA 1S8FA 1BMFD 4LOAA 2OCAA 2CHQA 5EE1A 1MABA 1A7JA 4NTZA 4TZ0A 3CPJB 3WYGA 1GUAA 3JVUA 4ZCLA 1AM4D 1KI7A 4EAQA 2LKDA 1OYWA 4BEJA 1PVOA 3U60B 1SVIA 3LLUA 3IO5A 3CRMA 1Z08A 3CNNA 3PUVA 3RDPA 1FP6A 3SEAA 1CJMA 2NO7A 4BECA 1YU9A 4D4LA 4ZDIA 1FX0A 1KK3A 4P0TA 4B3CA 4PPFA 1KOFA 5CIWA 2IA5A 3WRXC 2QA5A 2MMCA 3BRWD 4EIWA 4TYNA 1II0A 1E2PA 2BBOA 1NKTA 2O8FA 1EFRA 4IVPA 1OT3A 4DLYA 2QU8A 4UKDA 3LA6A 3U44A 4K81B 2R65A 1F5NA 3AVWA 4DSNA 4PZLA 1Z6GA 1R5OA 5J4LA 5DI3B 5K8UA 3K0CA 5HPYB 4OQFA 2ZI9A 2C9OA 2O8DB 3AVTA 3NBFA 1VMAA 3CH5A 3EXAA 3TVTA 1DBSA 2QMHA 1F2UA 2Q3FA 2ZYUX 4IEEA 4L4UA 1HQYE 2SHKA 3TSOA 4M22A 1U2RA 3DZ8A 3I3SR 4DBLC 5JWHA 3LX5A 4UNSA 2WZQA 3VHLB 4EDHA 2BMFA 1JI0A 1G8FA 2H5EA 1E9BA 2JLZA 5KHOC 1GNPA 2IUUA 3EZ9A 1K5GA 2NO0A 4LV5B 1OH8A 4KJZA 5AJVB 1YHNA 2C77A 1XNJA 3HYRA 1TUIA 1T4GA 2AWOA 2EFCB 2E1RA 1NIJA 2J45A 2MMGA 1U81A 4Q1FA 3TSWA 3NH9A 4FMBB 4AKHA 3HU2A 3NTUA 1Z5ZA 4U00A 4LC0A 4ARZA 1R5BA 1NVVQ 1ZRHA 3F5FA 2GILA 2LKCA 2W0MA 3PQCA 4PZZA 1NP6A 4JLJA 2ZITA 1NVXQ 2RGEA 4TMTA 2QP3A 2GBLA 3AVOA 3P27A 1KSGA 4DSTA 5IT5A 2CJWA 2ZRFA 2A7QA 4Q18A 3MWKA 1TF5A 2EWVA 2HLDD 4LBWA 2P0EA 4P4UA 1MO5A 4TMXA 1EFTA 2BV3A 2XB4A 4P33A 3EW9A 1T3SA 2OV2A 1E1RD 1O87A 3C14C 3KL4A 4AKEA 4ZCMA 3LH5A 4XWOA 2QBYB 4IOKA 2J46A 1R4AA 1LS1A 3NXSA 3A4NA 4TMKA 4JVNA 3ZH9B 3GLIE 5KPDA 1W36C 3CR7A 1D9ZA 4IXMA 1IXZA 3WMGA 1SGWA 1F6BA 1OIXA 1FMJA 1XDBA 2NO1A 4CZ2A 2IYQA 5B57C 4A0RA 2JLSA 3OAAD 4A4DA 2R2AA 2KJQA 2XOKA 4I1VA 1GM5A 5CB8A 1NNEA 2CL6X 2IYTA 4C0JA 1EWRA 3PITA 3NDPA 2O8DA 2PEYA 2FE4A 2NO6A 3PCRB 4ARZB 3B1WA 1CLUA 2O52A 4QNRA 3GLGA 2DR3A 4HLDA 2HEIA 4IJMA 1JB1A 5EUMA 4R98A 3ZVMA 2GRJA 4US2R 2IXFA 2ZE8A 3WY9A 2VBCA 1R0XA 4RZ2A 5BWMA 5L3QB 1Q1BA 3QKUA 2ZS7A 2WWFA 2J41A 1FUUA 3GJ6A 4BZQA 4DLVA 4G5QA 2Q9CA 2RMKA 1GP2A 3H0KA 4JL8A 4C4PA 1UF9A 1E2DA 4PO8A 3WP1B 1I2MA 4C0HA 4PSAA 1PJRA 2ZRJA 3TRFA 3THXA 2R6AA 5GVRA 4LJ5A 2KB0A 3W90A 4B48A 1XMVA 5JECA 5AJWA 3O8CA 4OKSA 1CR0A 3KXIA 3C7KA 3LD9A 2A30A 2CMKA 1II8A 3WBJA 1Z2CA 1T0JB 3W6OA 2FGJA 3CO5A 4JS0A 5HKKD 1SULA 2BOVA 2EFGA 4F4IA 5BN3A 3I5YA 4C0KA 2WAXA 4YMVA 3SJBA 3FPAA 1OB5A 1T91A 1G7RA 1CXZA 1RW4A 1BO6A 3BBPA 3LWNA 4QG7A 4DVGA 1CRPA 4L9SA 2QMOA 2VRWA 4W9MC 1PUIA 4NBSA 4PANA 4DWJA 1EX6A 1R6BX 3KX2A 4Z51A 2W2TA 3SYNA 4C0BA 1Z6YA 3BJIC 3IPYA 2WSSD 4DB4A 1TQDA 5E7MA 1UBGA 2JLRA 4DLRA 3QPUA 5LDDC 4MYTA 2J9RA 2QZ4A 1FFHA 1NG1A 2H16A 4CF7A 3M6AA 3K70D 1AGRA 3R20A 5J4YA 4JZKA 2B21A 3GLHE 4M4SA 5D3MA 1GDDA 3RWMB 3U3RA 3NBXX 4Q1BA 3P20A 4PHHA 1D6JA 5GJVC 3KXLA 1JALA 4OHXA 3MWYW 2I3BA 1B23P 4G0NA 1GVNB 1E1QD 2Q3MA 5E95A 3DDCA 2HXSA 3DHWC 3VQTA 3SYLA 2C95A 2J0QA 3IGFA 2GJ9A 3D3QA 2MSEB 4Q4HA 2XXAB 4ZCIA 1H8HA 4EKDA 2W2XA 5CITA 1W5TA 3FDIA 5BN5A 1HURA 2ZRHA 5J40A 3EA5A 3OEHA 1EFRD 4JBWA 2XEXA 2OUKA 4PC1A 4DLXA 1BMFA 1VG0B 2BEJA 3EX7C 3KTAB 4IDPA 1OW3B 1R0WA 2O0KA 3K9NA 4FCVA 1EXMA 2GJKA 3THWA 3HDTA 3RC3A 5C4MA 2GA8A 5L3SA 1AS0A 3TVDA 1MO6A 1QHYA 2DYKA 1OLOA 4Q1DA 4M8NE 4HUTA 1EG7A 2OHFA 2IBMA 1OH7A 5KSPA 3I8XA 1P4SA 1RVDA 2YOGA 2ZIAA 3VKWA 1FP7A 5F98A 1U8YA 3CF2A 2C9CA 4P3YA 1HT1E 2QGNA 3CW2A 3PUYA 3B60A 1IJFA 3ADBA 4M1KA 2ZSFA 1TF7A 4MKHA 3TW8B 2PZGA 4URUR 1KI6A 1XEFA 4U5XA 1TL7C 4LYHA 4C0SA 3U2QA 1VCMA 3FFBA 1GNQA 2OAQ1 3B8HA 3U7HB 4P4SA 1IN5A 1A82A 2F1IA 3AF4A 3LDAA 1G8YA 4GBMA 1NVWQ 1EFUA 4FXPA 4Y0VA 3M0EA 1CRQA 1UDWA 4O25A 3EIQA 2DHRA 5C2JB 1H65A 4DDWA 2CBZA 3T12A 3QBTA 3KJIA 5JEDA 1G64A 2QQEA 4Q4AA 2BIFA 3IHWA 4YQFA 1WE2A 3WP0A 1AZTA 3H4MA 2QG6A 3EPLA 5EXSA 1WF3A 2UKDA 4DSOA 2PZEA 1VCOA 1KJYA 2WWIA 2YNMA 1PUJA 1FQKA 3QNUA 5JJLA 1N6PA 4Q4AB 4Q01A 3UWKA 1E1RA 1G3MA 2IEZA 1EESA 3THYA 4MA4A 3A4MA 3TGPA 1W4CA 3C4JA 3SJCA 2ZANA 3GLIB 2H92A 1LNZA 1E0AA 1KGDA 1J2JA 2IF0A 2G1KA 4KAXA 1TQ4A 2CCGA 3OHMA 5LB2A 3TK1A 4BRUA 1SZPA 3GP8A 3B6EA 1W4AA 2QAGB 4Q5IA 5DI3A 4HAVA 4A6XA 2QSZA 2GZHA 4LV8B 4DEYA 4D82A 4RD1A 2ZUCA 1CJUC 4Q9IA 4OI1A 2OXCA 1G1MA 2B6HA 4DKXA 3GJ3A 3THOA 4H1VA 1L4UA 4BLOA 3VNVA 4GSYA 1S3SA 2GAAA 1A2KC 1DO0A 3U3JA 2ORVA 1LFDB 3ZLJA 2ZSEA 4QRHA 1E79A 4RZ3A 2HYDA 421PA 2XB2A 3BFKA 1D9XA 4I1OA 1PZNA 3CRRA 1F2TA 3PR1A 3R7WB 3EAQA 2ZM5A 1B0UA 2BJWA 1KI9A 2XITA 4O0MA 3NC1C 3REGA 1G41A 3I1FA 2JAQA 4YLGA 2AFIE 1OFHA 1JAIA 1Z29A 3O8DA 2G0TA 1DS6A 1WQ1R 2ZVPX 3AP1A 2Q9BA 2VF7A 4HLUA 3I61A 3Q7QA 5D3QA 4B3BA 1KTVA 2XOKD 2GVZC 1ZUIA 3BFVA 2IYLD 3NWJA 2V8OA 1HV8A 4KLNA 2JJ2D 4TLAA 5TXGA 3I5XA 3RS5A 1IN7A 1N5JA 1TU4A 3NKVA 3GJ8A 4PZYA 4WXPA 1FL9A 4ESHA 4BLTA 3DOFA 3IDQA 2ZJ8A 4FD2A 4C9BA 2ZR9A 3W5JA 4P32A 4CEIA 1QHXA 5GJWC 4DXAA 2WJIA 4DDVA 5KDOA 1U0HC 4Q48A 2PCLA 1UKEA 4CDGA 2IHYA 2QUZA 1NKSA 3TAHA 1FMLA 1RFLA 1E9FA
chains in the Genus database with same CATH superfamily
2DHQA 2JH8A 1DCMA 2YIDA 1N25A 3HGQA 3ASUA 2I7XA 2VEOA 4XEHA 8ADHA 4TWAA 3ZCTA 4DBZA 1MAVA 4YROA 5CT6A 2RIPA 3VDNB 4HWTA 4TMZA 2HDOA 5M3BA 2AOXA 2B37A 3CLUC 3GRPA 5ICGA 4B82A 1H1TA 2ZUEA 621PA 4GOND 4HNQA 4RIEA 4TZKA 4X97A 5LUAA 4GWLA 1N8TA 2FPUA 2RHWA 5JV5A 2VF4X 4OHVA 1UAAA 4Z8XA 2P7IA 1GV1A 4HYYA 4OYYA 1ZA2A 5I9MA 3U7FB 2ATCA 3COJA 1NX9A 1F0PA 5E8JA 2AQ8A 3QPCA 3L07A 2CVFA 1GPJA 4QJ5A 3R7LA 4GU5A 1GEEA 4D96A 2A0YA 4R05A 3HKBA 2Q7OE 2JD1A 3AVQA 2HMYB 1M2VA 3QXHA 2LE0A 4FSXA 1P2FA 4LHXA 5G4KA 1IVYA 2FVXA 3R5XA 5JNLA 3QVGB 4ADSG 4JXZA 1KBQA 1Z8NA 3D7LA 3Q3EA 4DMUB 1NLUA 4MI3A 5KX5F 1V1JA 4FGSA 1J2UA 5C31A 4EPXA 4HGOA 1F4VA 4NK5A 1P81A 4Z5XA 1PLJA 5HJEA 1JFSA 2NZ8A 1JQAA 2Y0CA 4IIVA 4BE4A 4BMZA 2D62A 2YZ7A 2ODTX 2ZGVA 3E18A 1G59A 3EMDA 3UANA 4RZQA 2CFCA 2D1QA 3A27A 4KXXA 4QC2A 5JH7F 4ZOQI 3PXXA 5CFLA 2CMGA 1SC4A 1BKSB 2FPIA 2HJVA 2IFTA 3A1TA 3K09C 5TT1A 2YZMA 1A4XA 1TJ4A 2A0WA 3T7AA 3W7AA 1OOEA 2G5TA 1PJLA 3GLIA 1RHJA 2WMDA 2Z5FA 3SEFA 1Z7YA 4DIBA 4Q7EA 3TMKA 4YCMA 4ZAWA 5AVYA 1UFVA 1X7WB 3S2ZA 3DP9A 1AGNA 3W05A 2HF2A 3C3MA 2NUBA 3MB5A 4WCFA 2UZ4A 1ZGBA 4LQ4A 1Q3HA 5EPUA 4UBMA 821PA 4WW0A 4WQMA 2B5VA 2B78A 5IUNC 5SZKB 2WNHA 1ATIA 1TCVA 5IDVA 1JFRA 2NU6B 3QE4A 5G2OA 1NXPA 3BGOS 3KVOA 2P9GA 4D02A 5IZCA 3FPKA 3QEBZ 5HBRA 4OGFA 2XCQA 4W7IA 1LX7A 1TYCA 2UVQA 3AR3A 1Z7WA 2F8MA 2IZ1A 2QXUA 2WICA 4HQ0A 2CLIB 1ILWA 4LHYA 3C7TA 4TWBA 5ED4A 5FPTA 3FVVA 1H42A 1XWIA 3E3LA 4F4CA 1GSIA 5EIAA 2DR2A 4ZICA 4RS3A 4L51A 5LMCA 5IXSA 4I4LA 2Z04A 4B6EA 4XH9B 2QXTA 4G0QA 1P5FA 5CLGA 3WL7A 2WMNB 3ABZA 4L5JA 4PXSA 1QHGA 2C5AA 1QYDA 2RHGB 3FCOA 4IINA 3UH1A 4LRTB 4BTLA 1KYQA 1N2GA 2O8CB 3A31A 1XQ6A 4E5PA 1SBTA 4CKYA 1JTEA 2IK8A 2VTBB 1GNVA 3EC1A 1JVSA 4WY8A 2CDAA 4QUIA 4HK4A 1NLYA 4NY1A 4Q3BA 1V3VA 1MOSA 3IVMA 5IW8A 3NGLA 3G5AA 3R0QA 2IPMA 2XODA 1QFZA 2ODAA 3M4NA 1ORDA 2DT5A 4Y7DA 3VUFA 1M76A 2P0AA 1P33A 2AE1A 1GA4A 3G0BA 1YJBA 1KJ9A 2VVTA 1IHDA 1SB8A 1RDFA 2IYRA 4UTOA 3OQIA 1MJGM 4KUGA 4RV9A 2XSZD 4YJFB 5K3SA 5ALOA 5SZIA 2O8BB 2ZSKA 3FI9A 3ZK7A 3PQ7A 2XVAA 3QKWA 2NO5A 1L7VC 2VA8A 3C6KA 1XD8A 1VRCA 2EX0A 3F6YA 2FB9A 4OD0A 3U7QB 4BMXA 4URXR 4EWLA 2FWRA 2C5GA 2M6SA 3AFIA 4GNKA 4RKRA 2C7BA 3O38A 3N0RA 1J0AA 1JBEA 1NLZA 4WOCA 5HX7A 4NXNB 3MCTA 1GAEO 4RSGA 2QJWA 5P8WA 3IB6A 5E9AA 3BEDA 3K0FA 2J0VA 1DMSA 4JBXA 2Y1KA 3BXXA 4A6PA 3FCAA 1RKBA 1Z63A 3GA5A 3OZDA 3FOFC 3RH0A 2CE7A 1JJIA 1ZZGA 4B6JA 1X8KA 3FRIA 3PC7A 2IL1A 1WUIS 9GPBA 1JKJA 1JNXX 1VPLA 2Z8ZA 4EKEA 5ESDA 2E4ZA 4KQXA 4P3NA 3PUWA 5J2UB 2V4UA 3VR6H 3U1BA 3CMMA 4FZVA 1J9EA 2AQHA 4PIMA 4EG1A 3RIHA 3UA3A 1IZ9A 3BE8A 3OBIA 2V3CC 4Q19A 2IS4A 2WVJA 3AWIA 3MFYA 3WGIA 4ITVA 5F9FA 2HUNA 3JQAD 3KUDA 4RFLA 5FAXA 4IIFA 2QRZA 3SDBA 2BSXA 4KN8A 5JC1A 3T3NA 4H6VA 3ICWA 1HSOA 2XD9A 4HGYA 3L0OA 5AKHA 5BVGB 4MV7A 4D44A 1N2CB 4C6TA 1LLUA 3TOVA 1J9GA 4JR1A 4Q9NA 1RHMA 1Y98A 4R1QA 2XA1A 1I36A 4X64B 1XYVA 4HNUA 3RM3A 1WZ2A 3IHLA 2Y9PB 4ZVSA 2YHUA 1ZQ1A 2H11A 1QOZA 4XM2A 3SC2A 1HLGA 1R1DA 3IT2A 1XT6A 4DNXA 2H5JA 2DKNA 1XRLA 4NOJA 1YB2A 2ACKA 4FFSA 1DC7A 4LSGA 3QEKA 4KEAA 4F8JA 4IDAA 4HNVA 3PFKA 4NDNE 3V00A 1RMYA 3H1TA 2BCJQ 3PRKE 2GN2A 2X1HA 4UJ5A 3H84A 4H1WA 3OOEA 2AOVA 2PS9A 3OF5A 4Q16A 4QUKA 3FUVA 3EYAA 3M81A 5AI5A 5FWYA 5ICMA 2II6A 3E7FA 4JFRA 1M8GA 3AUJB 1YBFA 4MHSA 5IF9A 1QP7A 1EK2A 8ABPA 1IQUA 2A0XA 5SZHB 3FDJA 3L7YA 1CQXA 5HBGA 2Z8XA 3OG9A 1JSCA 3IKMB 4M8KA 2A1UB 4DIOA 3OQ1A 3ZTWA 2X0JA 1XTTA 3L8MA 3L7MA 4KXQA 4P54A 4KLAA 4NWIA 3U5TA 2ERYA 3AY3A 4YCSA 2JNWA 1CUWA 3KVYA 4XX1A 2GFIA 2X1MA 3NHLA 3H2KA 3BB1A 5TJ9A 3ZH2A 2PKQP 3STUA 3VRHA 2HU5A 3VNQA 3WWOA 2P2NA 3WLEA 2H1OA 1T9AA 4RE5A 5F2OA 5HCIA 3SI7A 5EUQB 1EXVA 2CLKB 3G9XA 1U99A 2XUGA 4HVAA 5DIZA 3PNKA 1U0BB 1JR2A 1XQVA 3HL0A 5E2AA 4C7BA 5KDDA 1QFXA 4LYDA 3H9UA 3VR2A 1M0EA 1NBOA 3BORA 1BGXT 3K1TA 1GQFA 2BEWB 3BZUA 4D9FA 3VAAA 3NOXA 5KU1A 1N92A 5J2TA 4PX2A 3L4KA 3QY9A 1N1DA 3A3YA 2BZGA 4INOA 4YUWA 4OI4A 4JLNA 4WRRA 5DBIA 5AK0A 3OCJA 4W99A 4YJ2B 1KOGA 1IAQA 2HW8A 1YZQA 1WMFA 4L1KA 4KMMA 2BRUC 1ZOSA 3NFRA 4TVOA 3QEOA 2HIGA 1AKNA 4X3OA 5EJ5A 3BK1A 3WKBA 3FOCA 4IAOA 1KYVA 4UHBA 3HTXA 1VYUA 3BRSA 1HQKA 1OYOA 3MJVA 4DMCA 2QBYA 3RUIA 3DOCA 3V8EA 1NJ8A 1EDZA 1LLQA 1UANA 3QE9Y 4YR9A 1WSWA 2GZAA 4TTSA 1I24A 4H7HA 4LBZA 1TO6A 1VYTA 2R68A 3CN7A 4GLLA 3ACBA 4WKCA 1JKMA 4ZQHA 3R24A 2YH2A 4WK2B 5L3VA 2ZIFA 5CVTA 1PGJA 5GM1A 2VQDA 5ICCA 4NCNA 1FFYA 1S3GA 2QY9A 3Q8XB 3GA0A 4LJLA 3UY4A 5B3LA 2ECPA 2H0AA 1H8ED 1R18A 1TJPB 3IQGX 4MLZA 1KARA 2SNIE 3N7TA 4KAAA 1MA0A 1OX4A 2ADFA 2ZPAA 1ZVKA 4O4JA 4RNDB 1G17A 3V3KA 5F2KA 2AOTA 3PVZA 2E6UX 2HLPA 1SOAA 2XQJA 3GVCA 3DFKA 3VSBA 2DUMA 4R16A 4GP7A 3QNWA 3TF5A 3RC8A 1QGUB 1ECJA 1Z17A 3GRRA 4L78A 1P9OA 1FBTA 1S2DA 2L69A 3BN3A 4B8WA 1PGPA 3AZPA 2R8YA 1KJQA 4H6PA 2X4LA 4OJYA 2J87A 3K53A 1IY2A 2NQ2C 3USES 4NLLA 1F1JA 3BWCA 2I91A 1MQAA 1E61A 2OGTA 5K6TA 1F7VA 3DHNA 1P7YA 5P21A 4BZWA 1U2ZA 1XDSA 3ICCA 3MTAA 1HDGO 4QXOA 1C4WA 4PCAA 2HIMA 1U0LA 1LDEA 1Z4KA 3JW8A 4WZBB 1E0SA 3GDGA 4E3ZA 3EPRA 3MT8A 4G8JA 4MHTA 3ESCA 3DKRA 4NVRA 2R8XA 1DC3A 3T15A 3AGQA 4RWZA 1Q6YA 1NQXA 1QDUA 1H69A 2B7BA 4L5IA 4F2DA 2JGJA 4ZCSA 1V7ZA 4M8IA 1CYEA 3RVKA 1PT6A 3DXFA 3ZPXA 3RTGA 1IATA 1F9AA 2O5VA 3O2SB 4S1OA 3VU8A 3AV0B 2A9RA 2IU3A 4DG8A 1XF1A 2HJSA 4O29A 4JLVA 3ROTA 5HHTA 3VZDA 1P18A 1UL1X 3IEUA 2PJZA 2Q21A 3FLEA 2HSZA 1AKWA 2YW9A 2GJ4A 1C9NA 4N0EA 4CNQA 5BMVA 3AI3A 1KWKA 4M1TA 1X8LA 5T67A 1JBQA 1NN3A 4MV3A 2B4RO 5EIWA 3O21A 2EZTA 3B7WA 4F38A 2CMFA 2OAGA 2N1MA 3HFGA 4O4IF 4OH1A 3ENKA 4B0OA 1VIVA 8MHTA 1KH2A 1NJFA 3F46A 2GM9A 1JR6A 1G6Q1 5E4JA 3WL3A 1U9YA 2CB0A 3U26A 3KPUA 3IUPA 1T8PA 1X9GA 4PHTA 3T3EA 1PZEA 3I05A 3GFBA 3P9RA 4EB0A 4U3JB 1PZXA 3JAWA 4X6XA 4O2BA 3BQMB 1SKBA 4PYNA 1NATA 3UJ9A 5K7SA 3V8MA 5B64A 1AV7A 1DUIA 2A2ZA 2VOJA 4LI0A 4TKUB 3TCKA 2QM8A 3PGJA 2Z5GA 3FVRA 3JATB 5AKKA 1YJ5A 2DHDA 2IV3A 1L7AA 3TFQA 3PEEA 3NMUF 5LQMA 1WTCA 1I7LA 1MFPA 2RHJA 4LTNA 4YJ3F 4EUKA 1XZQA 3QVUA 1M34E 2PRZA 5KWJA 4JIGA 4ASUD 3ZDDA 4OHMA 2VUTA 3KR0A 5B1SA 3DTVB 5DK6A 1IPEA 1Z8DA 1JDNA 4X63A 1F4LA 3H99A 3DKVA 3QH4A 4Y7CA 4QBGB 4NMLA 2ZULA 1GG8A 2AX4A 2V7VA 1MC5A 2VQ3A 2K2WA 1NFFA 1Z0KA 3HZZA 4AQDA 4CKXA 2EP7A 2FMFA 1ZM4A 4KBYA 4BVEA 2XVMA 4YUAA 1P4JA 5DHFA 4JT4A 4KIWA 2H59A 3W2FA 4HATA 4KMOA 3C7DB 3AQ4A 3F1LA 1BE8A 3CUVA 2IYVA 2PS1A 3SX2A 4W6QA 2C5EA 5AVOA 1P1BA 2CWDA 2XECA 2ZXEA 3OUZA 4QTTB 1DX9A 4DCVA 3H2YA 3E8SA 4ER0A 5CM2Z 4WAUA 3MTEA 4GIBA 2WY2D 2PGAA 1AA6A 3PGA1 1LZLA 1C81A 5L3RA 4LF8B 5L6LB 1A97A 4S24A 4BLVA 2ZTUA 3LGSA 4EHNA 1M2VB 4GZ6A 5GINE 2QTTA 5F23A 4HDKB 2B25A 4D9NA 1EVJA 3SS9X 1TUGA 4A27A 3B2QA 2ZBDA 2A84A 2PZFA 1CS4C 2QSJA 4UU7A 4DJDC 4B84A 4DCJA 3BK2A 3JASA 4HPWA 5IC4A 2XPCA 3QWIA 1JVBA 3DE2X 1AUVA 1L5FA 1GTJ1 1QFJA 3VDXA 3BERA 3A28A 4PC3A 5AUQA 2XRZA 2KBEA 3V2IA 4J91A 2WT8A 3DDNA 4LVUA 4ECEA 2B8WA 4OQPA 5IJXA 3QELA 1JDJA 1XCPA 1J5EB 1NW7A 1IXRC 1TO1E 1G7CA 1UXKA 4UTXA 1W76A 1Z16A 1G20B 4I1RA 1BD3A 1RWBA 3AERA 5ALXA 3RK4A 4LBYA 2IP2A 1FY2A 5KREA 3G2PA 3KDSE 3HM9A 4MNTA 1DJNA 1NVDA 4RCZA 3KPVA 3IYLW 2PUDA 5CJJA 1WW2A 5ILQA 1N2JA 3V7UA 2OO7A 3PUXA 4IDOA 3I8SA 4CG1A 2DBZA 3Q41A 4Z9FA 3VHXA 4M2LA 1Z2DA 2CXOA 1CS0A 1KDTA 4G23A 4K6CA 3RFXA 4EO9A 3JS5A 4H1HA 2HTFA 4URHA 2DUNA 2XNKA 3A36A 4JR2A 5B2EA 3UC9A 4PO1A 3DEIA 1JJFA 1VPEA 2VYVA 1YR2A 1MRSA 3B1VA 1TLFA 4DAEA 2RE8A 3TM5A 3HWX1 2QENA 4A8PA 3TH5A 1DOAA 3NBAA 3EZXA 3UK1A 3TX2A 3FTCA 3LBAA 3RNLA 1HKHA 3K6KA 1A71A 2YHBA 1JLHA 2IELA 2NM0A 3SIPA 3GAZA 4BX3A 3NQ41 4NF2A 3IIIA 4YDRA 2YNMC 2ZSUA 2NZXA 5HCUA 3GUYA 4DJTA 3IQFA 1ZCAA 3N2IA 1Q21A 1R3DA 3ZGOA 3DMTC 2FZVA 1KWGA 4GO1A 2FH5B 1AKUA 1J2EA 3GV0A 2O3UA 2NSDA 4PRYA 2QTHA 4RZIA 1NVVR 1QPBA 4I4TF 4IEFB 4YDHB 4AUNA 4RH0A 3PGMA 1CUJA 1VIDA 1XB2A 3ZX4A 2HJWA 3QBJA 4B4VA 2J4CA 1FXUA 1G9TA 3KLMX 5K0EA 3QI7A 3KZVA 4EA6A 5FA8A 1CIVA 4V3BA 2PD4A 3N8GA 3WB9A 4ILKA 1MVNA 1BNCA 2GCOB 2RAVA 4B71A 4CEJA 4PQEA 1JMKC 1U3FA 4MKXA 3U80A 3GT7A 3AO0B 1WPQA 4M9UA 1IL0A 1EWTA 1GGFA 1N6RA 3EOAI 3R3ZA 3T99A 1LJLA 1T2NA 2BTQA 5LNK6 4J07A 4D0NA 2EBUA 2X0RA 4URVR 2NACA 4UMVA 4IYRA 3V42A 1MOQA 2OCYC 3LQ1A 4IKPA 1JEYB 2R6CA 1X38A 5DP1A 3D54D 3QYJA 2DPGA 4I55B 1ULAA 5FOUA 5A9TA 3RSOA 2WHYA 4HGRA 2CKDA 3SE7A 4REOA 1CULC 1JILA 2CLCX 3FR8A 1NOIA 4OGLA 3GRZA 2UZAA 5ICFA 4FT2A 4OBXA 2C4TA 4UPDA 5HF8A 1HEIA 3AUKA 3RU3A 1P80A 5AVUA 4CCSA 3WLJA 3LWBA 1RZRA 2YN0A 2BFBB 4YI5A 3KQHA 5CURA 3GLTA 4B81A 4QPZA 2LNDA 4L4XA 2UUPA 4JJKA 2H17A 4QDTA 4AG6A 1YZVA 4C21A 1VKJA 4NZ9A 1X3LA 2GNAA 4BKOA 4DQVA 2JHCA 1E5QA 1LB1B 1Z25A 2GK6A 3DOEA 3E3MA 5L8VA 2EFJA 1FPMA 1ODTC 5JAQA 1FXSA 3CEPB 3JQFA 5JZBA 3VA7A 4BZZA 3WL8A 4AQ7A 4Z1MD 1GL6A 2ZTHA 4AUMA 1LI4A 5AHWA 3R5KA 3WWPA 3WLTA 2PMCA 2ZJ3A 3W6NA 1FU4A 1BX3A 4C6HA 3KHTA 1FYEA 5LDHA 4I5DA 4J43A 3SYRA 1WABA 4XPIA 2DETA 4QUDA 3UBMA 2ONYA 2Y0DA 1OASA 5BNWA 3NEYA 3AHCA 1OZ0A 3V4PB 2OKCA 1Q91A 1WZIA 1GGVA 1K9VF 2NSLA 3BSSA 1FNSA 4NV0A 4QTYA 2EV9A 1Y6GA 1R2QA 1VL0A 3C3YA 3INGA 2ZJAA 4FQ8A 2XBLA 4LZOA 1BEEA 2GN4A 3DA8A 2H4WA 5E1OA 2YMMA 4FB5A 1ADGA 2HO5A 1GRQA 3H13A 1NAIA 2HNAA 2FETA 1CQPA 2ATVA 4NG5A 2OHJA 2IY9A 1I3LA 3HN2A 1BFUA 1I4OA 2LCIA 3D4IA 4RKEA 3CGGA 4IGEA 3RVDA 4YT2A 2Z6UA 3M5PA 2B20A 1JHOA 1SN7A 3C5EA 3PNSA 5HJ7A 3CQ9A 1UK7A 4N5LA 4KFCA 3FCEA 3VNSA 1PQWA 4Y0NA 2D13A 2O3TA 2YZ2A 2ECQA 2PK3A 2CL0X 5EP4A 3T35A 2JVJA 1UZNA 3OLVA 2J67A 5D5HA 4RC9A 2IUEA 1K7CA 1MV8A 1TVKA 1YZLA 1UZAA 2F00A 5K8TA 4E2XA 1KPGA 1TU3A 4U1RA 3WTCA 5I3ZA 4CN9A 4ZAZA 4DR5B 4ZRDA 2OK7A 3FR7A 3F2IA 3K9GA 3LHKA 4YMSA 3C16C 4DVJA 3G5UA 1STOA 5FYQA 2WG1A 1PHPA 5GOZA 4CIDA 5IZ4A 3EF1A 3IP9A 1XSEA 2HF9A 4PZ9A 4ZKEA 1H4SA 3PQ5A 1Z07A 4K8RB 2B30A 1G6OA 5K0ZA 1A4UA 4N3NA 5IUKC 1TQ8A 4OB6A 5CEEA 1U2GA 3BDAA 4UU1A 1V5EA 2QF7A 3RS4A 4EFKA 4OQXA 4TZTA 4OUDB 1N0VC 2XAUA 3GNTA 3ZU2A 3F74A 5LN1A 4ZVLA 5JS6A 1FIUA 1ORRA 1S7CA 4YFYA 1CR4A 1E4EA 3PEUA 5AXAA 3S2FA 4EA9A 5FL3A 4Q3DA 1N5DA 4PFSA 3NIFB 1NRXA 1PR2A 3ECSA 1GYPA 1EGVB 2P8JA 3V4SA 4QYIA 4ZJYA 4B3XA 4EPWA 4HG2A 2HR1A 2Q4BA 5KNCA 4TT8A 3EDYA 1NHWA 2B4QA 1Y4ZA 3FCUB 3G2KA 5CLHA 3H5TA 3S28A 4V02A 4M9RA 3CUUA 3FCCA 5ETJA 4R0MA 3PNPA 4NFSA 1XNQB 2RGXA 4RY0A 4MI1A 3EHEA 3U49A 3JY6A 1LW7A 1W6RA 4QO7A 5ITWA 3T5TA 4MW0A 3Q12A 3ZVKA 4JI0B 4RTRA 5F12A 1FP1D 1KU6A 1DXHA 2FX2A 2HRZA 1U4OA 1VL1A 3B20A 2PKYX 1JEDA 3H6HA 5K0LA 1VIAA 1MG0A 5JH7A 2PO5A 1RWMA 5KMGA 5JJKA 4AJJA 3KYBA 2EJBA 3H1FA 1VHLA 1Z36A 4U6SA 4QWMA 3S4YA 4HDOB 3IQEA 3I2KA 2YIJA 5CVDA 3IPXA 5DHAA 5DT9A 4GS5A 3SPXA 3WNDA 4G5OA 6CHYA 1P8JA 5E6RB 3LXRA 4WINA 1AE1A 1M2NA 3LXXA 3PC8C 4JJ7A 5FPYA 5CNMA 5B58C 4E21A 2VAMA 5MN5A 2DFNA 2GBGA 2VHQA 2GOYA 2YL2A 4PICA 2NU9B 3N87A 1KDZA 1P74A 3GEPA 2NPOA 2G8NA 1Y63A 4IP0A 2V6JA 2FP3A 2JAPA 4BE7B 1LSJA 3LX8A 4QDZA 3MQFA 3DUFB 4AZ3A 1CQJA 9MHTA 3MERA 2HXGA 1XZLA 2HHAA 5JDIC 1TEHA 4EKYA 1UOQA 4LDRA 4GRDA 1FPQA 1E2MA 3OTQA 4XEUA 1VSBA 3TW8A 1GADO 1MB9A 1P9NA 3KPWA 3NTLA 4D8VA 1Y8QA 1PJBA 3KVRA 1CY1A 3GFRA 2LRHA 2E1PA 4OB7A 1SXJD 2AG1A 3B5EA 4DCSA 2AUNA 4AS1A 4ZU6X 3UGTA 3O91A 1RD4A 4M1ZA 2Q41A 3A4LA 1O7JA 2NAFA 3GFTA 3PC6A 4KIUA 1Q95A 2OB2A 3HABA 4EF4A 3UWOA 3KR9A 1XBTA 1KS9A 5DHQA 3W7VA 6YASA 4ZI5A 3S8YA 3ZHZA 4YB8A 3I28A 3MSXA 4J0KA 4BYMA 4DG5A 3G8BA 1I2DA 4IDGA 4JJGA 1VTKA 1ZGHA 2O48X 3EBLA 5T4BA 4TVKA 2OUIA 2XSZA 5LL6P 1FRQA 3QPAA 3U7IA 3DHVA 3SXUA 4KO2S 5BN3B 1J8MF 3ZCUA 1R6VA 2IKSA 1Z3IX 1V3TA 3DGFC 4HDCA 4IDCA 5HE8A 1P4AA 4R68A 2C78A 2R2GA 3E9YA 1NJSA 3TQQA 1JMYA 5K0FA 3OMLA 3VR3A 3U7EB 3BMCA 2Q7XA 1N6IA 5EIBD 1TD1A 1QUFA 2WT9A 3E8XA 4IMRA 2VCHA 2WJZB 1DKMA 1U04A 2O7RA 5FFMA 4YMUA 5JBIA 2G0NA 5FADA 4DQKA 3I9JA 1XJWA 3AR4A 5BMVB 2AWNA 1UJ6A 3MRXA 3IOBA 2ZXFA 1KYYA 1PYOA 1GAWA 1VE1A 3LV8A 5EMHA 4PW0A 2HCFA 4E2YA 2VLIA 4GLFA 5DWQA 2MINB 2Q50A 3W3ZB 3RB8A 4H0FA 2QUHA 2HDWA 2MOKA 1JE1A 1LBIA 1YU6A 1E2KA 3I39X 3K1YA 2TMGA 2ZB4A 5AW4A 1M0TA 1QDEA 3ITNA 4MGZR 3LUCA 3FMGA 1T4BA 2X8WA 4JR0A 3TTSA 3TI7A 2FF7A 3KEOA 3WLNA 4P4LA 4XYMA 1U65A 2VL7A 1E3MA 5AVQA 1VI5A 4HP8A 3EGDB 5I6DA 2EWMA 1T9DA 4Q7JB 3RG8A 1TADA 3MXTA 2V58A 1R3UA 3QPVA 3E53A 1XQWA 3CRNA 4B7AA 4NXMB 3R2JA 3DMTA 1E96A 2JGMA 3IEPA 3NT5A 5IHPA 2G7ZA 3FOZA 3NVKI 4TQ9A 5J1TB 4BV8A 5CDTA 2Y99A 1F3OA 2E4WA 3D1VA 3IEXA 4M60A 4D1YA 4DUGD 4WFKA 1UPCA 4NENB 3EB9A 2J33A 4D8XA 1BA3A 4WJLA 1VPDA 2DU8A 3PNBA 2JBAB 4C22A 4RHFA 1KORA 2B8JA 3R3HA 1P60A 4DT1B 2R87A 3HXMA 3TD6A 3UXMA 1NFRA 1BA2A 4M9QA 1ZMOA 2Q6IA 2QDKA 3I9MA 4ZU3A 1OE0A 2XMZA 3UO8B 2FUEA 2UZIR 4BPBA 3RFVA 1H1LB 4I99A 3O26A 4I5IA 1P0PA 4D4IA 1VGVA 2D8AA 4KFTA 3UCXA 3KT8A 4R3NA 2X0KA 1W29A 4DHWA 4C01A 5GZ3A 5K0GA 4H7DA 2X5NA 2GUWA 4YRFA 4F5WA 1F2TB 2F1RA 1ND5A 3JQ7B 4KFSA 2XNCA 3R7WA 3BZBA 1KJ8A 2OESA 3Q72A 4TLCA 2P2GA 3S2EA 3G0DA 1X7XA 1O96B 3REQB 1G66A 1QJ4A 3NUQA 3RANA 1I13A 2AEEA 4XB2A 3ZQUA 4F0JA 5EGSA 1HRKA 2O2ZA 3FPCA 4QYTA 3ZY5A 1E2GA 2YXNA 4NNOA 2H4ZA 2O14A 4TV9B 2VK1A 2QRUA 2O2SA 4ZHQF 3LPAA 2QW8A 1LPNA 3ZG6A 4B32A 1H3FA 3LQQA 1F1BA 1CUDA 2GBIA 4FGKA 5CUQA 5GMOA 4E1VA 1X1CA 1VSTA 3L05A 5JPDA 1HFEL 3QXCA 3GVHA 4O63O 2IYYA 3MJSA 4R7ZA 3A1NA 3O1LA 4ZAFA 4DKJA 4PAOA 5J1SB 3REFA 5HA5A 1K2WA 4EMSA 1KZ1A 2H0RA 3FVWA 4MRSA 3QP9A 5AKXA 1L7NA 3AVPA 3O4FA 3SE0A 3T6KA 2XRFA 2EJTA 1P6UA 1R00A 1NT2A 1ST2A 3D6MA 3GRYA 3TLGB 1AQIA 2VWHA 2RGCA 4OYRA 2OXIA 5ALEA 1LK7A 1A9QA 2FRVA 3C7AA 2ASVA 2C2KA 2V8BA 3RSFA 4F86A 3VR4H 1XPUA 3LT1A 4M9ZA 1RRFA 4N0QA 1FMFA 1JUDA 5K45A 5J2UA 2RK4A 1VLVA 2W2KB 3UQZA 1QVWA 1MG5A 1SD5A 2ZE6A 1U3GA 2ZU6A 1E8DA 3H4VA 1NE2A 4QFCA 1O54A 1J20A 5AK5A 2C59A 2IW3A 4DPKA 4WLEA 1D7OA 4EJSA 5BY2A 4DV7B 1ZESA 2WD7A 1TTTA 5A4MS 2P4QA 3M7IA 4ZMSA 1D6NA 4LJKA 1WDTA 2M1ZA 2MSCB 4BVHA 3ZIAD 5HSGA 4N41A 2ZZNA 1CEEA 1ZBDA 2JFPA 4JL5A 3ZOKA 2WHPA 1RBMA 4HZUA 3K0KA 4IRUB 2XUZA 1BGWA 2QX8A 4R71A 1C30A 1Q0SA 2D4AA 5MN4A 1QNLA 3WICA 1CRLA 2E87A 1E2FA 1NI4B 1TU0A 1BW9B 2F3RA 4MMZB 3HADA 3N0TA 3DONA 1KEEA 1V8BA 1E5VA 3WLHA 2AD5A 4ZXFA 4F5DA 1PT5A 1GD1O 4LY6A 3U5ZB 2NXCA 3N05A 3I1IA 4IJUA 3JASB 4RKQA 2F62A 1PDWA 2R86A 3RYFB 3MTJA 5KNCH 1DC5A 2H7CA 3NBQA 5DM0A 2DTEA 2EHDA 2C83A 4Z1MA 4QJ3A 3RS2A 4RHYA 1T1JA 3AF2A 2DBVO 2VZEA 2KPOA 2R96A 4YCBA 3NALA 5JTTA 1ULBA 3O73A 2ECOA 1JTFA 3EA4A 4YRMA 2BYTA 1EVEA 1SXJA 2AZMA 3KU4A 1PVDA 3CV3A 4FN4A 4HN9A 2Z3WA 4RORA 1W1WA 5EJIA 1VFPA 3AY6A 3N9IA 5JFOA 2QAJA 2ZS9A 4K9SA 3R7SA 1DHTA 1XD2A 2A59A 3MYRA 3OSZA 1UEJA 2BEWA 2A9VA 2V3VA 4EMBA 4YV7A 2QYOA 1JLKA 1E2IA 1KOJA 2CEAA 2OO3A 4TGLA 4D57A 2BEUB 1SCQA 4R84A 3C3DA 2FQXA 2VPYA 1KI3A 5B7PA 2P8SA 1NULA 1SOVA 4Y6GB 1SXHA 5KYTA 3WA7A 4QGHA 1XMOB 3F4BA 3N2GA 4RFVA 4S2UA 3FHJA 3CPSA 3GGJA 5EPOA 4CGZA 4PBSA 3HDJA 2YJ4A 3W5UA 2OLKA 2XMQA 2V59A 3EAGA 1XU7A 5B1EA 4YP0A 3T5DA 2F3SA 3F7NA 5AOAA 3UOWA 4UAJA 4Y0AA 1DDGA 2FGKA 4J2HA 4TTVA 3L6UA 5TF4A 4DLTA 1H05A 4Y3UA 1MB4A 3OPYA 3OTOB 4W9NC 1GITA 2YWRA 3C8ZA 3C45A 3NEJA 5CT4A 5EP2A 3RADC 1QHHA 1QG2A 1R8JA 2XRYA 3B6KA 2HIAA 1C3XA 1P7CA 3R3UA 3KEQA 4LE0A 1GZ5A 1OV6A 3PIRA 4Q3LA 3C6BA 3JWEA 4HQNA 1PCXA 2WYVA 5J59A 3NI2A 1SUCA 3RJTA 3ZZTA 4CNBA 1KZ7B 3ND9A 1X7ZA 1S6YA 2Z83A 2HK9A 3BH0A 3AONB 1QIIA 3KO8A 4B5LA 4L02A 2NQTA 4LCBA 4XUGB 4I2NA 4F3YA 1WY7A 4X1OA 1U2QA 3OM8A 4UU0A 3SBOA 3QU4A 4BFZA 1QG4A 1NXSA 1W0JD 3EODA 5GJCA 1TQHA 2EW2A 4ZA2A 4J0HA 1ZSVA 4O5AA 1FRVA 3Q10A 1SKMA 1IHPA 4CV3A 2WQZA 2Q4OA 2REQB 5CR9A 1C5KA 1AS2A 4HC4A 4S2EA 3EFOA 3EN0A 3F49S 1BQ4A 4IH9A 4ROTA 4EW6A 4YGXB 2C2HA 3UT5A 5CYOA 1FS4A 2WFLB 4D8TA 3D31A 4OMCA 4C30A 1RLUA 3OE7D 3MWEB 3LTNC 3F73A 4HTAA 3RFTA 4FDAA 1F6DA 4NBNA 3IIEA 4TV9F 1JI3A 2JIZD 1JR3E 3D4PA 1YH3A 3HI6A 4LJAA 1ZLYA 1Z6XA 2RK3A 3ZW8A 1OFUA 1YQDA 2V9ZA 4V0NA 1GPH1 3C74A 3BMCB 2W48A 3QV1A 2AJCA 4GMDA 1J06A 1RRGA 1A8SA 4MQ5A 1TW3A 4MQEA 1GZ4A 1FFAA 1EJ0A 5CD1A 3L4SO 3OU7A 5JS2A 4TT3D 1QVAA 5CU7A 4CE6A 1EZZA 3PJGA 2ZB8A 1RYYA 4CKZA 4CLHA 4EA7A 4XWAA 3D02A 5I9IA 4JZYA 4MRMA 2PUBA 1HNXB 3T7SA 2GLXA 2PMDA 1BH6A 3B3GA 3WLRA 4P7KA 4D3FA 3SGLA 5EIHA 5BUCA 2EZ8A 4PX5A 3FPEA 4GF5A 4RMHA 1HT0A 4YRGA 2BAGA 2E55A 4ZGWA 5JSZA 4PYRA 4DNOA 4JT9A 1EVKA 2P4SA 2ATEA 5LWQA 1Z5PA 2GWHA 3LHSA 4CXMA 1V26A 1UJCA 4UD2A 1BJKA 1EVZA 1CEXA 3TS1A 3WZMA 3IPCA 4AIIA 4F4DA 4HDNB 2EAUA 3AF5A 2XIJA 5IH7A 3ILXA 1ID8A 1GQSA 1JLLB 5KC9A 4MVJM 3L9XA 3AHEA 4A1OA 1XZDA 2IP1A 3GIDA 2RFLA 1KSJA 3A05A 3R6DA 1Y80A 1OH5A 1JHZA 2H2DA 3X3HA 4TXMA 1U7PA 1WEHA 1DCFA 1QK3A 3CEJA 3CJTA 3HBMA 4RW0A 3UCFA 4OQZA 4Q4JA 3W9UA 4FZJA 3F7TA 3FTPA 4BIIA 4X62B 3JD1A 1UEXC 2CNLA 5FV4A 3WB2A 3O1IC 2AR7A 2GPAA 4WBSA 3L7LA 2XUJA 1JLMA 2QIOA 3QYFA 3RSSA 1JKXA 5IFLA 4PN7A 4WESA 3URMA 3Q9LA 4MJ7A 4OK3A 5HCNA 2R85A 5AOVA 5DMXA 1W5FA 4MQUA 4YUYA 2ZI6A 3UBTA 3DBLB 4HH4A 1CLEA 3ZV3A 3K35A 1KFJB 1P0MA 3AHDA 2I4MA 4G1BA 1C4KA 1CU1A 2B3DA 1AQLA 1UJNA 2JZCA 2WKWA 3C3JA 3PYLA 2GESA 2UV8A 3MUNA 1QP8A 4JBLA 2E5WA 4ZPJA 5DSZA 3ILYA 4EY5A 4AT1A 3F97A 3ZTTA 5TIIA 5FI0B 1W59A 3KJQA 4TSKA 5BOVA 4RADA 2IUTA 3ZIAA 1HWYA 1MO2A 3K16A 1C7IA 1I7DA 1KO1A 2ON6A 1WAMA 1X94A 3RV3A 3L4BC 3O4HA 4MV4A 2EDAA 4I6EA 2VWGA 3ROZA 1I7QB 3R6TA 3Q3HA 2AXQA 3Q3JB 4HSEA 5F9HA 4FQ5A 1GUZA 1ABFA 3KVVA 4WKNA 1Y1PA 2XDQA 5L95A 1N9GB 3NYWA 2GK3A 4FW8A 2EGGA 4JWKA 5JADA 4YRAA 2BH2A 1XO1A 3KYCA 1X8JA 4PX9A 1DAMA 2BBWA 3PLRA 4O5OA 3QU5A 3G1WA 3STWA 5IKXA 5E9JA 1AQUA 1L5LA 1LSUA 2CD9A 1QLJA 2V3WA 1T0PA 2JCYA 1HE5A 2ZT7A 4Q9KA 3DEYX 4B6QA 1XDWA 1CWUA 4BQPA 3ABOB 3O0DA 4CTKA 1OIWA 3GC6A 1PV4A 4HDSA 4LDPA 1SCNE 5K3DA 5B12A 2PZLA 2JCXA 1I4LD 1TNDA 2XE7A 1G7SA 2JGDB 4QE3A 2WWGA 5HF6A 5C0OE 3QMMA 4NE7A 3BWEA 1KNXA 2VBIA 1Y8QB 1FJ2A 3BGVA 3EGXB 2WWXA 4G63A 3TTUA 4M1YA 4WBNF 3V5NA 3INYA 2VKTA 1OVGA 4Y2JA 3K0SA 3N2KA 4Y6LA 1MMFB 3DOIA 4PAGA 4BQFA 4QM7A 5CLQA 2AGVA 1OXMA 3HCOA 4WLUA 3DULA 1P5ZB 1QFYA 4XR9A 2WF5A 2Q4RA 4JUIA 1NV8A 5IHXA 2PSSA 1OU4A 3NDBB 1WBJB 3EGOA 4K1LA 4B79A 3ITEA 1TMKA 4Q4CA 1UEIA 3JXEA 2YWFA 4AMBA 1PEKE 1PR3A 2GZ1A 2VC2B 4ESEA