1SA0B

Tubulin-colchicine: stathmin-like domain complex
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Insight into tubulin regulation from a complex with colchicine and a stathmin-like domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 127
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1sa0B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1sa0B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1sa0B01
4I4TB 4ZHQB 4O2BB 4DRXA 4O2AA 5JQGB 5IJ9B 3WGMA 4I55B 5LOVA 1W59A 2VXYA 2BTOA 4KWEA 2XKAA 4FFBB 3N2KA 1Z5VA 1FFXA 4O4HA 3HKEA 4DRXB 4I50A 1FSZA 5GONA 3JARA 5LOVB 3RB8A 1W5BA 3N2KB 3HKCA 1W5AA 1FFXB 2RHOA 3M89A 2Q1YA 4TUYA 4O4HB 5LP6C 1TVKA 1Z5WA 4I50B 3RYHA 5GONB 3JARB 3VO8A 4B45A 4U39A 4X1IB 3UT5B 3ZBPA 1SA0A 3HKCB 4YJ3A 4LNUA 4TUYB 1TVKB 4M8IA 5EZYA 4HNAA 3RYHB 2Q1XA 3WGJA 5CB4B 4EB6A 3E22A 4B46A 4YJ3B 5BMVB 5EZYB 5CA1A 4O4JB 5C8YA 5KMGA 1OFUA 4EB6B 4IIJB 2VAPA 5LXTA 1TUBA 5CA1B 5MN4A 5KMGB 4O2AB 3ZIDA 5FNVA 3JALA 3RYIA 1TUBB 5EIBC 3C8LA 4EI9A 3N2GA 4X1KA 3HKEB 3JALB 2RHLA 5J2TA 3RYIB 4EI7A 3JAKA 3N2GB 5LA6A 4X1KB 5LP6A 4O4LA 5J2UA 2R751 5J2TB 5MN6A 1SA0B 5LA6B 3VO9A 4LNUB 3RYFA 5LP6B 3JASA 4O4LB 5JCOC 4ZI7A 1JFFA 5JH7A 1RQ7A 2GVIA 4HNAB 4WBNA 3CB2A 3HKDA 5ITZA 4X20A 3HKBA 1W581 3E22B 4ZOLA 3VOAA 3RYFB 4F6RA 3JASB 2BTQA 4ZI7B 5JH7B 3RYCA 5C8YB 1W5FA 4E6EA 4WBNB 2XKBA 3HKDB 4O4IA 5LXTB 2VAWA 2R6R1 3ZBQA 4F6RB 4TV8A 3RYCB 5LYJA 4I4TA 5CA0A 3VPAA 2RHJA 5FNVB 4O4IB 5M7EA 5IJ9A 4YJ2A 4TV8B 4U3JA 3M8KA 5CA0B 5LYJB 4FFBA 3VOBA 4IHJA 3JAWA 5EYPA 5EIBD 3WGKA 3JAKB 5IYZA 2VAMA 4YJ2B 2RHHA 4X1YA 4U3JB 4IHJB 3JAWB 4TV9A 5J2UB 5EYPB 1W5EA 3WGNA 3V3TA 5IYZB 5KX5A 4X1YB 4X1IA 5JCOA 3JATA 3UT5A 1RLUA 1RQ2A 5IJ0A 1JFFB 4DXDA 4TV9B 5ITZB 5JVDA 4XCQA 4X20B 3HKBB 3WGLA 3R4VA 4ZOLB 5CB4A 5KX5B 4EI8A 3JATB 2BTQB 5IJ0B 4ZHQA 4O2BA 5BMVA 5JVDB 4O4JA 5JQGA 4I55A 4IIJA 5MN5A
chains in the Genus database with same CATH superfamily
4XJSA 1KO5A 5TSDA 4DQXA 2R86A 1XNRB 5B5SA 2XCLA 3VDNB 1VTKA 3ZR4B 3S8MA 4J07A 3HKCA 2ZR8A 2ZRJA 5JNLA 2JW5A 3CCBA 1YACA 2ZUCA 5TMEA 3TYXA 2IPNA 3W9SA 1M56C 3SJUA 5LXTA 1KDPA 2HRZA 3SJBC 3QEJA 4S2EA 3WXMB 4YASA 1II8A 3ANXA 4JTCB 4FJCC 4FSXA 3GC6A 3DFMA 2KHZA 3CWBH 1N2CA 5FA5A 3RYFA 3K03A 1IC6A 1K2VN 1T1EA 3NTXA 1MB4A 3DYBA 3EY4A 2CLSA 1NF2A 5B5EZ 5C3MA 5J2TF 4ZV9A 3UT6A 3KCQA 1EP2B 4QQKA 1R7RA 3RSGA 1T0UA 1UQTA 3DP9A 1ZO8A 4NCNA 1NU6A 2FZLA 2ZQZA 3FM9A 1MSWD 3FMFA 1E66A 4AD8A 2R9IA 2QSYA 3OE7A 3IAYA 3HBFA 2PD6A 1J95A 1PR5A 5KPJA 4J7KA 3FRIA 2RAUA 3GJ4A 2GD6A 2UYQA 5HWSA 1UBUS 4QNHB 2WKQA 3BH7A 5IANA 1D5NA 4NYMQ 2CT8A 3FTEA 1D2HA 3ENNA 3MT9A 2ZU0C 4QARA 3AVWA 3K15A 2OM6A 1P7ZA 4Q37A 2YUIA 1X0VA 3N53A 1JR3A 3N2GA 1RXWA 3A4IA 3H1JH 3U37A 1SA0B 2ZS7A 4MAAA 4BEJA 3QX9A 2GCIA 5TR9A 2QN6A 1VZ3A 5FOTA 4I7ZB 2PYIA 2Y0DA 3E3LA 2PL1A 1GAWA 3RVZA 4HFMA 1RW4A 1J0BA 1TO2E 3DONA 3WYNA 1SG9A 5DRTA 4MZDA 4BVHA 2J45A 1PM9A 1VG1A 4ZARA 1NQ3A 3LJKA 3TBKA 4ZHQB 3AUJB 4KR2A 2JGFA 3B9RA 3PE4A 3TFOA 2IH5A 1XHLA 4AJLA 4HMOA 3LWPC 1VQ5V 1YL7A 3THSA 3PXBA 3T4XA 4OLAA 1C7JA 4X71A 3UMRA 5JNUA 1SVNA 5CGQB 4BAYA 3IP7A 2ZGVA 1OCRB 4IVNA 4I4NA 1WB4A 1XJ0A 4TT3A 1X7YA 4QIWF 3O8LA 3H19A 3SEZA 1DG1G 3FVQA 3CY6A 2QRVA 4Y1FA 4DLNA 4DCJA 2R751 2EBFX 3ABKC 4OHOA 1X7XB 1A9TA 3PT5A 2QNIA 5JQWA 4JC4A 2EATA 2O8CA 3KLMX 3UQ8A 5HRCA 4MVJH 3UFBA 4OBWA 1DMRA 1E99A 3B8NA 3AW9A 2VR1A 4QUJA 1KK0A 1F51E 1ONNA 4MYRA 2IC5A 4M6WB 1JEQA 3IKEA 4ZK6A 1THTA 2QS9A 5BWCA 1DDGA 4UBJA 4YPVA 1GTMA 3CPEA 2Y0BA 4MVJG 4YR7A 4NFSA 3ZJ4A 5L9AA 3FBWA 2IELA 1CW2B 2OHVA 3OFNA 1B4DA 5HIJA 2HDNB 4CKBA 4I3HA 1I3LA 3OLZA 3NHPA 3RROA 4N8DA 1KKMA 3R23A 4BT2A 3DQPA 2R8XA 3OURA 3EODA 4KYUA 3SLGA 1K5GA 2IZ7A 4MV8A 5BWLA 3M6AA 4DO2A 4RTMA 4GWGA 4TQAA 3TL2A 4F38A 1IM5A 1UKYA 1KHTA 4P3KA 3TTTA 5L7TA 3IQIX 4AYTA 2IS2A 3PUVA 1FJ2A 2F1MA 4DR2O 4PZPA 5EINA 1RYHA 2PJDA 4UVGA 1R8JA 1KFJB 4KXMA 5EPUA 3LVBA 3MTEA 4YA6A 4QQNA 4XJVA 1XEFA 1NOIA 4DA0A 5CBPA 4UMVA 4IIUA 2OZPA 3QEMA 2OQ2A 1NZJA 4UAGA 2R9AA 2QLNA 4G25A 3ZBPA 1Q6IA 4FYKA 4CMEA 4GEGA 4KH1A 3WL8A 4YUZA 2C54A 2C4TA 2FYUH 5GTHZ 3K5HA 5MFZA 1B00A 1QC5B 4RPCA 3K5LA 2H8KA 1TUBB 3I2JA 4YJ3F 4QOHA 2IS1A 1I13A 1URFA 3ROKA 3Q7TA 1GH6A 2P6OA 3VYWA 4Q18A 2ZJ6A 5CVEA 2OENG 2XAGA 4KHPO 4I1IA 1W1WA 3EA5A 1G60A 3UWOA 1OFVA 3RS0A 2YFYA 5F64A 4RPJA 2A7XA 4Y2UA 4KWHA 3TMAA 1TM7E 3SQWA 5AJYA 5CEFA 1RLGA 4DV2B 4OXSA 3PE3A 1KZ6A 5AVVA 4K46A 1MVLA 4QDTA 5J1SB 1VHLA 4X00A 2X19A 2ZWIA 4K1XA 4M46A 3RIXA 3L8GA 4H7JA 4XIJA 2GCPA 1WXGA 4FBMA 5KTSA 4OHYA 2PT9A 4BQFA 4F85A 5IZ4A 1ZXXA 4DMCA 1YDXA 4XDHA 1U7TA 1VF6A 2IYYA 5DI9A 3CNEA 1K27A 2Q1SA 1E7YA 4LNHA 5HZGA 3A2NA 2C04A 1YBVA 2BCJQ 3ICXA 5I4IA 4K88A 1XI1A 3PSAA 4OHXA 3QNUA 1VQ6F 1Z6PA 3R0VA 4MEAA 4UCXA 3RRNA 4UB6Z 3TTXA 4HCJA 3LPLA 2Y1FA 4B3SB 3CURA 2ZIWB 1S8AA 4O63O 5DBIA 4KYVA 3ZWCA 1G2OA 2ZSJA 3WC4A 4GKKO 4IIXA 4URYR 2FA9A 3TX2A 4DPMA 3LUGA 3IUSA 3OQVA 1ST2A 5EJIA 5IJ9B 2ZCJA 4RGBA 4KN6A 3MBKA 3G0DA 1E9VA 4BHTA 3K2EA 1CY4A 1HNWO 2I4OA 3JQBC 2B4QA 2O2SA 2AGVA 2IEBA 3PD0A 3AETB 1T5TA 3N4ZA 4HZUB 3NC1C 2X23A 4WKPA 1BHJA 2HYDA 4CNBA 5DNEA 4LHVA 1WV1A 5CA1F 1Q7CA 1EN4A 1BS2A 2HH9A 3K1AA 2O2JA 3FTNA 1QHHB 3II6X 3CS3A 3HY3A 3C24A 2DB3A 2VH2A 3UM7A 1AB6A 1C3JA 5DZSA 3MG9A 1N34O 5LB2A 4FIDA 2HQSC 2ZRQA 5FOXA 4WRRA 5BO5A 4AP5A 3I34X 3AHIA 4GM0A 1SEPA 3FJOA 3OCJA 2GZ1A 3ILXA 1NZFA 1TM5E 5GTDA 2QWXA 2GBCA 3TG8A 3ETLA 2FF7A 7AT1A 4Z99A 3WLHA 2CN1A 4S1PA 4ZT3A 1MT0A 3TLMA 2GXUA 2H4FA 3IP1A 4F4IA 1CJUC 5HS4A 2TMKA 4F93B 1EBUA 2OD9A 2CE2X 5FOUA 1YT5A 2PX8A 1CP9A 2NQTA 5FUMA 4BEVA 1JIKA 4FW8A 4LXIA 3GL9A 4EKDA 4FMBB 3ICWA 4JKYA 3RJ5A 3PN1A 2FTKE 3EGDB 2E21A 1FRVA 4ERXA 4LOLA 2OBLA 1WM1A 4FZ3A 3RRBA 5LQCA 2HTEA 3ZEDA 1XCOA 4S1OA 2JK5C 1VBMA 3OIUA 3C6XA 1C3OB 2MSWA 5B3AA 3HY6A 3BRWA 3MGKA 4X9QA 3ECCA 1Q2XA 1XAJA 3JVHA 1TT5A 3PXEA 3KFXA 4H3KB 1C50A 2F8SA 2QRHA 3NBUA 5CFNA 5JSZA 5HYVA 4QXRA 5TLSA 5KOJB 2QUJA 4GLJA 4OBEA 1SETA 2O3UA 3L0IB 2DWQA 4JGBA 2O2IA 1RYBA 3YASA 4YI5A 1M2FA 5CFRA 3TINA 4ASUD 4EPRA 2ZUEA 5DK4A 3B12A 3GUYA 4D0GA 2V6BA 4TSFA 3TLGA 3WMEA 2HLDA 4JLBA 2ZPTX 2X1MA 3LKZA 5JSHA 2NVBA 1SQVH 4PVDA 4XFKA 2Z6QA 4JI6O 1RC1A 4N5HX 3GIDA 4PS0A 4X3LA 5FEMA 3KK0A 4XX0B 2BFCB 4W63A 2PGDA 3KHSA 2WSYB 4LJAA 3FKSG 2Z4TA 5DCLA 5TS3A 1NUQA 4UBLA 4B5KA 4JA0A 4XUEA 1KO8A 3R5FA 2OXTA 2BGUA 4J1TA 1UPXA 2OG1A 3T38A 3AL2A 5EKUA 5JDCA 3HDVA 1R4MB 3SFTA 3U4MA 4ZRNA 5HTKA 5T6BA 1SBYA 2QMUA 1Q7GA 1SKYB 4GGOA 4MVWA 1KXZA 3CLTD 4WKGA 3EQ8A 1G6KA 1N6HA 2PGOA 3DF9A 2R5FA 4DDTA 4L4ZA 3RSLA 3D7NA 3GJRA 3ZWYA 1D9ZA 1NONA 3MZ0A 3ZIDA 3PICA 3CWQA 2EULA 4G28B 4LF6O 1W40A 2QN1A 5JJKA 4HQKA 4KITB 4J0QA 4LC0A 4XJTA 3B8HA 2JCSA 1R1BA 3VV2A 2QAGC 3NTRA 3OECA 1V11B 2YKGA 2BOVA 3KYCA 2J3JA 1VI6A 4IY1A 4IDPA 3MCVA 3WHLA 2XXAA 4AJPA 3CZQA 4ZI7F 4NONA 3MB8A 3DUFB 5FTJA 3VPCA 2V6FA 2P6MA 2FCAA 1NWHA 1G55A 2AI1A 2J33A 4FHEA 1GPAA 4J7CA 2NUTB 3UBTA 2UYKA 3MNFA 3W3AD 4A8TA 4HHEA 4B34A 2XWBF 5B2EA 3L6OO 1JDBB 3DCJA 2Q6KA 2D2FA 4EX7A 5ICEA 5TX7A 3S27A 4IS2A 2XPCA 4EARA 2EDAA 4FLWA 2DYYA 1R9GA 4NATA 1VQMF 5HGXA 1K4KA 1W5AA 4JI5B 1BFDA 2MMGA 2G82A 5LZ9A 1MN6A 3AY6A 4EUKA 4D6PA 1YR8A 2J67A 3JSLA 3C6QA 4LMAA 1KUQA 1HE5A 2IW3A 4XQ0A 4F9GA 4EK9A 2X0FA 1X8KA 3PIIA 1E1QD 3CC4V 4A5SA 4Y8VA 3O7MA 1QPGA 2D13A 2L18A 3ODPA 4RTJA 5ALTA 3KKMA 4G1EB 2VXOA 3B53X 1SBIA 1GGMA 1PK9A 2W2OA 2ZRBA 3NOVA 3B6MA 2YSUB 4RHXA 3W06A 4J11A 3L7DA 2B1QA 4Z1VA 3KQSA 1IN8A 3HPQA 2PMWB 4R8KA 3E81A 1RM1C 3TAUA 1YI2F 2KWIA 1YA8A 4GLLA 4JOQA 1I0IA 1M1NA 1ZGHA 3M6LA 1QV9A 2AEMA 4JT8A 4RZ3A 2ZNIA 2BDEA 4MOWA 1DX9A 1T9GS 2IITA 1KOLA 2X0RA 1VQOV 4IT5A 2OLEA 1V3QE 2FPPB 3GJSA 1K6MA 3CG6A 1JR9A 2I4RA 2QV7A 3L4BA 1UBRS 3ZI7A 1XTQA 3D5EA 2GN0A 1H6DA 3VPGA 2ZR9A 4EJ0A 2CFCA 1PJ8A 4KP7A 3FHJA 1VCHA 5KHHA 2KW5A 2ODAA 2R8YA 4FBGA 3TTYA 3AR5A 4F1JA 3CMEF 1VL5A 4OHVA 4PZ9A 1SBTA 3JQ6A 2JIOA 2WFLA 2R66A 2C3OA 4L95C 1F2TA 1DK1A 3ZKAA 2Z2YA 3F6EX 4UEJA 1RQ2A 4NZ9A 3SHTA 5EBMC 4GMGA 2CTWA 1XJWA 4QYXA 2R4QA 5EI5A 3HO8A 1HOXA 1PZXA 5L6MB 1BZYA 1XP5A 3BXXA 2V7PA 3F7NA 1GA4A 1JH8A 5AI6A 1GEEA 2CTRA 4F71A 1YBMA 2P6RA 3MT8A 2P0EA 3ZCSA 3GJXC 5AVYA 3NYIA 4M99A 2OOSA 2VBIA 2W6CX 2O5RA 2ZZNA 3MJRA 3G79A 5CM8B 3QH4A 3H0EA 5LD2B 3T1VA 4KQHA 3GT0A 1AI7A 1BIFA 1XQ8A 4EVQA 4MJ7A 3GFPA 1R0KA 1CEQA 3KZNA 1SBHA 3GFBA 5IRCD 2GTHA 2WM9B 1YFZA 5JZVA 4MW0A 4R0MA 2EIMB 1ZHOA 3I04A 1JBKA 4HVAA 5KAIZ 1KI9A 4RTRA 3NCTA 1ISIA 4EYKA 4AKTA 2WJ3A 1DQNA 1COWA 2JI4A 4FFOA 1KH1A 2GD2A 1L5YA 1E5QA 3GRYA 3OOWA 4H08A 3MTDA 3IE1A 4GUAA 2YL2A 3DVSX 1YQDA 3DPIA 1RWVA 2YZKA 1CUXA 3T5DA 3W1EA 3FFMA 1XQVA 2AGAA 4ND5A 2WQ6A 1RLIA 1WS6A 1WP7A 4IZ6A 3W7XA 3QU2A 4ER7A 1R0BA 4WNCA 3BFJA 4CM9D 4FHGA 3IAM1 2CVFA 4IR7A 2IH4A 1B73A 1E9AA 1IE3A 3HDGA 2H0RA 3SYLA 4I50F 3EGEA 1G4UR 5HSGA 3OAAD 4JGSA 1Y4SA 1GQYA 2AZDA 4HVTA 1LX6A 1MMFB 2ZLBA 4JUAA 1UK6A 5DMHA 3HDTA 1T1JA 5JAQA 2A30A 2HRDA 4O4LF 3ZCPA 2C9OA 3FTPA 2DF8A 1UAYA 3RGGA 2ADQB 2ATKC 4TTVA 2IKQA 3IJ5A 4BRWA 4C1NA 4PSCA 3DE7X 3PQCA 2IU6A 4PZCA 4MQEB 4QM7A 1ISPA 5KLVH 3VR5H 2HP0B 3PQFA 4S0ZA 5KQPA 4HVLA 4TYWA 1MABB 1P4SA 1RFGE 3WOVA 2HS0A 3CZ9A 1HE2A 1JQKA 1K9MH 3SE0A 1PUJA 5I9SA 1KERA 2A3QA 4FTWA 2WSSG 4G26A 1Z4LA 3WGJA 1FSSA 1AKTA 1MB9A 4FD3A 1CE8B 4O02B 1KQSU 1UPGA 2P9YA 2VYVD 5B1HA 2CHVA 2DUNA 2AJTA 1H2FA 2OECA 1GNQA 3T9FA 5IUNC 4HWGA 3UMJA 4E03A 1AHNA 1WMEA 4GWKA 3DH0A 3F0DA 5EZ6B 3CF0A 3DKPA 1YHQV 1MOQA 4H4DA 3U1TA 1I0HA 3EDQA 4EHJA 3J7AU 5P21A 3COZA 1L7NA 5DNAA 3BA8A 2D7CA 1MAAA 1Z06A 5ILGA 1S2GA 5L53A 1P31A 1G5QA 3RTCA 4HGNA 2ZUWA 1R5BA 5B3SC 2IOFA 3MDSA 4DF3A 4KIUA 1P7WA 3IKFA 3UO2A 2DKOA 1NJ5A 1M1XB 1D5AA 2FUCA 2BEUA 3ELDA 3RWRD 2JF0A 2CH7B 3OD5A 2LPMA 5ALYA 3QE0A 4JR1A 2IBTA 2QE7G 4QPZA 1XHZA 1W2HA 1XZJA 1SCBA 2GARA 4MHOA 3VHXA 4ID9A 2Q3MA 1E2IA 1HWYA 1CYDA 1UBOS 2WPNA 2ZEJA 4NY1A 2HJ9A 2IHVA 4L28A 2OBXA 1Z6GA 3TK1A 1K5QA 2QMHA 4DK1A 3T5CA 3CVJA 4LY6A 4RD4A 2BKUA 3ID6C 3WNVA 3ZNNA 1RR6A 4MVJE 1NX9A 4BAZA 2P6PA 1QVGU 3QX7A 4FU0A 2BFWA 2XJ9A 3P0IA 4M76B 5HPYB 4E88A 2UV8A 3STYA 1O8CA 4GL4A 1ZNWA 4HDMA 4K8OA 3EFBA 4R0NA 1IHPA 4I1VA 4XPIB 2YV4A 4UE2A 1E1CA 1YZTA 3HGQA 3H8VA 2BYTA 1E20A 5SY4A 4C6TB 2GCOA 1EZJA 3PPVA 5CT9A 1NP6A 4LBWA 4IVQA 1FUUA 1RWBA 3GDWA 3SSNA 4JK3A 4W5QA 5LVAA 4BRSA 2OHIA 3IBSA 4PQEA 5KMGB 4BGVA 5EIBC 3CCMF 3ELUA 1XUOA 1V5WA 2G8LA 3WMFA 1DWUA 4EJFA 3CR8A 4CCSA 1GM8A 1BD3A 4ZT2A 1XPJA 3FD8A 4JB3A 5AJWA 3CG4A 5BSRA 2CVHA 1E60A 1SG0A 1RM4A 1O94A 3MW8A 4M9CA 2ZBUA 2O8EB 1Z2NX 3IVAA 4TN1A 5A0FA 1XYVA 4DW8A 4DRZA 3H2GA 4C7BA 2HQ1A 4EJ2A 5FQOA 3IUMA 4GOXA 4ZOBA 4LX0A 1SH7A 2XNDD 3TAXA 1CEYA 1VSQA 3Q9LA 2ZIXA 2SKCA 4G0MA 4R7TA 3M9LA 3AGKA 1CR0A 4WK2B 2R65A 4CIBA 4R9UC 3A9CA 1E8NA 5CBFA 4IUYA 2HYIC 5B55A 4PGGA 3GMDA 1ABBA 1YVPA 4HI0E 1J0EA 1HT0A 2DTDA 3UOWA 3IQXA 3TI9A 2A06H 3T7RA 1WOYA 3VQWA 5EZYF 5DCYA 3GR6A 5F3DA 3A0BZ 4XYMA 1B41A 2OBMA 2XITA 1MO6A 4KFRA 3I9OA 4L75A 4IG9A 4JWTA 4ED9A 3S7TA 1H4QA 3LT4A 4EJSC 5AVTA 4HN4B 1R6BX 3GWZA 4B7AA 5K0BA 1EFKA 1VI2A 5BURA 4B4DA 4GC9A 2YY5A 4MLPA 4TKLA 4DXWA 1W35A 3WIUA 5KAPA 4IVRA 4OHMA 1YO6A 4U7NA 3OBWA 1NQ5A 3EPLA 2QENA 1Q7YH 1FFEA 2Z6AA 4QQRA 5EHXA 3TZ6A 2QSZA 2ZRCA 1L5HB 1XV2A 4ABYA 2W6JD 3QX8A 1L1EA 1HQDA 4WDRA 3GLVA 3L4KA 3V5NA 4H16A 4AJ2A 4OQNA 3HXLA 4G4JA 2P5OA 3VPHA 5CDGA 2QNBA 4ER5A 4ZZIA 1UBSB 4JSRA 5AICA 3HN7A 3ZZNA 1QLEC 5AYVA 3HCOA 2HHLA 2VJOA 5L45A 5F2VO 2WWGA 3ZXYA 1WW3A 3P1JA 1P2SA 3T3EA 1KS2A 3A1EA 3QF4A 4WXEA 3UXEA 3IEUA 4ETIA 3K9FC 4PICA 1TRKA 4QFMA 4QUHA 1ENOA 5KYYA 3MJSA 4JBGA 4G4SO 5EEHA 2BWJA 5HZHA 1SKUA 3MHPA 5HY2A 1Q0UA 3ANLA 3C7KA 1HI9A 2G1UA 4ZCMA 1HR0O 1P19A 1N6OA 1GN8A 2ID4A 4RL4A 1M5TA 7MHTA 3EVAA 1UMBB 1LNSA 2NYVA 3ZHVA 1OF1A 3HYLA 3F6BX 4W1QA 1IBLO 5LQSA 1VOTA 1H0HA 1JKFA 2Z56A 2Z3VA 2YDXA 4XYBA 2LKDA 1A97A 3I37X 1UC9A 3KT0A 4F1KA 3CZ5A 2C61A 2YMMA 2FZVA 2FHPA 4D3XA 3K20A 1VM6A 3WKBA 1P1CA 2CUTA 3NCHA 1Z68A 3QELB 1FFDA 3D4OA 2ID8A 2OTJV 4YCNA 1PW5A 2JNBA 2GCNA 3CLHA 1NW8A 5EXDA 3T9BA 2EZTA 3EYAA 1FBNA 5JPDA 1A4RA 1T0AA 2PZEA 2OQVA 4RV5A 3UXYA 3G9ZA 3LOUA 4GP9A 2YNMA 3CE2A 1PD1A 1WTAA 3BSFA 3R24A 5K09A 2P77A 3GMSA 2YH2A 2CHFA 5FUXA 2O2HA 1NP3A 1U3FA 4D02A 2H57A 4UNRA 1HW7A 1U2GA 4OJNA 4EUEA 3AZOA 4BT6A 3D6HA 3D4BA 5KNLA 3HVRA 4X7PA 1T2CA 1G1AA 3DM9B 1W0JG 1XCJA 2YICA 3FUVA 2X9VA 4CVNA 1MHTA 4WOKA 4MR9B 4FHCA 5IJ0B 1X59A 2N46A 2LP4Y 1E2EA 5DISB 4C43A 1J8FA 2XJ4A 4PDMA 3E3NA 2NN3C 3BA6A 5G0SA 1ZU5A 1FP1D 2Q7XA 4KPEC 2A67A 4EHHA 1BHO1 5I5GA 2DWOA 2FSVC 3AIKA 1O6ZA 1I2MA 2BO1A 2QNRA 2B83A 3GPLA 1OB2A 1K8QA 5AVSA 4DZZA 1QF6A 3FPIA 1KVUA 4ZBMA 3L8EA 2RGGA 3IQHX 4YAIA 2C42A 3KQKA 3PVZA 3FDFA 3UK1A 2QU7A 1MOSA 2OCBA 5E0OA 2EIKC 3V7QA 1JV2B 4YN3A 1FXKB 4X92A 4Z0TA 1J09A 1A69A 2EIXA 2K2QB 4KQXA 1TL7C 5FNVB 3A9RA 4BU1A 5JZSA 3RR2A 1GTJ1 4LZOA 3TZKA 5UKDA 3RIGA 4FFBA 4OP3A 1DXYA 3C5WP 5LNK1 1M2GA 4MUGA 3GFOA 2VWJA 5HHTA 2B4TO 4G8DA 4JLJA 4AX8A 1A2OA 5F52A 3LL4A 2NTVA 3L7AA 3VM6A 4CN9A 5E38A 5I9MA 1XNQB 1QFZA 1XZCA 3G3EA 3NDJA 3LY9A 1DWQA 2WLJA 3OJLA 1ZNZA 4NZMA 4F9EA 4KGXA 1ONPA 4J9UE 1CIVA 2FF5A 3ROTA 2FDRA 2JI8A 4RCYA 1EFPB 1KSFX 1W4RA 7REQA 1D6SA 1OFUA 1GLNA 1DV2A 4KOEC 3G82C 4EY8A 2NZWA 4I8DA 1FFHA 5K4GA 4FMPA 2J9ZB 3T3GA 1Q0ZA 3PEEA 4EECA 1CZUA 3K5PA 5LA6A 1YRAA 1EZZA 2Z4RA 4KUGA 1SXQA 1G20E 4OPHA 1WXQA 2YRFA 1PKEA 1NV8A 1IJEA 1IZZA 2G83A 2WE7A 2ZJ7A 4JB8A 1SUDA 3STTA 1DL5A 4B5CA 5E7IA 1NLMA 2VATA 1NY5A 2VDQB 1H4VB 3L1IA 4NICA 4ZGWA 3NDPA 1W19A 2HJRA 4XR9A 2HA4A 1XAHA 2GN8A 3FPHA 1PL4A 2VJKA 4TYMA 1ES9A 1BEEA 3CWCA 3V4DA 5BSFA 4R1MA 4I9FA 1GA1A 2J87A 1V96A 5DGDA 4EO4A 3EEFA 2FY8A 3N4YA 4LI0A 1GUYA 1ZOOA 4WK4B 1VMKA 2HHAA 4Y1RA 4G24A 2VDWA 2QTHA 2XB9A 4MYTA 4EYQA 4I55F 3JS5A 2VBFA 1SUSA 2OZLA 2R62A 4JEUA 4JP8A 2P40A 4D0SA 3TW4A 2REXB 2FE4A 2Y3IA 3TJRA 1IJBA 2NV0A 2WF9A 4K9RA 4I99A 5JC8A 4KNVA 4X45A 5J2TA 2QMZA 4B4VA 4B1FA 1G17A 2CXTA 4TVKA 4G36A 4AKEA 1J06A 2D54A 3L1VA 3CIFA 3BMXA 1HZZA 2Q28A 4FGZA 3QGMA 1QTNA 2JARA 5IK2A 2NV2B 3T3OA 1QVZA 1OWOA 3FD9A 4F4FA 2ZJ0A 1SJ9A 4QG3A 3KB1A 3CTMA 1RQRA 3RFXA 1QLHA 3ME5A 2XWPA 3Q8XB 1XKXA 3RGWS 5IXJA 3DOIA 2AHZA 4FOOA 3ZDZB 2X0LA 3EVTA 3RW9A 3EFEA 3GT3A 2O50A 5HMLA 1YK1A 1N3IA 3OE7D 2V0CA 3ZHYA 3H83A 1Q1BA 3IO5A 3AESA 1TYCA 1K98A 2VRWA 1KFBB 2C5SA 3V4SA 3GVHA 5F7XA 4BNTA 4QU9A 4WXPA 2ZAMA 2NT4A 2WZQA 2LV8A 5LHGA 1ZD3A 3MBOA 3E3MA 3IC5A 1OY1A 3Q7QA 1JE1A 1FPQA 4FB4A 1QQBA 1W2BU 1KS9A 3SSAA 2HW8A 3TD6A 3D1LA 3BH0A 2IUFA 1JR3D 1OXMA 4YJDA 2C03A 3HBNA 3C3SA 1RM3A 4WBNF 3I05A 5CRIA 1BX1A 3O4VA 2I4IA 4KSCA 2UKDA 1NRJB 1Z8DA 4EG6A 1Z33A 2GKGA 2OYSA 1NJSA 4JC5A 1KH3A 3BJIC 4KBFA 3RBAA 1YR7A 4JSYA 1S76D 5EKXA 3QKRB 1U8UA 1EUCB 4EGFA 1CVIA 5HKKA 4AJJA 3X1MA 3O83A 4JL8A 2LDXA 4N82A 4GRIA 1GDHA 3RYHA 4RESA 2O0JA 3WQSB 4DK0A 2XAJA 3S2EA 1GZ6A 3PJGA 3FPGA 2EWVA 4ITUA 2QM7A 1WUTA 2BH9A 2YBEA 4ZO8A 4MVQA 3A7DA 3AM4A 3F98A 2IHYA 5DP2A 3DDSA 2F48A 4HWPA 3HFGA 4IIYA 1M10A 1O96B 3OLXA 3DLAA 4TT3D 3W6OA 2Z1NA 1H3NA 1OCOC 1P29A 4NK5A 2V58A 5BN4A 1YB1A 5FL3A 2PGLA 1ZN2A 4YUAA 2VLIA 3CW2A 2X0IA 3IQFA 3NBAA 4CIWA 2E1RA 1UJWB 3CF4A 4XDYA 5C2JB 1BMFA 1ORDA 1WLEA 1AI4A 3EULA 3MJVA 3VC2A 3USCS 3BQMB 3JQDA 2DTEA 4RTSA 2YXHA 1Q11A 4IDAA 2YYSA 3UQZA 2Z1EA 4LRYA 3VR0A 1PR0A 2XUKA 1SC1A 3BY6A 1W6RA 1NVKA 3IAAA 3U49A 3UHFA 4J0FA 4J4HA 4KLNA 3V32A 1ZH8A 1TI7A 4NU5A 1U2DA 5IBRA 3VTKA 2MHCA 2I6QA 3DJFA 5A7HA 3Q72A 5J5VA 2JJ2A 4XVCA 2QWNB 1QBZA 1STOA 4IKEA 4J90A 3VUEA 1YR6A 1M73E 2RI0A 1HTWA 1SVIA 4L51A 3OFND 5EHGA 2CGNA 2PAAA 4TQUS 5EFOA 2XNJA 4PV7A 4UATA 4CQNA 4L7QA 1A9RA 3TZEA 3HLYA 5H9CA 2R7KA 1FMLA 2VF7A 1TECE 2VP6A 1A5SB 4HUQB 1BVRA 1T5IA 3F3MA 4NARA 1W94A 1G64A 3SG0A 4LV8B 4PG8A 3V1TC 4BY9E 2RDMA 4FOLA 4DE5A 1GPNA 4WA7A 3A6PC 5FTKA 2QWPB 4XKJA 3OJWA 5BQPA 3U0BA 4XVUA 3LMKA 4JP5A 4J6FA 3JQ8A 1SCJA 1EE9A 2F1IA 4RMNA 4YJ3A 4C3UA 5LP1A 1IBSA 1T9BA 4UTNA 1M7BA 3RS4A 2Q5CA 1QIMA 1BE8A 1A9OA 3CNLA 4LYFA 2QPTA 3H9JA 1EG7A 3RS2A 4HNVA 1XEAA 2B78A 3EZGA 1NFFA 2Q3HA 3X2QC 3IFSA 5AK5A 4WZBE 3QYPA 1JDJA 1PW7A 2JL1A 3ANYB 2ZVQX 3OUUA 4F6RB 3THOA 3MELA 3V1MA 5HCIA 3SJAA 2FNAA 1FP7A 3MWJA 1GU0A 5DW0A 2Q7DA 1KZGB 5H5NA 2B4RO 3NHRA 4U3JB 1DFHA 1DXOA 4BEWA 3N7UA 1SC4A 1N0UA 3TR6A 2A86A 2QRKA 1ENZA 3EIHA 1Q43A 4U6QA 1MGPA 4HFNA 5DV9A 1Z6YA 3RSCA 4N54A 1RHQA 4YT8A 4Y6LA 3USES 3BORA 1BX3A 5C9ZA 4NB5A 3ZHUA 4BPBA 1XCMA 2PU5A 4FDMA 4LPKA 3DL4A 2X2PA 4ANFA 3OT5A 2V8OA 3DAOA 3MS2A 4CTJA 9ATCA 1MZFA 2GKSA 2WD9A 4YFVA 4OMFG 4UMEA 3KOXA 2KQUA 3KQOA 4LNUB 2ZUSA 3GCGA 2P1DA 3X2FA 3CX6A 4GHWA 1Y0BA 3A6EA 3HR8A 5I8PA 3OQIA 3J7AR 1KTVA 4LJRA 2NP6A 1P91A 3A4TA 3OOEA 1EM8A 1XDDA 4HNQA 5I7SA 2KSQA 1GZ4A 2B7LA 4U2CA 1Z4QA 2JBHA 3RFCA 3N0TA 4B6SA 2F6RA 2GFIA 4PLFA 3G0OA 3IB6A 2BKVA 4LOIA 3AJEA 4U7HA 2YIDA 4JI4O 4OB7A 1GA6A 4RQAA 1HEIA 4DHWA 5BOVA 2Q9AA 2YYEA 3SSOA 1IURA 4FHZA 3PRHA 3C39A 3T80A 3OHPA 5BPHA 3K2IA 5TMDA 1GYRA 1AKVA 3NNSA 3P9KA 1N5DA 3RBXA 5CA1A 1Q5PA 2PRYA 4WFKA 3ZXXA 5JANA 1V7ZA 3ZGLA 4AZSA 5LNK6 1E2JA 4PPFA 5AUOB 3A2FA 2C8LA 2FMHA 3R5JA 2GJ8A 3P71T 3BE8A 3W5IA 3VI3B 3GCDA 4RPIA 1YK0A 4BVQA 1E3LA 5HY0A 1Z6ZA 2ZXWC 1XN4A 4Q9AA 4HNUA 1IIBA 3V6LA 4IDDA 4DS3A 3KE8A 1QR8A 4DR4O 1FYXA 1UJ5A 2O3RA 4DQKA 1OILA 3OQJA 2HPAA 3L75H 2BSAA 4J2HA 4Y2YA 1T25A 4RDXA 1XXHA 4DN6A 5ILQA 4F04A 3DLHA 3WE7A 2BZSA 2G1PA 4Y9RA 2YZ2A 3X0DA 3FVVA 3VO2A 4Z1MA 2ZUBA 1GGVA 4RGVA 4Z86A 4FZJA 1F8YA 1JJ2U 4NZZA 4TV9F 3EMKA 4UDXX 5BW5A 4NYMR 4L3WA 5FV7A 3PNPA 2J09A 4OLFA 4TVOA 3DBRB 2ZDHA 3L8ZA 3LAWA 1ZMBA 4F97A 2QKAA 1V95A 2VYQA 3JZIA 1OVMA 3AUUA 1U40A 2KX7A 4B09A 1MR3F 2PH3A 1NJFA 4EZBA 1TIPA 1HFEL 3LYAA 3AILA 4NKGB 4Z4FA 3CUKA 5CCXA 4DREA 3DC7A 2D2IA 1ZJ6A 2YJ4A 3WMRA 1U43A 1H2SB 3IALA 3FX2A 3FNRA 2ZVZA 1S77D 2VHUA 5C31A 4X20A 1R6AA 4W4KA 2EIHA 4RL6A 1TLTA 3ZP4A 4QVKA 2A5LA 3ICOA 5JV5A 3FOZA 4IZIA 1LZKA 4LBZA 3SC3A 1EFDN 4UAUA 4Y2GA 4AKGA 1YCDA 1J21A 1BXZA 3O8OB 1XHOA 3HMKA 2CKMA 3LG2A 4ZIBA 1IEXA 2Y66A 3I76A 1Q3KA 3OMAB 3GYQA 5A7FA 4FLVA 4RH3A 5H80A 2XBMA 4YB8A 3U1BA 4G0OA 2OSVA 1V25A 4NBVA 3QMMA 4BFTA 3U3OA 5GZ6A 5KJ6A 5BMVB 3BRWD 2YVLA 1ZN7A 2ZPAA 4GX2A 3B6EA 4K6KA 4V38A 2RMKA 1Y42X 2FK7A 4RORA 3LUKA 1RRFA 4LTDA 5BN3A 1H93A 1QM5A 3GD5A 4S2UA 3HSYA 4D3ZA 2H8EA 4IGGA 1V5EA 1M1YE 2H1LA 1GX1A 4KAAA 2C3MA 2EL7A 2A9JA 4BVFA 1Z2CA 3HKDB 4Q48A 3G5AA 4UUOA 1AKNA 4CI0B 2NSHA 4F3CA 4CZZA 4KEAA 4TSFD 1P62B 2HLDD 5JO0A 3TEMA 2QEXV 4NEQA 3EXHB 1NTKH 1UBCA 1J2EA 4WNYA 1QYCA 3SLKA 4YACA 3EHBB 1L4UA 2P69A 2ODQA 2EW2A 4E3ZA 2H7VA 1QIJA 1AHPA 5CDSA 5CB4F 3Q85A 3LL7A 2HHHO 1ZISA 2HMAA 5EC1C 1NH2B 3Q8KA 1U4SA 3RHZA 3LLMA 1M8FA 2WILA 3KM0A 4DV6B 3VXKA 4CM7A 4UVCA 2ZIUB 4UNPA 1UZUA 2XLCA 1QQAA 4XLZA 3E5HA 1UOPA 3UBMA 4G0NA 4DEVA 4INZA 3WLPA 1NM5A 2GVIA 4ZI7A 1RXEA 4YECA 3KSDO 3JWHA 1OBHA 3I28A 4CT0A 4L2IA 1R16A 2EF0A 3PUKA 4KTVE 3K9AA 5DH9A 1I7NA 3FFXA 2G71A 5CLLA 5JECA 3AR3A 4YJFB 4RA6B 1ZCJA 2JJQA 1E4EA 1K75A 1KOFA 4CIVA 3ZG6A 5CR9A 1XYYA 3WYEA 3UMMA 3FYSA 3HI6A 3JVDA 4AMYA 4NK4A 3COYA 1QS0A 5KB3A 2ASEA 4RGQA 1YZFA 4K8ZA 1BS1A 3C97A 4ZCIA 3GY0A 3JRNA 3I01A 1THGA 1H05A 1WAMA 1XA4A 2QKCA 4BX0A 4RJTA 3AIIA 1UI9A 3QO8A 1M1KH 1DAPA 2PLFA 5KZMB 3CLVA 1NY6A 1CDZA 5AESA 2FR0A 3OSUA 1ACLA 1VGVA 4E21A 2PMBA 4P92A 2QN9A 4EUFA 4KG7A 1L4BA 3LE8A 3WGOA 3T15A 4EB8A 3UCEA 3Q9UA 2ZIFA 2IEIA 1J90A 1ZOSA 1U8AA 3F78A 2VP4A 5HG0A 2DZDA 1KGDA 1CQIA 3S55A 4WGFA 4NNJA 3KSZO 4NZPA 4Y2QA 2AN4A 4DMGA 3PFIA 3EPKA 4AF7A 3JAWB 3O47A 1KDOA 4KODA 5KTPA 2HK8A 2YJGA 4ZTBA 5CA0F 5E7QA 3UWPA 6YASA 3Q5DA 2BEWA 3K9NA 2I99A 4MW3A 3QHAA 1FRZA 4JDUA 4G0XA 1ODTC 4B7KA 3LQ4A 1JTFA 1KIMA 5CDFE 5ITWA 1DOZA 1WSDA 3Q8LA 3G6KA 3SDZA 2JVKA 2Y4UA 2GASA 3OCZA 2E7ZA 4MA4A 2FW1A 2JKZA 4G0ZA 4B81A 2VRZA 1UXKA 1USIA 1SC6A 1GYPA 3EK2A 5TISZ 4LZNA 1XZQA 5DGXA 3M33A 4ZP1A 3OQOA 4IF6A 4WKCA 1AR1B 3KJIA 5AJXA 3DAPA 3RYTC 3SC2B 1IDSA 3Q6NA 3NHSA 4C05A 4CYMA 4DV0O 4EI7A 4XYEA 5E4FA 2CMHA 1PV4A 1RQNA 3FGOA 2VCYA 2QDXA 4MCIA 4BNZA 2GOYA 2JKVA 3PJDA 1ZINA 4NXMO 3SPIA 2ZJZA 3H5NA 1MJ5A 1O54A 2N0SA 2OFPA 2FPIA 4AUNA 2JDIA 4ZD6A 4QVIA 2H4XA 2IY8A 3SZOA 4RE5A 4XM1A 3AYXB 4H4EA 5FB3A 2XOKG 2C96A 1BQZA 4QRIA 2WKSA 1MX5A 2B35A 2QAJA 4O2LA 5EJ8A 1CKEA 5BSKA 4IH9A 3IAS6 1SCDA 1KPIA 2GH1A 1D0IA 3DZKA 5C5EA 3K6SB 2XBUA 3UFXA 3OP4A 3KYBA 3QTLA 4JBWA 4OUKX 5F2OA 4P3OA 4EITA 1HDIA 3THXA 3S0YA 4Q3EA 4DJEC 4TVSA 2XAUA 4QTZA 3ZHOA 3A1FA 4YXFA 4OY3A 1EX6A 3I1IA 1TF5A 4PHCA 4U7DA 3Q88A 1X7ZA 1XWIA 4M9XA 1GM5A 2JIZA 1NGSA 4IGKA 3A9UA 3HSKA 1CEEA 4DMUB 1HX7A 4HPXB 3VNQA 5JAUA 4G4IA 1ZRMA 3A06A 4U9UA 2QZ9A 2PKQO 1EQUA 2RGXA 1XL1A 3IBGA 3P0HA 4GPZA 4EG7A 2QORA 1KDTA 2Y48A 1N2XA 5G0VA 4UPVA 4R9VA 4US1R 2HK7A 3KE9A 5CN0A 1UFKA 3HL4A 3K8ZA 1JCHA 3AFHA 2WYIA 4I50A 3HZZA 4JX8A 1COWD 4EHAA 4RA9B 3UY4A 4IYIA 2P9JA 3OA2A 4B45A 3L6EA 3D7KA 4O5OA 5F5NA 4CTMA 3GWOA 1O4WA 3ZO8A 1S9HA 2GPJA 1YZQA 3MMPA 3D2BA 2VHTA 4E5KA 1M5UA 2C92A 2AFHA 2GZ3A 2I3DA 3VR4A 4NOKA 3U60B 4O4LA 3H97A 3K72B 2PSFA 2V7VA 5IAEA 3ILHA 3R7NA 3T1NA 3O7WA 3O8BA 4YAFA 4TKVB 2C5EA 1KI3A 3WBBA 1DKNA 2AYXA 5JI2E 2WHXA 4BAGA 1CX9B 3QK7A 4NL4H 3DTUB 3R3XA 4N5LA 1RRGA 1JIXA 3AHEA 5K2OA 5F3WB 4LRTB 3OO0A 3AK4A 5EUBA 2W9XA 4HUTA 1QR6A 2OFOA 1ZD9A 2V98A 3NKLA 2Q4RA 2FWMX 4JITA 1KEZA 4K3AA 4CUJA 3MAJA 3PQ2A 3D81A 1JECA 3LFHA 4PBTA 1U31A 1G3QA 2CY0A 3ZTYA 3IVCA 2BBOA 4HAMA 2C98A 4QLOA 2JH3A 1D2MA 1VKOA 3DE4X 1FFBA 2IVFA 2JLBA 2WMNB 5HVNA 4B8YA 4EGJA 2KPOA 4Q3BA 2EX1A 4BVBA 1JE0A 1ZD5A 3GRVA 1DKLA 1Z8HA 1VE5A 3JVUA 4URWR 2Z43A 3G2JA 1KI4A 3RRMA 4FIPC 1UWKA 4GRDA 1SXJB 1SUEA 3RK4A 1U11A 4AJEA 1F6DA 3QG5A 1XMXA 2Q07A 2EKQA 3QPDA 4K2HA 1QHNA 3TR5A 1E6WA 4X63A 1Z73A 2SNIE 3EPPA 3LNMB 3R4CA 4JV5O 3I5UA 2GXQA 3ELCA 2VSNA 4YROA 2D0PB 2YJ3A 4MW4A 1GAQA 1E2MA 1ZSYA 2PDAA 5IHPA 3D7MA 5HF5A 4ABMA 1GKLA 2Q6TA 3LBYA 2V4MA 4YRKA 4UM7A 2GTPA 4OVKA 3FLAA 4WESB 2XGGA 2GZRA 3GEPA 3AB8A 1DTOA 1XMQO 1DCKA 3JRWA 2RGBA 2R84A 4M0EA 4WPGA 1WPRA 4UZSA 4PCLA 4HDNA 3UWDA 4WINA 3JV7A 1W93A 1VL0A 2V65A 1YR1A 1KDRA 3CGWA 4TXMA 1P17A 1P5RA 2EJCA 2DUJA 5ECYA 2PUTA 4D44A 3QNEA 3RLFA 1T4DA 2YY6A 4N5DA 2YWXA 4R2MA 4JENA 5LL6P 1JX9A 1JY8A 3L8MA 4ICIA 1U02A 1Z5NA 1P7CA 2GT1A 3LDCA 2O14A 5NLLA 4GDFA 3PGMA 4LWOA 1RFYA 3ZX4A 2XMGA 3ZDQA 2IOHA 2HWWA 2P65A 3R9WA 4YRPA 4X24A 4HMQA 3B2EA 1OCZB 1BN7A 2AC4A 3AY3A 3SICE 2FN3A 2W0MA 1LI7A 3ZZ0A 3HCRA 3C9SA 2CDAA 5EXPA 4FCWA 3ROPA 4DDWA 3FGNA 4HAVA 5GMOA 4NV1A 4I7EA 1T3TA 3L05A 2VHVA 5BW6B 2NU8A 1GL9B 3BL6A 3MJTA 4JLKA 3W2TA 1PG2A 2BEVB 2OUKA 1JT2A 2WOJA 3FWKA 1GNPA 3EEIA 1DJOA 1R4NA 4XB1A 4R40A 1AUXA 1TO6A 3MIZA 5IHXA 4IX1A 4AJ1A 3A2LA 4BO6A 1DAEA 1AP5A 1ABFA 1ZHHA 1B0UA 4QUBA 1OGJA 4IQFA 3IUPA 1WUKS 4ENWA 2AFVA 1JVBA 1GTZA 1YJ9F 3O3OB 1NVBA 5JHHB 1O94D 1TVEA 5SYAA 3V1KA 3LWZA 4PI0A 2GLXA 2R1TB 1VFPA 2HMUA 2ZJBA 3TW6A 3I3FA 2EJ7A 2IDMA 3M1YA 2F9FA 5DWQA 3C4VA 1I6WA 2C31A 4BB9A 2BE9A 5EZYA 2WIFA 1GZDA 3C9RA 2XKKA 4YMTA 3O3CA 4BP8A 1YA6A 1L5VA 1ZP6A 5KQMA 3S06A 2B6HA 2NZ8A 1CJVC 1Q44A 1SURA 2DERA 4RD1A 3W2FA 5FBWB 4QDKA 5H3HA 2VF2A 3BM5A 5HXZA 4JXJA 1SZQA 4V3CA 1GO1A 4LZWA 2WB4A 1KDYA 2ZJ4A 3U7QB 1ZMOA 3E89A 2JGDB 1OH6A 4UUMA 1JDUA 1RYEA 1E1RA 3PC3A 3U4CA 5KNDA 4BNWA 5ETJA 1N0VC 3KU1A 4HEQA 1BE6A 3PZBA 3BXPA 3IIEA 3TG2A 1RBMA 3KVYA 2A0YA 3GJTA 3EIOA 3USZA 4W1PA 2IYSA 4WFQA 1DFIA 1U28A 2UXXA 1ZNXA 1XLTC 4ZIRB 4GO1A 3OIDA 4RTPA 4IH4A 1U2RA 2CK3A 3O8NA 5CHYA 1ECPA 4HADA 4G4ZA 1V3VA 1R6KA 4JI3B 2AHYA 4JJEA 3LZDA 1VQKV 1H2RS 2P9ZA 2H8CA 1ZI8A 2C5HA 4L5YA 1VSTA 5L3SB 1Z2GA 1X38A 1GR0A 3L93A 1C7QA 3Q7RA 1KDZA 5J43A 1P6XA 2WYVA 3DOHA 3HSSA 1OFUX 4BUCA 4ZODA 2YC4C 2H2DA 2QLMA 3ES9A 3R6DA 1R3UA 5AH0A 4UE6A 3OBIA 5KNBH 4HAYA 4LYHA 3KHNA 3RIHA 3PJRA 5F76A 4IDNA 5GVRA 4KKXB 5JXJA 3CC7V 3CZ4A 4R8CA 1TZKA 1M2OA 3AOEC 5FTNA 4IDEA 2DHRA 2Z01A 4QUDA 1V35A 1JHAA 3I30X 3RLIA 3NC0C 4G2TA 3FWZA 1DJNA 4FHFA 3EC7A 3UHJA 3W34A 3ENWA 1F3OA 5I7OA 4LXHA 4RF4A 4QNRA 5B6IA 4MGYR 5KU7A 3CUYA 5LUAA 4I1YA 1J25A 2OK8A 1RCFA 1DVRA 3EIXA 5IWCA 5LPNA 3MUOA 3RAGA 5L3QB 1YOVB 3HXPA 2HSJA 3QVXA 3DAGA 2UYPA 3KG2A 2CLKB 1IBMO 1BAPA 2BFFB 3F9CA 1P2VA 3NTLA 4O4JF 4WCEV 3HJFA 5JBNA 5FOQA 3UV7A 2XRMA 3K12A 3AEQB 1F20A 4NDZA 4K0KB 3IKLA 1ECJA 2XAHA 5L3EA 3DWGA 2HA6A 5E6UB 5KDOA 4IJUA 1YCFA 5J2UB 4JI8O 5DPMA 4U7PB 3CINA 5C81A 4ARSA 2YNMD 1PHPA 1W85B 2ZCEA 1T0HB 2A9QA 3IGAC 4XQGA 3EMBA 3TQTA 5DTEA 3RD5A 3P0FA 3NO4A 3L1HA 5EJ2A 2X40A 2AN3A 3RI3A 1FRNA 4O3FA 2GNPA 1VL1A 3DOJA 2GFHA 4CQJA 3NZEA 3B8MA 1YU9A 4L8VA 3SYKA 5LP6C 2QZPA 5IAKA 9LDTA 3ZHBA 3NP7A 5HE9A 3EPHA 2Q6AA 3I2KA 2YOFA 2Y1XA 4V0NA 4RTQA 2W6IG 3PEUA 2ZJAA 2J9GA 1Q92A 3G2HA 1VCIA 2QJRA 5U1PA 4P3PA 1Y7TA 3DXFA 2ZE5A 2Q5LA 3WQQA 3KHKA 1T3LA 4TS4A 1E9CA 3LVQE 2P4UA 1Z08A 1K88A 2V7TA 2QT9A 2X14A 4JI1B 1SELA 3OPQA 4YAUA 3QQPA 2H4ZA 4ACBA 1ZUQA 4N7MA 3FYUC 1BROA 1E96A 4CKYA 1GCUA 5ECWA 5C18A 3A37A 3STZC 1BCCH 3IHKA 1O5TA 2QI2A 4R7CA 1ZD2P 5JCOA 4LQLA 2PBFA 1OWPA 3HLKA 5ERYA 5EMLA 1HK7A 3OZFA 3NEJA 2FLVA 1AMUA 3DD5A 2I7TA 4C4XA 1K6XA 1N8TA 5IVKA 2CVQA 3G0IA 3OQMA 4J10A 5B37A 4U00A 4G9EA 4CQMA 2AMYA 3RIMA 1ULTA 4WY5A 4PCUA 3I6ZA 4IFEA 4BFCA 2FSIA 1KC3A 4EGSA 2GZAA 5K0CA 5BWNA 3TXSA 5AM3A 1SPBS 5K8JB 2XRZA 4INJA 3RCBA 2FU5C 4FLZA 2E5LO 1A7UA 4HDCA 4P7BA 1ZCFA 6PFKA 5AW9A 2GUZB 1TJ5A 3LC0A 1OAOC 3F73A 4YPOA 1TF7A 3K0GA 2MTBA 4NENB 1KMHA 2BHTA 1VJRA 4DWVA 3FB5C 3BOSA 1N0JA 1YS4A 3DUWA 2UUAB 2F3RA 1WB6A 1ZJ5A 1ADJA 3HPLC 1AE1A 3B1ZA 4EHFA 2QI9C 5K03A 3QF7A 3QYFA 2WFAA 1U90A 4I55A 3EPJA 3COVA 3NV9A 1A3CA 2WICA 4FZ5A 2Q49A 3DHYA 1R0SA 4JVOA 5BQXA 4WJZA 3E1YA 4FMCF 1XTBA 4ZA2A 4FWIB 2OHWA 4A5OA 5FYDA 1ABEA 4RD0A 4JI0B 1ULZA 3JYCA 5C1OA 3CPSA 1Q14A 5KDLA 2YHBA 2RB9A 1N92A 1GMGA 3VNAA 2B0CA 4FGKA 2GAAA 1QBKC 4H17A 3E3AA 1U7DA 3OPYA 5AR1A 5KTRA 3KR2A 4LXUA 1RBYA 5CFZA 4GM1A 5C7LO 4MQLA 3ZKWA 5J4HA 3SQDA 1SZCA 5JHGB 2PS0A 2QE6A 1ZJ4A 2ZI9A 1XTRA 3BPZA 2R5NA 3KDAA 2RHMA 4R9NA 3C3WA 4DV3B 2YX1A 2A5DA 3JSNA 4DCCA 2RKWA 4DIKA 4P7JA 2V9ZA 2Z95A 1FZQA 3I4FA 5SZKB 2C4WA 1JLLA 1L6RA 2B36A 1K8RA 2NO0A 5AW0A 4E22A 3H1AA 5IK2D 5LMNB 3A1SA 4ZVMA 1OH7A 3F8WA 4B76A 3RVOA 4UUBA 3R6WA 4PSAA 1KR2A 2R72A 4NYIQ 5JD6A 2HC9A 4FVMA 1VPWA 3T9AA 4LF9B 1KQ3A 4N3CA 2AK2A 1JPXA 3HCFA 1U98A 5JCPA 3M5WA 5DHFA 3FNBA 4PANA 4KOAA 1JIIA 5EG5A 1GWNA 4NWIA 4OMUA 1QKKA 1MG0A 5C7IO 1O0CA 2JVDA 3ABZA 2O05A 5A4AA 4XUCA 1E6MA 4WBNA 1YU6A 2UZ1B 2O1XA 4GI7A 4IKOA 4HXYA 1AGYA 4BO2A 4KQEA 4BYMA 6ABPA 4YQYA 4C4PA 1K7CA 4DCTA 4XQEA 2G9RA 1ZIXA 4ZVLA 3HI4A 2IY9A 2Q9LA 4L9SA 2ZJ5A 1YHNA 1F14A 1ZUWA 5HUJA 4GVLA 1Y74B 1IK4A 4A8JC 3TLXA 4MXDA 5K6AA 2AFIE 1DSSG 3KIPA 4R2HA 4H15A 1WUHS 4OO3A 2EILC 1XEQA 1GTOA 1GZSA 4X90A 1CXZB 3QPUA 1ZCBA 4B3GA 1QYRA 5K0JA 2R1UA 4YJHA 3T3IA 1JVNA 2WFZA 2HXYA 4U7OA 1T4MA 4C1BA 2B1RA 1IONA 1O4VA 4QQFA 4JF3A 1EE2A 3DB1A 1KWKA 3OE1A 3VH3A 3ZYCA 1GG5A 4KIJA 2YMPA 1JHPA 3G85A 4HNSA 2XVXA 4DY6A 5KTOA 1V0JA 1Z12A 4KPFC 1K5SA 4X8MA 4TKMA 3ROGA 2GN4A 3IHWA 3A32A 4X6UA 4KI0A 2R6CA 5AVQA 5AVXA 3HKBA 1MZVA 3C90A 4JMPA 3UJ9A 3THWA 3RK0A 4RHTA 3V8NA 2IQIA 3PDUA 1C7EA 3WICA 3WGZA 2UYYA 2X1VA 4X3PA 3VR6A 1V5GA 1FYDA 4HDRB 3G5MA 3JATB 1GO2A 1ECBA 2B7CA 3P52A 3GPIA 1WLSA 3ROXA 5TF0A 2VQ3A 2GEKA 5A3RA 4TL9A 1CJBA 3OFSA 3CX7A 4BW0B 3DEZA 1BMFD 2C20A 4IO1A 2PUCA 4D4KA 4BN4A 5DW3A 2NMVA 4CKWA 2R6DA 2IEAA 1XZDA 1AU9A 4BFSA 1R6NA 3OWOA 3RSFA 2BSQA 1XU7A 4IIGA 2IDZA 4OKSA 3GQBA 2DULA 2ORED 5A5EA 4DIDA 3HE3A 2C4NA 5C5IA 1WP8A 1LXCA 2W2LA 3IAM6 2PH1A 1YTLA 3D8CA 4IIVA 3DYVA 1KORA 1O2DA 4MYHA 1AHHA 2Y4OA 3WZLA 2J3HA 2R6R1 1GL3A 3KCXA 2VRCD 3IUYA 1V1JA 1U5BA 3VU9B 2JJ2D 2A6PA 2A0LA 1N2ZA 2GHTA 2GEJA 1LJLA 5E1BA 3FMVA 2ZVYA 4DR5O 4YUWA 3JQRA 3LIPA 2ATIA 1QVAA 2BD0A 3STHA 1JA1A 1E6CA 3GRRA 1PJ2A 3P9IA 2MSNA 3HBLA 2NXJA 3QIVA 2LP7A 2SKEA 1I3KA 5F23A 3PUZA 4BJ5A 5A6SB 4O0MA 2P30A 4UCRA 5BY1A 3IEVA 1MBZA 2RB4A 3K6KA 3MJFA 1E32A 5DHPA 3MEQA 1IATA 3KDSE 3R3UA 3KE1A 4ZHWA 5BVGA 3BCUA 2B8JA 1E1KA 4K87A 4M8NE 4YUXA 1OFGA 1TJPB 2P0AA 5E4JA 4U0KA 2G38A 2FX3A 4DGSA 4B84A 1FYFA 1TTHA 4KV9A 4MTCA 3NC4A 3JPYA 2HCJB 1VQ9F 2JASA 1RHJA 3WLMA 3UCSC 2JC3A 1IXKA 1ATIA 3Q8HA 4KQWA 1VQ8V 4LFAO 4ND4A 1H2YA 1X70A 3T1HO 1DQYA 1LDMA 4UU8A 3QIAA 3Q6IA 1AKMA 2BN4A 4TYYA 3RWBA 1KK3A 3WKCA 1I10A 3P4UA 4C89A 4PRKA 4PLZA 3TR0A 4Z54A 4QSHA 4JYPA 4RHFA 3QHQA 2WJIA 1PL6A 1AS3A 1FP2A 3U4GA 3CMAF 1GKUB 3HJWC 4CLXA 1Y8RB 5CH5A 4C0HA 1PWHA 4OXNA 3MCWA 1MG5A 2I54A 2V4UA 3O26A 5LQDA 3PQEA 2H1FA 5T6MA 4MKXA 3UO3A 2P75A 5AI8A 1S96A 4JIMA 4YYZA 2JIQA 4Y9UA 4B3RB 1EFHA 2GBIA 1M2JA 4Q3CA 3B78A 2IXBA 4DABA 4RFSB 2WB2A 3JZAA 4TRJA 3ADCA 3SJBA 3LWDA 3ASOB 1K4CC 4LGYA 3WLOA 1AJPA 1QK4A 5FWYB 1E7SA 3ITEA 4EG4A 4DJFC 3LWOC 1JA8A 2AX4A 3ND5A 4DLKA 3I3OA 3K94A 1IUKA 4EEKA 1EP3B 1EESA 2P79A 5DXAA 3GJ3A 3WYAA 4P93A 1SWWA 2M6YA 4HT3B 2H1HA 5MDHA 1RPAA 2K7ZA 5JWHA 1P7VA 1Y98A 1ZXLA 4RTLA 1VJ5A 1QYWA 2A5GA 4D6TH 2GSWA 3EFOA 1TU3A 1MAVA 1PKXA 5T5QA 1HFWA 2ERYA 2P67A 4F0JA 2YJZA 3IILA 2PO7A 1E7RA 1T9CA 3HBAA 2VSOA 4PAGA 4TUYF 1IAVA 4JYCA 5ALVA 3MILA 3W77A 4QX6A 2CJYA 3M9XA 3WNDA 1FY2A 5I9BA 3TJZA 4HZGA 2XMBA 3TECE 4NECA 3ITDA 2Y05A 3PL1A 3FZYA 3DOFA 3OU2A 5IT9A 1IUNA 2NVUA 2YIMA 4CPDA 3LBHA 2WF7A 2JHGA 1UMCA 5TT0A 3LKBA 1FPOA 1GPKA 4MVRA 4TV9A 3TSOA 2JAXA 1QAOA 4UXJA 1ADCA 3FAZA 4F6LA 3UC9A 4CG0A 1NN5A 4PYIA 3V1YA 3N9IA 3PXCX 4YIKA 1XK7A 3FD5A 1LNQA 3HV0A 2G9QA 5KKAA 2JFUA 4TXHA 1U4OA 1NT4A 1FNMA 3WIOA 4FGUA 5DU2A 1KI7A 1KKUA 4KU4A 2QL7A 3WDSA 4Z1MD 1H1LA 1NMSA 4CFSA 4FYVA 1KQPA 3SJZA 1QVRA 1ZK3A 4E4EA 1O7JA 1AK1A 3HGTA 4OPMA 4G9GA 4A0GA 1L8XA 3I6MA 1H2AS 3D3EA 2FZ4A 3LCJA 1N8RW 3JASA 1MAUA 4DB2A 4A2WA 3O0DA 4JDPA 4O8CA 1NJIW 3SC6A 2PKCA 3L8HA 2OYRA 4CEJA 2GJAA 5K2MA 1XMJA 4GZ3A 3S3TA 1EI9A 4KSBA 1F9AA 5TEWA 1SC9A 4C4WC 2E5WA 4P5EA 2GEUA 3RAPR 2GLTA 3WBJA 3CPQA 2IH2A 3KHTA 3GLSA 1COMA 4OX9B 1IXRC 1PNRA 4UVDA 1CJMA 2XKAA 3KJKA 1B6RA 4HTFA 1XCBA 4Z53A 2D5LA 3NOQA 3ZRWA 1YR9A 1S2DA 4K7JA 2K4MA 5F33A 3CCUV 2DFNA 1DARA 4UE3S 5EUQB 2QJOA 4QIHA 5IC6A 4PRLA 2WWFA 2FPMA 2ACVA 2OFWA 3GEHA 3CWZA 5KTMA 4AICA 3HYNA 1R6UA 2RCNA 3K5WA 4MS2A 2HREA 4P4SA 1NE7A 4JNCA 3B36A 3O92A 5KJCA 3MMXA 5ULLA 3C9UA 4H31A 4JQOA 3L04A 4MIOA 3AEZA 2LRHA 4MB6A 3ZZTA 4TGLA 4J6EA 1X4TA 1GPDG 3WK8A 2AFRA 4EPVA 5JJLA 2VC2B 4NABA 1Z22A 3FBTA 4ZDIA 5CB4A 4EEZA 4CUZA 1LPMA 2TSYB 3H6HA 3EGXA 4YRNA 4YY3O 1CUHA 3TQOA 1Z4PX 3KWFA 1C9DB 4R84A 1W57A 5ABPA 4UUAA 3RADC 3M4JA 4X62O 3UEOA 4RKYA 1MEOA 2KGWA 4ZANA 1DJQA 2IH1C 2IHNA 1R0RE 3WRWA 4XVQA 2P6YA 2XMCA 4CR7A 1JNXX 2GJKA 1QZZA 3GYBA 1P45A 1IM8A 3TGPA 1G9TA 2YXLA 2W0SA 4G1BA 1SC3A 2QLBA 2QM4A 4ZJUA 1C1HA 3J81N 4MIKA 2VJBA 5G41A 2C1ZA 4ZVNA 5AJVB 4QE9A 2EIJB 2IX3A 3LOPA 2JIPA 1OZAA 3B7WA 2R11A 3AQIA 3NNNA 4LQCA 3LM8A 2IXFA 4B6OA 4WXRA 4YS6A 3PRYA 1Z8FA 4O1IA 2CMFA 2WIJA 1SCIA 1QGYA 2N48A 2XGMA 5B3JC 4LC1A 3LPDA 1Z5PA 2ZCUA 3HXTA 2MSLA 4WAUA 1LPSA 2GR9A 5EFZA 2ZBEA 2DH5A 4EKGA 1JQBA 3D9QX 4ZKEA 4UOZA 1ZOLA 2C58A 3OM9A 1HNXB 5EBLC 1IB0A 2BFBB 2AYZA 4WNIA 4N6OA 2Z98A 3L0CA 1XRRA 1KO4A 4QXAA 2BR4A 2PTGA 4J8PA 3MCZA 2IA5A 3H9UA 4HRVA 1T8TA 2GS9A 4D7AA 1SQGA 3JQ7A 1NXPA 1JR4A 4NI5A 1T34A 3GN2A 3O1HB 2PR2A 1Y3FE 4MDYA 1Z4MA 5AK0A 5CA0A 4B4KA 3TSYA 1O6CA 3ENKA 3ZUGA 2VQ6A 2UXBO 3CH7A 3VOBA 3OLQA 5C4MA 2LVBA 2NO7A 4BNIA 2WMDA 3RJZA 4REMA 2ETNA 1N32O 4O59O 2AR0A 2XZPA 1KAHA 3ER9A 1T43A 4IJ6A 3CLSC 2H65A 3VYUC 4NS1A 1IZ8A 2A78A 2NZVG 3RAFC 4B4OA 1J70A 4NNOA 5K3EA 4F9FA 2JZNA 1EHIA 3IR9A 4BX2A 3QVNA 5I3ZA 2J3DA 1DXHA 1XZHA 1OROA 3E8SA 1W76A 3MMZA 5IN4A 1EVQA 3KT8A 4G0QA 4KWTA 3C8LA 4FOSA 3ROZA 4N03A 4MJLA 2REOA 1VQ7F 2Q5IA 1GCGA 5B36A 1OASA 3FFAA 4AZVA 4BS9A 3I32A 1I2ZA 3UMSA 4PU0A 2D4HA 2HN9A 2VTKA 4DR1B 1R8QA 3FOBA 2ZYDA 2R48A 3HG7A 4HJXA 4A1FA 2HVJC 1TE2A 3SOPA 4B74A 2Y69B 1JAXA 4AZTA 5DWVA 4UPDA 3WRYA 5L3GA 1UC5B 4KAJA 3SR0A 1I7FA 3DXRA 2BLLA 1UT5A 5FLXA 2PQ2A 2A1UA 1B6QA 4N7BA 3AKZA 2JGUA 1TTQB 4C7KA 5C8XA 1L7BA 3GFVA 4U7WA 3HB0A 2P7TC 4W9NC 3H5LA 2YWRA 3EB9A 1GM9A 2W2PA 1B6TA 1CJSA 3AG3B 4QUIA 2JDID 3ET4A 2HQSA 2K9PA 3CO0S 2QKSA 1JN1A 3I55F 1RP7A 1E58A 1IY9A 5BYJA 3MWDB 5K3FA 4KIWA 5JD3A 2Q2QA 4OYLA 4CG2A 2A88A 4QODA 2J6HA 3ZGZA 3IEXA 4KR7A 1CZKA 3NATA 2FKAA 4NQ3A 3PYXA 4IM7A 1YAJA 4LF7O 4MPPA 4E51A 2HZ7A 4RULA 5JJIA 3A0UA 4FCCA 1FUKA 3KJEA 5FA6A 2B94A 4A8HA 4PPGA 2ZIMA 2IUYA 3BWDD 4JZKA 1BDJA 3AHCA 2Z9DA 4PGHA 4RKQA 1X6VA 1T3ZA 4YIPA 4MCAA 1U96A 4BR6A 1CUZA 2JIZD 5DP1A 1ZEMA 2X8WA 1YZNA 1UOEA 1YTUA 2WLLA 1E2NA 4AB1A 4DIBA 3EGOA 1FSFA 3HABA 5H9VA 4WE3A 3WZMA 2HAEA 1VI5A 4GYJA 4M8IA 1WA8B 3M34A 2ZJ2A 4H4CA 1GGJA 1GV0A 4R2KA 4WL0A 3VYTC 5T4BA 2XTJA 4RY0A 4BE7B 3A31A 2OK7A 2WD7A 3DDNA 1JKMA 1A2BA 1Z82A 5AI9A 2BJWA 2EZOA 3GBPA 4DR7B 5CJJA 3D8UA 1JU9A 3QWIA 2JFFA 2JH9A 1R9NA 4DDMA 4C0XA 4D9MA 4Y6PA 1AUVA 2PYDA 1RI3A 2Z2KA 2JHPA 2G9ZA 3M5PA 3PXUA 5L3VA 2O7SA 4PWTA 4RLSA 2EERA 1T9DA 1S8NA 3IA2A 3UV3A 4E5SA 1ULAA 1W75A 2IYEA 3Q2IA 2I4MA 3BUSA 1UM8A 2VNAA 1NATA 5IXYA 4Z2YA 4DNXA 1OIWA 5DNUA 2V3WA 2HGSA 3KOMA 2X0EA 2BSKA 3BEDA 4H0FA 3GEEA 2I62A 3BMQB 3A36A 4MWOA 4ZRDA 2F9LA 3KV1A 4ODIA 2F67A 4F2GA 3O21A 5M5BA 4NMLA 3BERA 1AOXA 5KYGA 2JPDA 3IAFA 4R8VA 3DVAA 4IIJF 3AG7A 1TAGA 4DLTA 2JATA 2WABA 3I9V1 2XDAA 2HFJA 1QOZA 4F8YA 2WM8A 3IPLA 3HUUA 5AIAA 4PGMA 3QO7A 4X89A 3PG5A 1HDJA 2WAAA 2AN9A 3WMXA 1J8DA 1FNJA 3LX6A 3H4VA 3G2QA 4AWBA 3Q3EA 4GBJA 3UH1A 3SS9X 2QAGA 5IYZB 3KUXA 2WPDA 5D85A 2NQ8A 1B2LA 5LYJF 1S0UA 4E94A 3WGUA 1NF3A 1I5XA 2ANCA 1V1MB 2BFMA 1XL6A 1XXLA 1EFTA 5KX5F 3GARA 1Z4KA 3HP1A 1AGRA 4OF4A 4BN5A 2L82A 1M9NA 4GKVA 2FE1A 4CRWB 2M2IA 1TO1E 5ECGC 4QLBA 1YL5A 3OPVA 4DWOA 2RGUA 2R8OA 2W8BC 4MUHA 1JKXA 3TIFA 1DIOB 4N5IX 1RHKA 4MROA 1S1CA 1UDWA 4BIOA 5K4AA 1I08A 1CSEE 1ZWZA 5A2QA 4KN5A 1LK7A 3OEEA 2ZAYA 3BFVA 1N8KA 3MOSA 1EE1A 2AXEA 2F9ZC 3ZWOA 3TW8A 3ESJA 2Q50A 3J7AC 3HA2A 3LY7A 5EYPA 5CFOA 2MR5A 4Y0NA 1QK5A 4DIOA 1K7EB 1KRWA 5AM5A 5AP9A 3U3ZA 3VSAA 1YA4A 4YP5A 2TMYA 4WQMA 2PI4A 4XCVA 3V9PA 3WQHA 3KRTA 2P4EA 2DQKA 4EL5A 3IAUA 3X1KA 4IDOA 5M34A 1ZA2A 3M5CA 3FAKA 3H9QA 1HTBA 4XX1A 3ONDA 1YRYE 2Z5FA 3U26A 2ARKA 1JAZA 4C07A 4V0ME 5ICSA 2ZS9A 5I7UA 4K9OA 5D6NA 3RFTA 3F67A 1UPTA 2I33A 2Q6OA 3GLFA 1MENA 4N9QA 4QU8A 1UBLS 1P3JA 4XSVA 4D4IA 1EUDA 5ENVA 4KFCA 3W4JA 3RODA 1L1RA 1U0OC 2HK6A 2RGDA 5E2BA 4LKOA 4HNAB 4LI3X 1FQJA 5KYUB 2J9YB 4OL0A 4HGOA 1D1TA 3DO5A 3T2MA 1IHDA 3M70A 2AEFA 4NCHA 4D56A 1F0PA 4BWYA 2OT3B 3K2QA 4IOKA 1G66A 1BJTA 5IUKC 4UVHA 2DBRA 3LY5A 3ROFA 4D46A 4IAOA 1U0SY 2DSNA 1W2GA 3W5CA 2BKAA 1ZWKA 1FLDA 2YXYA 2OSBA 2QD3A 5ALNA 1TZMA 3L0OA 1EHYA 3N05A 2O9JA 4ER3A 4RKFA 2HWXA 3UKDA 4EQZA 2B4AA 4DLWA 3CXCU 3EGIA 3FDJA 4QGGA 3ODGA 2R70A 2E4ZA 1Y9EA 1H1TA 3WKEA 4N76A 2FMIA 3TSAA 4RXMA 1EFRG 2V1DA 3PU6A 2AOTB 1BH6A 2IWHA 3ZK7A 5DHUA 1X2EA 4HX5A 3AQ4A 3UAVA 3I9NA 4Z51A 8LDHA 3FNHA 1WXIA 3O3MB 4EFBA 3I62A 4MVUA 5CYPA 1D5WA 1HDOA 1GXSA 3M8AA 4KX3A 4W1RA 3A3PA 1NASA 5DEIA 3VH2A 4GUDA 1RJWA 2HO4A 3ZY4A 1J8MF 1Y1LA 3ESAA 4IQ8A 3OTGA 2P4HX 2Y1KA 2EP7A 4EKYA 4HG2A 2X4DA 4M54A 1LSOA 2J9FB 5A4FS 1V6SA 2G9NA 4TXLA 4YRBA 2I4NA 1E1RD 5KNDD 2DCUA 1E63A 5B1AC 5FQNA 2LBTA 4LOJA 2AOUA 2JA1A 4ZAVA 4JP2A 2BUAA 4Z0HO 1O0SA 3A0RA 1XMPA 4BFYA 4CLOA 1IG3A 3TOVA 3O95A 4C4TA 4I9UA 3M3PA 2CK3D 1NTRA 1ESNA 5GGYA 1XE3A 4ARIA 3D1JA 1Q3TA 4M0LA 1SC5B 4H1WA 2VQEB 1SOUA 4LISA 3G9XA 3CJHB 4HB2A 1Q7RA 3I8XA 1MB3A 5C8YF 2QX7A 1ID8A 1DEKA 3M6FA 2PWZA 3CCSV 3D6AA 1F7YA 3DCNA 4WCVA 3RIEA 2NU9A 1L5SA 5GJCA 4HNGA 3CBGA 2VJMA 3DDOA 1KARA 1JL3A 1QONA 2PRSA 4YDQA 2GESA 4WOJA 3F6MA 5EWJB 4YHBA 4F4UA 1H9BA 3N74A 2Q8VA 5KHIA 1JHVA 2WE8A 2X6TA 1BU8A 3NBQA 4KK4A 3KQQA 4NV0A 1C4KA 1XREA 3ZK8A 3E48A 4XM2A 3KXPA 2BONA 4F2PA 3Q41A 2DR0A 4MYCA 4CLDA 3HNOA 4LGVA 2WA3A 2G6BA 2QPOA 1KO1A 2JHCA 1NDUA 4CH4A 3ICQB 5HFJA 2FAXA 3O1LA 4JI7O 2OQIA 3A3NA 2JCXA 4L8LA 3D6TB 3GT4A 2QTSA 3JAMA 1C9NA 4E08A 1J2JA 3I9FA 3HZRA 2C0CA 1IJKA 2HRCA 3W5UA 4KRGA 3W6ZA 1YQGA 2FJ0A 1W4ZA 4BLOA 5EWMA 5JASA 5TVKA 1YJWV 4UQLA 2TRSB 1PFYA 1PD0A 2QQFA 2BBSA 1TW2A 4ESOA 1LGYA 5CJPA 1PZMA 1K9SA 4I5FA 1T8WA 2PL3A 3QTYA 2WINI 3ZLUA 5DO9A 1NUHA 5DYNA 3HDHA 2XVAA 2J5KA 1VP3A 1IB6A 2ATXA 2Q8NA 1UDXA 3G6EV 3DZFA 3VZBA 4FC7A 4MS1A 3K06A 1MA3A 3MRVA 4ZJYA 1AHIA 3KYDB 5DB4A 3MBMA 2BGMA 4BTVA 1YH3A 2GYWA 3MSCA 2BCCH 2EFHB 3BKXA 3I5MA 1YI1A 2ZRIA 3JSXA 4DLVA 2Y99A 3QW2A 3EQ7A 2MSKA 1YVDA 2FP4A 1NURA 2Z30A 1MABG 2JFQA 3AL3A 4OXIA 2DBQA 1SQXH 1WMFA 2FQWA 5J23A 4G07A 1NBIA 2AXTZ 4KQ2A 3OCXA 1HURA 2A33A 3HDYA 4PG4A 2CZGA 3EWAA 4TZ0A 2RCYA 1KFCB 3I6QA 3IA7A 5LLTA 4IX9A 3TLEA 4N18A 1NLYA 3TCUA 1EM6A 4S1VA 3LGAA 5K3BA 4Q19A 1IZ0A 4OXKA 2V4ZA 1CUVA 2GGSA 4E6PA 2BRUA 1FJGB 3JW8A 1HXHA 2G0TA 1V1RA 2Z4SA 4L15A 3S2GA 4GC5A 1EA5A 3EQZA 1XVVA 2ATCA 3KZXA 2BGRA 1Y7IA 3ORSA 1VXRA 4CQMD 2IJJA 3K0DA 2QZZA 2HSZA 2QF7A 3DNMA 3MTBA 2ID7A 2NW6A 3PQ5A 2P2GA 3P2YA 2FWBA 4MGIR 1U0RA 3H1BA 1H2XA 1X7PA 1ZQ1A 4P58A 2K6GA 3WDMA 3OWHA 3D00A 3KX2A 1H48A 1W0KA 3ZS8C 1XZPA 1WRBA 4TRNA 1P72A 2I5PO 1E9DA 3NIGB 3KTOA 3G4SV 3SC4A 5AMXA 1PJBA 3H1PA 2X9NA 3EISA 4QRHA 2VO1A 1QRSA 1QYXA 5C5DA 4XVHA 1VJGA 4DQUA 1SG6A 1T8RA 3AVOA 2IEZA 4O2BF 1M2NA 2VYCA 3ONWA 2VJLA 3L4SO 1ZH0A 5F3RA 4GZLA 1CYEA 4I19A 3SYAA 3C4QA 4C7OB 4WZ6A 1QXSA 3VFDA 2O0KA 4RY2A 1H9AA 4ENUA 5IJZA 2AKEA 2R44A 1QV7A 2GDSA 4A92A 2RHRA 1J2UA 2O8BA 3WWZA 4B3BA 1OBOA 2ATEA 2IZ1A 3FDZB 3DHEA 1OYOA 4GYYA 4AO8A 4G56A 2O8FA 1PS0A 5BV8A 3CEHA 4CF4A 4C4OA 4M49A 4QJ4A 3ANTA 5WRFA 1R3LC 3K96A 3UJ7A 1Y5LA 3D4PA 1DELA 4I1SA 1QP7A 3VKFA 1A9QA 2WAXA 4UBIA 2B2CA 3H2SA 3F47A 4DLLA 2ZYAA 4EJSA 4PHFA 1KNKA 2XH8A 1QCCA 2UVPA 3E05A 2IDKA 3ZWDA 1SVWA 4Q4JB 4YI3A 4NAUA 4K5QA 4MVOA 1NSTA 4RJKA 4KUMA 3UW3A 1AJQA 3DBHB 1LLFA 3GGOA 1JZQA 2Q1XA 2I87A 3INRA 3P9RA 1FW6A 3A1TA 5DYTA 5KJFA 3A1UA 4AULA 2OIGA 4HQRA 2W70A 2R6HA 3CZMA 3KSAC 3AEIA 4ZMSA 3FWYA 2LGWA 3X1XA 4LDJA 4RKEA 2MSEB 5ERXA 1E1NA 5IVDA 4HXFB 3SF0A 4WEQA 1CD5A 3DHVA 3OGCC 5AHXA 3VQTA 3DZ8A 4V0LA 3HJTA 3EF1A 1L8QA 3UOAB 3ND8A 2CGOA 1VKZA 3KPWA 4J03A 4RENA 2VJDA 2B4KA 3RM3A 3NIBA 1RYNA 3A8TA 3JWEA 1U3UA 2R8BA 3IXLA 2FEAA 4UBOA 1E9EA 4DA6A 1ZM4A 1ZH4A 1XRGA 4JSTA 4GGPA 4AT1A 2Z6VA 5BV2P 5BVHA 2O2DA 2YN2A 2Q5HA 5C35A 4ON9A 1KQNA 1N25A 1ULHA 4REQA 2XZTA 3LDUA 3NHWA 2XQVA 3KIZA 3A14A 4Y2HA 2UDPA 3H01A 2PWPA 4I8XA 5CMLA 3WWEA 1TUEA 3F97A 4QASA 1TB4A 3R9XA 1AIPA 1BQEA 3K58A 1FA9A 4UD6A 4GOJA 4FGLA 2ICAA 1E3WA 4NBTA 2N1BA 4Q16A 2BH2A 1WN7A 4CV2A 2OWEA 3E70C 3GLIE 4KX5A 1JWBB 4CHGA 1U6IA 1CF4A 5EWLB 1VQ1A 3DTVB 4YMLA 3R7WB 1Q2UA 4FK8A 4FM0A 1RP1A 4Z4HA 1Z3CA 4PX5A 3BTSA 2FGJA 1UFRA 2ISCA 1M72A 3EW7A 3JQQA 5AW5A 4BMZA 4NCXA 1W36D 1TU0A 3N2KB 4NBSA 4XE5A 4ER0A 3VR6D 1KEEA 4J7AA 1YQEA 3TPCA 1OBFO 3CH5A 2XUHA 4KZKA 5B1BB 3MK31 4D41A 2FEXA 3B1YA 1FVXA 1N0NA 4DVJA 1WVGA 5E9WA 1OAAA 3ECSA 1NR7A 4UTVA 3E9ZA 3LECA 2WJZB 1W2BF 1NPDA 4KLZA 3W2GA 3AY0A 1HBJA 1KXJA 2M1ZA 3EZ6A 4KRYA 4PHGA 5LP6F 3VOUA 2CWDA 1JN0A 3DS8A 4AJHA 2G28A 5BQFA 2W2LD 4B8ZA 3AF2A 4Q9NA 3QI2A 2BFEB 3NKVA 3R40A 1ZH2A 1PFGA 1DT9A 1BHQ1 3HPRA 3K1YA 4KDRA 2WVGA 2VBGA 2XYPA 3WB2A 3G2PA 4OJYA 1YE5A 3KB8A 5EK0A 1A8SA 1H8EG 2C78A 4UTXA 4IBOA 5HKAA 2CMDA 2ZE8A 3O1JC 2OIEA 1F1JA 4DQLA 3I61A 3AU9A 1NT2B 4X94A 1YJBA 4AS2A 4Z0PA 4PS1A 4BIIA 2D0DA 2X6BA 2ZIVB 2PWYA 1SZJG 2C3PA 1XTUA 3AR4A 1MO3A 2D3WA 5A5FA 4FN5A 2F4VB 1T5DX 1A8UA 1E69A 3DXZA 3VZQA 1XRSB 4GNKA 1CY8A 1B8VA 1V43A 2A5FA 1X1CA 2VAVA 1MX1A 4BCCA 1V55B 3AU8A 8ABPA 2CZCA 4OSPA 4MR7A 2BW0A 1G8FA 3F5SA 5AOCA 4YYEA 2V9PA 1IEVA 5DI3B 5AM4A 5EWRA 2H48A 3CKMA 2CV2A 4G4XA 5KWJA 4O4HB 3B82A 2P0YA 3DDCA 3OMIB 2CAZC 2QMEA 1LDNA 3H2IA 2P78A 4QTTB 4P3YA 4I3FA 1DIRA 1L7AA 4ZYWA 3FNGA 2REQB 3KKPA 2C77A 4H18A 2V03A 2NU6A 3G17A 1M2KA 1XTKA 4G1VA 1DJPA 3OQBA 1H2WA 3K0AB 3LX4A 4R05A 2GQ0A 2QI9F 3OEHG 4IGFA 5G1NA 2VHZA 2MU1A 4PFQA 3VDRA 3AM5A 4I4LA 4WDQA 3ER8A 2BGKA 3K9GA 3KLPX 3EWIA 4AY4A 4JNKA 6ADHA 1P0FA 4UULA 5KIAA 3OZXA 2HU2A 4K6FA 3CRVA 1MLDA 5M7EA 4EW2A 5JZOA 4KR3A 2RHGB 4M8LA 1ZY2A 3CUTA 4M83A 2GN9A 4KNWA 3ADDA 1ZX1A 3G71F 4AWXA 1AO3A 4TV8F 1WAZA 3CNHA 5AKIA 2BZ1A 4XFDA 1DGSA 4GZMA 3AXTA 3WRVA 1X7WB 3PDIB 4ALIA 3EIEA 1WHTB 2Y92A 2GTSA 4KK3A 5FLYA 1NQVA 3VBBA 4TUYA 4CGZA 2O20A 1N5JA 1J1UA 4WBSA 2P3SA 4ZK2A 1YDFA 2PZKA 1X7DA 3DMTA 1Z8NA 1IEWA 1VKJA 1DTWA 4BNGA 1I7LA 1P5ZB 4QBKA 3V8VA 2WLNA 3MCAB 2WLTA 2AB0A 4F4JA 4H1UA 4FS8A 2IQQA 3NANA 2ALJA 3NVKI 3Q10A 1VG9B 3T5AA 4F4DA 3MD0A 5DN6G 3IMCA 2FW0A 3ERCA 2GM5A 1JHXA 2PJZA 1D03A 1WLYA 1IYZA 2XSZA 3OH8A 1KECA 4FVTA 2XNCA 4EY7A 1WZNA 5TT1A 4FFRA 4JOCA 3M6IA 4I3GA 1N4CA 3ZJUA 1YRQA 2QBYA 4NYIR 1TPZA 4QEZA 1VK3A 5HGJA 4BV3A 3F7YC 3NGXA 1R8XA 1ZJZA 3UQYS 5HKKD 4MR8B 1PQUA 1QDLB 3FLEA 1UCFA 3M9WA 4IYJA 2QRLA 1Z13A 4B0OA 1H22A 1WZCA 2GN6A 3LC2O 1X0XA 4Y98A 3H2JA 3WO0A 3NHYA 4XLTA 2QD5A 2A35A 3I39X 5EJ7A 4BV9A 4PV1B 1I0ZA 3UPUA 1BOOA 1B2RA 4CIXA 1IHOA 1IMOA 5CFPA 1AB5A 2YBDA 3CUEF 2DJIA