1S99A

The structure and function of b. subtilis ykof gene product: ligand free protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
186
Chain Sequence
RIAGFRFSLYPMTDDFISVIKSALAATDTSKVWTKTDHISTVLRGSIDHVFDAAKAIYLHAANSEQHIVMNGTFSIGCPGDTQGDTYLDKRVNEDAVRGLKAEAPCQFALYPMNEPDYMGLIMEAVDIAKAQGTFVQGVHYASELDGDAHDVFSTLEAVFRMAEQQTNHITMTVNLSANSPSRKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ykoF
publication title The Structure and Ligand Binding Properties of the B.subtilis YkoF Gene Product, a Member of a Novel Family of Thiamin/HMP-binding Proteins
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligand binding protein
total genus 50
structure length 186
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07615 Ykof YKOF-related Family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s99A02
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s99A01
1LXNA 1LXJA 1S7HA 1YQHA 2EKYA 1VK8A 1SBRA 2IBOA 1S99A 2EPIA
chains in the Genus database with same CATH superfamily
2K1RA 4KO0B 2B6AB 3IRWP 2R8HA 3TQ1A 1U8SA 3QIPB 5HQMA 2ZH6A 3KK3B 2F7VA 1ZS6A 4NLYA 5B7WA 3MXHP 4ZLPA 1MW7A 2FHKA 3KKFA 1H38A 4LRBA 2K7JA 5KFLA 1LNQA 4G1PA 2QSWA 3G71S 4DL5A 3FEZA 3Q0AA 2LFVA 4PQUA 4U8VA 1AT1B 2ADCA 2XGQA 4JI3F 1PBUA 3ICLA 1XMOJ 1D9FA 1EKRA 1SUQA 3EJMA 1F3FA 2O66A 2QMWA 5M2UA 3ISZA 3HZGA 4MTPA 3M8PA 4B9NA 4JI6F 1B99A 3FSIA 3ILJA 1X8DA 5DLFA 4BCAA 3MMBB 4JV2A 1C0UA 2PDAA 3GJQB 5B0EA 4C98A 2AP6A 3JSYA 3KLIA 2A1BA 2YNGB 1WSVA 1WD6A 3H5UA 4DR3F 2P9GA 4ZVEA 4XPEA 4K4SA 1H2UX 4ECZA 1TR0A 3PO5A 2FJWA 3DYAA 4ILRA 4NCAA 2R2SA 1RWWB 4USIA 1NM2A 5BR8J 1UWBA 1YRUA 1FD8A 3FCWA 2F4VF 2Z8QA 3OPKA 2NPIA 3N6NA 2DNNA 5DRKA 3BB5A 3UO0A 2YKMB 3S01A 2VC1A 1FFSB 4A8MP 3M8QB 3UPFA 1EZZB 4IO1A 2KFZA 5EHHA 3KTQA 3BBBA 1K8AT 1PAUB 1S9GA 4RLEA 2R7SA 4C3LA 2XB2D 1JLAB 4ES3A 2ZC4A 3NNHA 4B3OA 1YZ7A 1UP1A 4QBUA 4ZPAA 2HYIB 1IN0A 2M3DA 1RCXB 3WBZA 2M5YA 1L3KA 2W2MP 4OV6A 3T41A 3IWXA 2YWEA 4LSNB 4NLOA 5F3ZA 3LP0A 2V4JA 2E1RA 2KVQE 3HFKA 4JI5F 3EM1A 2AGQA 4B3RJ 5F9LA 2ROPA 2FIUA 4Q43A 2H4YB 2JC1A 4W98A 1VQYA 1R0BG 2B4UA 3RTVA 5FD1A 2C3OA 3O3LA 2DHHA 2MJUA 3UD3P 2NUUG 3U1MA 2CNKB 2G0IA 3PO4A 5CABA 2HG4A 1TKTA 4OYWA 1B4SA 4DDFA 2FHJA 2HRYA 3AQPA 2LU1A 4CWBA 2MQNA 1JLFB 4IRKA 1N5YA 2BYCA 3UDVA 1VBYA 2GQ2A 2FY8A 2WK4A 3HVTB 3WIVA 1OPIA 1NSPA 5ETSA 3Q8VA 3MEGA 1Q8LA 1NB2A 2XLJA 4F2RA 3DI6B 5LSOA 2BZ2A 1ZZNA 1T03A 2L3MA 2GJIA 2G4BA 3KLEA 4A8SA 2HZAA 2ZD1B 1IBLJ 1TELA 2H1YA 4ILLA 2RRAA 3W3SA 4KQZA 3DOMA 3OTOJ 3HKWA 2WOMB 2LVWA 5E3QA 4DF8A 5ETRA 4CLWA 4F4XA 4ZCLA 2HS0A 3LPYA 1FI4A 3DLEA 4FNIA 4YY3F 1JB0C 1R7IA 2Y0BB 3NBPA 4AXJA 2VG6B 4K4TA 1X5OA 1IM6A 4NYZA 2VKRA 3PVXA 4N41A 4X4QA 4CO0A 2NPFA 3QT7A 4PYAA 1L3UA 5IV3A 2JWNA 3MFHA 2MKJA 4RU9A 2OI2A 3D0IE 4RNFA 4M5DA 5EWFA 2P9CA 3CDBA 5LMNF 3NEKA 4MAKA 5D4PA 3UI3A 5D4NA 3TZXA 2QFIA 1T7PA 1VI7A 2MKHA 2ZH8A 4X2BA 3W65A 3LW5C 2CJYB 3EVOA 1TU0B 1TL7B 2QLJB 3GIJA 4K4VA 4FPIA 3F0NA 2AQ4A 4LMZA 1TVRA 1CULA 2LXFA 4NA3A 1LEOA 3W63A 1HNIB 1NHKL 2ASJA 4ZP9A 2NXUA 4OX6A 2FLPA 4B02A 5MAOA 5IC6B 1N36F 2NZCA 4LUBA 1FJEB 1HNXF 4J9UE 2ILYA 2BANA 3CCJS 4QYRA 5BYRA 4ZVRB 3EXYA 3GYGA 2GIQA 1YLXA 4P72A 4ZK7M 5CXTA 1FKPB 4J9PA 2HZVA 5J2NA 1JLQA 3EX7B 1S9FA 4X4UA 1F9EB 5FLXY 1RTZA 4OHXA 4EYHB 4DCPB 4P7VA 2QGFB 3T1YF 3GONA 4TYBA 2ZBIA 4X4OA 2IC3A 1TL1A 5J1NA 2XTJP 5LSLA 3HO1A 5I3QA 2E7WA 4FYDA 3GCWP 1NEEA 4LT6A 2J6TA 1N6QA 3QZ7A 5F8HA 1VDHA 4ZJLA 1UEVA 4PG8A 4J9OA 2OPQB 2HNDB 3FMBA 1FFWB 4N76A 3OFHA 1PIEA 4OI2A 2D9OA 2Y1LB 5A8WA 3H0PA 3A13A 4GKJJ 2M4MA 4RNNA 3JSBA 4B17A 2X1FA 2R3VA 3HX9A 5J2MB 1SC3B 4M5HA 4CTAA 2XLKA 2RUGA 3TUIC 2Q43A 5KG7A 1GTHA 3MR5A 4AQYF 4B3TF 4ED8A 3EPGA 5L38A 3FCVA 3D0HE 1LWEB 2RB7A 4JV5J 5C42B 4Q0BB 1J5EF 3MM5B 3GLJA 4DV1F 3UCUP 1UEKA 2Z57B 5FLXU 1VR6A 3OL6A 5K14A 4DEZA 3NGDA 2CUYA 2FHOB 3RBEA 5KFYA 4WIIA 1H0HB 2OD4A 4DX7A 2QEXS 3NMRA 2XY6A 1TL5A 3AOAA 4QQBA 2UXDF 3J7A1 4G65A 3A1YG 4FXWA 1U6ZA 4YHHF 4P2XA 1XNRF 3D7SB 4UZCA 1UVJA 1NK7A 4QIVA 1RWVB 1KD1T 1NSAA 3KXDA 3H7HB 3DOKA 3MMCA 4NI2B 1U6FA 2B7BB 3VAGA 1FXDA 4DR4F 4R8UB 4ZCMA 5LJ3Y 1Q4RA 4UTGA 3VHQA 2XMKA 3QT8A 2QRRA 4DSIA 3KLGA 3DHWC 1S97A 2UUCJ 3IRXA 2V6AA 3F56A 2OPRA 4JI0F 1S1UB 3LWMA 2KH9A 1NJZA 1IJEB 1B70B 2B3TB 2BR0A 1H72C 4JBCA 4EUVA 3CCUS 5IC4B 2CWKA 4TY8A 1WI8A 2P5VA 5K8OA 4IQXA 2Z4PA 2V8GA 2B43A 3QJPA 1X31C 1HNVB 1SH3A 1RKIA 2B56A 1SC6A 2DITA 3A3PB 2Z30B 3JYTB 2VASA 1RHMB 4X65J 3RU0A 2G9OA 2ASLA 4P2FA 2ZM6J 2KN4A 3J7Z5 5HROB 1KRPA 2FVQA 2VA3A 4WF9Q 5C25B 2ZOGA 1U1KA 5D0EA 5F3TA 4ZIWA 5KFQA 1S7IA 4M5IA 1TMMA 3DLHA 3DRXA 3CNQP 2HGNA 2E1CA 4MKAA 3KLFB 4JOUA 4PWDB 2GO9A 2PEHA 3HSGA 1N5QA 3KJVA 1FA0A 1ZTWA 4Z7YA 4HT7A 4PXBA 3D1OA 3R5DA 3D1QA 2DISA 4DUZF 4MKBA 4QZVB 3GV7B 2DGSA 5KFOA 1UVMA 2NCKL 1VHFA 4JI3J 2HLTA 4LQ3A 2YX7A 1RYRA 2ZKTA 5EWGA 2BA9A 1S9EB 1TKXA 3OBIA 3HFZB 4KKOA 1KQSR 4NLWA 2LXUA 2KM8B 1YX2A 4QOTA 2C3PA 3SFUA 2MZJA 5DG8A 3ENVA 4I2PA 5BXIA 1NK4A 4DMZA 4MFBA 1BHNA 5F8NA 3W7BA 1UFKA 2AT1B 3B78A 1T9TA 3US5A 1BY9A 2LKZA 4J9QA 1VQNS 4ATNA 3N4WA 4B9SA 1UJ4A 4RKUC 3V5RA 3LP1B 4DFJA 2LEPA 1T9UA 2C2NA 2BBEA 3D3BJ 2E1MC 3BREA 1WG5A 3QATA 4HTJA 2HFOA 5F8JA 2E7XA 1URNA 1B7FA 4ECSA 1U25A 3VTIA 4O44A 1U24A 3CSKA 3SFGA 3T5HA 4QR1A 2CWXA 4USMA 5ETNA 2CPIA 1CS4A 2ZVIA 4OYIA 2VU5A 4Y2AA 1PKUA 5HATA 4LF6F 4CNYA 4DV2J 2VC0A 2HS3A 3MHYA 3KJNB 7FDRA 1X4CA 1BQXA 4K59A 3C15A 4ZP8A 1Q8KA 3THVA 3R3TA 1IKXB 2V63A 3IFEA 4CO2A 4A8OA 2COLA 2CJ9A 2C2EA 1YSJA 4IOCQ 3BZQA 3JTOA 3FRZA 3K0JA 2CZ9A 3KMQA 4K4UA 5JJBA 3SQGB 1C1CA 4RBTA 2V8HA 2Z58B 4LFCF 4JI5J 3UVJB 2NQPA 5KFPA 3UD4P 3W62A 4ES2A 5AXKA 4HH0A 3QGGA 4IG3A 4QIEA 3NCPA 3JSMA 3JAMY 1QVFR 3UCGA 5ETVA 2BQRA 5IWAJ 1N8RT 1OQ3A 1FRXA 4YN3B 4O3OA 1HW8A 3J7YI 2XSFA 2UUBF 5L1JA 4I2QB 1IQTA 3OUYA 3CJKB 3UQSA 3M32B 2I6WA 2RVJA 1LWXA 2Z2LA 4EMDA 3SDEA 4MYUA 3UN5A 1S6OA 2X51A 4NMXA 3FJ2A 3MM8B 2HGMA 3W5YA 1BE4A 4CLFA 2PIIA 3MTKA 4MKYA 3QPIA 4NZ7A 1MU2B 1S1WB 5DQGA 4Z7CA 4A8FA 2HNZB 1UZHA 3BEGB 3AB2B 4LVNP 1VFJA 2D7SA 2PT0A 4AXIA 2RE1A 3H90A 3FFIB 2XY7A 3QJLA 2J7WA 3SEOA 1QAIA 1VRTA 2WBMA 4OZ3A 4C8ZA 3J7ZT 4DPUA 2AEMA 2ATLA 4YUDA 3RB0A 1B7YB 3MEEB 3WC0A 4OZ2A 5DGAA 3VGTA 3C46A 3OXGA 2MXYA 2YNHA 3JAMU 4Q5VA 1VJQA 1RYSA 1HHSA 1HQEA 1GK8A 1OJ4A 4ELTA 4YB1P 3WX4A 3QRQA 4DFKA 2J76E 4NEZA 3DLBA 4RBVA 5A6WA 3G8SA 1N4LA 2LECA 1DTQB 4DV4J 5LMNJ 4C3KA 5GAGU 2EG1A 2MGZB 1R0AA 3G86A 1UMJA 1U7LA 2CNOB 1LK5A 4HH1A 5MLCV 3DGPB 2OKQA 4IFVA 4AE5A 3AXMA 1HMVB 5FDLB 3ELHA 2D74B 3D1HA 2MSTA 1CC7A 1IUJA 2R2TA 2BDPA 2H4WB 1N36J 4PPZA 1W2BR 1KKHA 4HVZA 3GYXB 3SSQA 2XO7A 4O0IA 2XG8A 1PCAA 1X5TA 2VFRA 2U1AA 2E66A 4CT8A 4URGA 2DCLA 5T7LA 1SQGA 4RW9B 1BMQB 2HIQA 4K0KF 4O4GB 5J2PA 1QVGR 4CP5A 2DGQA 1GX6A 2ACMA 1FNOA 1Q53A 2DGXA 1QY7A 3T1YJ 2Y1JA 2C22A 2RKIB 3QLHB 2MLZA 2K3IA 3AOBA 1RQ0A 4ECTA 2E44A 5AE1A 2W2QP 3R7BB 2QA1A 4B3MF 1B0VA 1REGX 1S1VB 3RW6A 4LR7A 3MR6A 5CZXA 1NJXA 2ASYA 2FZCB 3PYGA 2DRBA 4G1IA 1APSA 4CLPA 1K0VA 3CW2C 4F26A 4U96A 3MEKA 3VAHA 5DG9A 4CO1A 4AQYJ 4KGMA 2Y0SD 3E01A 3H42A 1M5HA 4JI2F 1BQMA 2YX1A 3BGRA 1J5EJ 1EJ7L 4UZBA 4DX5A 1NK6A 4WE1A 3W2VB 2IPOB 2WVBA 5KFUA 3W5ZA 1WOPA 3M8WA 1DLOB 1U02A 4ZLJA 4MJKA 1SCJB 1WI6A 1T8EA 1RWXB 3K7RA 4RU2A 1JWWA 4D3GA 4JI4F 3PRVA 4YHHJ 4C8LA 4KO0A 3CGIA 2B6AA 5L8RC 2KVIA 2VF3A 2RS8A 2CQ3A 3FVYA 3PXGa 2XMAA 4DL4A 3KK3A 1FNXH 3ISND 3IS9B 1SJQA 4F3OA 2F8EX 3HI9A 1HWJA 3OHAA 1RHKB 3VWSA 1AUDA 3QBCA 2WHOA 3R1HA 3LAKA 3SYZA 4OI3A 1RT4B 4H4OB 1N54B 2FVRA 1I5OB 3CD5A 4DV6F 2UUAF 2EC2A 1Q95G 1D8ZA 5KFTA 3OSNA 3NCQA 1XC9A 2EBGA 3ETMA 3C6TA 4JI0J 4PEOA 4E2FB 2VUGA 4CO5A 3KMSA 2JJ4D 3CIMA 3U7JA 3TZWA 2NYHA 3FSYA 3MMBA 4C8MA 2B51A 3GJRB 2HS4A 1U26A 2LXIA 3HHEA 5JVGQ 1RT2B 1Q5VA 2IM2A 2HHWA 4ZLNA 2YNGA 3BH6B 3HF5A 3W9JA 4ZVOB 4U7UD 4LF4F 1UZDA 2IBOA 3ZTSA 2GVZB 4QWBA 4ED5A 4DJBA 1SIWB 5C2GA 1K47A 2XWYA 3FKBA 2M9KA 3IBCB 4ZCKA 1EQ0A 2QYCA 2YKMA 2FB0A 3RRHA 4BWJA 1MMLA 4WBFA 4LF5F 3M8QA 2VODA 3THTA 3OJUA 2ROEA 3IGNA 1KOOA 3C6UA 4KTQA 1K0TA 2VL1A 1ZYQA 2V67A 3R6LB 1JLAA 3DC2A 1WELA 3I0RB 4LRDA 4JV1A 2HNYA 4L72B 2U2FA 2VKZG 4DUZJ 3GR1A 1LXNA 2HEKA 1FE0A 2NREA 4DCOB 3BQ1A 2DPJA 3FNNA 4LSNA 2CPHA 2PE8A 2DY9A 4I6AA 1QUPA 1RT1A 4PPDA 5E33A 1XMBA 3TA0A 2F40A 4CNZA 3HSDA 5D4LA 3CJ4A 2RH3A 1F2HA 2LU2A 3AD9C 2VBWA 2CQCA 4K4ZA 4R5PB 2PO4A 2CZ4A 4DV3F 1RT5B 1X9WA 2C3UA 2DHGA 3Q8YA 4RR5A 2W4PA 3I4HX 1T3NA 2ZC3A 2GZOA 5K9FA 2MKCA 3OTEA 2R7UA 3CT9A 1JLFA 3IWNC 2JEFA 4HYKA 3ET6A 3I96A 1F9FA 3HVTA 3F44A 3Q8PB 2LA6A 3PHTA 5HJYA 2VBYA 1YITS 3CCES 2FLOA 5LOQA 3KLVA 2BM0A 3PKYA 2CPYA 2K8GA 1SIZA 4R25A 1P6TA 2JLFA 4ZLLA 3LTOA 4NLDA 3TA1A 1U1PA 2XC9A 5D0HA 1YK9A 2ZD1A 1R6VA 2EEYA 2YNFB 3AY0A 3UDLA 1SC4B 1WKJA 3SXLA 4LF6J 2QMXA 4LF9J 1SL1A 3TQEA 1AFJA 4ZITA 2LQ8A 4TNOA 4KIAA 2VG6A 1L3TA 2XNRA 2B8QA 3MMAB 3T5KA 1RACB 1Z4UA 4X4SA 3CMAS 1AUSL 1EARA 4CCHA 4N8OA 4DPWA 5KFWA 3O44A 2CXEA 4PXEA 2VJVA 3TVZA 2FGCA 4TKTA 4PR6A 4DR1J 3L9ZA 1ZETA 1E6VB 4KE5A 4C0BA 4RW4A 1Y5NB 4USTA 3V4IB 1RTDB 4J5OA 1TL7A 5CYJA 3ETOA 2ALZA 2CPFA 2MDAA 3BGFA 3DFEA 3CMES 1YJ9S 1HNIA 4WXWA 4YQWA 2ASDA 3ZNUA 1HNZJ 4J90A 2R42A 4WYLA 5F41A 3M6WA 5L9XA 3T9ZA 2PN6A 4J9SA 4OX9J 5KFSA 3PW4A 5HP1B 1KSPA 4X66J 2XS5A 3DOLB 4IG0A 1F6TA 1FKPA 3IBWA 4KAIA 3SZ2A 3G8TA 3MM7B 3PJWA 4AL7A 2PA3A 2GAGC 2PI5A 2QLBB 4FKYA 2NXCA 2X7IA 4QWAA 2CNLB 2CQGA 3PG9A 1GNKA 3DDIA 4HKQA 3GTYX 1UW9A 3LGNA 1NB7A 3CIZA 4DG1B 2R8GA 4K4WA 4C9DA 1PJ5A 1HYSA 1FEEA 4P6QA 2OPQA 4UUXA 1S57A 2NXJA 5HO4A 1KTVA 5HJXA 2EFVA 3KDNA 4P2MA 4JI8J 2HVEA 5A76A 1RGVA 4ZJQA 2O1PA 2KFNA 1PJ6A 2HHSA 3MUMP 2MZTA 4WKYA 5J2MA 4KH0B 1VQLS 2MPUA 1Q78A 4OZ0A 4XDCA 4XDDA 1B64A 1EQMA 2ZUGA 4M63A 5HBMA 5KG4A 3CJQA 3CULA 4J9NA 2AYGA 4XTTA 2DR7A 4TU7A 3R8YA 1LWEA 1OQ6A 1TUWA 4Q0BA 4RWXA 3MM5A 2BE2A 3DMJB 1A6LA 3OLBA 1TAQA 1WSRA 1R27B 1KP6A 2BKNA 2OPSB 1U1MA 4IRDA 4NLVA 4NXNJ 1QSYA 2C2MB 4OJHA 4OLOA 2MJNA 4P2SA 3VQSA 4CI0B 4DI6A 4QR2A 4WTOB 1RB0A 1SJ1A 3P6YC 2IY5B 1SL0A 2AYMA 4K0KJ 2ZFHA 3S8SA 2VPWB 4NA1A 3W1YC 3W8PA 1Z2LA 3NCRA 4NI2A 1UPMB 1WHVA 1M90T 5F8LA 2W7OA 1MWQA 3S6EA 1RAJA 3DRYA 2UXBJ 4KFBB 2D3O1 1V3RA 3JQJA 2E5JA 2ACYA 4UY8T 3GSDA 3GILA 4R0JA 1S72S 3G8QA 3LAMA 3DLLQ 4E8UA 4B3MJ 2HQGA 3PACA 3BO4A 1D09B 1SXLA 4C8OA 1M5SA 4DPYA 4F4AA 1RKJA 4QU7A 4DX6A 5KFIA 4DL6A 1U4BA 1QE1B 2YXLA 4DU7A 1KC8T 2DGUA 1XR5A 4IUFA 3R5AA 1CC8A 3H5YA 4NLUA 1X4EA 2N82B 4KV8B 3JTPA 4PRFA 3ILOA 3JYTA 5DGBA 4FF4A 4JI2J 1IXKA 2RDJA 1JLBB 4O0NA 2OEKA 4U9RA 4UOGA 4ZIVA 5HROA 4OFZA 1HQ2A 1ZAXA 3TZYA 1IKVB 4ED4A 4LR9A 2XEXA 2FYXA 2GMJA 3EXCX 1XTZA 2WAQD 2XMWA 5CQGA 3MCSA 5B09A 1U1NA 4I6YA 3BN7A 4NLTA 1HFEL 1RWOB 4JI4J 1WC0A 3KLFA 1VK3A 3J81Y 5F0UA 3OL9A 2KT2A 2J5AA 1TV6B 3IG1B 2HMIB 1LWFB 4Y6IA 4DV7J 4DR2J 2E5LF 1S77D 4W4MA 3MI7X 1U47A 1HBUB 2JFKA 3HHNB 1ZAWA 4O3QA 2YWWA 1KN6A 3I0SB 4NLSA 2WZ1A 2UUAJ 2DNZA 2WSCC 4WFAQ 1ZM4A 3OL7A 4HDHA 5SZTA 5DZ7A 4KHMA 3H5XA 3W5XA 1S9EA 1FKAF 4WU3A 1NKEA 2XWXA 5EWEA 2KZMA 4A8QA 1P1LA 3MPVA 2GHVC 1NH7A 3MAAB 1S1TB 2JHEA 1RU1A 2BXJA 5JXSA 1FK9B 2E1AA 2WVDA 4DL7A 3RRGA 1FKOB 3GG1A 2GMLA 1JJ2R 4X62F 4DUTA 5A0YB 3BKTA 4LF4J 2KHDA 3DHXA 1VQOS 1CQMA 4OYOA 4ECUA 1NLKL 4LVOP 3NAHA 3C8YA 2YKNA 1GTEA 1UJ6A 1ZH5A 1R6YA 2MKSA 2NZ4A 2BQUA 2BJ7A 1HBMA 3WDOA 1FJGF 4WFYA 4C48A 3VQTA 4HTIA 5AE3A 3H40A 1VRUB 5DDRC 3KUGA 5CAAA 4CO3A 4FYWB 3AHPA 1JNZB 3LALA 3MD1A 4Q8FA 4ES1A 2AW0A 3SCJE 2POKA 3RBZA 4X4PA 1T05B 1O0PA 3LA0A 1MROA 3D3CJ 2OIHA 1S1XB 5BR8F 2BM1A 4Q2LA 4CZCA 1HIYA 4WZQA 2MB0B 3A4TA 2YPYA 3AJ2A 5KAKA 1VBZA 4OV1A 2YPZA 2DEJA 1CJVA 2DO4A 4USWA 4P7TA 3FUYA 2C3MA 3OTCA 2YQ1A 3MEDA 3IN5A 4X4RA 2KYZA 3OVBA 3ZZRA 2AZ1A 2V4QA 3MM6B 1VMBA 3UVJA 3BKFA 4QR0A 5E0OA 4EU0A 3K17A 1R3NA 5KFHA 3BR9A 4CLLA 2LEBA 4M5NA 4WPAA 1SH0A 3E3XA 3KG0A 5IOLA 5HMZA 3EICA 1VQKS 4I7FA 3T1HF 2KRBA 4K2JA 2J6UA 4I2QA 4YOEA 3M32A 4CIOA 4DL0C 1GX5A 3AOCA 4EWTA 3MM8A 2XMVA 2GA7A 2C42A 4LIRA 3L7OA 1P9YA 1S1WA 2AIRB 1T0TV 2H48B 1GFWB 1NDCA 4RNHA 4WP8A 3M2UA 1UVLA 1YRTA 4WP9A 1RUSA 1F9HA 1SB6A 2ZBPA 3M30B 2HAIA 2GHWA 4ZJOA 3CJ0A 4GMKA 2H3EB 1X7VA 1IQZA 2KG0A 3ENQA 4F2SA 1FRJA 1FDAA 4F4YA 2P8IA 1I6JA 5KG1A 2JH3A 1RT6A 2IA6A 1U6BA 3CTRA 5AXLA 3AD7C 2VG7B 2UZAA 2VQEJ 3TUJC 1BD6A 4LRCA 1IBLF 2VDIA 5CYMA 4ED0A 1RSCA 3GIIA 4WK3A 5DQHA 2EXUA 2OJ3A 4DXLA 5B0AA 2FTRA 3R6GB 3NRBA 1Q5YA 1DTQA 3OTOF 3LO3A 4C8YA 1LW2A 1UKUA 1WDTA 3M4XA 2VICA 3LGHA 2VJUA 1I94F 3PHEA 4ETXA 3MR2A 3C3LA 2MGZA 2Y8YA 2AD9A 3MECB 3ZFVA 1IR1A 1S12A 4OZ1A 2HK3A 1G4CA 3M9OB 1B3TA 1XR7A 4GC6A 1HMVA 5KG0A 2NYIA 1UFWA 3C14A 5FDLA 1CQNA 5E3RA 1N52B 3PIOQ 4MYTA 4FXDA 2ZDPA 3T5JA 4G1QB 3R5CA 1HI8A 2MYFA 5I42B 5K8MA 1S48A 2BKPA 3HXMA 2IMWP 3POTB 3H4DA 1VRQC 4GKKF 3VF0B 3Q89A 1SKSA 2ZJRQ 4RW9A 4ED1A 2L48A 1XQIA 5KFCA 2AJFE 1Q8BA 3M7VA 3QFWA 4LF2A 1HI0P 1UFLA 3NWRA 4DUYJ 5BYSA 1RK8A 3AT1B 1MLAA 2IRXA 4ZS6A 1D3WA 5HVHA 3ILIA 1MWZA 3G4SS 4EFAC 2G13A 5GMKa 2AGOA 1VQ6S 3QLHA 2IVFB 3I56S 1VLOA 1T95A 5D3GB 2YX4A 3LP2B 1IM4A 1PG5B 4GVLA 2O5DA 1I3OB 1FFGB 1S1VA 1NJWA 3E8OA 5T41A 4KC5A 5HQLA 3V4MA 2KT5A 3TARA 4PABA 1RLCL 2YY3A 2R2RA 4IDKA 3I82A 3ZC4A 1MNEA 4MH8A 1FRMA 1JX4A 4RUCA 3CO0P 3CVKA 3OR1B 4NMLA 3D68A 3W2WA 2HRTA 2IRYA 1FRIA 4KB7A 2G2OA 1MN7A 4DV5J 4GKJF 3E51A 3JQMA 3QNWB 3W2VA 4EK2A 5HSPA 3AXKA 4XPCA 1M5OC 2K1RB 2A2DA 2EK1A 5GAHU 1URRA 1NK5A 1SH2A 5E3AA 3PZPA 2MKKA 4IH5A 4K8RA 1UWAA 1ZA1B 2F1FA 2BE9B 2VONA 2HHQA 3TUZC 1NUEA 4EO8A 4DR5J 4QIFA 3IS9A 4HACB 2GFFA 1QTNB 2C1EB 3ZZPA 1MG7A 2RF2B 1DJ0A 2DK2A 3PRDA 4NXMJ 2CJKA 2F5GA 1BWEA 1RT4A 4H4OA 1H74A 2WBRA 3K5MA 3M2RB 1HNWF 2K06A 2L9NA 3K2YA 5U47A 3KLHB 5KG3A 1S10A 4JUZA 2OMOA 3FZBA 3M8PB 1L5UA 4NLGA 2H5JB 3I32A 4CLSA 1VYAA 3ITHB 3PW5A 4RJVA 5B0DA 1C0UB 3OXLA 4Y3CA 3TJ8A 1UL3A 3MAHA 3HJVA 1IJFB 4LBHA 1YGYA 3KLIB 3GU0A 2H51B 3PY8A 4F25A 1RT2A 2UUCF 5EUHA 2CJXB 4RW7A 3BSOA 1AXQA 3M6VA 3SI8A 4F3MA 2R7QA 4C2MA 2GVZA 3PV8A 5KFVA 3G6XA 5H1SV 1S7HA 4URQU 1S76D 4KJIA 1X9SA 1V5IB 3FMWA 3KK1B 2W8KA 3JS9A 1GQEA 3H8YA 4NE9C 1CJTB 1J2VA 4USHA 3PJ9A 3HHKA 4J91A 1WKLA 4BC7A 2OEJA 2FJXA 2E9RX 3R9LA 5HANA 1KWMA 2GVDB 2PD1A 3JTNA 2ZM6F 1GMUA 3OFEA 2FJEB 4UF4A 3EDRB 3HM9A 1TK8A 3A8IA 2BW2A 3AA8A 5B0FA 4IFYB 4C97A 4OZ5A 2HFNA 3I0RA 2YKPA 3NOGA 2CQPA 3PW0A 5AXNA 2VD3A 1HQUB 4DBQA 2UUTA 1BQNA 1K73T 1KQGB 1J27A 1NDPA 5ETLA 4JV0A 2EG2A 3G2XA 1S5ZA 3C2PA 2B9EA 2N3LA 4WZMA 2NUHA 1WG1A 4N7TA 4TQRA 3NG8A 1I1GA 3RG6A 2CADA 4ECYA 4JYAF 2F8HA 5A6PA 3GWCA 2RU9A 2V68A 1O6XA 1PYTA 1O8BA 5KFGA 5CCMA 1FNMA 1QM9A 2KYXA 1R0CB 2DY1A 3DDKA 2QA4S 1VQPS 1IKYA 2OPPA 4M5MA 2ZE2A 4X62J 2F63A 2I1RA 4LSZB 5GADU 2FJDB 1S4FA 4OX7A 1X4FA 1SI9A 1YDLA 4M5LA 3M8SA 4AT1B 3HHLB 3R27A 3CD6S 1VQ4S 1OIAA 1FJGJ 1LW0A 3AQOA 3BGUA 2AV5A 1YBUA 2I5JA 2CQBA 2JX2A 2VHGA 2CIMA 3PW7A 1S0NA 2EKNA 4AL5A 2GMHA 2YNFA 3GFYA 2N7YA 2GJFA 2L9DA 3DLEB 3ZTQA 1RAOA 2JZ5A 1F3VA 4BHQA 1X9MA 4H4MA 3I9V9 3V6JA 5JUMA 1CEZA 2MQLA 1RWKB 5F0WA 3NGRA 2QZ8A 2EI5A 4HL9A 1GXUA 2H9ZA 3MMAA 4Z2XA 1JQGA 3CJSA 4DPXA 4I68A 3HP6A 2CPJA 7FD1A 2RQKA 4FDFA 4NYPA 1YKWA 3CC2S 2FGOA 1IBCB 4J9KA 3WHIA 2QMUB 2ZJPQ 1X4HA 2RUSA 4QPTA 4DV2F 2QJ3A 1S49A 3ZO7A 4Y28C 3KOAA 4Y2CA 3CC7S 2FC9A 1D8YA 3KG1A 3N79A 3RAXA 1E6VA 3PYDA 4LSLB 2K3KA 3V4IA 3O1LA 1RTDA 2C2ZB 2EFNA 3ZZZA 1RHUB 3H2UB 2MEWA 3R2DJ 1FJ7A 1WHXA 3T1HJ 1SBRA 2G0CA 1R8HA 3ENAA 4OX8A 5HLFA 4MMOA 3FQKA 1R89A 2DNYA 2V9KA 1UVKA 5KFZA 3ZZTA 2CZVC 3PDNA 3PW2A 3LUYA 2J8AA 1U1QA 3N6MA 4RW6B 2ZNYA 5IWAF 4ECWA 2LEAA 1OYDA 2QX0A 4K5SA 2IVYA 5J2NB 4OL8A 1JLQB 4WFNQ 3DOLA 4ZPDA 3B6BA 3UWTA 3R2CJ 1DQ9A 3G87A 3PR4A 2ZH3A 2YQ0A 2DGVA 5F8MA 1N33F 1TL1B 2NS1B 3JQKA 4FBUA 1PC4A 2D1CA 1N6QB 2MHNA 3NS6A 4KT0C 2IDEA 3QAEA 1XK8A 4DG1A 4Y0FA 2I9SA 4PG5A 2N4CA 3CDAA 4DV0J 2J7KA 4QIWD 5A8WB 1UA0A 2HZCA 3BQ2A 2R7RA 3UR0A 3AJDA 3QQCD 1KS2A 3FSXA 3DGVA 1FDNA 1M1HA 3MTJA 2BOAA 3VGUA 3GIKA 2AU0A 1I94J 2DRAA 3DDNA 2ZH5A 3ZNJ1 1H98A 1RA7A 2KT3A 5E3PA 4C8KA 2QIFA 3ISNC 2CDRB 1U49A 2OFGX 1BWVA 2VPYB 1VBXA 2ZH4A 5H9FJ 3SMZA 3DMJA 3THPA 3WC2A 5K14B 2IJRA 1RAAB 2DNHA 1KONA 4DV4F 4CT9A 3OR2B 1OYEA 4IQMA 1FESA 2E5HA 1Y0HA 3IXQA 1YI2S 4ANCA 1PYOB 2KB2A 2G2ZA 3ONQA 3D54A 2GQQA 3DRSB 4QPXA 4GKKJ 4BBYA 4ZPTR 2AYEA 2B0GA 2ZHAA 2GHPA 1S99A 2LQJA 4YS2A 2I38A 3Q8SB 4G6VB 2KM8C 3P4UB 1REVB 2V8PA 1OSCA 5DO2A 4YR0A 1L3VA 3TAQA 5DJBA 3TR5A 4KFBA 2E7VA 2F3JA 2MZ1A 1DURA 1K44A 4ID5B 4HHUA 3DRRA 1V5VA 2HHHJ 3N5FA 3MR3A 2R7OA 1GH8A 3O8WA 1FWPA 3SCLE 4R0EA 3QZ8A 1NK8A 4L6V3 4N8NA 3CWJA 3I5AA 1ZM2A 3NWGA 3SCKE 1XN9A 5L1IA 5C5JA 1IBKF 3ZTOA 4JI7J 3BH7B 1IR2A 1QE1A 1T9YA 2DNQA 3NGUA 4BDPA 5KFNA 5K8PA 2CPEA 4NRUA 5AE2A 2HW3A 2XNQA 4KV8A 4DCJB 3SQOP 2GCFA 4YMEA 1VQ8S 2HWHA 2VH7A 4IOAQ 3IP0A 1D9DA 2DIVA 2J7UA 2DGOA 1M1GA 3KNAA 5ETPA 1IKVA 1A0OB 3LOUA 2HFVA 3CCTA 2BW7A 4PCQA 4CLZA 1FX2A 4FF2A 2HGLA 2BJDA 1HWUA 4ED3A 1U48A 3CJ5A 3RBXA 2HURA 2FJVA 1N32F 5I3PA 4FP9A 1SJRA 3Q86A 4ZPCA 2HMIA 1NU4A 5L9NA 3N0VA 1HBUA 3D4JA 1SJFA 1NMEB 1X4AA 3D2WA 3ZZ0A 1EIYB 4TLRA 3DU6A 2AJ0A 2G0JA 1JJHA 2VPZB 3I0SA 2ZBQA 1JK9B 2B9XA 1HNWJ 2CQIA 4DLGA 4B9MA 1XJWB 4CLTA 3LGMA 5A8KB 1Y7PA 1TKXB 4M95A 2KKHA 1RZMA 2M8HA 1AZSA 3OW2R 3MCNA 2Y3YA 4ZOSA 1GMWD 2EFQA 1RHJB 2R8JA 1O5JA 2DH9A 2GIFA 4DX8H 4C11A 1FD2A 2UUWA 2IVMA 5AXMA 1DARA 3GYNA 2C28A 1UCNA 3PIPQ 3HFVA 4WK1A 3MAAA 2BJEA 4ICLA 1HR0F 4RBUA 3QWPA 2Z2YB 4RL1A 4WIQA 1TP7A 3IO1A 3DXSX 3M9MB 1RTHB 5CZVA 1FKOA 1NK0A 1VIOA 3VR1A 2WSFC 5KG5A 4NLQA 1M1KT 1PBAA 1B0TA 1S6UA 3CDWA 2JVOA 2D9PA 4M5JA 4B08A 1WTBA 4OMFG 3V6HA 3UN2A 3QRPA 5LMUJ 3M9NB 2I8EA 3HHLD 1HPZB 1U1OA 3HT0A 3VAFA 1JJ4A 1QSSA 1VRUA 5FJ4A 4CDIA 2V2ZA 1IKWB 2XYGB 3UDCA 1I51B 5CD4H 3HVRA 3NGSA 1T05A 1NHVA 4UW2A 2AJQA 2O67A 1NZAA 3VGSA 5E3CA 2CJBA 3C15B 1D1UA 4DN0A 1PGZA 1LWCB 1S79A 4DSLA 2J6SA 3P96A 5KTQA 4FS2A 5HMWA 3IBFB 3KHLA 1RWPB 1Y3KA 2B7CB 2MQQA 1CVJA 1TUVA 3CCZA 1OSDA 1Y4ZB 4M94A 5I3UA 2YH1A 4W90B 1BXNA 2FQQB 3VGVA 4IR1A 5IT9Y 3A8KA 1P27B 4LF7J 1NSQA 1F5BA 3MM6A 3LANA 4JYAJ 4A8YA 2RDIA 4ED2A 1LXJA 3BO2A 3M6UA 4DQRA 2IM1A 2BJ9A 4CO4A 3MM9A 1TFWA 3H20A 3Q24A 5L39A 4F8RA 2VBXA 1U0SA 2DO0A 1V3ZA 1HHQA 1MSWD 1N5VA 2HVDA 1D9AA 4EO6A 2LQ5A 2RT3A 1RT3B 3BN4A 5HVFA 4CH0S 4LRAA 5C24B 3JSRA 4LQ9A 4F36A 2Y9HA 1RISA 2GV1A 4LBIA 4FXVA 3AFGA 1WC5A 3D66A 2DNLA 2GGPB 1RWNB 2ZUAA 3A3OB 3P3DA 3RZAA 3FK4A 3CD7A 4DPTA 5L1KA 3H59A 4ZVFA 2MQPA 5IT9U 1A9NB 3M1VA 2VFUA 3FGVA 3X1LB 2WB4A 2YQ3A 4X64F 2BX6A 3CCSS 1FVQA 3AH6A 2DPIA 1HD1A 2GS8A 1GXTA 1WC6A 2JEGA 4QWEA 3EZOA 4I6WA 1W2IA 2FC8A 3U02A 5HI7A 4B9TA 4DSKA 4OZJA 5F9NA 1TK0A 4DL3A 2BVZA 2CQ0A 3QMQA 1N0VC 3EPIA 3HD1A 4Y34A 2AEFA 3L7PA 1W25A 2B4OA 3EMTA 4YP3A 3MDFA 1SKUB 2G2YA 2VOOA 4LF9F 1XNQF 2J0WA 3DXBA 2DR6A 4XIUA 4DQPA 4B3SF 3GJSB 2XLIA 1WNEA 5EX3A 3V81B 5KFDA 2RDDA 1NJYA 5ETOA 4FVMA 2X1BA 1QAJA 2DNOA 3B82A 2XZDB 3ZXWA 4ZN3A 3V6DA 1GMVA 4CRJA 2Z0GA 3TUPA 1BUXA 5E7OB 2XHCA 2IBKA 5LL6d 1RADB 4RX6A 1OY6A 4YB6A 2ZHOA 4I69A 4DR1F 2ZJQQ 2HKEA 3I5BA 4G1QA 1V3SA 5LM7E 2BEFA 3BSCA 2BMBA 3U1NA 3SV4A 2RHSB 1FVSA 3PRBA 1RHRB 4MK9A 2ZITA 1WEZA 3BSNA 3H2VE 2CPXA 1XR6A 1HNZF 1N33J 2RJZA 1JLGA 3BM7A 1M0SA 5EX0A 1WG4A 2V9WA 3CMQA 5IQ6A 2N4DA 4OX9F 4L3NA 3M2VA 1JJCB 2ZBCA 1X0PA 1YRXA 3UD5A 4X66F 1GT8A 1NAQA 4JI1F 5GAHI 5BYQA 1C1BB 1SV5A 4MK7A 1ZOTA 1ICEB 4FKXA 4OJGA 4TQSA 5H9FK 5DDQC 3I4PA 3BYRA 2GX8A 3KHGA 2M0GB 2RHQB 1P9QC 4OQJA 1SKWA 3EZUA 5KFMA 5ETMA 4M8LA 4IR9A 4CM0A 4OJ1A 1RTIA 3QO9B 2DTJA 1UAWA 2W7PA 3R5JB 1FRKA 1SKRA 3E01B 1RTJB 2HBQB 1HKAA 2MZRA 3OR1A 1NRKA 1IVZA 3I6PA 1X4DA 4F0MA 3NLCA 4A4JA 4JI8F 2DNKA 1WC3A 4KHPF 2J8SA 1N48A 2YH0A 4WE1B 1VQ5S 1AROP 3D6MB 2X3DA 1TKDA 1W7WA 2FZGB 4F3QA 3NNAA 1G6BA 5GMEA 1VOMA 2YNIA 3ZTRA 2HVIA 1FHTA 1Z1ZA 3ZZUA 3FDSA 4XAKA 3R5GA 1QAYA 4WFZA 5IM0A 1DQ8A 3UE2A 3RR7A 3SIPB 3BKUA 5CD4A 4EZ9A 1RP5A 1U0HB 2LQ9A 5CYQA 3CCVS 1Q7YT 3A8JA 4MT1A 4HACA 2OAUA 2KI2A 3Q8UA 1X0FA 2RF2A 1RABB 1UPPA 2F65A 4B9LA 2V2QA 4NXNF 3O2IA 4ZVPB 5C2CA 3M2RA 4OI0A 3C6TB 5DDPC 3KLHA 4C4WA 6FDRA 3DLGB 3TNVA 2QV6A 2AHOB 1X5PA 3ITHA 3TEGA 3U27A 1RAIB 1EETB 5HMXA 3VCDA 3FC9A 2GAHC 1KQFB 4L73A 2IAJA 3TAMB 1IBKJ 5L46A 2UXBF 1S4EA 3G6YA 3CB4A 2YWHA 2ERRA 2R8IA 2QYGA 2MLYA 4L74A 3EUNA 2A18A 3CCWA 3RGIA 3DN9A 2HPUA 4I4BA 4NLXA 4LFAJ 5T14A 1JLCB 4E0DA 2P9EA 4XK8C 3OLAA 1Q16B 2ZH9A 3D9BA 1TL3B 4CLYA 2ALYB 3AODA 3BF4A 3D0GE 3L7UA 1MWYA 4CH7A 3KK1A 2W8LA 3J7AN 1MMNA 1CJTA 3MOZA 3LPEA 1HWKA 4Q44A 2JLGA 5DG7A 3OFFA 1FO1A 4L76A 3C6UB 2RIJA 2YKOA 1N32J 1AW0A 2LMIA 2GVDA 3MCOA 4ZDNA 3Q22A 4NEYA 3S7RA 3K89A 2ZDOA 3JB9k 2MHEA 3T9NA 4ERDA 4NA2A 5B0GA 4J7CA 1FDBA 2HNYB 5GADI 2KZZA 4IFYA 2ZH2A 3OD2A 1HQUA 2MZSA 3DU5A 5ETKA 4Q2MA 1KVKA 1ZPWX 4QJVA 3BO3A 5J1EB 5J2QB 1RT1B 1GMWA 3K5OA 3QIPA 5B08A 4DV7F 4DR2F 2QLFB 5KT2A 2F4FA 1KLMB 2CQHA 2ZNZA 1KLNA 3RR8A 4ZHRB 4OYAA 1QSLA 4G3IA 2DCUB 2ZEJA 3HT3A 2VV5A 1HR0J 3CEDA 3HPOA 2HAFA 4WU2A 4UT4A 2LCWA 4U8YA 4WFBQ 3CC4S 4FN5A 3ET6B 5KOXA 3MWBA 3T3FA 2KL8A 1PYSB 5DETA 2J0SD 4HI1A 1H7WA 3HHLA 2HBZB 5KFRA 1HHTP 4M5GA 3L09A 3T5LA 1JLEB 2SXLA 4Y2MA 3W61A 3FZ2A 2E5IA 2FVSA 2FVPA 1CBKA 2DNRA 3TVYA 1KEKA 1DBDA 3PX6A 1WC1A 2OD6A 2DHXA 3H98A 3S1TA 1F5CA 2KXFA 2V2VA 1OY8A 1RAGB 4A47A 4KSEB 2OUGA 4NYOA 2E29A 3PCOB 3UFCX 4DZ6A 3WZ0A 3HD2A 3UNGC 4WJBA 4C6AA 2QSFA 3GR0A 2JC0A 2FJBB 4WP3A 1QUVA 2C2KB 2EK6A 2VA2A 3DLKB 1Q8IA 4RW4B 2A6OA 1TK5A 4U6PA 4WCEQ 5KT6A 4LSLA 1RBAA 3MR7A 2UVRA 1R8BA 1RBOB 1H6KX 2A2CA 4IYQA 4UOCA 2NSBA 2WTFA 3FBBA 2AKWB 1RAFB 3QGHA 3PFEA 1R43A 2HQCA 1FE4A 3K5PA 1DZ5A 3GG0A 4OYPA 3GZ7A 2DXFA 3CJRA 1R8AA 2FHMA 2YWKA 4IG0B 4RW6A 2VOPA 4KPYA 1R8CA 2RS2A 1TL4A 4ECQA 2QA2A 4FF3A 2E9TA 1T9WA 3EWGA 3PNIA 1R31A 4YB7A 3PYEA 2WW4A 4CYUB 2CKWA 3I31A 4X64J 4DZDA 1KBRA 2EFGA 3MFIA 2OLWA 2V8DA 1HBNB 5E2QA 4Q8EA 1V9OA 3MAQA 3DI6A 1HYSB 3RB3A 4UY85 1UJ5A 2G1DA 1CJUB 4C0HA 4QU6A 3IGVA 4N5SA 3GV5B 3R7SB 3KYLA 2FD2A 1RAHB 1J5OB 1TFYA 1WJ9A 2V69A 2WOMA 4F0HA 3PKMA 2DRDA 4ENOA 1XNQJ 2VG5B 2FVCA 5HBMB 4B3SJ 2ADBA 4KR0B 2OTJS 1EP4B 2VQEF 4X4NA 2AYBA 1FEHA 3QSIA 4N56A 2BE2B 4EBEA 1JKHB 3K59A 4HHHA 1NNDA 3G82B 3NAIA 4PXDA 5A2QY 2WONB 5D15A 5IXUA 3OR2A 1RHQB 3IR6B 5CA5A 3CCLS 3K8VA 1YJNS 2XM3A 2BOPA 1XBWA 2RRNA 1RDRA 1X4BA 2F9DA 3DRSA 1E6YB 4V1Ak 2EFPA 1Y00A 2FLNA 2OFHX 8AT1B 3N01A 2LDIA 4OI4A 2QE5A 2OO4A 4DR6J 2DNPA 5AJ3F 1NZ8A 2XO6A 4ZP7A 4FF1A 3R7NB 3H4BA 1ZTTA 4ZVQB 2HWIA 1REVA 4TY9A 4OZLA 2OELA 1WEXA 1WF1A 3TYTA 2B9YA 1YBAA 3HJFA 2UVWA 3TI0A 4FYXB 4ID5A 1VCTA 2VQFJ 4FYVB 3VV2B 3SSRA 4JI1J 1NCLA 1YZ6A 2RILA 1SVDA 2QLWA 2RRBA 2W7AA 5A2QU 2ZVSA 4DUYF 3TRGA 2KU7A 3IAM9 3VAIA 4F4WA 2XSJB 3TANA 5A8RB 2C2DA 2HNDA 3GIMA 3W8GA 1IWAA 4YEAA 4OYBA 1L3SA 2A0FB 3HMJG 5D77A 1UVIA 3J81j 4KHPJ 2FLLA 1TQLA 1U45A 2R7VA 5KG2A 2I2YA 5DS7A 2MY8A 2UV8A 2HHPA 3I5CA 4S0MA 4DQIA 1DTTB 3B54A 1PO6A 2EW9A 1F2GA 5KFAA 3UN3A 4ED7A 1SQEA 3C16B 3M05A 2N3OA 1NK9A 3CPWR 2ZHBA 5C42A 2L9WA 3JXOA 2K2PA 4DV5F 3Q23A 3N9UC 3PX0A 3MCMA 4BS2A 2WVCA 2IRUA 3BYPA 2MQMA 1RLDA 1VQ9S 1T94A 5ADZA 2BKOA 5G0RB 1NXIA 2IYGA 4TXSA 4YDXA 1RT7B 4OZNA 3H25A 1QLNA 2EFOA 1VC6A 3G9CA 4ZPWR 5A8KA 5I4MA 2ABYA 3MGJA 3NMAA 4DR5F 3BV8A 2ZZTA 4ANEA 4JI6J 3NOCA 4AUKA 2RU3A 3A8EA 1NDKA 3E2EA 2Z2MA 4ANDA 4UQGA 2YWFA 4NXMF 2KJVA 4LRFA 2M8DB 2XY5A 2DR9A 4PUOB 4R8UA 4DU8A 1PSDA 2D69A 2CYYA 3MOJB 4DR3J 4USKA 3Q8RB 1RTHA 3R1LA 4ELVA 4GVBB 1S1UA 4EBDA 1DHMA 2YKNB 1H2TZ 1D0EA 3KJQB 3L4BC 4K2XA 3O6QA 3ULHA 1C4CA 2EBEA 3TWZA 2F4VJ 1S0VA 2JNJA 1HBMB 4DFPA 4RNMA 1K1SA 4FPRA 4DFMA 1FERA 4QCLA 2DBBA 4O3RA 4USVA 4RZRA 1HPZA 3ZZYA 2OHDA 1HNVA 1IKWA 4NCGB 1KFSA 4LIWA 1MROB 4ECRA 4W92B 4WWSA 3GE9A 3KK2B 3VALA 1Q81T 2PI4A 1NHUA 2MTLA 2XHWA 1VQ7S 1SL2A 3HSJA 5C25A 4B9UA 3PM9A 1LWCA 1TAUA 1CJVB 4OI1A 4FBTA 4RWWA 4WTYA 3MEDB 2BABA 1UVNA 2J9DA 2B5JB 2PFDA 2HFUA 1X60A 5LJ5Y 3CO9A 4PWDA 2BJ3A 2LYVA 5D6GA 3K58A 4TN2A 1W26A 4ED6A 4BLGA 4YR3A 1ZBTA 3I55S 2VB6A 3X3UA 2WVEA 4DSEA 2BJ1A 2QTWA 2B4PA 4IOBA 3FEYB 4ZVUB 5G4DA 4QWCA 5IS2A 3TEHB 4I7FB 2OSQA 1PC5A 5CCLA 1RA6A 4AFFA 3MUVP 4Y2IA 4YB5A 2PEBA 4QWDA 4F7VA 1S6QB 5KFXA 1RT3A 4USJC 5KFJA 1HBOB 5C24A 3QAUA 2J0QD 2M7SA 6FD1A 1N5TA 2FY1A 2BE7D 1HA1A 3M2UB 3BDEA 4F67A 2GGPA 1C0TB 4EBCA 1YTYA 1NPRA 1KR4A 1TZ0A 1H2VZ 3CJ8A 1ELOA 3EDQB 2E9ZA 3J81U 2MLXA 3EYZA 3P5TL 2WRMA 4DN9A 3Q8QB 3FCHA 4ZN1A 4J37A 3KNGA 2DYAA 4UQTA 5HAOA 2ZKUA 3UDEA 3OFGA 2OH2A 3LP1A 1LOUA 3CD0A 4YY3J 3F73A 1TUGB 4RW8B 4ZMMA 1BLUA 3DM2B 1RT6B 3DRPB 3RYLA 1VS3A 3KUHA 1VK8A 3QYYA 2A10A 5CYMB 8ATCB 2LDYA 1T9VA 4TLQA 1LKZA 4DHVA 4PG7A 3UW1A 1LW2B 2V94A 2ZZNA 4KGXB 1FX4A 2V8VA 5KG6A 3PX4A 2BJ8A 1RCOB 2NSCA 5ITHA 1NKCA 1IKXA 3V81A 3HZEA 4KBIA 1R8PA 2H5EA 3T6BA 3L95X 2P6SA 3C14B 4C8NA 3SQGA 2J9CA 2LQBA 4KPCA 2P6TA 1EKSA 2QLXA 2W9BB 2Y1IA 5HN0A 4ALZA 3HLUA 1SC1B 2ZOFA 1HNXJ 5ETTA 3TO8A 1VISA 1VJWA 2QFJA 3BGOP 2DGWA 1HWIA 3IWLA 1EB0A 1QJHA 2IYIA 1Y3JA 5JVHQ 4DPOA 1XWLA 2YVSA 3EGWB 2AJ4A 4I1TA 3ILLA 1ZA2B 3NKYA 1LQ9A 3CJKA 1YQHA 4EGLA 4USUA 3W64A 1SJ4P 2Y1RI 1HARA 1HL6A 3NP5A 4CLKA 2CJAA 1X5SA 4LF8F 2DNMA 3TOQA 3KHHA 1MU2A 3QWUA 3BQ0A 2PMZD 3BGLA 5HL7Q 2HNZA 4HEA9 2YKQA 3I9ZA 5IQQA 2XMTA 4RNOA 1C1BA 3FFIA 2B8PA 4F0KA 2VFTA 1CLFA 2C2OB 1S6PB 5H9EJ 4IDKB 1ITPA 3GSIA 1EAYC 3FBCA 3D28A 3H2LA 3TA2A 3EVWA 1Q82T 2LLZA 4F04B 3MEEA 3PEHA 4P71A 3V6KA 2J0XA 3OL8A 3N6LA 2APOA 3QO9A 3TW0A 2Q6CA 4EEYA 4B3TJ 4IH7A 3LH2S 1RTJA 1FT8A 3W2WB 2HK2A 1CJKB 2XMJA 2Q79A 4DV0F 1DRZA 1RE1B 4KHRA 4NWBA 4DV1J 3RJMB 4J9RA 2L08A 2A6MA 3CE8A 4O23A 2W4CA 4OI6A 3Q2SC 3EVMA 3TX0A 2V4RA 1WUUA 2X1AA 4OYZA 4BWMA 1MMDA 4NLRA 4NPOA 3RUBL 4H4KA 2UXDJ 1NKBA 5IZHA 3W66A 3CCRS 1XNRJ 2XCPA 3U1LA 1WF2A 3NNCA 2Z56B 2XS2A 1FCAA 4NASA 4ZCIA 4K4XA 5M2PA 3DGPA 1TMJA 2IDLA 1U0HA 1HW9A 4JP8A 5AJ3J 2WW8A 5KT4A 4DR4J 4HHJA 2XS7A 5F8IA 4ECXA 3FEXB 3HCXA 4CQ1A 1N34F 3KJFB 4D3HA 4C0OC 2XCAA 3SCIE 2KHCA 3DLGA 1OY9A 2OMLA 1YIJS 4NZ6A 1LFWA 3OV7A 2X1GA 3P49B 1FTCA 1ULRA 4O4GA 3W9HA 1EETA 5AT1B 3HHLC 2W9CB 4I0WA 3PFOA 2D3ZA 4YDDB 2YBVA 2Q66A 5D0GA 3TAMA 2DH7A 2E1PA 1VC5A 5C7PA 3PR5B 5HK4A 2RKIA 1OS5A 4RW7B 3BJYA 1H7XA 2LA4A 2HLUA 3EGNA 4YFUA 4TVAB 4HT5A 2HHHF 2IIHA 4NRTA 2FUG9 2MY7A 2ZH7A 2ZBRA 1YG0A 1IWGA 2HQFA 3NS5A 2F9JA 2J9DE 1JLCA 2XMUA 4U67Q 1EX8A 2AF6A 1OWXA 1NBEB 2QO3A 1TL3A 4RUBA 6AT1B 2HFZA 2IJNA 3K8WA 4JI7F 5IV4A 2HHTA 4UOFA 1TKZB 3OVSA 9ATCB 5GAEU 3KUEA 3GB0A 1AA1B 2CNNB 4ILMA 2B9WA 5BJRA 2I0XA 2IFXA 2Q3PA 4NLPA 5L1LA 2MMYA 4KGZB 1QD1A 3MPUB 2H5IB 1WDDA 1JXEA 2DH8A 1BQNB 1FXRA 1DLOA 3B8HA 3RB6A 1F0XA 2VPXB 4CM2A 1S0OA 2V34A 3MPYA 1KDNA 3NS7B 5J1EA 5J2QA 4M5KA 1JXVA 2XZTB 1Y5LB 1YJ7A 3DLJA 1AFIA 2YKAA 3D6HB 2AWZA 4RUAA 4XO0A 2WVFA 1KLMA 4MIBA 1G7CB 2OP5A 2ZWOA 4ZHRA 3EE3A 5IFMA 2XYHB 4LF1A 2NLWA 4WXOA 4PQUB 1XEZA 4ER8A 1IKYB 1DAXA 3CCQS 1KVIA 2OPPB 2ZE2B 1CG2A 4E98A 4FZVA 4Y65A 1SUQB 3CXCR 1LFPA 2O3DA 2DR5A 2IM3A 3BBFA 1PAEX 1A7GE 5RUBA 1Q1KA 3FRYA 1RI7A 1GAOA 2D41A 1X4GA 4Q45A 2DIUA 2DHSA 1MN9A 1Y9OA 3CCMS 3UR3C 1LW0B 3PJXA 2IHR1 3N28A 4L3KA 2I5JB 4U95A 1JLEA 3RRKA 3KWMA 1RXOB 1YHQS 3VZIA 2VFSA 4IKAA 2HQIA 3HULA 1VLYA 4ZPBA 1FWKA 4ZVTB 2W2PP 3IM8A 3DYAB 1M5KC 2XMMA 3MPWA 2QA4G 4KRWA 5E41A 1XMQF 2JDJA 1KFDA 1UWBB 3TAPA 3QFHA 4U7UK 4H4MB 3TJAA 3HK2A 2VIHA 5LMUF 4LREA 1WEYA 3TZZA 5D8HB 3M8YA 2CVIA 2R7XA 4DQSA 3FBEA 3DKDA 4O3PA 3BBCA 2KDOA 3TX8A 2CAJA 2QT7A 2RQCA 4PG6A 4P9SA 1S9GB 4GRSA 4V19J 3QRRA 2UU9F 1YJWS 4URSA 4LFCJ 5F8GA 3RW7A 4F02A 4H54A 1P1TA 4WFXA 4ZVGA 2ILZA 9RUBA 3GCXP 4B3OB 2PGCA 2DXDA 3DLKA 2ZZMA 2RQ4A 2RSQA 3MD3A 2D3OR 2UV8G 3WX8A 3J80Y 1F5AA 3EZ5A 4PAAA 3LP0B 2V4JB 4F4KA 1BC6A 2UUBJ 4LF7F 5HLFB 4HLBA 4HR2A 4LFBF 4KYZA 1ZM9A 3LWLA 1RU2A 1F60B 3WIUA 2JEJA 2R7TA 4QYZJ 4QW8A 4TU8A 3B4MA 1WKKA 3R97A 1WOOA 3CUNA 2MZQA 2Q1LA 1TKTB 4R5PA 2QL9B 2X3GA 2WSEC 2R4FA 4K7QA 2M70A 2R7WA 1RT5A 1FDDA 3TP2A 2JFDA 1N5YB 2G1HA 2AJ1A 4CYUA 4N47A 1QTMA 3MEGB 2HRUA 4C7QA 4PXCA 1OO0B 1HBNA 5SUHA 3TJ9A 1UA1A 1T03B 4KGVB 3KLEB 3CJTA 3J80U 1WOSA 3A12A 1C2PA 2V50A 1CJUA 4ZA1A 3D6TB 2C3YA 4P52A 2XZWA 3DOMB 2DEIA 1BGXT 3QSYB 1YJUA 3D6FB 2V0NA 3OTDA 5D0RA 1J5OA 3CDEA 3G96A 2YTCA 2NR0A 1U1LA 1VIXA 3GMGA 1JIHA 3AD8C 3NBPB 2VG5A 3UCZP 1G3OA 2PSZA 2KJWA 4Y00A 1IBMF 4DLEA 1EP4A 1VBKA 4WYWA 2KG1A 2RQMA 2PC6A 3QIDA 1YVFA 1VGYA 1SJ3P 5IT0A 1JKHA 4M5DB 4BC9A 2HIYA 2HBYB 3G82A 3EGZA 1NPPA 2WONA 3NGTA 1NO8A 1AYEA 3LF0A 2XULA 5E5NA 3AAWB 3IR5B 3GFZA 1RAEB 5K8NA 2JLEA 2W24A 2CG8A 3HVWA 3B4DA 1TVRB 1CULB 2HVZA 4I64A 1E6YA 4MIWA 2HSEB 2DXEA 2FZKB 4NL5A 4B9VA 3HSZA 2GJ2A 2JL9A 3T6JA 2RD5C 4NZ0A 3NY0A 5H9EK 4GO5X 1FRHA 3GFXA 2BANB 1ACMB 4U7CA 4LF8J 4GC7A 2UXCF 3EGVA 3DRRB 2W2NP 2N7CA 2DT9A 5HP1A 1AB8A 1NDLA 2H54B 4P75A 2W9AA 1K1QA 2IJFA 3HHDA 3KDOA 2CPZA 3NL0A 1Y11A 3MM7A 1K9MT 2Z2ZA 3K57A 5B0BA 2CDQA 3QT5A 4PZVA 1B0PA 3A3NB 2QL7B 2IC3B 1U1RA 3G6VA 1ZAVA 4OIXA 1FRLA 3HVAA 2MQ8A 2XI3A 4HI2A 2XSJA 2HQDA 2J9EA 5A8RA 5JMNA 3VAKA 1OMSA 4MIAA 2QC3A 3HKZD 4PQAA 2EPIA 3GV8B 1RJJA 3AB4B 2XBPA 1SQFA 2JSXA 2E5GA 4CTAB 3PTWA 1UETA 2PA8D 3GP9A 4O3NA 1U8WA 1NSKL 3GFHA 1WTFA 1DTTA 1VQSA 2DVIA 4FYYB 4DR7F 3C16A 3T1AA 2MKYA 4EYIB 4X4TA 4J9VA 3N5BA 1N56A 2EWHA 2GIRA 1UW4A 2CQ1A 3IM9A 1VQMS 2AEJA 3QGIA 1T9XA 3IC1A 4PWWA 2OPSA 2KFYA 5G0RA 2QG9B 5LXYA 2CQ2A 4DV6J 1RT7A 3M6XA 1N34J 5HQ8A 1AZSB 3MUTP 4P74A 1VHIA 2P2CB 2V5HG 2OEMA 4UUWA 2R9LA 1YBTA 4OLPA 4C11B 4V19X 3DOKB 3MMCB 3ZTPA 1FF2A 3BR8A 3RB4A 2KO1A 3AA9A 4A8KA 3OVAA 1S59A 2GO8A 4ICLB 2GW8A 1F1BB 1Q0NA 1T02A 3CDUA 4PUOA 2QL5B 3KLGB 2V2KA 4DSFA 3IRXB 2OPRB 1ZZFA 1XMOF 2FDNA 2W4DA 5ETQA 4A48A 3LQVA 5KFEA 4GVBA 1Y10A 1YJTA 4M1KA 4X4VA 3DNCA 4AYBD 5J1PA 3IA0A 2KXHA 4RPFA 4TY8B 3AJ1A 5HVGA 2JOQA 5K5MA 1UTAA 4L75A 1DQAA 4A46A 2VZ9A 3CF5Q 4LF5J 4OJ3A 4KY3A 2DD8S 3C19A 3P45B 4ZVSB 2FPHX 4NCGA 2CPDA 2W01A 1KHVA 4I67A 2FJAB 1JLBA 3KK2A 2AX0A 2AZ3A 5HMYA 4LFAF 4GO7X 1HWLA 2CQDA 2HWTA 4ZKAA 2JRSA 4O4RA 3UNYA 4IH6A 1VC0A 1FTRA 1NPKA 2MQOA 5I3UB 2W25A 3OSPA 4NX9A 2WCXA 1HI1A 2B5JA 5D4OA 4DS5A 4HDGA 2H65B 3KJVB 2HQ3A 1TV6A 3IG1A 1LWFA 2UP1A 1KOHA 3BSAA 2GQCA 4N77A 3MM9B 4C3MA 5K20B 1N5SA 1IR0A 2ROGA 5B0CA 3NGKA 3ENWA 1Q86T 4ETZA 2XGPA 1P8GA 4DV3J 3VAJA 2OTLS 1NJIT 2DHAA 1CPZA 4B3RF 1YJRA 1H73A 1ZPVA 4K4YA 4OHYA 2HHXA 1SPBP 2DKOB 4JB8B 5KFFA 4KKOB 1WACA 1XIQA 1S6QA 1GEHA 3CJ3A 1N88A 1O51A 4CH1A 5THWA 3M8RA 1U2RA 1HBOA 1YJVA 1T3OA 3SBMA 3D67A 1S1TA 4I2PB 5GAGI 4LJMA 1JMTA 2R2UA 4LR8A 4P73A 4MFBB 3OQ2A 2M52A 4NCBA 1FK9A 1QDUB 1C0TA 5KFKA 4F4ZA 3ADAC 2KXNB 3M1VB 2CFXA 2FHJD 2AX1A 5M2RA 5A0YA 2CJQA 2VFVA 1Q7LB 4F50A 3V2UC 1XMQJ 4PG4A 4ID8A 4IO9Q 2UVVA 4FVCA 2CRLA 2GC8A 1C4AA 4TYAA 4RW8A 5DDOC 3K5NA 3DM2A 3DRPA 4DF4A 3GQCA 5DQIA 4MKVA 4O44B 2YWGA 1Z2ZA 1KTQA 3MPDA 1CS4B 5FIIA 5IT4A 3MZIA 2UU9J 2K7KA 4AD6A 1JXLA 3ZZOA 2DR8A 2VBZA 3SV3A 1RBLA 4I56A 4DWIA 1S1XA 4LBPA 1LV5A 2BQ3A 4A8XA 4H4KC 4QYZK 4RO0A 3DCAA 2W1BA 1JNRB 2B4VA 1PJ7A 4RUHA 1C1CB 2EVZA 3O5TB 3V6DB 4ELUA 2RNEA 5LT5A 2BUNA 3T19A 3BDPA 1UEUA 2W9BA 4KH1B 3F41A 2R8KA 3KG4A 4LFBJ 1HD0A 4Y2KA 4OHVA 4IG3B 3FQLA 1M5PC 3JSMB 3C66A 3G6ES 4KGKA 3GJTB 2UVUA 3PEJA 2HHVA 2ZOMA 3W9IA 2XYPB 4O3SA 2HHUA 3OUYB 2HFSA 1KHWA 3OHBA 4NOHA 3SDEB 3OTBA 2ATCB 3QT6A 1FWLA 3Q83A 1JLGB 4QIGA 4DS4A 5LXRA 2NXNA 1KVJA 2HBRB 3VZHA 1ZM3A 3M2VB 1LK7A 4DQQA 4PYDA 4EZ6A 2IMOA 1PILA 2PMHA 1SV5B 2M88A 2L41A 3RAQA 2KRRA 4OYXA 3M30A 1VRTB 4DSJA 1WHYA 5GVQA 4P10A 4MK8A 1S6PA 2HVHA 1CSJA 3NXZA 1RTIB 4AL6A 1WC4A 2YNHB 3H5SA 3PYFA 3J7YU 2Q6BA 4ZPVR 3W60A 1HQEB 4ZP6A 1FXLA 1IBMJ 1CJKA 4DOZA 2VG7A 7AT1B 1KQKA 2EKYA 5DM7Q 3MURP 3OJSA 2XI2A 1FJCA 1ROFA 1WF0A 2YNIB 3BPSP 4ITSA 4QW9A 4OHWA 5EGYA 2KTQA 2DGTA 1R0AB 1WWHA 1XERA 2GNKA 4Z37A 5IM0B 3L3CA 2BV3A 2LP4A 2IA0A 1T11A 3MECA 4J9MA 1M5VC 4JV5F 2AGPA 2F8MA 1V6HA 2M2BA 1YWXA 4IFVB 4Q7AA 4ECVA 2AMCB 3R5BA 1DFDA 5CYQB 3IAS9 2DNGA 3TVKA 2A3JA 3GIRA 2Y8WA 1WORA 2CQ4A 1U09A 1G2EA 2PMWA 3P5BP 1GXLA 2CG4A 3Q2TC 2XQCA 4PKDB 2WB1D 1NH8A 4PWUA 5CH7B 4OYMA 4X84A 4CLUA 3WQPA 4DL2A 5I42A 2UXCJ 3I87A 5T7LB 1TTHB 5KT3A 3POTA 2BACA 5DM6Q 4IRCA 1DY3A 5KOWA 2W2OP 3VVUA 5EDWA 1S0MA 1EHWA 3OT9A 5J2PB 3GPAA 5GAEI 2JEIA 2RMLA 1H3DA 2MSSA 4DR6F 4J9LA 3MF5A 2IAJB 2W9CA 1RWMB 2OSRA 2JVRA 4OHZA 1U2FA 1WHWA 3QJJA 3KHRA 2EC0A 3HDSA 5EN1A 3OXFA 2VQFF 2C2RA 5D3GA 4A8WA 1KNZA 2CA9A 3LP2A 3IMQJ 8RUCA 5LSRA 2O01C 5CHCB 3CJ2A 1N0UA 3P8BB 4YR2A 1RWUA 2RAQA 3BS9A 2QN6B 2ZWPA 3M8ZA 3RBDA 1G1XA 5GMDA 3KFWX 3D5MA 5D78A 4K50A 1TKZA 1Q79A 2VDHA 3K5LA 2DB1A 4X65F 1Y5IB 1BQMB 2BRLA 5KFBA 3BGRB 2PFFB 2AJ2A 3SSSA 4DR7J 1HLWA 5KT7A 3VAMA 2OGUA 2CVEA 5DZ6A 2E5LJ 5KT5A 1OPZA 4WKRA 2ZH1A 2BRKA 1U2CA 3BPDA 4FS1A 4TU9A 3VVTA 3FBFA 4UOHA 2IM0A 4K5RA 3RAMA 4ZVHA 4EI2A 2D3UA 3QGPA 2DJWA 4FNHA 3MMJA 3IR7B 2NXEA 5DLGA 2MKIA 1QAXA
chains in the Genus database with same CATH topology
5L9NA 2K1RA 3N0VA 1ZETA 1HBUA 1SJFA 4KO0B 2B6AB 3IRWP 2R8HA 1E6VB 1X4AA 4KE5A 4C8NA 2J9CA 4RW4A 3SQGA 4C0BA 1Y5NB 2LQBA 3TQ1A 2P6TA 3D2WA 1U8SA 2QLXA 3QIPB 3ZZ0A 2W9BB 2ZH6A 3V4IB 1RTDB 4J5OA 2Y1IA 5HN0A 2F7VA 5CYJA 3KK3B 4ALZA 4TLRA 3DU6A 3HLUA 2AJ0A 4NLYA 3ETOA 2ALZA 5B7WA 1JJHA 2CPFA 2VPZB 3MXHP 3I0SA 2MDAA 4ZLPA 1MW7A 1JK9B 2ZOFA 3BGFA 2B9XA 3DFEA 2FHKA 3TO8A 3CMES 1YJ9S 3KKFA 1VJWA 2QFJA 2CQIA 1H38A 1HNIA 4DLGA 4B9MA 2K7JA 3LGMA 5A8KB 1Y7PA 4WXWA 5KFLA 1TKXB 2DGWA 1HWIA 4YQWA 4M95A 2KKHA 3IWLA 2ASDA 1QJHA 4G1PA 2M8HA 2QSWA 3OW2R 2IYIA 3G71S 4DL5A 3FEZA 4ZOSA 2EFQA 1Y3JA 3Q0AA 5JVHQ 2R8JA 4WYLA 5F41A 1O5JA 4PQUA 2DH9A 4DPOA 2ADCA 3M6WA 1XWLA 4DX8H 2XGQA 4C11A 4JI3F 2YVSA 5L9XA 1FD2A 3EGWB 2AJ4A 2UUWA 4I1TA 2IVMA 5AXMA 1DARA 2PN6A 3ICLA 3T9ZA 4J9SA 3NKYA 5KFSA 1LQ9A 3PW4A 3GYNA 2C28A 1D9FA 5HP1B 3PIPQ 3CJKA 1YQHA 1KSPA 1SUQA 4WK1A 2BJEA 2O66A 2QMWA 4EGLA 2XS5A 1SJ4P 4ICLA 5M2UA 4RBUA 1HR0F 2Y1RI 3DOLB 3HZGA 3ISZA 3QWPA 4IG0A 4MTPA 3M8PA 1HARA 1HL6A 3NP5A 4B9NA 4KAIA 1FKPA 3IBWA 4JI6F 3SZ2A 3G8TA 1TP7A 3IO1A 3MM7B 3FSIA 2CJAA 3PJWA 3DXSX 1X5SA 4AL7A 1X8DA 4LF8F 5DLFA 2DNMA 4BCAA 2PA3A 3MMBB 3TOQA 3KHHA 4JV2A 3M9MB 1RTHB 5CZVA 1FKOA 1NK0A 2PI5A 1MU2A 1C0UA 1VIOA 3QWUA 3VR1A 2WSFC 5KG5A 3BQ0A 4NLQA 1M1KT 4QWAA 2CQGA 2PDAA 5B0EA 1B0TA 2PMZD 1S6UA 3BGLA 4C98A 2HNZA 5HL7Q 1GNKA 3CDWA 4HEA9 2JVOA 2AP6A 2YKQA 3JSYA 3KLIA 2D9PA 3I9ZA 4HKQA 2A1BA 3LGNA 5IQQA 2XMTA 4B08A 2YNGB 1WTBA 4RNOA 1C1BA 3FFIA 4OMFG 1WD6A 3CIZA 3H5UA 3V6HA 4DG1B 4DR3F 1NB7A 2R8GA 2P9GA 2VFTA 4ZVEA 1CLFA 4K4WA 4C9DA 4XPEA 3M9NB 1H2UX 4K4SA 4ECZA 1S6PB 2I8EA 5H9EJ 1HYSA 4IDKB 1TR0A 3HHLD 1FEEA 3PO5A 4P6QA 2FJWA 3DYAA 4ILRA 1HPZB 4NCAA 2OPQA 3D28A 4UUXA 2R2SA 1U1OA 3H2LA 4USIA 3TA2A 5HO4A 3VAFA 1KTVA 1Q82T 2LLZA 2EFVA 3MEEA 1JJ4A 1QSSA 3PEHA 1UWBA 1VRUA 1YRUA 1RGVA 1FD8A 3V6KA 5FJ4A 2J0XA 3OL8A 2F4VF 2Z8QA 3N6LA 2APOA 2O1PA 1IKWB 2KFNA 3QO9A 3TW0A 3UDCA 3OPKA 2Q6CA 2NPIA 3N6NA 4EEYA 5CD4H 4IH7A 2DNNA 3LH2S 1RTJA 5DRKA 1FT8A 3BB5A 3W2WB 3HVRA 2HHSA 2YKMB 3MUMP 2XMJA 2MZTA 4WKYA 1T05A 1NHVA 5J2MA 2Q79A 4DV0F 1DRZA 3S01A 2VC1A 4UW2A 1VQLS 4KHRA 2MPUA 3M8QB 1Q78A 4OZ0A 4A8MP 4NWBA 3UPFA 4IO1A 2KFZA 5EHHA 4J9RA 2L08A 3KTQA 2AJQA 4XDCA 2O67A 4XDDA 1NZAA 3T6BA 3CE8A 4O23A 2W4CA 1B64A 5E3CA 2ZUGA 4M63A 1K8AT 2CJBA 1D1UA 4DN0A 1S9GA 1PGZA 4OI6A 4RLEA 5HBMA 5KG4A 2R7SA 3Q2SC 1LWCB 1S79A 4DSLA 4C3LA 2J6SA 3CULA 4J9NA 2AYGA 3P96A 2V4RA 5KTQA 4FS2A 5HMWA 2DR7A 3KHLA 2X1AA 4TU7A 1LWEA 1Y3KA 1OQ6A 2XB2D 2B7CB 1JLAB 4BWMA 1MMDA 4NLRA 4ES3A 2ZC4A 4NPOA 2MQQA 4Q0BA 1CVJA 1TUVA 4RWXA 3NNHA 3MM5A 4B3OA 3CCZA 1OSDA 1UP1A 4QBUA 4ZPAA 1Y4ZB 4M94A 5I3UA 2YH1A 4W90B 2BE2A 3DMJB 2HYIB 1A6LA 4H4KA 3OLBA 1NKBA 5IZHA 4IR1A 5IT9Y 1TAQA 3CCRS 1IN0A 1P27B 2XCPA 2M3DA 1R27B 3U1LA 1WF2A 3WBZA 2M5YA 3NNCA 2XS2A 1F5BA 1L3KA 1FCAA 3MM6A 2OPSB 3IWXA 1U1MA 3LANA 4ZCIA 4K4XA 2YWEA 5M2PA 2RDIA 3DGPA 1LXJA 4A8YA 4ED2A 4IRDA 4NLVA 3M6UA 3BO2A 4DQRA 4LSNB 1HW9A 2IM1A 4NLOA 5F3ZA 3LP0A 1QSYA 2V4JA 2E1RA 3HFKA 4CO4A 4OJHA 4JI5F 4OLOA 2AGQA 2MJNA 3MM9A 2WW8A 4P2SA 3VQSA 3H20A 4CI0B 1TFWA 5F9LA 2ROPA 2FIUA 5KT4A 4Q43A 4HHJA 4QR2A 3Q24A 2JC1A 5L39A 4F8RA 2XS7A 2VBXA 5F8IA 1VQYA 1SJ1A 2DO0A 3P6YC 2B4UA 3FEXB 1V3ZA 4ECXA 3RTVA 5FD1A 1SL0A 2AYMA 2C3OA 1MSWD 2ZFHA 1N5VA 3O3LA 4CQ1A 3S8SA 1D9AA 1N34F 2VPWB 4EO6A 2MJUA 4NA1A 2LQ5A 3UD3P 2NUUG 4D3HA 1Z2LA 3NCRA 3U1MA 4C0OC 2XCAA 2RT3A 1WHVA 3SCIE 1M90T 1RT3B 3BN4A 5F8LA 3PO4A 2KHCA 4CH0S 3DLGA 2W7OA 3S6EA 2HG4A 1TKTA 1RAJA 3DRYA 4DDFA 2OMLA 5C24B 1YIJS 4NZ6A 1LFWA 2FHJA 2HRYA 2X1GA 4KFBB 3OV7A 3P49B 3JSRA 4LQ9A 1FTCA 1ULRA 1V3RA 3AQPA 2E5JA 2LU1A 1RISA 2GV1A 4O4GA 2ACYA 4UY8T 4FXVA 1EETA 3GSDA 2MQNA 1JLFB 3HHLC 3GILA 2W9CB 4I0WA 4IRKA 3PFOA 1N5YA 2BYCA 2D3ZA 4R0JA 1VBYA 4YDDB 2GQ2A 1S72S 2Q66A 2DNLA 3G8QA 2WK4A 3HVTB 2GGPB 3LAMA 3RZAA 1OPIA 2DH7A 3P3DA 3TAMA 3DLLQ 1VC5A 4E8UA 3CD7A 3PR5B 3MEGA 3PACA 3BO4A 1Q8LA 2XLJA 5L1KA 1SXLA 3H59A 4ZVFA 4F2RA 2MQPA 2RKIA 3DI6B 5LSOA 1OS5A 4C8OA 4RW7B 1M5SA 1H7XA 3BJYA 1A9NB 2LA4A 2HLUA 3EGNA 2VFUA 2BZ2A 3M1VA 4YFUA 1RKJA 3FGVA 3X1LB 4QU7A 4HT5A 2HHHF 3K58A 2WB4A 2YQ3A 4NRTA 2FUG9 2MY7A 4X64F 3CCSS 1FVQA 3AH6A 2DPIA 1HD1A 1ZZNA 5KFIA 2ZH7A 1T03A 2L3MA 2GJIA 4DL6A 3KLEA 2G4BA 4A8SA 1GXTA 1YG0A 1U4BA 1QE1B 2ZD1B 1KC8T 3NS5A 2JEGA 2DGUA 1XR5A 4QWEA 4IUFA 2F9JA 2J9DE 3R5AA 1JLCA 4ILLA 1CC8A 2XMUA 4I6WA 3H5YA 4NLUA 1X4EA 2RRAA 3W3SA 4KQZA 2N82B 4U67Q 4KV8B 3JTPA 4PRFA 1W2IA 1OWXA 2AF6A 2FC8A 3DOMA 5HI7A 3HKWA 2QO3A 1TL3A 3U02A 5DGBA 3JYTA 2WOMB 2HFZA 2LVWA 5E3QA 4DF8A 4B9TA 4DSKA 4OZJA 5F9NA 4ZCLA 4F4XA 1IXKA 2IJNA 1TK0A 2RDJA 1JLBB 4DL3A 2HS0A 3K8WA 4JI7F 2BVZA 2CQ0A 4U9RA 3LPYA 5HROA 3DLEA 4OFZA 4FNIA 3QMQA 4YY3F 1N0VC 1ZAXA 1JB0C 2HHTA 1R7IA 1TKZB 3NBPA 3OVSA 1IKVB 4AXJA 2VG6B 3EPIA 5GAEU 4Y34A 2XEXA 3GB0A 3L7PA 4K4TA 1X5OA 1W25A 2B4OA 4ILMA 4NYZA 2VKRA 2B9WA 4YP3A 3PVXA 4N41A 5BJRA 2GMJA 3EXCX 3MDFA 4X4QA 4CO0A 2NPFA 2I0XA 1XTZA 2WAQD 2XMWA 2IFXA 2Q3PA 5CQGA 3MCSA 1L3UA 5B09A 4NLPA 2VOOA 2JWNA 3MFHA 5L1LA 1U1NA 4LF9F 1XNQF 2J0WA 3DXBA 2MKJA 4I6YA 3BN7A 4XIUA 4RU9A 4DQPA 4B3SF 4NLTA 1HFEL 2MMYA 3D0IE 2XLIA 4RNFA 1WNEA 3KLFA 1VK3A 3J81Y 5EX3A 1JXEA 4M5DA 2DH8A 5F0UA 5EWFA 3V81B 2KT2A 5KFDA 3OL9A 2P9CA 3CDBA 2J5AA 1BQNB 1NJYA 1TV6B 3IG1B 5LMNF 1LWFB 2HMIB 1FXRA 1DLOA 3B8HA 4FVMA 4Y6IA 4FF4A 4MAKA 3RB6A 2X1BA 5D4PA 2E5LF 1QAJA 2DNOA 3UI3A 3B82A 1S77D 1F0XA 3MI7X 2VPXB 5D4NA 1U47A 1HBUB 1T7PA 1VI7A 2MKHA 2ZH8A 2JFKA 4X2BA 3HHNB 3LW5C 3V6DA 1S0OA 3MPYA 1ZAWA 4O3QA 5J1EA 5J2QA 3GIJA 4K4VA 2Z0GA 5E7OB 1Y5LB 2IBKA 5LL6d 1KN6A 4RX6A 2AQ4A 4YB6A 3DLJA 4LMZA 2ZHOA 1TVRA 4I69A 4DR1F 2LXFA 2YKAA 3I0SB 1AFIA 2AWZA 4NLSA 2ZJQQ 4RUAA 3I5BA 4NA3A 4XO0A 4G1QA 1KLMA 1HNIB 1V3SA 2DNZA 2WSCC 4MIBA 4WFAQ 2ASJA 1G7CB 1ZM4A 2NXUA 3BSCA 4OX6A 4ZP9A 2FLPA 4B02A 5MAOA 3OL7A 2OP5A 4HDHA 4ZHRA 3U1NA 5SZTA 3SV4A 4KHMA 3H5XA 5IFMA 1N36F 1S9EA 2NLWA 4WXOA 4PQUB 1XEZA 1FVSA 3PRBA 1FKAF 4LUBA 1FJEB 1IKYB 1DAXA 4WU3A 1HNXF 4MK9A 3CCQS 2ZITA 1KVIA 1NKEA 2OPPB 2XWXA 2ILYA 2BANA 3CCJS 2ZE2B 1WEZA 5EWEA 2KZMA 1CG2A 4E98A 4FZVA 4QYRA 5BYRA 3H2VE 1P1LA 3BSNA 3EXYA 4A8QA 3MPVA 2GHVC 4Y65A 1SUQB 1NH7A 3CXCR 1LFPA 2O3DA 1S1TB 2JHEA 2DR5A 2IM3A 2GIQA 2CPXA 1XR6A 4ZK7M 5CXTA 1HNZF 1A7GE 2BXJA 1FKPB 1Q1KA 5JXSA 3FRYA 4J9PA 2RJZA 1JLGA 1RI7A 5J2NA 1FK9B 2E1AA 1JLQA 3BM7A 1GAOA 3EX7B 4DL7A 3RRGA 2D41A 1M0SA 5EX0A 1WG4A 1X4GA 2DIUA 2DHSA 1FKOB 4Q45A 1Y9OA 3GG1A 1S9FA 2GMLA 2V9WA 4X4UA 1JJ2R 5IQ6A 2N4DA 4OX9F 3CCMS 4X62F 4L3NA 5FLXY 3M2VA 5A0YB 4OHXA 2ZBCA 4EYHB 3UR3C 1LW0B 1X0PA 1YRXA 3PJXA 4X66F 2IHR1 3N28A 4P7VA 1GT8A 2KHDA 3DHXA 3T1YF 1CQMA 1VQOS 2I5JB 4ECUA 1JLEA 3RRKA 3KWMA 1NAQA 4TYBA 2ZBIA 4X4OA 2IC3A 4JI1F 1TL1A 5GAHI 4LVOP 5J1NA 3NAHA 5BYQA 5I3QA 5LSLA 3C8YA 3HO1A 2YKNA 1C1BB 1SV5A 4MK7A 2E7WA 1GTEA 1ZOTA 1YHQS 4FYDA 3VZIA 2VFSA 1NEEA 4IKAA 4OJGA 4LT6A 4TQSA 2J6TA 2HQIA 1UJ6A 1N6QA 1ZH5A 3QZ7A 5DDQC 3I4PA 1R6YA 1VLYA 2MKSA 4ZPBA 2GX8A 5F8HA 3KHGA 1UEVA 2M0GB 4PG8A 2NZ4A 3WDOA 2BQUA 1HBMA 4J9OA 1FJGF 4WFYA 1P9QC 3DYAB 4OQJA 1SKWA 2OPQB 3EZUA 1M5KC 2XMMA 2HNDB 3FMBA 3MPWA 5KFMA 2QA4G 4KRWA 3VQTA 4HTIA 5E41A 4N76A 4M8LA 1XMQF 5AE3A 3H40A 2JDJA 1KFDA 1UWBB 1VRUB 5DDRC 4IR9A 4OJ1A 3TAPA 4U7UK 1RTIA 3OFHA 4H4MB 4CO3A 4OI2A 3QO9B 3HK2A 2D9OA 2DTJA 3AHPA 1JNZB 1UAWA 3LALA 3MD1A 5A8WA 4ES1A 2W7PA 1FRKA 4Q8FA 1SKRA 2AW0A 5LMUF 3SCJE 2M4MA 1RTJB 2POKA 1WEYA 3E01B 4RNNA 5D8HB 2MZRA 2CVIA 3JSBA 3OR1A 4B17A 2R7XA 4DQSA 4X4PA 2X1FA 1T05B 1O0PA 3HX9A 5J2MB 1MROA 4O3PA 1NRKA 2KDOA 3TX8A 3I6PA 1X4DA 2OIHA 1S1XB 3NLCA 4A4JA 5BR8F 2BM1A 4Q2LA 2QT7A 4CTAA 4CZCA 2RQCA 2XLKA 4JI8F 2RUGA 4PG6A 3TUIC 2Q43A 2DNKA 4WZQA 1S9GB 2MB0B 4V19J 5KG7A 4KHPF 3AJ2A 5KAKA 1N48A 2YH0A 4WE1B 1GTHA 1VBZA 1VQ5S 3MR5A 2UU9F 1AROP 4AQYF 4OV1A 1YJWS 4B3TF 1TKDA 4ED8A 4URSA 3EPGA 5L38A 5F8GA 3RW7A 4F3QA 3NNAA 4F02A 3D0HE 1P1TA 1LWEB 1G6BA 4H54A 1VOMA 2RB7A 2YNIA 5C42B 4WFXA 2HVIA 4ZVGA 2ILZA 2DO4A 4Q0BB 4P7TA 1J5EF 3MM5B 4B3OB 1Z1ZA 1FHTA 3ZZUA 4DV1F 3UCUP 2C3MA 3FDSA 3OTCA 2PGCA 4XAKA 1QAYA 3MEDA 3IN5A 3DLKA 4WFZA 4X4RA 2KYZA 5IM0A 2ZZMA 3OVBA 1DQ8A 3UE2A 3ZZRA 3RR7A 2RQ4A 2RSQA 3MD3A 2D3OR 3OL6A 2UV8G 2V4QA 5K14A 4DEZA 3MM6B 3NGDA 1VMBA 4EZ9A 2FHOB 1RP5A 3J80Y 4QR0A 5E0OA 3RBEA 4EU0A 1F5AA 5KFYA 4WIIA 2LQ9A 1H0HB 2OD4A 5CYQA 3EZ5A 2QEXS 3NMRA 3CCVS 2XY6A 1TL5A 3LP0B 2V4JB 4QQBA 2UXDF 3J7A1 1R3NA 5KFHA 1Q7YT 4F4KA 1BC6A 3A1YG 4FXWA 1U6ZA 4YHHF 1XNRF 3BR9A 2LEBA 4LF7F 2OAUA 1UVJA 2KI2A 1SH0A 1NK7A 3E3XA 1X0FA 4QIVA 2RF2A 5HLFB 4HLBA 1KD1T 3KG0A 5HMZA 4B9LA 4LFBF 1ZM9A 1VQKS 4NXNF 3O2IA 3LWLA 1F