1S99A

The structure and function of b. subtilis ykof gene product: ligand free protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
186
Chain Sequence
b'RIAGFRFSLYPMTDDFISVIKSALAATDTSKVWTKTDHISTVLRGSIDHVFDAAKAIYLHAANSEQHIVMNGTFSIGCPGDTQGDTYLDKRVNEDAVRGLKAEAPCQFALYPMNEPDYMGLIMEAVDIAKAQGTFVQGVHYASELDGDAHDVFSTLEAVFRMAEQQTNHITMTVNLSANSPSRKNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ykoF
publication title The Structure and Ligand Binding Properties of the B.subtilis YkoF Gene Product, a Member of a Novel Family of Thiamin/HMP-binding Proteins
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligand binding protein
total genus 50
structure length 186
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07615 Ykof YKOF-related Family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s99A02
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s99A01
1LXNA 1S99A 1S7HA 1SBRA 2EKYA 2EPIA 1VK8A 2IBOA 1LXJA 1YQHA
chains in the Genus database with same CATH superfamily
2NXJA 3EUNA 1DRZA 4CH0S 2CNOB 2QRRA 3GJQB 5IV3A 4FF1A 3OTOF 5FLXY 4IQMA 2IC3A 3O6QA 3WDOA 1YJVA 2VUGA 2WCXA 3DLGA 4LFAF 4IFYB 4XK8C 2HZCA 3DRSB 2D74B 5HQMA 4CTAA 1JKHA 1VJWA 4BWJA 3KUGA 3D3BJ 3RB6A 4X4TA 2JVOA 3JYTA 2KG1A 5DO2A 3QO9A 2E5JA 4EGLA 3QATA 1SIWB 3NGSA 1S12A 4JI3F 3OHAA 4DU8A 1A0OB 3H98A 3EXCX 4ILMA 3T19A 4M5DA 1Y3KA 3RG6A 2D69A 2F4VJ 2E5LJ 1N88A 1C1BB 2WRMA 5FD1A 4NRUA 1FX4A 2MZJA 2VC1A 4RW6A 3KLFA 5J1EA 2ZUGA 2Z0GA 4KHRA 4TYAA 4J7CA 2WW8A 4KRWA 1TMMA 3GLJA 1X0FA 3N01A 1B0TA 1ZAXA 4KC5A 5KFTA 1S59A 2NYIA 1TK5A 4P9SA 4DN0A 1B3TA 1TELA 2CIMA 4QWEA 2FJDB 1R8HA 2POKA 2BRKA 1J5OB 4YDXA 2ROEA 3W63A 4USTA 2W9BA 2PGCA 1HHSA 3JQMA 2BA9A 3FQKA 4DR6J 3NGKA 2PT0A 3MGJA 2ZBRA 5L9XA 2OTLS 3IP0A 4A46A 4LF5F 2IA0A 3BN4A 1MSWD 2GQQA 2PMZD 2V8GA 3MM5B 5GMKa 2WB4A 2V6AA 4N76A 3PV8A 3MXHP 5T7LB 1TL3B 3NGTA 3CIMA 4ANEA 4I67A 1NSPA 4YR2A 2HMIA 2W9AA 3PKMA 3UCZP 1XNRJ 3TNVA 4AE5A 5FLXU 4FNIA 1SKWA 2OTJS 2V69A 1JNZB 1KBRA 4QIFA 4DV6F 2XLJA 3KJNB 2Q66A 2QLBB 2Y8WA 4DS5A 1FNOA 3A8JA 1RHUB 2CQGA 2QGFB 3WQPA 2D41A 2XY5A 1U2CA 3PNIA 2DYAA 3HF5A 1RHMB 2ZH2A 3Q8VA 2Z8QA 4ITSA 2XB2D 1KRPA 1Q1KA 5GAGI 5D77A 1NK6A 3KMQA 2ERRA 4NLVA 2UU9J 1FJEB 2DPIA 1LWEA 3B54A 1OSDA 1RT7A 2YKNB 1UZDA 2K1RB 3EMTA 4F3MA 2DY9A 5B0BA 4OYAA 2FTRA 3H8YA 3W64A 1CC8A 3P49B 1GTEA 3OR1A 4QJVA 3VAGA 3QRPA 3TX0A 1S48A 4PKDB 2ZZNA 3MMAB 1S99A 1MMDA 3ZO7A 3LQVA 2XWXA 4PCQA 3GIRA 2V2KA 5J2QA 1TZ0A 4ES1A 1S1XA 1FNMA 3ISND 3GP9A 1T9WA 2GAHC 1NUEA 4ANDA 1IWAA 5AJ3J 2GJFA 1XQIA 2KFNA 3Q8QB 1SJQA 4IFYA 4OI2A 3DRSA 1KFSA 2L41A 4UF4A 3B82A 1DQ9A 2XGPA 3EZ5A 1VMBA 3J7AN 1IM6A 2GQCA 2P9GA 3AB4B 2RF2B 2J0XA 1ZA1B 1T11A 2DB1A 1NM2A 4X4UA 2AP6A 4G3IA 2CPIA 4JI6F 3FEXB 4B3MF 2W1BA 2KJVA 5L1IA 3ENVA 3OTDA 1C1BA 1IKXB 3CT9A 4ED2A 5KFHA 4H4KC 2VV5A 2BOAA 4LFBF 1X4EA 2CXEA 3EICA 1K0TA 4QPTA 4N5SA 3ZZOA 3FSIA 1RTIB 1FRIA 2FZCB 3QMQA 1FF2A 3VGSA 3FRYA 1VRTB 2X3GA 5IC4B 2MKKA 2HLUA 1UWBB 4JYAJ 3D28A 2AEFA 1T05B 1Q4RA 4NASA 3SEOA 3C15B 1JIHA 1YJUA 4P71A 4IYQA 4TY8B 1D3WA 2OKQA 3Q0AA 4EU0A 3CCRS 4RLEA 3K0JA 2DCLA 2DNMA 2CPHA 3GR1A 3FGVA 3MPUB 3NBPA 1IM4A 4WP9A 1K9MT 1FTCA 1Q53A 4OHZA 3MM5A 3EZUA 3FC9A 5IM0B 2F4FA 1DBDA 2JZ5A 5T7LA 1TL3A 1PGZA 3C6TB 2BEFA 2O5DA 1NJIT 4MJKA 3WC0A 3LWLA 2UUAF 4WK1A 2HG4A 2Z2ZA 4YQWA 3BR9A 2DT9A 5L39A 1YJNS 4J9MA 3I5CA 2NXUA 2CRLA 2ZM6F 4F2SA 1D9DA 3OSPA 3W9JA 1SJ1A 4ZVTB 3NOGA 3VAHA 3D3CJ 4RWWA 3PTWA 4OYXA 1KOHA 1LV5A 5KFZA 2MQMA 1H2UX 2ZJPQ 1U1KA 1GT8A 4ECRA 4O0NA 3OVBA 3I5AA 2YKNA 2K1RA 2BQRA 2I38A 3CDUA 4DQSA 4JI1J 2HNZB 1R31A 2OEKA 2YTCA 3CCTA 3MMAA 3AAWB 4MK8A 4TU9A 2HBRB 1Q7YT 3NMAA 4Y00A 4LR8A 2Q3PA 4B3RJ 1SI9A 3HFKA 2VONA 3NCPA 4DPXA 3N6LA 3G8SA 3EE3A 2FIUA 3CWJA 1QUPA 2RF2A 5EWGA 2GNKA 3M8YA 2W24A 2JEGA 4XPCA 5H9FJ 3FBCA 3PDNA 1VS3A 3GB0A 3L95X 2ZHBA 4RU2A 3PHEA 1IR0A 2OHDA 5BR8F 2J6TA 3MM8B 4DR4J 3CO9A 4BC9A 2DRDA 1FFGB 1ZAVA 1IKXA 2C2MB 4U9RA 1OSCA 4A48A 3BQ2A 5J2PB 5DM6Q 1RP5A 3KUEA 3TA1A 2EW9A 4OYWA 2RDJA 4C48A 1FD8A 3IR6B 2LKZA 1VRTA 1Y7PA 1VQ8S 2OEMA 1S49A 3SQGB 2J0WA 4KIAA 5FDLB 2KVIA 2QTWA 4DV4F 1UWBA 3K2YA 1R0BG 3PEHA 5CA5A 1T05A 3EDRB 3G6VA 3I9V9 2XLKA 4NXNF 5HN0A 2J9EA 1JLBB 2R7QA 3C15A 3PFEA 1GTHA 3PHTA 5IQQA 3FZBA 5KFQA 4TY8A 2CZVC 3F0NA 2IPOB 3S7RA 1X9MA 1M5PC 2KYXA 3BGRA 2RU3A 1SQEA 2M7SA 2Q43A 2VOPA 1W2IA 3AD9C 1UA1A 2HHTA 5IM0A 1REVA 4P74A 2X51A 1HI1A 2C42A 1S1UB 1P1TA 1VQKS 1UVJA 1TKZB 4J90A 2ZZTA 1FVQA 1NPKA 1PILA 3PRDA 4A8KA 2HHXA 2F63A 1K44A 3FRZA 3VWSA 3MHYA 4W4MA 3RRGA 3R6LB 5E3AA 3R2DJ 4WTYA 1H0HB 2Y0BB 2YQ1A 2JSXA 2G1DA 1X4HA 2YBVA 5JMNA 4FPRA 4OYMA 1RBLA 3GV7B 3MD3A 1UMJA 1FDBA 3L09A 1K8AT 5KFIA 3HZEA 4AXJA 3CXCR 3G8TA 2CG4A 2EC0A 5M2UA 2JLGA 2DK2A 3QT5A 2AZ1A 4QWCA 5IWAF 1HNIB 2D7SA 1CULB 4DV0F 4QW9A 2HNZA 3S8SA 3UWTA 1AUDA 3W9HA 4ILRA 2I0XA 2HGLA 2AKWB 8AT1B 4X4PA 2DHAA 4RX6A 4HACB 4NLWA 2YWKA 4NOHA 1NJXA 2G9OA 4TQSA 4GKKF 5KFEA 2CADA 4USKA 4K50A 4CNZA 3IM9A 2AT1B 3BO2A 4W90B 1YJTA 1RJJA 2Y1RI 1HNZF 4X64J 2HBYB 2OPPB 2BE2B 5HVFA 3PO4A 2RVJA 5A76A 1HPZB 3G9CA 5IT9Y 3MM8A 4D3GA 3JSMB 3GIKA 1I6JA 1VDHA 3EJMA 4USHA 3HK2A 3HVTB 3O2IA 2FZGB 3M30B 2DISA 4OZ3A 1JLQB 2AEJA 3Q89A 1ZM4A 4NWBA 5GMDA 1X4BA 1QVGR 3GQCA 2OAUA 3KNGA 4MIWA 3ZZZA 1R6VA 1NK0A 1O6XA 2L08A 3MTKA 4FYDA 1ZS6A 4F26A 3SQGA 3FMBA 4ELTA 2LP4A 5FDLA 1O0PA 4J9PA 3SI8A 2H5IB 3WIUA 2MHNA 2XSJB 1U1NA 4DV3F 3TAMA 4DV2F 1JLBA 2AYBA 2EFNA 3S01A 2DCUB 2H54B 4OLPA 4UY8T 4LSLB 2OEJA 2HQGA 4I64A 2DKOB 3HVWA 4DCPB 1FD2A 3K59A 5ETRA 5CYMB 4I6YA 4JI4F 3LA0A 4USWA 3VVUA 4KPYA 2R7UA 4F4WA 3RB3A 5EGYA 1QJHA 5ETOA 3MEEB 1S1UA 3FNNA 1SC4B 1TKZA 4URSA 4TN2A 5KTQA 3I0RB 2UUBJ 4O23A 4CZCA 4CRJA 1V5VA 2CPZA 4B9LA 2BJEA 1VQOS 3AJ1A 3RR7A 2OI2A 3DMJB 3PYEA 4P73A 5FIIA 2YKQA 4K2XA 1NDCA 3VGTA 5IZHA 1U47A 2J6UA 4JV0A 4PG5A 3TAQA 4TLQA 2CQ0A 2CVIA 3ELHA 1M90T 1I3OB 4Z7YA 3VF0B 4TYBA 1X4FA 3FBEA 1PJ6A 5GAHI 2VJUA 4HR2A 4G1PA 4EEYA 1PIEA 3GG1A 5DLFA 1HNIA 2V9WA 1WWHA 1CULA 3P4UB 5IT9U 1CJKB 3WHIA 1FRKA 3H4BA 2L9DA 1VLOA 2MQNA 1I94F 5KT3A 1IQZA 1OO0B 2ATCB 4HACA 4YOEA 4GO7X 2PI4A 2XYHB 1ELOA 4CNYA 1GMUA 4DR3J 5KFPA 4Q2MA 3PVXA 3R5JB 3X1LB 2B5JB 2BOPA 5F8MA 1KC8T 4OZ2A 3BQ0A 2AW0A 3RU0A 1VCTA 5HO4A 2BE2A 2KHCA 2ZH6A 2KFZA 4NPOA 2DBBA 4P2MA 2YNFB 2R7SA 1PKUA 4LSNB 4L72B 1JLEB 1HPZA 3W5YA 2FLOA 2QA1A 3JSMA 3CJ2A 2KL8A 3TO8A 3M2UB 3JTOA 3M30A 5L1LA 2ZITA 4LBIA 4OX9F 3HMJG 5KFUA 2HPUA 4YB7A 4WZMA 2O67A 4X4RA 2LDYA 3HXMA 4GKJF 2WZ1A 5LSLA 3VV2B 3H5YA 5C7PA 1HNXJ 4DF8A 3EXYA 3PX0A 4LFCJ 2XSJA 4DL6A 1WC3A 4PABA 1JLCB 1V3ZA 3ADAC 4ICLB 4LSLA 4QWDA 3IMQJ 4EMDA 2ZOGA 3I32A 3X3UA 2KB2A 2QC3A 3OBIA 4ZJOA 4DQQA 5KFMA 4F04B 2B7BB 1NBEB 2DNOA 2JJ4D 2NUUG 3UNYA 2XBPA 3FJ2A 3A3OB 2DEIA 3MEEA 4HVZA 4ATNA 1UA0A 1R7IA 2H65B 5THWA 3I0RA 1T9XA 1KQKA 2BKNA 4ZVFA 4XPEA 4JP8A 1IR2A 2ZUAA 1WOSA 1ICEB 3TJAA 3DMJA 4ZP9A 5LSOA 1LWFB 4XIUA 2R8GA 3DLKB 2ZZMA 5A8KB 1FRJA 2NXNA 1PYSB 2V63A 2RHSB 1Q8BA 1OMSA 2APOA 2KM8C 2LFVA 1OY9A 2P8IA 3N79A 3M8PB 3H5SA 4LF9F 3F41A 1FRLA 4F3QA 3BEGB 1V9OA 1V3SA 3DOKB 2CPDA 4DZDA 2YPZA 5L1JA 4NLYA 3K8VA 2FQQB 1CJKA 4DV1J 1NNDA 1KR4A 1L3KA 2ACYA 4QU7A 3VALA 4AUKA 2OP5A 1FRHA 2P6SA 2JFKA 2HYIB 5D4NA 1HR0J 2RQKA 3RUBL 3BF4A 2Z2LA 1RAAB 2FC9A 4BBYA 3ICLA 2A10A 3VAFA 1U02A 2YNHB 4OZ1A 4O3OA 1JWWA 2CQDA 4NLSA 3CC2S 2B7CB 4NYPA 2K7KA 4ZVUB 3EX7B 1S9GB 1U48A 2E44A 1WSRA 4N77A 2B5JA 2ZBPA 5KFBA 1NK9A 4O0IA 4F4YA 1U0HB 3CCZA 4A8WA 3MDFA 4PEOA 1N5TA 5HP1B 3U1NA 2K3KA 2WBMA 4OI6A 4B3TJ 1CJUA 1IBMF 1Y4ZB 2YNFA 3ILOA 4LSNA 3QJJA 4M5GA 2JC1A 1JLEA 4UTGA 2IFXA 1RT1B 1ZM2A 1HMVB 2FPHX 1U6BA 3M2VA 1LWXA 4M95A 3H4DA 3A3NB 1AXQA 1RTJB 3M2UA 4I7FA 1GFWB 2EFOA 3V6HA 2BE9B 2Z57B 2VA2A 3J7YI 4Q2LA 5DQIA 5B7WA 4J9SA 1NSKL 2CJXB 3SV4A 3DC2A 3K58A 2F7VA 1KLMB 2YPYA 4LRCA 4WK3A 4F4ZA 2IYGA 4KPCA 5EX3A 1VBXA 4J9KA 2VFVA 1M1HA 5U47A 3GE9A 2V2QA 3VHQA 2MLXA 3CJ0A 1S72S 3U02A 1WF1A 1ZM9A 4ICLA 1KTQA 1LQ9A 1WJ9A 3V6DB 5BXIA 1YG0A 3R7NB 2K3IA 2EK6A 1N48A 2HIYA 2V94A 4GVBA 4JI8F 1LK7A 1XERA 3M8RA 4CO3A 2ZNZA 1X9WA 2QFIA 3NOCA 3VCDA 1U2RA 2DVIA 3HHLB 1X5SA 3G2XA 2FLLA 3A12A 2OSQA 2HVIA 2E9RX 2VF3A 1XBWA 3KLVA 5KT6A 2JEFA 1FFSB 2DNLA 2HQ3A 3DLBA 1LWFA 2JWNA 4J9VA 1G6BA 3DLKA 4NLXA 1W2BR 4DZ6A 5A8KA 3I0SB 5T41A 1KSPA 5KFXA 1KD1T 2XMUA 2MQ8A 1S4EA 1FK9B 3T1HJ 1D9AA 2M9KA 4F0MA 2HS3A 3M8PA 3RB0A 5HROB 1VQ9S 5A6WA 2GW8A 5LMUJ 3UE2A 3NNAA 3WX4A 1C2PA 1MN9A 4PRFA 4B02A 4DXLA 2WSEC 1QVFR 1QUVA 2FGCA 2QLFB 4FKYA 1SKUB 1NHVA 4O44B 4O3SA 1N4LA 4ZVHA 4JI2F 1WHYA 2V4JB 2MY8A 3W3SA 5HSPA 5ETSA 3CJ3A 3IXQA 1RU2A 3PM9A 4PG7A 4YHHF 1N5YA 5CCMA 1KS2A 5KFCA 1R8AA 2BZ2A 3D1QA 2IRUA 3R5CA 1RTHB 2WTFA 1OQ3A 4M94A 2VDHA 2AQ4A 3GG0A 1X5TA 1BXNA 5D0EA 5KG7A 1S9GA 1GNKA 3RYLA 4RNNA 3GR0A 3IRWP 5F9LA 1OYDA 1YJ9S 2FVSA 5H9EK 1X4AA 3LO3A 5HP1A 4OJGA 1H73A 4HH1A 4OMFG 2RD5C 1RCOB 4EI2A 4KE5A 2EI5A 3GFXA 1PBAA 4DEZA 1HMVA 4AYBD 4PWDB 2X3DA 3LAMA 4K8RA 1RTJA 1HWKA 2LU1A 3PYFA 4P72A 2BJ1A 3Q23A 2IAJB 4I69A 4IO1A 1H74A 1L3UA 3OL8A 2V8HA 3RRHA 3NAHA 1Q5YA 3ILIA 2HFSA 1JXEA 1KLMA 3H25A 4DL4A 3RBZA 3SDEB 4DBQA 3PXGa 4EWTA 1T9TA 4FYWB 5CYQB 3HJFA 2F4VF 2EPIA 3KYLA 5DDPC 2E5LF 5ETTA 2VU5A 2PMWA 4RW8B 4FNHA 2U1AA 4DI6A 1TVRB 1SQGA 1F9HA 5RUBA 1NK4A 5AT1B 2PIIA 1RHRB 1NK8A 4IR1A 3T5KA 1UJ5A 3TUJC 3K5PA 1VRUB 2HHHJ 3V6DA 5F3TA 1SKSA 2KI2A 2Z2MA 2Y0SD 1KP6A 2FHMA 2VQFF 3L7UA 4FN5A 1XMOF 4DLEA 2XWYA 4H4MB 4JI5J 1ZETA 3HHLA 3DKDA 2PFFB 3AA8A 1RK8A 2ZEJA 3W60A 4ZLJA 2ILYA 1XEZA 4XO0A 1WG4A 2I1RA 4U7UD 2Y1LB 4DR6F 3MM7B 5KG6A 3TAPA 1UVKA 3W7BA 3MZIA 1VBZA 2OFHX 2ZKUA 5B0GA 3BZQA 3K17A 2QLJB 3I0SA 2PA8D 1C0TB 3T1YJ 1DLOB 1XK8A 3LALA 3OFFA 4EUVA 4Q8FA 1K47A 1WC5A 1FK9A 2YQ3A 1H7WA 3W2VB 2MYFA 3UDLA 3QIPB 1NDPA 1RWXB 4AXIA 3ISZA 4U8YA 3TARA 5HROA 3J7A1 1XNRF 3GJTB 4LMZA 1JXVA 1S0OA 3I4HX 2RMLA 4C3MA 2C22A 4DU7A 4F4XA 1OPIA 2IHR1 3FDSA 1PC4A 1JJHA 1WDDA 1FDDA 4YB1P 4ZCMA 4I56A 3NNHA 3J81U 4F50A 3VZIA 2OD4A 4RBVA 2XMKA 2V4JA 3RBDA 1KONA 3CCES 3QZ7A 1R43A 5C42A 6FD1A 3HSDA 1HLWA 4PWWA 3PW4A 1QTNB 2UU9F 2X1FA 3QFWA 2DNRA 3MEGB 4KSEB 3TQ1A 1X7VA 3NWGA 2R2SA 4ED1A 4B9VA 1RTHA 3HHNB 4FKXA 1ZOTA 4WU3A 1FJCA 4L3KA 3M6UA 3OL7A 3AJDA 4N7TA 4OHWA 2J9DA 4DPYA 2OPRB 5AXLA 3QRRA 5K8PA 1RHJB 3HHKA 4QYZJ 3OFHA 5LMNJ 5LXRA 3IGVA 2FC8A 2R2UA 2W2QP 1LW2B 4P2XA 2V68A 4NLRA 2HHPA 4HTIA 5AJ3F 2MXYA 3PRVA 2FJVA 1G2EA 3D0IE 1WUUA 4ZN3A 3G6XA 2DY1A 1XR5A 3A8IA 1RLDA 2XS5A 2IAJA 2DNHA 3QPIA 1B0VA 3ZNUA 1D1UA 1YJRA 1IBCB 4ZJQA 5A8WB 1ZZFA 3ENWA 3OTCA 1EQ0A 2VG5B 2FJBB 2ASYA 3SDEA 3EDQB 4ERDA 3EPGA 4BDPA 1R8PA 5CYQA 1IKWB 4OL8A 2DHSA 3R7BB 2HQFA 4RW8A 1TUVA 3S1TA 1FJGJ 2HURA 1Y3JA 2D3ZA 1FESA 5DG8A 4DFPA 3DGPB 1I1GA 2R8IA 2VIHA 3OPKA 4C8NA 2DGVA 1S9FA 4OJ1A 5CHCB 2R7XA 1GX6A 1R0CB 4KYZA 1EX8A 4HYKA 4JYAF 2VICA 1TK0A 4KGKA 4F67A 2KYZA 4FS2A 1TUWA 1RTZA 1S7HA 3M8ZA 4ZPTR 1T0TV 2CQPA 2ASDA 1TKXB 3MM7A 4C8ZA 4KHPJ 2MDAA 4ZIWA 4DR1J 1NJWA 4MIAA 3N6MA 3T6BA 1TL7B 4ELVA 1C0TA 3G82A 2G0CA 2F1FA 3IAS9 1Q8IA 3IA0A 1WG1A 3W2VA 4JI0J 2ZH5A 2E1MC 2DPJA 3QIPA 1CQMA 2AWZA 2C2NA 2DGWA 3J7Z5 1F3FA 5HBMB 3VZHA 4ETXA 2KXFA 1T03B 2GVDB 5KOWA 3GCWP 1W25A 3D7SB 2MSSA 5J2MB 3MR3A 1RCXB 3D6MB 2DHXA 2EFQA 1VRQC 3LP2B 1HD1A 4CLFA 2O01C 3KJQB 1FRMA 2HRTA 4XTTA 3BS9A 1YX2A 3CEDA 2BVZA 1SKRA 2DEJA 2QG9B 2UXBJ 1NH7A 2JFDA 2HSEB 3HM9A 3MEGA 3ILJA 3DU6A 1C4AA 4PXEA 3LGNA 4WPAA 4DX7A 2XI2A 3N28A 1XR7A 4JI1F 3CD5A 2OPRA 1QY7A 2YX1A 2MQOA 1X8DA 4UZCA 2GHPA 2V2VA 2XMAA 1U1QA 2MKJA 1RWOB 4HT5A 2EKNA 3QWPA 4RWXA 3BSAA 4F8RA 5M2PA 3KFWX 1EETB 2RDIA 2OH2A 1XNQJ 1BWEA 1S6PA 3PZPA 4OQJA 4B3RF 2B4UA 5DG7A 4R0JA 2JDJA 3T1AA 2ZWPA 4J9QA 1HWLA 3CGIA 4WXWA 1T94A 4OX8A 4CLUA 3PW5A 5M2RA 5DETA 4USVA 5LOQA 4K4SA 4LF4F 3QGPA 3AJ2A 1X4DA 4MT1A 3W9IA 5A8WA 3L9ZA 4Y65A 4DUYJ 2DR9A 3OL6A 2UUTA 2VG5A 4ZJLA 2OPSB 3M1VB 1VR6A 1HWJA 2HEKA 4DJBA 1HW9A 1WHWA 4ZN1A 3HHDA 2RJZA 3MCMA 4DR4F 1IKWA 3D54A 4P6QA 2QJ3A 2QN6B 5A2QY 4ZPBA 1AFIA 1FHTA 2NLWA 4HHHA 1XWLA 3DGPA 3EPIA 2H51B 2EKYA 2LEAA 3MR5A 5D0RA 1F3VA 4QYZK 2VG7B 3KG1A 1NEEA 2B9XA 3CJ4A 2QIFA 4Y28C 3N5FA 1WEXA 4AL7A 4NMXA 1RBOB 2ASLA 3M05A 3SSRA 5DG9A 1CC7A 1FT8A 1HBUA 5EDWA 4KGMA 3QIDA 3MPDA 4ZPWR 3KLHB 4ILLA 3G8QA 4LIRA 5LJ3Y 3CDBA 1TKXA 2ZOMA 1JNRB 4Y2AA 2HK3A 2Y1JA 5GMEA 2N3OA 3I9ZA 3OVAA 2FJXA 3KOAA 1Q86T 1TL7A 2F65A 4OX7A 3RR8A 3AD7C 1XMBA 5LM7E 4PYDA 2X1BA 2QLWA 1VQLS 4RUHA 5SUHA 4K5SA 2CNKB 3K57A 3HZGA 3DLHA 2R7RA 1DZ5A 2CJKA 1YHQS 5SZTA 5HBMA 2OMOA 4FYYB 3R9LA 2O66A 4DR2J 4ZCKA 1N8RT 1T03A 4DV7J 4P7TA 2GVDA 3PG9A 1N32J 1SIZA 3MD1A 5J2MA 2CQHA 3VAIA 5KFYA 5KG0A 1RWWB 1XTZA 4EFAC 4WWSA 3HFVA 4IRCA 2FVQA 2RQCA 1ZH5A 1KQFB 3NGDA 3GZ7A 1JJ4A 1VC6A 4DX6A 4FXDA 1RISA 2XZWA 1B0PA 3JSBA 5F8JA 3LW5C 2QL9B 4ER8A 2RUGA 2KJWA 3PRBA 2RS2A 2ZBQA 1YTYA 3BGFA 4DPOA 2RQMA 2MKYA 1P6TA 1UW4A 5A2QU 3KJVB 2DTJA 1UEUA 3ZZUA 4FF4A 2QT7A 1EETA 4JBCA 5HVHA 5ADZA 5IT4A 4PZVA 2PMHA 2QA4G 2BJ9A 4CDIA 2LXUA 3CCQS 4V19X 3KMSA 5DGAA 2V0NA 4QQBA 3P3DA 1LXJA 1HL6A 4DUZJ 1GH8A 1SCJB 2BM1A 2YKAA 3I96A 2AGQA 2P6TA 1RAEB 4U8VA 4PAAA 4X64F 2MZTA 3IS9A 1C4CA 4DPUA 3Q22A 3PYGA 2NZCA 1R6YA 2IJFA 2OPSA 2ZVIA 3M2RB 3OXLA 2LMIA 4GMKA 2FVRA 2MHEA 3D0HE 4CTAB 2VKRA 1U49A 5HJYA 2CPXA 1L3TA 1UEVA 2VPWB 4B3MJ 2HS0A 2YKPA 2HBQB 2B51A 3D9BA 4LF7J 4P2SA 5ETPA 1M0SA 3PY8A 3KLIB 2CPJA 1B7YB 2VG7A 1FX2A 4AFFA 2ZHAA 1HHQA 1N52B 2BXJA 3Q86A 2NPIA 2VBWA 2MLZA 1RYRA 4M5NA 5DGBA 5F8GA 4KAIA 2F9JA 3C6UB 4CM0A 1VFJA 1B4SA 3VAMA 3WBZA 4I6WA 2B8QA 4K5RA 4F25A 1Q8KA 4AL6A 2AYGA 5J1EB 1RKIA 1VC0A 2DR8A 4CM2A 4FYVB 4X4VA 2CNLB 4IG3B 1Y9OA 3AHPA 4C0OC 3BR8A 1HI0P 3AQOA 2FY8A 1YLXA 4WFBQ 2WVCA 3UN5A 4UUWA 2UUBF 3MM6B 3OLAA 4WE1B 3CIZA 3M9MB 1WHXA 4BC7A 1F5BA 1YBTA 1YZ7A 4IOCQ 5KAKA 3LP0A 2NUHA 3C16B 2ALYB 1C1CB 3PIOQ 2RIJA 5DZ7A 1H2TZ 2FDNA 4E98A 4CH1A 3DFEA 3FVYA 4FDFA 3MR2A 1IVZA 3KLGB 2AJQA 4C0HA 4A8QA 3ENQA 2XYPB 2MZ1A 5IFMA 4JI7F 3LP1B 5DDOC 5HK4A 2EG2A 1KVJA 3OTEA 1RWNB 2K06A 4DR5J 1MMNA 5C24B 3RJMB 4IR9A 2EC2A 1KFDA 1LKZA 2HWIA 2BACA 1NZ8A 1TAUA 4P75A 2BE7D 4GC6A 2R2RA 4NZ7A 1TL5A 3KJVA 5GAEU 3GTYX 1FCAA 5ETVA 2QMUB 1T3OA 2FHJA 4YR0A 2L9NA 4WFYA 3HJVA 1RT3B 4Y34A 2XQCA 2DNZA 2R42A 2W2MP 1FKAF 1LWEB 4DR3F 3HULA 1NKCA 2DITA 4RNHA 4YDDB 5K8NA 1W7WA 3CO0P 2DR6A 5T14A 4ECUA 2JEJA 3MECA 2W7OA 1SQFA 3F73A 3GMGA 3MPVA 2R7TA 5J2QB 3W5ZA 4UOGA 4DQIA 1S1XB 4PG8A 3QGHA 1S6OA 2MKIA 3G6ES 4HDGA 4LRAA 1X5OA 3M2RA 1Y5LB 2QYGA 1RQ0A 1JX4A 1VQYA 2W8KA 1SL1A 3LAKA 4X4OA 3BKFA 3B4DA 4L74A 1UP1A 4QW8A 3GIJA 5BR8J 3H42A 4PXBA 4KH0B 2XO6A 4OZ5A 2ASJA 2IDEA 5LXYA 3M8WA 2C2RA 1LWCB 3TRGA 1FEHA 3IWNC 2BV3A 3KLIA 3G87A 1MMLA 1T95A 1HNXF 4OV1A 1ZZNA 4LFCF 5KT2A 3HSZA 3DRXA 5L46A 1URNA 4C0BA 3TANA 3IWLA 3C6UA 3G4SS 1SH0A 2M70A 1SPBP 2FJEB 2HFNA 4OZNA 2V2ZA 3DNCA 2KZZA 3KHLA 5KG5A 3NY0A 2YY3A 4IG3A 1IBKJ 2DGUA 1V3RA 1TKTB 4NA3A 4KBIA 3DOMB 2RQ4A 4GO5X 1FJ7A 1RI7A 2WW4A 4TU8A 2ZC3A 3GSDA 3AY0A 3CCMS 1A9NB 4Y3CA 1A7GE 1GMVA 3MM6A 4ZP6A 1NSAA 4OJHA 2WVDA 1ULRA 2GAGC 1RAJA 1M5VC 3BH6B 2OPQB 3A1YG 1YIJS 5DQHA 4KTQA 4K4YA 4WE1A 4XDDA 1T9YA 4UY85 2XMTA 2VG6B 2A6OA 4CO0A 3NBPB 2VJVA 4ZVEA 3C16A 1OY8A 4URGA 2C28A 3GSIA 1YK9A 1FXDA 1C1CA 4LRFA 1AA1B 3PW2A 1V5IB 4U95A 3HI9A 4CO2A 4OZ0A 4JV5F 2V50A 3KLGA 2OSRA 1NXIA 4OI4A 4RPFA 4IRKA 1SV5B 4WBFA 2PFDA 3ETMA 4QR0A 2COLA 3QJLA 2DGXA 3LP1A 4RBUA 4LF8J 1UTAA 1U8SA 2DXDA 4QR1A 4KGVB 1NKEA 3SSSA 1JLFB 5F3ZA 2EFPA 5C24A 1Y5IB 4WJBA 4ZLNA 4DV1F 2B0GA 3TJ8A 4AL5A 2DR5A 1AZSB 4M5IA 1S9EB 3CUNA 2JRSA 4CLYA 3CDWA 3GILA 1YRUA 5J2NB 4YB5A 2QE5A 3W66A 5D78A 4TXSA 1S0MA 1RT3A 4O3QA 1NSQA 3Q8RB 2RUSA 2HIQA 2GMLA 1CJVB 4BWMA 1PAUB 3V4MA 2VOOA 2PN6A 2QMWA 2QYCA 2CUYA 2V34A 4NLTA 2R3VA 3VQTA 3IN5A 4I6AA 1JJ2R 2HS4A 3GYXB 3C8YA 4B3TF 5GADU 2IYIA 1DAXA 1U45A 2DHHA 2G1HA 3K89A 2FLPA 2VBZA 3R2CJ 1VQNS 4KQZA 1IBLJ 3FEZA 4KKOB 4QCLA 4DFJA 1B64A 2VQEJ 4OYIA 3GFZA 1VK3A 5CD4A 2VODA 2JNJA 1MWYA 1LWCA 3R27A 3N4WA 1RAGB 3FSYA 3W1YC 3IAM9 3BGLA 5KG3A 2Z30B 2KT3A 3UD3P 2W4CA 3BSCA 1EKRA 2EG1A 1SJRA 2G0JA 2R9LA 4IQXA 1RUSA 3M8SA 4ZOSA 1RWMB 2J7UA 2H1YA 3QRQA 1KVIA 1TK8A 3B8HA 1F6TA 3K5OA 4DV2J 2E1PA 1YJWS 2JLEA 1SH2A 1X0PA 2QX0A 3ZZ0A 3DDKA 1TKTA 1IR1A 1TL1B 5KFOA 2L9WA 4GRSA 4GC7A 2ZVSA 2IMOA 3DOMA 1RDRA 3EWGA 4RW9B 3A8KA 3PW7A 1ZPVA 3M8QB 2B9YA 2X1AA 3GJRB 3Q8SB 3TI0A 2OPQA 4IRDA 4QWBA 4RR5A 3BGRB 4X2BA 2VG6A 2YWEA 2J0SD 1K1QA 1FWLA 1X4CA 2M8DB 2CJ9A 2WVFA 2HHQA 3W8GA 1REVB 4HKQA 2EK1A 1EB0A 3R1HA 1B70B 3SSQA 1HFEL 2VFSA 3T1HF 1ZAWA 1RB0A 1TR0A 2VB6A 1SV5A 1VQ4S 4JB8B 1TQLA 5E5NA 4KY3A 3SQOP 5LMUF 5F8LA 2FD2A 1JLFA 3ZTOA 1RADB 1UL3A 1N36J 2Z4PA 5EUHA 3OVSA 1JJCB 3VGVA 4EYHB 1AZSA 1S9EA 2ZWOA 2D9PA 5C25B 2OIHA 4CLTA 4A8OA 2XO7A 5J2NA 2E5GA 4QZVB 1RT4A 3TEGA 4NA1A 5C2GA 2GFFA 3HHLC 2ZJQQ 3N5BA 1CJVA 3SMZA 1ITPA 1I94J 1S1WB 4FS1A 3IG1A 2G2ZA 2HGNA 7AT1B 3QT6A 2EXUA 3MR7A 1Q16B 4S0MA 3MWBA 3BPSP 1WSVA 1RGVA 3NS7B 2J7WA 2ROGA 2ZBCA 2O3DA 4EBEA 1X31C 3CDEA 4W92B 4HTJA 1VK8A 1OQ6A 3QNWB 2F8EX 4KKOA 1RAOA 4J9LA 1X60A 3EGNA 1UCNA 1QM9A 3AT1B 3I56S 1H3DA 5KG4A 2NR0A 2OGUA 4OFZA 1RE1B 7FDRA 3P8BB 4UUXA 1BQXA 2IJRA 5JXSA 1VQMS 2H4WB 1KHWA 3ZTSA 2HVHA 3HLUA 2V4QA 5ETKA 4TY9A 4K4TA 1MG7A 5IQ6A 2QSFA 3ITHB 2MKSA 2ABYA 1JMTA 1TL4A 5CABA 2VPXB 4NEYA 4YFUA 3H5XA 3NP5A 2UUCJ 1DTTB 3GJSB 2CQ2A 2MMYA 1TL1A 4XDCA 1HQUA 4C11B 3G71S 3RZAA 1XIQA 4RW9A 4DSKA 3TVYA 3IC1A 3TAMB 4DPWA 4JI5F 3M32A 2V8VA 2LU2A 1N33J 3M8QA 1TU0B 2XEXA 3KDNA 4OHVA 4A8FA 4AT1B 2LEPA 2B8PA 2C2DA 2HFZA 3QSIA 3I31A 3KUHA 4UW2A 3UCUP 4ENOA 4ZPVR 2VHGA 4RUAA 1DQ8A 4M5KA 3QT8A 1TUGB 4MK7A 5K5MA 3T1YF 3JB9k 4MYTA 1CQNA 1P1LA 2CDQA 1UVIA 1WG5A 2CKWA 1AFJA 5ITHA 1U24A 4DCJB 4AQYF 1WC0A 1QTMA 2KN4A 2A18A 3W8PA 4L3NA 4ZIVA 4DSJA 3OJUA 2HGMA 3UDVA 2ZE2B 4QOTA 1CPZA 5A0YB 1EZZB 1HWIA 4OZLA 3TUPA 2DHGA 4WIIA 4U7UK 4WCEQ 5C25A 2CPFA 2CPYA 4YY3F 2GJ2A 2H4YB 1BLUA 1UAWA 2M8HA 2GC8A 3B6BA 5E3QA 4ZK7M 3KNAA 2MGZA 2MKCA 4ED8A 2V5HG 1S1WA 2XMVA 3FMWA 3PX6A 1RA7A 1XC9A 2UV8G 4DCOB 5KFRA 2DXEA 3C66A 2QA2A 4DL2A 1M5OC 3FKBA 3QAUA 4NX9A 4RZRA 2LLZA 5J1PA 4BS2A 1LNQA 1H7XA 3ZXWA 2XCPA 3OFGA 1F9EB 4DX8H 1HWUA 4LF6J 2C2KB 2CQ1A 3AOAA 2ZC4A 2LECA 1VOMA 1MROB 1KDNA 2GQ2A 4E8UA 2D9OA 1SL0A 2HHUA 2BANA 1GAOA 5HMWA 4NLPA 3HHEA 2D3O1 4LR7A 1KN6A 3JXOA 1HBNB 1VC5A 4LUBA 2GIRA 3M6XA 5LJ5Y 4LF1A 1P27B 1P8GA 5CCLA 2OFGX 2I6WA 1FJGF 1NLKL 3KLEB 3ITHA 4I2QB 3KK1B 3OXFA 1RABB 2YVSA 3SFGA 2KU7A 3DGVA 1DTTA 3ONQA 3IRXA 4NCAA 1RWKB 4RO0A 4ECVA 4C11A 4USIA 5MAOA 2RNEA 4ES2A 4ED7A 5HMXA 4PXCA 3OUYB 1YVFA 2DIVA 1KLNA 3PJ9A 1CS4A 2W2NP 2MJUA 4F0KA 4KHPF 1OWXA 1YDLA 3OV7A 4DR1F 4PPZA 5D4PA 2L48A 1L3SA 3BBFA 1FI4A 5ETLA 3EVWA 3MOJB 1N5QA 3SYZA 2K2PA 3HSGA 1VQ7S 1S57A 4WXOA 4Q44A 1MWQA 4MKBA 3TA0A 2BRLA 1IKVB 2WB1D 2N7YA 4X66J 2VKZG 2WONB 2OMLA 4JI0F 3I6PA 1WHVA 2KRBA 3T3FA 3C14B 1VJQA 1FA0A 3T5LA 2AEMA 2IVFB 1Q82T 2ZE2A 3T9ZA 4OI3A 1RSCA 4K4ZA 4NA2A 3UD4P 1U1OA 5A0YA 2AZ3A 4LBHA 4U6PA 4FVMA 3ILLA 4IUFA 2GVZB 1KWMA 2GS8A 3PYDA 3I55S 1XR6A 3BGOP 1RACB 4YMEA 3D6TB 2UXBF 2LQ5A 5B09A 1IN0A 3P45B 4RU9A 2AMCB 3BBBA 2W9CA 3CB4A 3K7RA 2BBEA 2YX4A 4FYXB 5KOXA 1SL2A 2BQUA 1S76D 3L7PA 2J0QD 2KT5A 2IMWP 3Q8YA 2XS7A 4ZPAA 4LF2A 4LJMA 3PJXA 2KG0A 2N4DA 3VGUA 1XNQF 1ZYQA 4OLOA 3HCXA 1EKSA 2X7IA 1N5SA 3FBFA 1MROA 1RWPB 2LQ9A 4ZVGA 1Y0HA 3G6YA 3HX9A 2J76E 3Q2SC 5FJ4A 2Q1LA 1GEHA 1I51B 4Q45A 2H5JB 2NQPA 1NDKA 3PX4A 4O4GB 1RXOB 4YP3A 2NSBA 4E0DA 5CZXA 4L73A 3T6JA 4DUYF 4WFXA 1HBNA 1CJUB 3DLJA 2JOQA 1VI7A 2UVRA 2R7OA 2LQJA 3NLCA 3M2VB 5BYSA 1NJZA 4I7FB 1OJ4A 4F4KA 2Y9HA 3KLEA 2LA6A 4I2QA 1O51A 4EK2A 3KK1A 4CLLA 2PEBA 1UFLA 1LOUA 1J2VA 2LXIA 3CTRA 1KKHA 3DRPB 4IKAA 4DR7J 2AJFE 3DDNA 3PACA 3FCHA 2M4MA 2CFXA 2HQCA 2D3UA 2FHJD 5BJRA 3HT0A 3CC4S 5JVHQ 2KT2A 3HKZD 1VYAA 3FSXA 3R7SB 3EGVA 5CH7B 3NAIA 1M1KT 3IM8A 3OUYA 4NI2B 2ZNYA 1ZBTA 3MFHA 2VQFJ 3RW6A 1XMOJ 1Z2LA 2KO1A 2OUGA 2WK4A 2YX7A 1N5VA 5ETMA 4NLQA 3QBCA 3J7ZT 3UI3A 3MCSA 1HIYA 2EBEA 4IO9Q 3TZXA 4DS4A 3DYAB 4ECYA 4GVBB 1IKVA 2A3JA 1VLYA 2WONA 4M8LA 1AT1B 3DRRB 3A13A 1T8EA 2HW3A 2HHWA 2E1CA 3I82A 1REGX 1TKDA 2H5EA 4X65J 2QL5B 3C14A 4OYZA 2HQIA 2IDLA 2HNDB 2IM1A 4EZ6A 4DR2F 4DV7F 1OPZA 5H9EJ 1N32F 1Y5NB 2JEIA 2P5VA 5LSRA 3OSNA 1QSSA 2HHSA 4NMLA 4C8YA 4TLRA 2GVZA 3N0VA 2ILZA 1UEKA 1R0AB 2B4OA 3B78A 3C19A 4X62F 4FXWA 1FWKA 1YITS 4ETZA 3KTQA 2XNRA 1CLFA 1PJ5A 5CQGA 4QIGA 4ECQA 3IBFB 2XLIA 3TP2A 4MIBA 2IJNA 3DOLA 3CVKA 3D0GE 5D4LA 1HW8A 1IJFB 1QSYA 4C98A 2CG8A 4C6AA 4NL5A 4WYWA 3RGIA 2XCAA 3NG8A 1S97A 4K0KJ 5E2QA 3CCSS 1MW7A 2LYVA 4G65A 4RNFA 3BJYA 4KT0C 2LDIA 3ZTQA 5G4DA 4V1Ak 1N5YB 1QDUB 2XM3A 1HNWJ 1U2FA 1VBYA 1VHFA 3DI6B 4FVCA 1HQ2A 4M5MA 2KFYA 4I68A 3CJKB 4DUZF 4ZCLA 3IBWA 2MZRA 2P9CA 3TVZA 2XTJP 4CT9A 2QA4S 1L3VA 2GO9A 4O4GA 2NZ4A 3QJPA 1QAXA 2FYXA 5D4OA 4IH6A 3BV8A 1HBOB 3PJWA 4F02A 2UVWA 2FHOB 1J5EF 1NCLA 3UQSA 5LL6d 3ETOA 1ZA2B 4DL0C 4ECXA 4R5PB 1URRA 4DG1B 3NKYA 1FERA 3DDIA 3W62A 1WORA 3CPWR 2K7JA 4ZMMA 3M4XA 3AODA 2DNNA 3T5HA 1U26A 4OYBA 4OJ3A 1RBAA 3NGRA 1F5CA 5KFLA 1F2GA 4LF7F 3DRPA 2VL1A 2ATLA 3FEYB 3L7OA 3MAHA 4X4QA 4LT6A 2Y3YA 4J91A 1FE4A 3SBMA 4CLSA 3BKUA 2BUNA 4WTOB 5AE3A 1QLNA 2Q6CA 5KFNA 3OT9A 5B0FA 1RAFB 6AT1B 4NI2A 4KV8B 3ZC4A 2AJ1A 3P96A 3CD7A 1BC6A 4M1KA 2VA3A 2CJQA 1J5OA 4DSFA 3CMQA 5KFDA 4DV5J 2ADBA 3G96A 2HWHA 3UPFA 3DYAA 2XS2A 2HLTA 3GV8B 3IO1A 1HQEB 1N0VC 3DXBA 3TWZA 5E0OA 3ENAA 2IIHA 2D1CA 2RHQB 3CSKA 1OY6A 3MOZA 1RT5B 5K14B 4JUZA 3D6FB 4Y0FA 5K8OA 1CBKA 2KXHA 3DRRA 1X5PA 3BPDA 3CCUS 3HVAA 2YXLA 2C3OA 3TZYA 2R8JA 3HVRA 3GPAA 1F60B 1VQPS 1R8CA 2DH8A 1FRXA 3EZOA 1SXLA 3BREA 4CLWA 2DJWA 2HNDA 1LEOA 3C3LA 3RW7A 3OXGA 5E41A 2W7PA 2V8PA 2AV5A 1VQSA 1UVMA 3R1LA 2FLNA 1V6HA 2IRXA 2GMJA 3DHWC 2XY7A 3FUYA 3VVTA 3QWUA 1R0AA 2F5GA 3QT7A 2M88A 6FDRA 5F9NA 2DNPA 1UVLA 5E7OB 1ACMB 1ZTWA 1D8ZA 3ZZYA 3HP6A 4LSZB 4DR5F 3MM9B 3BDPA 1JK9B 1UZHA 3QSYB 1OYEA 5C2CA 4KH1B 3NEKA 1WC6A 4RL1A 5HMZA 1KEKA 5C42B 3E2EA 2YWHA 1FXRA 1SC3B 2AU0A 4ZP7A 3QFHA 1RHQB 4IH5A 3S6EA 1FVSA 1WACA 2OO4A 4WP3A 2OELA 3DI6A 5KT7A 3DLLQ 4ID5B 3V6JA 3CJKA 2GX8A 1W26A 3FQLA 3DCAA 1MU2B 3QGIA 1AROP 3V6KA 4DFMA 1YZ6A 4B17A 2I2YA 1AUSL 1HBOA 1SBRA 5CXTA 3THVA 1T9VA 3ISNC 2IA6A 4MAKA 3KHHA 2PD1A 3O8WA 4USMA 4LF4J 2UXCJ 3U27A 4R5PA 2HHVA 2E9ZA 4DG1A 5JJBA 4GVLA 4B9TA 1U1LA 3VR1A 3J81Y 2RDDA 2MZQA 1R27B 3LPEA 3HO1A 1GX5A 4TU7A 2RRAA 1PC5A 2DH9A 3EYZA 1UPMB 1YGYA 4ZLPA 2VD3A 2CVEA 4B3SJ 5ETQA 4KFBB 4RW4B 2B56A 1QAIA 2DNGA 3AOCA 5E3PA 2AYEA 5K9FA 1SJ3P 1H38A 1RTIA 3BDEA 3POTB 2PC6A 3MAQA 2HKEA 1U7LA 4KV8A 1H98A 4BLGA 3LANA 4J9RA 2RKIB 5D3GB 2WVEA 1S1TB 2KRRA 2BJ8A 2LQ8A 2FJAB 5KG2A 1IBKF 5GAGU 1AW0A 3NS6A 4NXMJ 2BJ7A 4PXDA 4CWBA 3D66A 3QLHB 3NWRA 4V19J 1HQEA 4YUDA 1PO6A 5B08A 3OL9A 4Y2IA 1EAYC 1RT5A 5K14A 3UD5A 4C8MA 3K5NA 4OIXA 1Z4UA 1Y10A 2CAJA 3CCWA 4PG4A 1NO8A 4C3KA 3C6TA 2PSZA 4F7VA 4UQTA 2G0IA 5L38A 2QSWA 4LVOP 4WU2A 3TUIC 1U4BA 4TVAB 3G82B 3PFOA 5EHHA 4N8OA 2FUG9 4CCHA 3R6GB 1DARA 4MH8A 2JVRA 5DZ6A 1DURA 1OS5A 4M63A 1KHVA 1O5JA 2AX0A 3Q2TC 1Q79A 4LF8F 4FBTA 2DGTA 2ZFHA 1BY9A 4ZVOB 3SCIE 3WX8A 3MM9A 1S5ZA 3HDSA 1TV6B 1ROFA 4D3HA 1NZAA 5AXKA 4CO1A 4ED5A 4K7QA 1S4FA 5IXUA 3CJ8A 1MLAA 2H9ZA 3PO5A 4HEA9 4ZITA 2GZOA 1WOPA 3W61A 3OJSA 2DRBA 4ED0A 4YS2A 2UUWA 3RAXA 3I87A 4ID5A 2V8DA 2PE8A 4IG0B 4YEAA 1NMEB 4EBCA 3ET6B 3JQJA 4JOUA 4P10A 2MJNA 1MU2A 2B43A 3VQSA 3UDEA 1M5KC 4CLKA 2PA3A 3OHBA 3DM2B 3C2PA 4OI0A 1BQNB 3KJFB 3O44A 4OYOA 2W01A 2G2YA 3FCWA 3R3TA 5C5JA 4U96A 1S6PB 1KQSR 1LFWA 3SCLE 4UOHA 2CWXA 4C7QA 4TKTA 4QWAA 1IBLF 2ZH4A 2JLFA 4KR0B 4IOBA 2RSQA 1RWUA 1FKOB 2VQEF 4ZVRB 4LVNP 4NZ0A 3IBCB 2J6SA 3N9UC 2GHVC 3R97A 4KFBA 2HNYB 4RW4A 1YJ7A 3BBCA 5J2PA 8ATCB 5BYRA 4ED3A 2SXLA 5HATA 3RAQA 2CQ3A 1NPPA 2JC0A 2BM0A 5KFKA 1TFYA 4AD6A 3VAJA 3POTA 4K2JA 4MKAA 1Q5VA 3V2UC 2KZMA 2UVVA 2CQCA 4USUA 4ZVPB 1IWGA 2RKIA 3MFIA 2WBRA 5D3GA 1DHMA 4C8KA 1S1TA 1KQGB 3DHXA 4ANCA 1N34J 3OFEA 3CJ5A 2ADCA 4LBPA 2HBZB 3QLHA 2QFJA 4ZVSB 2CYYA 2NYHA 1FXLA 2ACMA 2RH3A 1FNXH 1UJ4A 2HVEA 3KWMA 4FF3A 1HBUB 3RRKA 5BYQA 3U1LA 5E33A 4KO0B 3QYYA 2XMJA 3FCVA 4IH7A 5H9FK 5IC6B 4DQRA 5D0HA 1VQ5S 4BHQA 2GMHA 4CLZA 1M5HA 3H2LA 2MEWA 3KKFA 4CO5A 2HFVA 2N82B 1R89A 2UXDJ 4G1QB 1VIOA 2HRYA 1Q78A 3GCXP 1YSJA 4HH0A 1RKJA 3D5MA 3UCGA 5ETNA 3US5A 2GO8A 5DS7A 3E51A 1BHNA 4DUTA 4E2FB 3R8YA 1TV6A 1N36F 4JI7J 3AFGA 5HANA 1U6ZA 4K4WA 4MKYA 2MZSA 2R8KA 3D2WA 3R5DA 3BH7B 5EWFA 4EYIB 3UVJB 4URQU 1XMQJ 2F8MA 1KVKA 5D15A 3O3LA 4YR3A 2M0GB 2KKHA 2VBXA 4IG0A 1CEZA 4A8YA 3ET6A 5DLGA 4EZ9A 2AIRB 4YB6A 3OR2B 1U6FA 4NE9C 4OX6A 2ZDPA 4CI0B 3DM2A 1BQNA 3R5AA 1EARA 2HZVA 1LK5A 1Y00A 4B08A 2CPEA 1GMWA 4Q7AA 5F0WA 2AJ0A 1X4GA 3GFYA 2OPPA 2KH9A 2FVPA 3NL0A 1FKPB 2DNKA 3OTOJ 4P2FA 3M7VA 1Q0NA 2HFOA 1FKOA 1GQEA 1WEZA 2X1GA 5JVGQ 4MYUA 5MLCV 4LFAJ 4CH7A 4KHMA 4PUOB 2V4RA 3HVTA 5B0CA 2AX1A 2HVZA 3IS9B 2NCKL 2BX6A 1JLQA 2HNYA 5KFWA 4WF9Q 3VTIA 4ID8A 3MUVP 4PWUA 5DDRC 1M5SA 2BW2A 3NMRA 3BGUA 4JI3J 1NJYA 4C9DA 3TX8A 4O3RA 3V4IB 5KFAA 2XNQA 2KTQA 1SJFA 3NRBA 3AXMA 3A8EA 5AXMA 2UUCF 2DGOA 1Z2ZA 2VZ9A 3UDCA 5GAEI 2E7WA 1FTRA 1PBUA 5F41A 2AHOB 4RW7B 2O1PA 3GIIA 3JSYA 4FP9A 1BD6A 2YH0A 4Q43A 5EX0A 3TJ9A 3TVKA 3EGWB 2DO0A 4QIVA 3K5LA 2IY5B 5CYMA 3IR7B 4N41A 1N33F 1E6YB 4KO0A 2C2ZB 1U09A 3UR3C 3MCNA 1UW9A 5KT5A 2NSCA 2J8AA 2E29A 2C2EA 2N4CA 3D1OA 2UVUA 3T5JA 1Z1ZA 2J8SA 4HHJA 2BJDA 1RU1A 3BYRA 2UZAA 4NZ6A 1WNEA 2CZ4A 2G2OA 4LF5J 3BO3A 3KHGA 2E7XA 2RT3A 2IM2A 4G1QA 1PAEX 3OTBA 3LF0A 4I2PB 1CJTB 2YKMB 4ALZA 1PSDA 4JV5J 3AOBA 5E3RA 3LP0B 1SH3A 3GU0A 2F40A 4O3NA 2WSCC 5A8RB 2G13A 1RHKB 2RRBA 2AYMA 1P9YA 3BQ1A 2EEYA 2DXFA 4F4AA 5AE2A 2N3LA 2C3PA 1ZTTA 3BSNA 4DV6J 2KVQE 3UW1A 3THTA 1NRKA 5DM7Q 3D4JA 1XJWB 3UVJA 5HI7A 1WI8A 2FHKA 4NLGA 4FXVA 3MF5A 2FJWA 2XG8A 4HDHA 4WFAQ 4N47A 4WIQA 3MPYA 4N56A 1IUJA 3GWCA 1DY3A 3HT3A 1UWAA 2FB0A 3OR2A 2IRYA 1U25A 4NYZA 5LT5A 2A1BA 1QD1A 1PYOB 4RUCA 5I3QA 3TA2A 3N6NA 4TQRA 2YNIB 3T9NA 4LF6F 2VFTA 2I5JB 2A6MA 2CQ4A 4UOFA 3SFUA 2VFUA 5F8HA 1FKPA 3MEKA 5KFFA 3KK2B 2R7WA 2YNGB 5CYJA 4Y2KA 4HHUA 1U8WA 2CQBA 3VAKA 4PUOA 4X4SA 3MECB 3DU5A 4KJIA 1NK5A 1YRTA 5D6GA 1N54B 5F0UA 2BR0A 4ZA1A 3Q8PB 5I42B 1KOOA 2DNQA 2E5HA 5B0AA 4A47A 4IOAQ 2R4FA 2MQQA 3PW0A 3V4IA 4N8NA 4MTPA 3RB4A 5HVGA 2F9DA 4JI6J 3AB2B 3CCLS 2QL7B 2EFVA 5EWEA 1WTBA 1JLCA 1IKYB 2B4VA 4LQ3A 3SCJE 4RW7A 4LFBJ 5GAHU 4WKRA 2XC9A 3UFCX 3W2WB 1TMJA 3ZTPA 2W2OP 2G4BA 4JV2A 4FBUA 1IQTA 4DL3A 2ZH7A 3JTPA 1E6YA 2A2CA 4QIEA 4UZBA 3CE8A 2A0FB 1RWVB 2IM0A 2E1RA 2BABA 1N56A 1VHIA 5KFSA 1LXNA 5HL7Q 2UV8A 3AA9A 4YN3B 4K4UA 5GADI 3WZ0A 3WC2A 3IGNA 3CJTA 1S79A 1G1XA 2XULA 1Q81T 3MEDB 1D9FA 1DTQB 2DNYA 4X66F 4ECZA 4CIOA 4NLOA 2BYCA 2ZOFA 5KT4A 2P2CB 4K59A 3UO0A 2KXNB 4I2PA 3W65A 1CJTA 1FDNA 5KG1A 2BKOA 2GIFA 4L75A 2YKMA 3MMBB 5AE1A 2YQ0A 2YH1A 4QYRA 5K20B 3GFHA 5A8RA 2UUAJ 2FY1A 1MN7A 1AB8A 4M5LA 1QAJA 4OHXA 2ZM6J 2XYGB 3DOKA 3O5TB 3H2UB 3BYPA 2EFGA 4K4VA 3NGUA 3EVMA 3M9NB 2MLYA 5DDQC 4ZP8A 4NCBA 1PYTA 3CC7S 1D09B 3CJSA 2HVDA 2C3MA 4L76A 4L6V3 1S77D 4H4KA 2E66A 1UETA 2E9TA 3FZ2A 3P6YC 1SC6A 2HAIA 2Y1IA 2YNHA 2DR7A 2E1AA 3CD0A 3SV3A 4U67Q 4F2RA 4ECWA 1WOOA 1CVJA 2IBOA 2YNIA 3C46A 3AQPA 2I5JA 1RYSA 4Z7CA 1WELA 1U0HA 3A4TA 1BGXT 2DD8S 3KK3B 4RNMA 4P52A 1QE1B 4KGZB 3D1HA 1SC1B 3KK2A 2YNGA 4ZDNA 4WZQA 1KNZA 3FK4A 4C2MA 3GYGA 1RT1A 2DRAA 1HNVB 3QGGA 4FZVA 2LVWA 4J9UE 3KXDA 4DMZA 1F2HA 3D67A 3TEHB 1WC1A 2U2FA 5I42A 1RAHB 1NK7A 1PJ7A 4UQGA 2VC0A 2BMBA 3OQ2A 1DFDA 5CZVA 1MNEA 3MMJA 3UR0A 3D68A 1TFWA 4NCGB 2C3YA 3DN9A 2XMMA 2XHCA 4FF2A 3J80Y 3AD8C 4CO4A 2HWTA 4B3OB 1Y11A 2VPZB 4DR7F 1IKYA 5EN1A 2HFUA 1P9QC 2FGOA 1JQGA 5HQ8A 4HI1A 4R0EA 3V5RA 1DJ0A 3E8OA 2DH7A 1UFKA 2Q79A 2F3JA 3W2WA 1YRXA 4MK9A 1T02A 2NS1B 1F1BB 1S0VA 4OV6A 2AGOA 1RTDB 3IR5B 2B9WA 3CF5Q 5D8HB 4DV4J 4NRTA 4NXNJ 1AYEA 4A8SA 2KHDA 2IBKA 2VH7A 1VISA 1NKBA 1BUXA 5CAAA 4DLGA 3MEDA 2HK2A 1Q7LB 3H20A 4J37A 1DTQA 1HKAA 2GCFA 1I5OB 4WFNQ 2A2DA 3NCQA 2XI3A 9ATCB 2VPYB 1M1GA 3ZNJ1 4ZPDA 4X65F 2MPUA 4HL9A 1JLGB 4NYOA 3MMBA 4F3OA 1JXLA 1YBAA 1S10A 3Q8UA 2CDRB 3JQKA 3THPA 1VIXA 3H40A 2QLXA 1WD6A 4AQYJ 3U7JA 3RAMA 1UVNA 4R25A 3BKTA 4ED6A 1E6VB 2AGPA 2XZDB 4J5OA 5HLFB 3T41A 4O44A 4C3LA 1QAYA 3J7YU 2ZH9A 1GXLA 4C8LA 3JAMY 4NLUA 1NB2A 4ELUA 5GVQA 5I3UB 4DF4A 1JLAB 3CNQP 4G1IA 1QSLA 4YY3J 4PR6A 3L4BC 3PEJA 5IWAJ 3HD2A 1NDLA 2WSFC 3MI7X 4JV1A 2RB7A 3ZFVA 4CLPA 4K0KF 3HHLD 3JTNA 2RE1A 1HR0F 3GYNA 4CP5A 3TOQA 3CMES 4DV0J 3J80U 2ZH1A 1WKJA 4IFVB 1WF2A 4RBTA 3CJQA 2CQIA 3M6VA 3KK3A 1HNWF 3LPYA 1RT4B 4X84A 2WOMB 1QE1A 3MMCB 4K4XA 1YBUA 2GV1A 4WYLA 7FD1A 3IG1B 2Q6BA 4DQPA 3IFEA 3AXKA 3TW0A 4ZHRB 4KGXB 1CG2A 1NH8A 2PDAA 1HNVA 1YI2S 4PWDA 5I4MA 4PQUB 2ZDOA 2AJ2A 2MTLA 4M5HA 1YQHA 4GKKJ 4I0WA 1TTHB 3TZZA 3QZ8A 4B9MA 3H2VE 3R5BA 2JX2A 1HA1A 4PPDA 5F8NA 3HFZB 2E7VA 2VDIA 4Y6IA 1HNZJ 1LFPA 3U1MA 1TAQA 1T3NA 1UPPA 4O4RA 1K1SA 4LRBA 2BDPA 1A6LA 1FE0A 4WKYA 3PIPQ 3PR4A 3HD1A 4NCGA 5KFJA 3BM7A 1H6KX 1R8BA 4H4OB 5DRKA 2I9SA 4XAKA 3RTVA 2MKHA 4DFKA 4B3OA 2AD9A 1TVRA 4EBDA 4A8MP 4F0HA 2PI5A 2FZKB 2R2TA 3TYTA 2NREA 1G3OA 3LWMA 4C97A 4RKUC 3MUTP 1BMQB 1VRUA 1RTDA 1VQ6S 1U0SA 3QQCD 1WF0A 4OZJA 3UN3A 4DV3J 1U1RA 3ZZPA 4HI2A 2C2OB 4H4MA 5G0RB 5KFGA 1IJEB 1X9SA 2HZAA 4DV5F 3OW2R 4IDKB 3CDAA 1GXTA 2M2BA 3JAMU 2GA7A 8RUCA 1HBMB 1HQUB 5D0GA 2M52A 3M9OB 2QO3A 3EGZA 4QPXA 4ZKAA 3M32B 5DQGA 1EQMA 3MTJA 2PEHA 4JI4J 1RT2B 1NB7A 5AXNA 2B4PA 3KDOA 1D0EA 2DGSA 1JLGA 3LGHA 1DLOA 3B4MA 3MPWA 4H54A 1WTFA 2ALZA 2J7KA 2CJAA 4USJC 3AH6A 5A6PA 2DO4A 5H1SV 5L1KA 2P9EA 2Z56B 2HAFA 2YKOA 1HYSB 1WDTA 3F56A 3J81j 2WVBA 3BO4A 2V9KA 1K73T 1T7PA 4RNOA 2W25A 5F8IA 1E6VA 4KB7A 1C0UB 2R7VA 1BQMB 5HLFA 1WEYA 2QZ8A 3Q83A 2B9EA 2JHEA 3K8WA 4PYAA 5I3UA 1WC4A 1JLAA 1U1PA 2GGPB 4DDFA 3E3XA 2ZKTA 4X4NA 4DN9A 4LIWA 4LR9A 2RILA 2BW7A 5L9NA 3HSJA 2MSTA 3P5BP 1FO1A 3CCJS 2ZH8A 4RUBA 2OLWA 4NLDA 4IFVA 4ES3A 4UOCA 5I3PA 5L8RC 2XGQA 2WOMA 2MGZB 3MMCA 5DJBA 3DLEB 1LW2A 3MURP 2CWKA 1LW0B 3MCOA 2CNNB 2W8LA 1F0XA 1HI8A 3K5MA 4ZHRA 2LEBA 3TZWA 1G7CB 5K8MA 4PQUA 1MWZA 2Z58B 4HLBA 1WI6A 1S6QB 3ZZRA 4DL5A 3E01B 4CYUB 1N0UA 2UXCF 3MR6A 4LREA 4Q0BB 4G6VB 4OHYA 2M5YA 3KG4A 3H59A 5JUMA 2L3MA 4I1TA 1VGYA 2HRUA 2AF6A 3M6WA 1UJ6A 4DSLA 1F5AA 3UNGC 3LTOA 4H4OA 2ROPA 2BANB 3WIVA 3I5BA 3CJRA 4OI1A 2ZH3A 4B3SF 1B99A 3GV5B 3ZZTA 2JH3A 2MQPA 4OX9J 5CD4H 2RU9A 4Q5VA 3NCRA 1NHKL 2KM8B 4B9UA 4GKJJ 4DSEA 4ZCIA 2M3DA 2B6AB 3EVOA 1UFWA 1IXKA 4ZVQB 2B3TB 5B0EA 2MQLA 4DX5A 5G0RA 2FVCA 2OD6A 1L5UA 3HKWA 2HHHF 1NHUA 5HMYA 4IDKA 4B9NA 4O3PA 4NXMF 1NAQA 3IRXB 2LXFA 1GMWD 1HBMA 3SIPB 5IOLA 1H72C 5HQLA 2C3UA 5HAOA 2XSFA 1SUQB 3NXZA 3NNCA 4DWIA 1UKUA 3O1LA 1RT2A 2GHWA 1JB0C 1EP4B 1CS4B 3V81B 1G4CA 1FEEA 2W7AA 1FFWB 2EWHA 1N6QB 3NS5A 4ZLLA 2I8EA 2ZD1B 2IM3A 1RT6B 1BWVA 2N7CA 1OIAA 1HYSA 2W2PP 2W4PA 2YWFA 1Q8LA 4RJVA 2J9CA 2Y8YA 3KHRA 1RA6A 4PG6A 2UP1A 4WP8A 4A8XA 3SCKE 1C0UA 2DIUA 1BQMA 4EO6A 2XY6A 1S6UA 3JS9A 3F44A 1BE4A 4R8UB 3QAEA 3LP2A 4DHVA 3H7HB 4MFBB 1S0NA 4Y2CA 3MAAB 2V67A 3MUMP 3RBEA 2GGPA 1DQAA 1O8BA 4X62J 2ZJRQ 4LF9J 2OJ3A 2IVMA 1RZMA 1SVDA 3R5GA 2C1EB 1YKWA 1WKLA 2RRNA 3H5UA 1WKKA 4CT8A 1T9UA 2H48B 4MKVA 5IT0A 2MB0B 5E3CA 2W9CB 1H2VZ 3DLEA 3LH2S 3GIMA 1LW0A 4BCAA 2H3EB 3LUYA 3TUZC 5LMNF 4I4BA 1HARA 1S1VB 3FFIB 3GONA 2XMWA 3G86A 1S6QA 3P5TL 3E01A 4Z37A 3W5XA 4CYUA 1RAIB 1PG5B 4ZPCA 1TP7A 2YWGA 1PCAA 2ZBIA 4Q0BA 1YWXA 2IC3B 1J5EJ 1IBMJ 1EJ7L 2IVYA 3M1VA 4DSIA 2XZTB 4A4JA 3DLGB 4CQ1A 1NPRA 2K8GA 1KTVA 2LA4A 4W98A 5HJXA 4MMOA 1HD0A 9RUBA 1JKHB 2GIQA 1J27A 3SXLA 2WAQD 2CJBA 3JYTB 1ZPWX 3BSOA 4WFZA 1GK8A 1B7FA 3QO9B 5J1NA 3CMAS 3L3CA 2NXEA 2YWWA 4PQAA 3DRYA 3A3PB 1FDAA 2B6AA 1S7IA 2VASA 4M5DB 2CA9A 5KFVA 2KDOA 4DOZA 1N34F 1EHWA 3KG0A 1FWPA 2CZ9A 4B9SA 4DL7A 1CSJA 3DXSX 3KLHA 3PR5B 4RW6B 2GJIA 3KLFB 4ECTA 2QMXA 4ZS6A 1SUQA 4FPIA 2VFRA 1APSA 2QEXS 4JI8J 1EP4A 4NEZA 2NXCA 2WHOA 2EBGA 3V81A 4EO8A 2CJYB 2EVZA 3PKYA 2AJ4A 3Q24A 1HHTP 2J9DE 2W9BB 3PCOB 1N6QA 3OLBA 4QIWD 4C4WA 2ZD1A 1VBKA 1RT6A 2LCWA 4Q8EA 4LRDA 2MY7A 1D8YA 4DPTA 1XN9A 4OYPA 2UXDF 2XHWA 3H90A 2E5IA 2BKPA 2RAQA 3CW2C 2LQBA 4R8UA 2BJ3A 3EM1A 1NU4A 3ZTRA 4MFBA 1Q95G 3MAAA 3RBXA 4ECSA 4QBUA 3LOUA 1U1MA 4QU6A 2HMIB 2QV6A 2W4DA 1EIYB 3BN7A 1R3NA 3IWXA 3OD2A 4J9OA 3D6HB 3TR5A 3CCVS 1SJ4P 2R8HA 2BQ3A 3FBBA 3HPOA 5IS2A 4C8OA 1XMQF 4UT4A 3BB5A 2HQDA 4U7CA 1ZM3A 2RS8A 1K0VA 2DGQA 4F36A 2F8HA 3SZ2A 4JI2J 3I4PA 5IV4A 3JSRA 4J9NA 3UN2A 4ED4A 3DOLB 1F9FA 3CD6S 4Y2MA 1RLCL 2VBYA 2ZHOA 4YHHJ 3H0PA 3CULA 2Z2YB 1RT7B 1S1VA 3FFIA 4LQ9A 2D3OR 1GXUA 4TNOA 3TQEA 2JL9A 4HT7A 2NPFA 2PO4A 4Z2XA 1SB6A 3OR1B 5B0DA 3ULHA 4QR2A 4M5JA 3LGMA 4P7VA 2J5AA
chains in the Genus database with same CATH topology
3EUNA 1DRZA 2AJ0A 4HH1A 4CH0S 3CDEA 4OMFG 2QRRA 4W92B 4FF1A 2RD5C 4HTJA 1X4GA 3OTOF 5FLXY 4IQMA 2IC3A 3GFYA 4KE5A 2EI5A 2OPPA 2KH9A 3GFXA 2FVPA 1VK8A 3NL0A 1OQ6A 1FKPB 2DNKA 2F8EX 4DEZA 3O6QA 3WDOA 4KKOA 1HMVA 1YJVA 4AYBD 4PWDB 2HFOA 2VUGA 4J9LA 1FKOA 1GQEA 1WEZA 3LAMA 2WCXA 3DLGA 4LFAF 2X1GA 4IFYB 4XK8C 5JVGQ 3EGNA 4MYUA 2HZCA 3DRSB 1RTJA 1QM9A 1HWKA 5MLCV 2D74B 4CH7A 4CTAA 2LU1A 3I56S 4KHMA 4PUOB 2V4RA 3Q23A 1JKHA 1VJWA 2IAJB 3HVTA 4BWJA 1H3DA 4I69A 4IO1A 5KG4A 5B0CA 1L3UA 2NR0A 2AX1A 3RB6A 2HVZA 3IS9B 4X4TA 3OL8A 1JLQA 2JVOA 2V8HA 4OFZA 3JYTA 2HNYA 5KFWA 3RRHA 7FDRA 2KG1A 3NAHA 5DO2A 4UUXA 4WF9Q 1BQXA 3VTIA 3QO9A 4ID8A 3MUVP 2E5JA 4PWUA 1JXEA 4EGLA 1KLMA 5JXSA 5DDRC 1SIWB 1M5SA 1VQMS 3H25A 2BW2A 4JI3F 4DL4A 1KHWA 3SDEB 4DBQA 3OHAA 3NMRA 3PXGa 4EWTA 2HVHA 3BGUA 1NJYA 4C9DA 3TX8A 4O3RA 3H98A 3V4IB 5KFAA 3EXCX 5CYQB 3HLUA 2XNQA 4ILMA 3T19A 3HJFA 2V4QA 2KTQA 2F4VF 4M5DA 2EPIA 3KYLA 5DDPC 1SJFA 2E5LF 4TY9A 3NRBA 1Y3KA 4K4TA 5IQ6A 4RW8B 2QSFA 4FNHA 3ITHB 2U1AA 1TVRB 1N88A 1C1BB 2WRMA 3A8EA 2MKSA 2ABYA 1JMTA 1TL4A 5FD1A 4NRUA 5AXMA 2VPXB 1NK4A 2UUCF 2DGOA 4YFUA 2MZJA 2VC1A 3H5XA 3NP5A 1Z2ZA 2PIIA 2VZ9A 4RW6A 3UDCA 5GAEI 2E7WA 3KLFA 1FTRA 5F41A 3T5KA 1NK8A 1UJ5A 4IR1A 4RW7B 3TUJC 1DTTB 2O1PA 3K5PA 5J1EA 2ZUGA 2Z0GA 3GIIA 1VRUB 3JSYA 4FP9A 3V6DA 5F3TA 4KHRA 4TYAA 1BD6A 2YH0A 4Q43A 2CQ2A 2MMYA 5EX0A 1SKSA 1TL1A 2WW8A 4XDCA 4KRWA 1HQUA 2KI2A 3TVKA 4C11B 2Z2MA 2Y0SD 3EGWB 1X0FA 3G71S 2DO0A 4RW9A 3N01A 4QIVA 1B0TA 1ZAXA 2FHMA 3IC1A 4KC5A 3RZAA 5KFTA 3TAMB 3TVYA 3K5LA 2VQFF 2NYIA 4FN5A 1TK5A 5CYMA 4JI5F 1XMOF 3IR7B 4DLEA 3M32A 4DN0A 2V8VA 4N41A 1N33F 1E6YB 2CIMA 2LU2A 2XWYA 4KO0A 4QWEA 2FJDB 4H4MB 1U09A 1ZETA 3HHLA 3UR3C 3M8QA 1R8HA 2PFFB 3AA8A 2XEXA 1RK8A 2POKA 2BRKA 4OHVA 1J5OB 5KT5A 4A8FA 2NSCA 4YDXA 2ILYA 2ROEA 2J8AA 1XEZA 2W9BA 2LEPA 2E29A 4XO0A 2C2EA 2C2DA 1WG4A 2HFZA 2N4CA 2PGCA 2I1RA 3D1OA 1HHSA 2UVUA 3I31A 4DR6F 3T5JA 1Z1ZA 2BA9A 3MM7B 4HHJA 4UW2A 3FQKA 5KG6A 3UCUP 3NGKA 4ZPVR 2PT0A 3MGJA 1UVKA 3TAPA 5L9XA 3W7BA 3MZIA 4RUAA 1VBZA 2OTLS 1DQ8A 2BJDA 4A46A 4LF5F 1WNEA 2IA0A 2UZAA 3BN4A 2OFHX 4NZ6A 2ZKUA 1MSWD 5B0GA 4MK7A 3BZQA 5K5MA 2CZ4A 3T1YF 3JB9k 2GQQA 2PMZD 4MYTA 1CQNA 2V8GA 3I0SA 1P1LA 2PA8D 3BO3A 3KHGA 1C0TB 2E7XA 3MM5B 2RT3A 5GMKa 2CDQA 2IM2A 4G1QA 2WB4A 3OTBA 1UVIA 1WG5A 2CKWA 3LF0A 4N76A 4I2PB 1AFJA 1DLOB 1XK8A 3LALA 3OFFA 5ITHA 4EUVA 3PV8A 4Q8FA 3MXHP 1U24A 5T7LB 1FK9A 1TL3B 2YQ3A 1H7WA 3W2VB 2MYFA 4AQYF 3UDLA 3CIMA 1QTMA 2KN4A 3QIPB 2YKMB 2A18A 4ALZA 4AXIA 1PSDA 3ISZA 4L3NA 4I67A 4DSJA 3TARA 5HROA 3J7A1 5E3RA 1XNRF 4YR2A 3LP0B 2HMIA 1SH3A 2W9AA 2F40A 3PKMA 4O3NA 4LMZA 3OJUA 1S0OA 2WSCC 3I4HX 3UCZP 2RMLA 4C3MA 5A8RB 2C22A 2G13A 3TNVA 2HGMA 4F4XA 1OPIA 2IHR1 2RRBA 4AE5A 2ZE2B 3FDSA 4FNIA 4QOTA 2AYMA 3BQ1A 1SKWA 2OTJS 1PC4A 1CPZA 1JJHA 1FDDA 5AE2A 1JNZB 2N3LA 5A0YB 4QIFA 4YB1P 4DV6F 4ZCMA 2C3PA 2XLJA 4I56A 3NNHA 1ZTTA 2Q66A 1HWIA 3BSNA 4DS5A 4OZLA 1FNOA 3THTA 3UW1A 4F50A 1NRKA 2DHGA 2OD4A 3VZIA 4RBVA 4WIIA 4U7UK 5DM7Q 5HI7A 2XMKA 2V4JA 1WI8A 3RBDA 1KONA 4WCEQ 2FHKA 3CCES 5C25A 2CQGA 4NLGA 3QZ7A 1R43A 2CPFA 5C42A 4FXVA 2CPYA 3MF5A 6FD1A 4YY3F 2D41A 2XY5A 2FJWA 3PNIA 3HF5A 2XG8A 2GJ2A 2ZH2A 4HDHA 4WFAQ 1BLUA 1UAWA 2M8HA 2GC8A 2Z8QA 4ITSA 1Q1KA 5E3QA 5D77A 4N47A 4ZK7M 5GAGI 1KRPA 2UU9F 1NK6A 2X1FA 2DNRA 3MEGB 2MGZA 2ERRA 3MPYA 3KMQA 3KNAA 4KSEB 4NLVA 3TQ1A 1X7VA 4N56A 2MKCA 4ED8A 3NWGA 1FJEB 1IUJA 2V5HG 3GWCA 1S1WA 2R2SA 4ED1A 4B9VA 1RTHA 2DPIA 3HHNB 2XMVA 3FMWA 1LWEA 3PX6A 1RA7A 1OSDA 3HT3A 1RT7A 2FB0A 3OR2A 1XC9A 1ZOTA 2IRYA 2YKNB 2UV8G 4WU3A 2K1RB 4F3MA 1U25A 1FJCA 5B0BA 3M6UA 4NYZA 5LT5A 3OL7A 5KFRA 2A1BA 3C66A 2QA2A 4OHWA 2J9DA 4DL2A 2OPRB 5AXLA 3QAUA 1M5OC 4RUCA 2FTRA 3H8YA 5I3QA 5K8PA 1CC8A 3HHKA 4NX9A 3N6NA 3OFHA 3TA2A 4RZRA 4TQRA 3P49B 4QYZJ 2LLZA 1GTEA 5J1PA 3OR1A 4BS2A 4QJVA 2YNIB 5LXRA 1H7XA 3IGVA 2FC8A 3T9NA 2XCPA 3VAGA 4LF6F 1S48A 2VFTA 2I5JB 3OFGA 4PKDB 2R2UA 2ZZNA 3MMAB 1S99A 4DX8H 1MMDA 1HWUA 2CQ4A 3LQVA 1LW2B 2VFUA 2XWXA 4PCQA 3SFUA 2V2KA 2CQ1A 5J2QA 1TZ0A 2ZC4A 2LECA 1VOMA 4ES1A 5F8HA 1S1XA 1FKPA 1MROB 4NLRA 2HHPA 1FNMA 3ISND 4HTIA 3MEKA 5AJ3F 2GQ2A 2MXYA 5KFFA 3KK2B 4E8UA 2R7WA 2FJVA 2YNGB 5CYJA 1G2EA 2KFNA 2D9OA 3Q8QB 1SJQA 4IFYA 3D0IE 3DRSA 4OI2A 1KFSA 2L41A 4Y2KA 3G6XA 1SL0A 1XR5A 2CQBA 3VAKA 2HHUA 4PUOA 3B82A 2BANA 2XS5A 1DQ9A 1GAOA 2IAJA 2XGPA 4X4SA 2DNHA 3QPIA 5HMWA 3EZ5A 3MECB 1B0VA 4NLPA 3DU5A 1VMBA 4KJIA 1D1UA 1YJRA 1NK5A 1YRTA 5D6GA 3HHEA 1N54B 5F0UA 2BR0A 4ZA1A 2GQCA 5A8WB 1KN6A 2P9GA 3AB4B 1ZZFA 1HBNB 2RF2B 5I42B 3Q8PB 3ENWA 3OTCA 1KOOA 2J0XA 1VC5A 2VG5B 2FJBB 2DNQA 2ASYA 3SDEA 2E5HA 4LUBA 2DB1A 5B0AA 4ERDA 2GIRA 4A47A 3EPGA 3M6XA 5LJ5Y 1P27B 4IOAQ 4X4UA 2R4FA 4BDPA 2MQQA 1P8GA 2AP6A 3PW0A 3V4IA 4N8NA 5CCLA 4MTPA 4G3IA 3RB4A 1R8PA 2CPIA 5CYQA 1IKWB 4JI6F 2OFGX 4OL8A 3FEXB 4B3MF 2F9DA 1FJGF 2DHSA 2KJVA 3AB2B 4RW8A 1TUVA 3ENVA 3ITHA 3S1TA 3KLEB 3CCLS 5L1IA 3OTDA 1C1BA 4I2QB 1IKXB 3CT9A 2EFVA 5EWEA 1Y3JA 3KK1B 3OXFA 4ED2A 1WTBA 5KFHA 2D3ZA 2YVSA 4H4KC 2VV5A 1FESA 5DG8A 3SFGA 4DFPA 1JLCA 2KU7A 1IKYB 2B4VA 4LFBF 1X4EA 1I1GA 2R8IA 4LQ3A 3SCJE 3OPKA 4QPTA 4RW7A 4N5SA 1K0TA 1DTTA 4C8NA 2DGVA 5GAHU 3ZZOA 4WKRA 1S9FA 4OJ1A 2XC9A 3ONQA 3IRXA 4NCAA 5CHCB 3FSIA 2R7XA 3UFCX 3W2WB 1RTIB 1FRIA 4ECVA 3QMQA 1GX6A 4C11A 1FF2A 4USIA 2G4BA 3FRYA 5MAOA 4JV2A 1VRTB 2RNEA 4HYKA 4JYAF 4FBUA 2X3GA 1IQTA 4DL3A 2ZH7A 3JTPA 1TK0A 1E6YA 2A2CA 4QIEA 4ES2A 2MKKA 4KGKA 4ED7A 3CE8A 2HLUA 1UWBB 2KYZA 4F67A 3D28A 2IM0A 5HMXA 4FS2A 4PXCA 1T05B 2E1RA 1YVFA 3OUYB 1Q4RA 1S7HA 2DIVA 2BABA 3SEOA 4ZPTR 1N56A 1KLNA 5KFSA 1JIHA 1LXNA 2CQPA 5HL7Q 2MJUA 2UV8A 2ASDA 1YJUA 4KHPF 1OWXA 4IYQA 4TY8B 1TKXB 1D3WA 3AA9A 3MM7A 3OV7A 4DR1F 4C8ZA 2OKQA 3Q0AA 4PPZA 5D4PA 4EU0A 2L48A 2MDAA 1L3SA 4K4UA 3CCRS 5GADI 4RLEA 3WZ0A 3WC2A 3IGNA 3K0JA 1NJWA 1S79A 1G1XA 2DCLA 3MOJB 2DNMA 2XULA 1N5QA 2CPHA 3SYZA 1Q81T 2K2PA 3GR1A 3MEDB 1VQ7S 3FGVA 3NBPA 4MIAA 3N6MA 4WXOA 4Q44A 1IM4A 3T6BA 1D9FA 4MKBA 1DTQB 1K9MT 2DNYA 1FTCA 3TA0A 2BRLA 1IKVB 4X66F 4ELVA 4ECZA 4CIOA 1Q53A 4OHZA 1C0TA 3MM5A 3EZUA 4NLOA 2WB1D 2N7YA 5IM0B 2BYCA 2G0CA 2ZOFA 5KT4A 2VKZG 2WONB 2F1FA 3IAS9 4K59A 1Q8IA 2OMLA 3IA0A 2KXNB 4I2PA 4JI0F 1WG1A 3I6PA 1WHVA 2KRBA 1FDNA 5KG1A 1DBDA 2JZ5A 5T7LA 1TL3A 3T3FA 1PGZA 3W2VA 3C6TB 2ZH5A 2E1MC 2DPJA 2O5DA 3QIPA 1CQMA 2YKMA 3MMBB 2AWZA 1NJIT 5AE1A 2DGWA 4MJKA 3J7Z5 3WC0A 1FA0A 2YH1A 4QYRA 3LWLA 3T5LA 5HBMB 2UUAF 3VZHA 3GFHA 2HG4A 4WK1A 4ETXA 4YQWA 3BR9A 2DT9A 2IVFB 5L39A 1YJNS 2KXFA 1Q82T 5A8RA 4J9MA 2FY1A 3I5CA 2NXUA 2ZE2A 2CRLA 2ZM6F 4F2SA 1T03B 3T9ZA 5KOWA 4OI3A 4K4ZA 4NA2A 3UD4P 1D9DA 1QAJA 3OSPA 4OHXA 1W25A 2MSSA 1U1OA 3DOKA 5A0YA 5J2MB 3O5TB 4U6PA 3H2UB 3MR3A 2DHXA 2EFGA 2EFQA 4FVMA 1SJ1A 4K4VA 3VAHA 4IUFA 4RWWA 3M9NB 3LP2B 5DDQC 4ZP8A 4NCBA 3I55S 1KOHA 1HD1A 1XR6A 2O01C 3CC7S 1LV5A 5KFZA 2MQMA 4YMEA 2UXBF 1FRMA 1H2UX 3BS9A 3CEDA 2LQ5A 5B09A 2BVZA 2ZJPQ 1SKRA 1U1KA 2C3MA 1IN0A 1NH7A 4L6V3 4RU9A 2JFDA 1S77D 1GT8A 4ECRA 3HM9A 3MEGA 4H4KA 2E66A 2W9CA 1UETA 3CB4A 2E9TA 3K7RA 2BBEA 3FZ2A 3P6YC 3OVBA 1SC6A 2YX4A 2HAIA 5KOXA 1SL2A 3DU6A 2Y1IA 1C4AA 4PXEA 2YNHA 2BQUA 3I5AA 3LGNA 2YKNA 1S76D 2K1RA 3L7PA 2DR7A 2J0QD 2BQRA 2E1AA 2XI2A 3CD0A 3N28A 2I38A 3SV3A 1XR7A 4JI1F 4U67Q 3CDUA 3CD5A 2KT5A 2OPRA 1QY7A 4DQSA 4F2RA 2YX1A 2MQOA 1X8DA 2HNZB 1R31A 2GHPA 4ECWA 1CVJA 2IMWP 1U1QA 2MKJA 4HT5A 2XS7A 2IBOA 4ZPAA 2YNIA 3C46A 2YTCA 3QWPA 3AQPA 3BSAA 4LJMA 4RWXA 4F8RA 3CCTA 2I5JA 3PJXA 2KG0A 5M2PA 1RYSA 3MMAA 2N4DA 1XNQF 3KFWX 3AAWB 1WELA 4MK8A 4TU9A 1ZYQA 1EETB 1BGXT 2DD8S 3KK3B 2RDIA 4OLOA 2OH2A 4RNMA 1BWEA 1QE1B 1Q7YT 1N5SA 1S6PA 3NMAA 1MROA 4OQJA 3PZPA 3D1HA 4Y00A 4B3RF 2LQ9A 4ZVGA 3KK2A 1Y0HA 2B4UA 2YNGA 4ZDNA 5DG7A 2Q3PA 3G6YA 4R0JA 3HX9A 2J76E 2JDJA 3Q2SC 3T1AA 4WZQA 1KNZA 5FJ4A 4C2MA 1SI9A 4J9QA 3HFKA 1RT1A 2Q1LA 2DRAA 2VONA 1HWLA 1HNVB 3CGIA 4WXWA 4Q45A 3QGGA 4FZVA 1T94A 3NCPA 4OX8A 2LVWA 3PW5A 3N6LA 3G8SA 2NQPA 5M2RA 5DETA 4K4SA 3PX4A 4O4GB 4LF4F 2FIUA 3CWJA 4DMZA 3QGPA 4YP3A 2NSBA 3AJ2A 4E0DA 1X4DA 5CZXA 1QUPA 5EN1A 3T6JA 4DUYF 4WFXA 5A8WA 2U2FA 2RF2A 1HBNA 5I42A 3DLJA 2JOQA 5EWGA 2GNKA 4Y65A 2DR9A 1VI7A 1NK7A 3OL6A 2UUTA 2UVRA 2W24A 4UQGA 4XPCA 3PW4A 2JEGA 2VG5A 5H9FJ 2R7OA 2VC0A 2OPSB 2LQJA 3PDNA 3M1VB 1VS3A 3GB0A 3L95X 1HWJA 3OQ2A 2ZHBA 1DFDA 3NLCA 4DJBA 5CZVA 1HW9A 1MNEA 4RU2A 3PHEA 3MMJA 1WHWA 3M2VB 1IR0A 3HHDA 2RJZA 3UR0A 4DR4F 5BR8F 2J6TA 1IKWA 3D54A 1TFWA 5BYSA 1NJZA 4I7FB 4NCGB 3MM8B 2C3YA 3DN9A 4P6QA 2XMMA 3CO9A 4F4KA 4BC9A 3KLEA 2LA6A 4FF2A 3J80Y 4CO4A 4I2QA 2HWTA 1ZAVA 1IKXA 1O51A 4ZPBA 5A2QY 3KK1A 4B3OB 2VPZB 1AFIA 1UFLA