1SA0B

Tubulin-colchicine: stathmin-like domain complex
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Insight into tubulin regulation from a complex with colchicine and a stathmin-like domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 127
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1sa0B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1sa0B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1sa0B01
5IJ0A 2VAPA 4I50A 1W5EA 1FFXA 4XCQA 1W581 4B45A 5EZYB 4O4IA 5JCOC 3JALA 3JAWB 1TUBB 3M89A 3JAWA 4I4TB 3UT5B 5J2TB 3ZBPA 4I4TA 3UT5A 5CB4A 4KWEA 3RYHB 4DRXB 3JATB 2R751 4DRXA 3JATA 5J2UB 5EIBC 5EYPB 3V3TA 5EYPA 4EB6B 4LNUA 1FSZA 2GVIA 4U3JB 1W5BA 4IHJA 2RHLA 5MN5A 4B46A 3RYCA 5LA6B 1OFUA 1Z5VA 5GONB 5KMGB 5LA6A 4X20B 4ZHQB 4EI7A 3JAKA 4X1YB 3RYIB 3HKDB 5JVDB 3RYIA 2RHJA 3HKDA 3N2KB 5LP6C 1JFFB 3N2KA 3R4VA 5EZYA 2VAMA 5MN4A 1JFFA 3HKBB 3E22B 4O4LB 5LOVB 3N2GB 1TUBA 4O4LA 5LOVA 3N2GA 5LXTB 5J2TA 2Q1YA 4HNAB 5LXTA 5IJ9B 3RYHA 5M7EA 4HNAA 4TV9B 5IJ9A 4O2AB 4TV9A 4O2AA 4O4JB 4ZOLB 5J2UA 5LYJB 3WGJA 5JCOA 3HKEB 3CB2A 5LYJA 5ITZB 3RB8A 3HKEA 5FNVB 4EB6A 5CA1B 5FNVA 4U3JA 3WGKA 2BTQB 3VOAA 5JH7B 4TUYB 4FFBB 5EIBD 5JH7A 2VAWA 5GONA 5KMGA 4EI8A 4X20A 4ZHQA 4X1YA 1W5AA 4EI9A 4WBNB 3ZIDA 5JVDA 3VO9A 2RHOA 3WGLA 4X1KB 4ZI7B 3VPAA 5C8YB 3HKBA 5C8YA 3E22A 4X1IB 3VO8A 4I55B 3JARB 4IIJB 2XKAA 1RQ7A 4YJ2B 1SA0B 4I55A 4TV8B 4F6RB 4M8IA 2XKBA 4F6RA 3RYFB 3HKCB 5LP6B 3HKCA 5LP6A 1TVKB 4O4JA 4ZOLA 1TVKA 1W59A 5CA0B 5ITZA 4I50B 5CA0A 5CA1A 5IYZB 1FFXB 2Q1XA 5IYZA 4O4IB 3JASB 2BTQA 3VOBA 3C8LA 3JALB 3JASA 4FFBA 4TUYA 5MN6A 2R6R1 4O2BB 3WGMA 4U39A 4O2BA 4O4HB 5CB4B 5JQGB 1W5FA 4WBNA 4DXDA 4O4HA 5JQGA 4X1KA 4ZI7A 3ZBQA 2RHHA 3M8KA 4X1IA 1Z5WA 4IIJA 3JARA 5KX5B 4E6EA 4YJ2A 1SA0A 2BTOA 4TV8A 5BMVB 5KX5A 4LNUB 1RQ2A 5BMVA 3WGNA 4IHJB 4YJ3B 3RYFA 2VXYA 4YJ3A 3RYCB 1RLUA 5IJ0B 3JAKB
chains in the Genus database with same CATH superfamily
1XAJA 4F6LA 1F1BA 5CBGA 3GK3A 3T95A 1FC0A 5P8WA 4KO4S 1ZD9A 2XQIA 3U60B 4I81A 1KD1W 3W3AD 5DYWA 4FFOA 2ZM5A 2OG1A 1FS4A 5ESWA 4AJ2A 3Q9NA 4MHSA 2EJRA 2W2PA 5E0OA 4LTNA 4DLBA 2G9UA 4QNNA 4YMTA 4B35A 3T94A 2VT6A 2MU1A 4R54A 5FV4A 1B04A 3EIQA 4IIBA 2K1EA 4LF8O 3WIDA 5KCZA 1F51E 3NV9A 3BXPA 1A2BA 2BRUC 4X1IB 3I23A 4M4SA 3H1HH 5B3SB 1YTFB 4ZJYA 2W11A 3ZU3A 3WYNA 5KNLA 1G8YA 4M7OA 2FEWB 3BD9A 3VIUA 5F77A 3I2HA 1B6RA 5L3CA 1MB9A 3CE2A 1RQ2A 5GJCA 5EY5B 3WYBA 2QSAA 4YRKA 2OO7A 2K4MA 3A70A 5JAIA 1MRZA 4N5IX 4TQ9A 1A8QA 2ZSFA 1QJCA 3DLTA 4G07A 2IE0A 4YRIA 3BSWA 2VQ6A 3TZCA 3WFIA 1KWKA 1EFRA 4JC0A 4LAFA 2DY1A 4RA9B 2Y4NA 5DXFA 1XHEA 4NOKA 2BUAA 4BECA 3TGWA 3L82B 2C4WA 3HVKA 1ODTC 2I80A 2IYYA 1YK0A 4RCZA 1PNVA 2PUSA 3AG1B 4ZC8A 1QIHA 4JJAA 4JUAA 1BDIA 1VJDA 2JEOA 1JKMA 1A7UA 2DWOA 2WA2A 5L6MB 3D6UA 2E87A 1H4TA 2O8FB 3M9XA 4O2BA 5KDLA 3QVTA 4NE2A 4EQ6A 5EJ4A 3CH7A 3F7YC 2GZHA 1YJWF 3LCCA 2QE6A 2WIDA 1BDJA 1MIOA 3LUJA 2WJ3A 5ESDA 5AVMA 3B3AA 1WBBA 5KWJA 2I2FA 1Z2OX 2QTTA 4GKBA 4BB9A 4KFRA 2Q62A 2PLAA 2FWRA 2AHOA 2X0JA 1QRRA 2VA9A 4M9CA 3RUHA 2X0DA 1CQXA 3OJEA 2R4UA 2JIZG 2W2VA 5HZGA 3QPDA 4FNGA 4TYPA 3X2EA 1SC6A 2H4XA 1DZ3A 1Y89A 2PL9A 4G67A 2IJHA 3OPXA 5K0ZA 2IGTA 3AINA 1US8A 1BE6A 3G5MA 3I8XA 2JFFA 4EF5A 1OUMA 3CX3A 2A86A 4QHTA 3QU7A 5LQRA 4KI7A 5HXZA 4GMXA 2HOQA 3DTVA 5DV9A 3NHWA 1JH8A 2MYPA 5DN6A 4KSYA 1TTQB 4IYIA 4Z0TA 1PJTA 3HJBA 1M90W 1RWKA 4IW3B 3T1YO 1WNTA 1C2TA 1R64A 1M6VB 1V54C 2BTUA 4FSXA 1KOGA 3C4VA 4MLPA 4H17A 1GLVA 1KECA 4F7WA 2HBZA 2J41A 1LY1A 4YRPA 3JV7A 1Z0SA 1XTUA 2A0YA 3T15A 1J0AA 3U9LA 1P1KA 1WUTA 2VP3A 4DIUA 3NZEA 1HDRA 1EB9A 3D54A 3QQPA 1L1EA 4FDVA 3N2GB 1KK0A 3CR3C 5B5EZ 2X8WA 4C0WA 2PHNA 4DIFA 3RF7A 5DHSA 3ZMVA 4AO8A 1J0CA 5B6PA 2V6BA 2V03A 1A9TA 3VVCA 3M6IA 3HJHA 1UDAA 2GILA 4TV8B 2H1OA 1QVFF 3LXMA 1JOYA 1I4OA 3GUYA 1TMOA 4QNMA 1DFGA 1VCOA 4DV6B 1HMYA 3JTEA 3RJ5A 1QU9A 1SXHA 1KI9A 3ST7A 5JXIA 1WXEA 3A9RA 5DOVA 4UQPA 3PEEA 3HV0A 4F8EA 4B6OA 4RF3A 1C9NA 4GM1A 4MYCA 4L9SA 1IU9A 4ZQHA 4C05A 1PNLA 4HMPA 1BEUB 3R7SA 3IOYA 3K70B 3GLGE 4J41A 3AIIA 2AZ0A 3UV6A 3C45A 3H11A 1SZDA 5SV2A 4ZIRA 4KQ6A 2I6DA 2QXUA 4HP8A 4UOZA 4WLFA 3M33A 1JDPA 2ZATA 1TKRA 1ZMBA 5CDTA 3TPFA 4MV8A 3KDPA 3ZWOA 2F4NA 1DAFA 1F17A 2I7VA 3TTSA 2I2BA 8LDHA 1MVOA 3WOVA 2OCLA 2TMYA 2H5JA 2HK6A 3T7EA 2ADFA 2FSFA 3TJZA 4O1MA 1CUIA 4KDFA 4CN8A 2B1RA 4WUTA 2XKAA 2G0NA 5HIIA 1LLCA 4PINA 2ORYA 2WSIA 4MV3A 1PN3A 4RE6A 3NETA 2XNCA 4QPPA 3JX9A 1TEXA 3QLUC 5HTKA 4F9FA 4QD3A 3HYCA 4XPZA 3GRPA 5ALPA 4X62B 2R6R1 4G81A 4KVFA 1NH2B 3QNEA 4REQB 2A33A 5H6QA 4Q0MA 1CS0A 2ZAOA 1OVGA 1KIAA 1W581 1UWVA 4O4IA 5E1MA 3SQWA 2C7BA 5JPIA 2PKWA 4HX5A 1IAQA 3SX0A 2GESA 3KU4A 3RUFA 2ODEA 2C99A 2NXCA 3QLVA 4R1NA 3PF9A 3NHSA 4ZZ2A 4B76A 1CUYA 1QG0A 1TO1E 5TPZA 4GDMA 4BP1A 3DMRA 1N8RW 2D0DA 5HILA 4KE6A 3ZJ5A 2VTDA 2IG8A 1PK8A 1GEGA 1I5XA 4AMVA 4DV3B 2H3EA 3D2CA 2JGIA 3QKIA 5FHQA 3M1LA 3VMFB 5FBQB 1P6QA 1G19A 1IHUA 1J1IA 3VR4H 1TTPB 4JVMA 3CD6V 4HNSA 3C74A 4KP7A 1I4LD 3KQTA 4E7PA 3UEOA 1QZTA 1T8PA 3AGQA 2BRUA 2OQ2A 1COMA 1JIQA 1W5EA 4L8VA 1EDBA 1OCZB 5EZYB 1GZ6A 3IAHA 2QW0X 4MR8A 1FOEB 1P1BA 3BH7A 4KQMA 2G04A 1K5SA 3PHIA 3SU8A 3R6DA 1VQOV 3Q3CA 1UM8A 1P2FA 1OZHA 2G4LA 3V4ZA 3LC7O 4QEZA 4N8EA 2VC2B 4ER6A 4REMA 1BXRA 4ZEVA 5LOVB 1UIRA 4DCCA 3ECCA 1KSGA 3VHXA 3RGWS 2XYVA 1NT2A 3KOWA 2ONYA 3VZQA 2ZYTX 4IQ4A 1PNMA 3O8QA 2Z01A 1SZJG 3AP3A 5B7GA 2GAAA 3F5QA 1TJ5A 3MD9A 2Z9CA 5CVJA 3QPVA 2J0EA 4JGSA 3IFXA 3K9NA 4P9PA 1C1YA 1EVIA 2CXXA 1HW7A 4IXTA 4E11A 2CW4A 1J95A 4PVCA 2BMDA 3BORA 2V0CA 4MUXA 4CLXA 3MAQA 1VC2A 4WJLA 3OMIB 2F1JA 4UHFA 3AJ9A 4G4ZA 4FFNA 4N39A 3A6FA 1PR3A 5C32A 1F8FA 1O6FA 5IE9A 2PG3A 3VX4A 3RFVA 1SHZA 1DXOA 3U49A 4Y2SA 3BHNA 3BB1A 3RA5A 2LNDA 1DC8A 5ICFA 5DWQA 3GD5A 3HZRA 1KEEA 3P20A 1QF7A 1T0HB 1T3SA 3EXEB 1OFVA 1RBYA 3HNRA 3CEIA 5IXJA 4RF5A 4RU1A 1X3SA 2GSDA 3GAZA 4IDDA 2DWQA 3VDNB 3S0WA 3G8DA 2I0FA 2QRLA 1XDDA 3WO1A 3I0ZA 2QMHA 2IVFA 3BFKA 3H05A 1ARZA 5LQKA 3CNHA 2UUBB 5AM1A 1XI1A 1Q15A 4UQOA 3K9AA 3KHTA 1YDEA 7AT1A 3QJGA 1V7PC 4AZ0B 3L75H 3M5WA 4MDEA 4N3GA 4BLWA 2GEJA 2LDBA 5EIHA 4EOGA 2RONA 3OOEA 5FEMA 4FCTA 2GYWA 3ZW7A 3BHIA 4YMIA 4QASA 4IG4A 1Y8QB 1G6OA 4XIGS 1E3LA 2FEXA 3OIVA 2KQUA 5FPSA 3WGOA 1NNSA 1E3IA 1PJLA 1JHUA 2G5GX 3HCEA 1RPJA 3RRBA 3AEUA 3FF4A 3GN2A 1V55C 5LYJA 4D5EA 1KMQA 2IX3A 3GLHB 1WA8B 2C03A 1CQIA 2Q5CA 2RHMA 3FYEB 3TBKA 2ZTVA 1II0A 4INOA 3FMPB 4FINA 3PNBA 2X7JA 2CWWA 1PNOA 3MFYA 3IEKA 4KIGA 2DWPA 4UBLA 3HBAA 1MHTA 3L77A 5MHTA 3SBEA 3ZEIA 1KFJB 4K2AA 1TQ8A 3L0BA 2IPMA 4HOYA 1L1RA 1N78A 2BDTA 3FCCA 1HFWA 2PA0A 4LOLA 3VTFA 3Q8KA 2ZXWC 3IC5A 1BCRB 1G21B 2DMRA 1UBLS 5BZBA 3CVUA 3JD4A 2H8EA 4QBHA 4FCVA 4BC0A 2HTFA 3BWMA 5BYKA 1WKCA 4A6XA 1ZH0A 2GGSA 1Y6JA 5TQ0B 3DSRA 2NO5A 1BXGA 3E0QA 2GN1A 3G89A 3BC1A 3MT8A 3WL5A 2QMQA 2NPIA 1DIRA 3F49S 3PUWA 1U3TA 4UNRA 3SIVA 3T1VA 2FLKA 4K9RA 4MW4A 3L5OA 1A9ZA 1NPYA 5ALMA 3ZWCA 3M9LA 2UAGA 3QFCA 1RA4A 1I0IA 4KGVA 1EP9A 1ZL2A 3FW1A 2GHIA 4IFEA 4JLMA 1ZW1A 4ASUG 4ZEOA 1T9AA 5KAPA 3RIMA 4M83A 3TNDA 1OV9A 3F5FA 1MH1A 1F2UA 3IEWA 4OOFA 5TVGA 3QLUA 1R5JA 2H1SA 5KKNB 1WVMA 4MINA 5K45A 3ASYA 1EVQA 3RDPA 4GYJA 3N0RA 3SQNA 3O93A 4HLCA 4ZVNA 4U7TB 4TV9B 1ESEA 1U2EA 1F4VA 1I01A 3TI9A 3ZJZA 2XDQB 2AKYA 2PQMA 1HRDA 3S2IA 3HWRA 3DOFA 5D2CA 3WRWA 5KOIA 4HAOA 4DEVA 5AM0A 3AOGA 2C31A 1KDTA 5KVQA 3JVHA 3H1FA 2JFYA 4WX2B 1U2TA 4LH6A 3RS5A 1EKXA 3WISA 4V2IA 5E79Z 3MTBA 1VKNA 1KNJA 2OBNA 3AUKA 2CL0X 5F35A 2YC2C 3HFRA 4JHLA 3C8DA 2GR9A 3IAS6 5BWBA 3IKTA 3WLJA 1PZHA 1PK7A 4PJ0Z 3ZY5A 3TQRA 4NEGA 4D43A 5EBLC 1X7WB 3QVJA 4UC0A 2SNIE 1WP4A 4EFEA 2OD2A 3ZLUA 3LDUA 4KQKA 2ZIWB 1L4FA 3DZGA 3CX4A 1ULSA 1LDEA 5JJIA 1C7ZA 3U5TA 2GPWA 4B4VA 1OIWA 2P2ZA 3N27A 1KJZA 4WXPA 1TIPA 1IATA 2QL5A 5FYQA 1FJHA 4JFAA 4V0SA 4IJKA 4EI9A 3L8HA 4OBEA 1QH1A 1L4EA 1U96A 3RIGA 4CMGA 3SSAA 2XYRA 4LH7A 2AFRA 3A2NA 2WILA 5NLLA 3LS2A 2OV6A 2BR5A 5J5VA 1JVMA 3F2VA 4ENVA 4BO7A 3ZOPA 3G17A 3L1HA 4K26A 1EFVA 4JXKA 1UMBA 2QB5A 1ZH2A 4FWBA 4H60A 4FFDA 2H59A 2IZ0A 3Q8LA 4DW8A 4E5YA 4ZV4A 5B7PA 1NW4A 3TOVA 3UM7A 1VHWA 3LWDA 1W2GA 4BV2A 5HX7A 2ZLBA 3SYLA 1RD4A 3PDIB 1VQ7F 4FMTA 3QVXA 4B71A 1V5IA 1FLAA 4LDZA 4W1RA 4GZRB 4LWOA 5AK4A 1NOKA 2BOVA 2BSQA 4BY9D 5KB3A 3GARA 2BI7A 2I29A 3WPXA 3U37A 2I2XB 4X71A 2HCFA 2GCOA 3G23A 4JJKA 1TW3A 3V8EA 4JP8A 4LG1A 1DIOB 3KT6A 5JHHB 1DVRA 1UAAA 3TRHA 2DLDA 4ZI3A 2V58A 1RM1B 1H5QA 4C0JA 3MOIA 5IT0A 4N03A 3CX6A 2COUA 3ZIUA 1XTIA 1DJQA 1Y66A 1IK6A 2CEAA 3C3EA 5DZSA 1VH8A 1LUAA 2OCGA 2HSEA 4H1WA 2E2WA 5LFAA 4NJMA 1Q7YW 3EEOA 4ATNA 3ZWYA 4I9HA 1E9BA 1VQPF 1Y9DA 4P81A 3CZ9A 4ONEA 1Y5LA 4XFKA 3A11A 2F3UA 4KDRA 4X44A 2GZ3A 4CLEA 4KR3A 3PCTA 5LZ7A 2YIDA 1FFWA 1LX6A 2YW9A 3LW8A 4R83A 1RPNA 2OFPA 2V5VA 4GP6A 3FB5C 5A06A 4Q6BA 3T54A 3BGWA 1B8OA 3ZGYA 1WETA 4F2HA 4KBYA 3EOZA 2G0TA 2FW8A 3AFGA 4LHXA 3U3DA 4ZVOA 2GJSA 1QIGA 4CM7A 2CNOA 4J0EA 1FRFS 4JTDB 1B26A 1LV8A 4O63O 3G49A 4OH1A 5AW7A 4I6JA 4UTVA 3DKRA 2IYWA 1NJ1A 1B0UA 4I8IA 2HIMA 2IU0A 2CCKA 5CLLA 2YFYA 4BEVA 1LC3A 3LK6A 3SIRA 1V7ZA 4PZ9A 2PQ0A 2J07A 4UOQA 4F2WA 1G5IA 3AB3A 3L8MA 3MWKA 4ISCA 3TUJC 3D1LA 3H5LA 3LUHA 5EVJA 1YU9A 5IY5C 5AR1A 1JEJA 1OGYA 3DVRX 1B76A 3WAKA 2UYNB 2H1VA 4D9KA 2DB3A 4MGKR 2FNAA 3ZWQA 2C5EA 5LBQA 1E9RA 2CJWA 1IPAA 3USCS 4IX1A 3UICA 3P0ZA 1GDDA 1R3IC 3EZXA 1O95D 1ZUWA 2PO5A 4K9QA 4JB0A 3GLIE 3DXYA 3D36C 4M6WA 1EXVA 3MCUA 3V34A 4ZHYB 2A58A 2AZXA 3ZV6A 4HWKA 2VGNA 4LS3A 3RJZA 3L6DA 2G07A 4HDAA 2I62A 3DHVA 4N3BA 4OTZA 4N9WA 2YEVB 2B9EA 4I2NA 1FDVA 2ZAMA 1IJKA 2CDBA 4LC0A 4AU1A 1XZKA 1N5OX 1V1JA 2WT4A 1C8BA 1EP2B 5DGXA 2PGDA 4OGWA 3EFOB 1M2WA 3VC2A 1NMXA 4YJ3F 4QXMA 1FEZA 3KG2A 4P80A 2AC7A 4LF4O 2VYVA 4WXMA 4MRAA 3CCQF 3CM0A 3MJ4A 3ESCA 2ZSUA 2FFBA 1BL8A 1PFYA 2V97A 4D80A 2VT7A 4D98A 4LZAA 1UDXA 4GVPA 2V0GA 4AJJA 3UV3A 2BTQB 3JVIA 1EG2A 3SEAA 4CDRA 4MI1A 4PZEA 5FPQA 1GYRA 3UJPA 4F5ZA 5KYWB 2AB0A 1I1OA 4M9UA 2B9VA 2WU1A 2JGDA 4RPGA 2PXAA 2E5LO 2VP6A 1E4OA 4R3UC 1OFHA 3NH9A 2P35A 5E6UB 4REOA 1FXHA 1PHRA 4O4HA 4QFCA 5BOSA 1UXHA 3Q88A 4H1VA 4TSFG 3WJ1A 2I2CA 4PNHA 4D3DA 1W6UA 4M89A 3IKFA 1JB1A 1T0PA 5ALXA 1QLEC 3RS8A 3NTOA 2MYNA 1M6NA 3N5KA 4RTMA 4BX9A 2Q21A 1TKAA 3IMEA 1OBCA 3W1VA 4R0MA 1TOAA 3EGOA 4LBWA 4N3AA 3RS4A 3NDRA 3X1YA 1L7BA 4Q4JB 1TRKA 3ZCRA 4Z2AA 4BKQA 3T3DA 4NENA 1GM5A 2R4TA 4ZZ0A 3PC3A 2YJ3A 2BP7A 4QDOA 2IEYA 4B4UA 2HK9A 1VP7A 1MEEA 2GDSA 4GE0A 4Z4GA 4YDRA 3HDVA 1LBHA 1M2FA 1M1ZA 2BLNA 3HGMA 3EIOA 3QWAA 4BRZA 2HSGA 4DRYA 1EWYA 5F33A 5JE8A 2M6SA 3LQ2A 3N58A 4G0UA 3VAZA 4ER3A 2Q4TA 3GR6A 1I0LA 5AM2A 2OK8A 3ZV3A 1JYSA 3FWNA 1Y6GA 1M8JA 1U2ZA 4GOKA 3OZSA 4UU7A 5JO9A 1XKXA 2Y0EA 1OX5A 4WK4B 3QNWA 1CK4A 4YRTA 3IKJA 4GLBA 3WQQA 3LGXA 4KH0A 3CX8A 4EYQA 2NU9B 1EBFA 2A5GA 5F98A 1F0KA 5AI0A 1TYEB 4GLXA 3MTGA 1ZONA 3FROA 1F23A 4DSTA 5KS2A 3NHPA 2JLXA 3LF2A 2QF7A 4Q3KA 4YYEA 1WD7A 1HNNA 4CR6A 4LYHA 3ABSB 3IRVA 1TECE 5A05A 4DYLA 4BAGA 3V7UA 3LC1O 5ERYA 1M9NA 4DM7A 2NSJA 4HGYA 4B83A 4C4TA 5AXCA 3AEKB 5BSRA 1V2HE 2JAWA 1NE7A 2Q3EA 1V48A 2GDZA 1R50A 1GCGA 5B1NA 1G5FA 2H11A 3RRJA 5FWXA 2H2HA 4WK0B 2R7NA 1UDCA 2HB6A 4UBKA 4JI8B 3CLTD 3KQNA 4LFCB 2EIJC 2Q4OA 4Z53A 4EHLA 5DSXA 1KJQA 1XELA 4EFNA 2WLNA 3HSYA 3R6GA 2O07A 3NRBA 3W77A 2QG6A 1KF0A 3A6ZA 4ZI7F 4WACA 4LWZA 2GRAA 3EUWA 3C9SA 3L0PA 4FX5A 4IKOA 4OUDB 3ML1A 3PI7A 1WB5A 5ADWA 2UU9B 3IIEA 1QU7A 4MQ6A 2ZQYA 2VDQB 1SIUA 2OFWA 2IZ1A 4EEQA 3BTOA 1YNSA 5TEVA 2VO1A 4CLRB 3SHTA 4YRBA 1YKFA 2FRXA 1I6LA 3SMQA 1P9LA 4B6JA 4JGBA 5J2UF 4YASA 1Y6ZA 3N87A 3R20A 4ARZB 4FR0A 3KSAC 3I56F 5EQDA 1E1CB 4J0GA 4W5NA 5CA1A 4UUBA 5DNCA 4Y2GA 5C1OA 1X7XA 1C7JA 4CLOB 3I9NA 5LN1A 4PO9A 2BHLA 3UGJA 4C07A 2CKDA 2Q1TA 5GW7A 1LWNA 5AIBA 4XYBA 4MW9A 1YZTA 2C5HA 2RN9A 3JAMM 3G4SF 1XRSB 1IBKO 2NU8B 3QA3E 1OSNA 1DE0A 5DN9A 1WP8A 4GKKB 3UAOA 4Z8XA 3DXRA 2Y0PA 2CJPA 3OT5A 1PT9A 3VA7A 1HSOA 1YZLA 1FLDA 4KRYA 4DMMA 5FRDA 2XW6A 1O8BA 2R1UA 2FR0A 4GOJA 5CITA 3BBPA 1NR1A 5H3HA 3GGPA 4RESA 4GMGA 1XIVA 2ZANA 3RRNA 5AH0A 1X38A 2C5SA 2PMFA 3FMFA 2QW8A 4QDKA 1OILA 1L5YA 3D00A 4WTOA 3O4FA 3ADCA 1HSZA 4LC1A 4Y2YA 3RWOA 2CB9A 2BGUA 3CLTC 3UO3A 1SUIA 4IFBA 3OC0A 3BE6A 3W79A 2XZDA 4IXWA 4LF5B 1SA0A 1K9VF 4F92B 1SEPA 2FF7A 1Q1NA 2WE7A 2BFCB 2AR0A 4CIWA 3D36A 3T06B 1I94B 4HI0E 3GBSA 3PQ4A 1QYRA 4RPLA 4R05A 1E8DA 3RUAA 3ZE6A 2VQDA 3LUAA 1JKJB 2W71A 2OXRA 2N3ZA 3NXKA 7GPBA 4MVJD 5JJKA 3CYOA 4M0UA 2NMUA 4JF3A 4URVR 1J33A 3FNRA 5BN3B 1SXJD 1UMDB 1EAYA 3JZIA 5BV2P 4M0EA 4GC9A 2D0PB 1ZAUA 5HIKA 1VMAA 5AHOA 3SDSA 4K0KB 1HBJA 3WGKA 2O8EB 1W1IA 2B94A 5HXUA 1CEEA 2A84A 1EUQA 3UJ9A 1XALA 2Q45A 3GY0A 2DUJA 3BF8A 3EY4A 4AY5A 5FH9A 3EC7A 2ODPA 3UXEA 3IBYA 1XYYA 4IRXA 3BYQA 3KZCA 4IUYA 3F7OA 1C3OB 4Z3KA 4FOSA 2QWRB 3K09C 2UYKA 4ZD6A 3MINA 1O57A 2XAQA 2PZKA 1AJEA 1J8YF 4U9HS 1NFFA 3PG5A 1GT6A 1X7ZA 3UB4A 2B8TA 2W2QA 3ROKA 5IU6A 4ZDJA 3N2YA 2WZCA 2XH8A 1UBFA 4BASA 3EXHC 4ZQEA 3F6MA 4IIUA 2I6UA 1I3KA 1NGSA 3GUCA 1UEJA 3IMGA 5K3DA 1THTA 2Z1EA 3A1EA 2RIPA 3TQCA 1FJGB 2C95A 1VP3A 3OTGA 4XKJA 2QWQB 3B77A 1J6UA 4RV4A 1T9KA 4MVZA 1FNDA 3DLPX 2B1IA 4YIOA 3EZ6A 5BV1A 2BGLA 1F51A 5E1DA 5L3RA 4UARA 5CG1A 1SXGA 1NBMA 1GADO 2JARA 2FQQA 2VHUA 1IRXA 1JF8A 4ZHQA 1MTZA 4IDGA 1RYZA 2QKSA 3VM6A 2OP1A 5BVGA 3L72H 3G2JA 1IN4A 4L3WA 3MB8A 2AEMA 4HN4B 4L4UA 3OR7C 2OBYA 4C30A 4Q1FA 2BBTA 3MTAA 3U48A 2D1FA 1DEKA 1KQPA 3I6MA 1JKFA 1GSHA 3V1TC 3OEHA 4I5DA 2L35A 2JA1A 1JAHA 5IT4A 3ASVA 3T34A 5IN4A 1TQHA 3INTA 3ANYB 2FGYA 3JY6A 2P0EA 1QQCA 5F7XA 3QKRA 3OWHA 3G79A 1TUBB 2CHTA 4WN3A 3FVVA 3ZWWA 2ZDHA 1TCAA 2G08A 4NYIR 3LT2A 2H1WA 2RHLA 1IY8A 2Y1WA 3O03A 2OYCA 1SESA 3RU9A 1SAYA 3ZCUA 4EARA 3QLJA 3F7VC 1URPA 2CSUA 1FVOA 4JP1A 1GWNA 2FN9A 1P91A 1AILA 3CZ4A 2AMVA 5DBIA 1DRVA 5DKFA 4Q4HB 3QU5A 3V8NA 4BWAA 3GJXC 4I3FA 1E7RA 3RVBA 4QHYA 1E7QA 3LX4A 4YMWA 1GUFA 3T4DA 4AMYA 3QSGA 2I6RA 5FPTA 4O2BB 3S7TA 2J6CA 1W2BF 4EQ6B 1N57A 1GDHA 3V1YA 1ZXXA 4MS1A 1MIOB 2JZOA 3I01A 3CUTA 3F1LA 3LJKA 2VYFA 4E5DA 4DIBA 2JAXA 2VPYA 2B5WA 3OJWA 1ZC3A 1ZITA 5G4KA 3CQ9A 2PKQP 1A9XB 2Q3HA 4CYMA 2A4KA 1JDBC 1AR1B 4PA7A 1Q1EA 2ACWA 1TMKA 2VUIB 1O89A 4KXLA 4MVSA 1BE0A 3VTAA 1MSWD 1IULA 3BZUA 2O6LA 5K4AA 2EIMC 2QLFA 5LQNA 4CM1A 4G9GA 3CIOA 1VSTA 4YCBA 4CKBB 1QLNA 3NHYA 1US8B 1FU4A 1KYIA 2QDOA 4O4LF 3WNCA 4H77A 2DF8A 1NKVA 1Z16A 1Y5MA 4AMUA 2EIKB 5KNCA 4RQUA 4WFIA 1D4FA 1B8UA 2XYGA 1NZFA 1IBLB 5CIQA 1HZJA 4C78A 1LTQA 1P73A 3ZQUA 1IB6A 3AG2B 5TEWA 4WK6A 3GJ8A 4ABYA 4LZJA 2XOXA 3EQZA 5K5EA 3LSQA 2Q46A 3W6OA 3IP8A 3MIZA 2X2FA 2X6RA 1IEVA 2RARA 2XUGA 2FJPA 4ZVLA 1BN7A 2YIVX 4MV4A 4U7OA 5CXSA 2IYPA 2FG6C 2K5UA 1V3UA 3NNSA 4O8ZA 1IHYA 2W70A 1Y1RA 4QU0A 3M6XA 1W30A 3G9ZA 4EAQA 1TPZA 1Z13A 3OZCA 4DR2O 3MDOA 3OOSA 5AW1A 5DHPA 2RNBA 3LNTA 3U9TA 5IEJA 1WU8A 5JI3E 3IA7A 3H0KA 3TZBA 3C8ZA 1PWZA 3U0VA 3RFTA 2P1ZA 1K88A 1Q1ZA 2XECA 4AT1A 1ZHHA 2A9FA 3OWOA 4PQEA 3T3OA 1KFCB 4JBXA 3ZE7A 1YE3A 4CU2A 3B7GA 1OI3A 1JWAB 2VYQA 1T0UA 1EWKA 3C2QA 1G3RA 3K6SA 3AK1A 1DCTA 4ZQCB 3GLGA 3ZIAG 4YB8A 1YEWA 1NW5A 5EJIA 2ZBRA 4PICA 3RWMB 1G4YB 2JJ2A 2V3CC 1QB7A 3DV0A 3OCUA 3VZRA 1V3TA 1OXBB 2G28A 4OLJA 1QIMA 4MQFB 1VG1A 3KYIB 3ND6A 4ZIRB 4HWRA 2QN8A 4P9OA 1H4SA 4QDXA 1DRKA 3QE3A 6PFKA 1MQAA 1GL7A 4BYMA 1SUAA 1AM4D 2C92A 1ZZGA 2IOYA 3LUBA 1NLFA 4JI7B 1XBIA 5BSVA 2X4LA 4RHUA 3KSZO 2PZFA 4KXXA 3CF4A 3PHLA 2ZR2A 3HN7A 5CH5A 4LMRA 5I51A 3ETCA 2BR4A 3PDJA 1OJHA 4BE7B 2UZHA 4KV9A 4KMOA 3NALA 3MGBA 3D8TA 4GNKA 3QXSA 2WG1A 5A1TA 3UTDA 3VU3A 4L2IB 1GLNA 2PSHA 4E3WA 4PPNA 1O96A 4RF4A 1E79D 3W7UA 3DMYA 1DT5A 4CHGA 4B8YA 4QX6A 5EJEA 5GIPC 2I1QA 2CUGA 1BQ4A 1IZYA 1UT5A 2IPAB 4ZO7A 4CKZA 4KB5A 3NANA 5C31A 1JTEA 1PS0A 3LUKA 3NR7A 3KAKA 1WCWA 4X8LA 2DMXA 2YMMA 2PV0A 3VFDA 1FVXA 2DR3A 1WS6A 5IAAA 3K09A 1VSBA 3ANMA 1C1HA 2FWMX 2QZ9A 1P4JA 1FDOA 4PCAA 4YCJA 3JSNA 3WGUA 1O97D 3GXOA 1QYXA 5TE9A 1PGNA 4B75A 2VRZA 2AI3A 2Y6UA 1PNQA 1SBCA 3I55F 3W2FA 3DBIA 3EXHA 3KPVA 3EK2A 2P3LA 2PFGA 5B1YA 4PEVA 3A8TA 4KYUA 1CETA 3RWRD 1H0RA 3FB1A 4MB6A 3K0SA 5A5FA 1PEKE 1BCCH 1WCIA 1X87A 2P4VA 3W90A 4YAOA 1W4ZA 4YHBA 4WLNA 3EPLA 1RJ9B 1JEQB 3LTEA 1BOOA 4Y9RA 2F8TA 1ODFA 3ZW9A 2WWXA 1N5RA 1SKUA 3PC6A 3EVTA 4PYLA 4F1WA 3RCBA 1V39A 4FEYA 3UMRA 3OIFA 3UENA 2P7IA 3PU6A 1RM5A 4FDAA 1HG1A 4JEHA 2EATA 1KRHA 3IB3A 3N0VA 4CUKA 4BLVA 4JLVA 2PRIA 4JGGA 1KQSF 1RHUA 3TXYA 3P19A 3JYCA 3VHXB 5D00A 5HQ3B 5KVAA 2D8AA 1NBEA 2IYSA 3H04A 3B48A 3HBFA 5ADUS 1RKVA 2LVBA 3BBLA 3FWYA 2EOAA 3E5HA 1TZBA 2Z8YA 3LOUA 3OM9A 4FYIA 1H2MA 2FW9A 5CT5A 1U8EA 4D9BA 1EBOA 4DMGA 5ALSA 4G0MA 1WVGA 1KYVA 5JALA 1I4DD 3R5KA 1SU6A 1ND6A 3UMBA 3ZDZB 3VKHA 3IL2A 1PAUA 1S8FA 3JRXA 4QQKA 5FJJA 4ZN6A 1XL6A 4HSGA 1ZA1A 4C9BA 3DPIA 3V1UA 1BHJA 1BE3H 5A2QN 5C7OO 3L93A 2N1BA 4Z0HO 1LPPA 2ABWA 3CRCA 1DIGA 1ADJA 2QQ5A 2WSSD 4URYR 5JMPA 3NNNA 1ZHOA 3UBMA 4KZPA 1JSZA 2JFWA 1EZ4A 1G4UR 2AMFA 5F2NA 4DNXA 3A1NA 4Y2VA 3SZLA 1GL6A 2IUTA 2ONJA 1AUPA 5AVUA 4M0CA 4JYCA 3AQIA 3ZO8A 1ZGAA 3IGFA 1LEHA 3PA6A 1P4AA 4R1SA 2JEZA 4PSAA 5EXSA 3L70H 5JPDA 3KZNA 2QD1A 2CDCA 1LI7A 4U02A 1YJBA 3CCVV 4BTLA 4WPGA 1XZAA 5C8YF 4IQ8A 4AN1A 2DQKA 3AEIA 2UUPA 3GIDA 5CB4B 5T4FA 4PC3A 4D3XA 2Z5FA 4FC6A 2BKXA 2GO7A 4KIWA 1O9HA 2EILC 5B36A 4X6YA 3ZHOA 2QEQA 2PYJA 2OHWA 2AJTA 2DTDA 5J2TB 4DDKA 4U6QA 4FR5A 1IV4A 1YITV 5ICEA 2RK4A 1QWSA 2EFJA 4IDPA 3WG7C 1NVPB 1G1AA 3LY9A 4UTXA 2C07A 1E9DA 2PZBA 4NESA 2LCQA 3STWA 4QOSA 3H2YA 2HX1A 3V8QA 3AEUB 2Z1DA 2LDXA 3MMSA 2GWRA 4B40A 5LYJB 4DQUA 2ZI4A 4D9EA 2D6FA 2MTBA 3DBRA 1Z7GA 5DGDA 2ZT9B 1KS2A 3WMGA 3G2KA 2R0QC 1IFXA 5DGHA 1P7VA 1Z4LA 1GQYA 1H1LA 4OJNA 2PIDA 4L0DA 1QH9A 2W43A 3U3XA 5ILOA 1ADCA 1OA1A 3UB3A 3RS7A 4TL9A 4II2A 3DOJA 3ZHZA 1HQKA 1L8QA 2IT1A 1SM4A 2YW2A 1FSFA 1BGYH 4QULA 3H4VA 3RS3A 1BXGB 1XA4A 1NIPA 2RJNA 4LXUA 2QJOA 4GR9A 3UN1A 5F23A 4JZKA 4HH0A 1JH9A 1QTNA 1XZPA 1V9PA 3HKEA 1B1AA 4AULA 3MS7A 2HVJC 4UHEA 3C8HA 3WGIA 4I6GA 1FYFA 5AJTA 1WHSB 5ERXA 3RT7A 1CUAA 3WIUA 3GF4A 4OXIA 4JASA 4NDZA 1N2ZA 4J1SA 1GA4A 2WQ7A 3H6GA 1NVFA 5IMSA 3IOBA 2FYUH 4R69A 4BQIA 5H70A 1DBFA 2V6IA 2BZ0A 4C6HA 1HPLA 2BH9A 5HSGA 4CBCA 4WBNA 2QPAA 3PEFA 3FFQA 3QQ5A 3OZVA 5I9TA 4H15A 5FWYA 1WD5A 1RI5A 4XTRA 4GH5A 3H2ZA 4UMEA 4RDCA 2X3YA 4BUJA 1L5NA 5GAJA 5JIBA 1K2WA 1FQJA 2IY8A 4Q16A 1RKXA 3SDBA 4KKXB 2HEPA 7REQB 3COSA 3K06A 2JD0A 4O5AA 1GAEO 4O29A 1W40A 3GUZA 2WYOA 1NN3A 1P0IA 4J2TA 4PZUA 4Z7OB 1D2GA 3NPAA 2HJSA 1LFAA 3ONDA 1FY2A 3ZVKA 1YULA 2VZ9A 1K73W 4UNNA 2FPKA 1E3SA 3FR8A 3LAWA 3V5NA 4LBYA 1J49A 4LOHA 2HQBA 2NNWB 3U7EB 3QYJA 3O2SB 5T6BA 1LLDA 4GGOA 1M6WA 5F4BA 1YI1A 1ZJZA 2FKNA 2DKFA 3QY0A 3FUCA 4J9UE 1PFGA 5CXXA 4FGZA 4MVXA 1UKBA 2FDRA 2ZVZA 7MHTA 4DPLA 4ZOAA 5CBPB 3FKQA 4GS5A 2PM8A 2ZAYA 1IN6A 1XMOB 3PUIA 1XP5A 3RTAA 3JYPA 5CDYA 3W7WA 1TD1A 5DISB 3SLRA 4WNYA 4EK9A 3EEQA 3H8WA 1RIFA 3D9QX 4I66A 1HFEL 4HL6A 1GGNA 3TG8A 3C5WP 2HO4A 4TXHA 5FBKA 5CLIA 3UTCA 2WU3A 1WX1A 2PUFA 3S0JA 1L6RA 1SVNA 3HCOA 1ZR4A 4ZJUA 1R66A 4PGHA 1T9DA 2FOIA 2W6JG 2PNFA 1IIRA 1WB7A 1QH1B 3BEOA 4EMUA 4B3SB 4HGZA 4R9VA 2QL9A 2K87A 1CUXA 3RVRA 4R8CA 4KMSA 1CUJA 1ECFA 3KWLA 1A1SA 4PLCA 3V55A 1EUZA 1WMFA 5IXYA 1JHMA 1EFVB 5M3BA 1QCZA 1UMBB 1ISHA 1K5DA 1N3LA 1EFPA 5B1IA 2FN4A 3OF5A 1TIKA 3Q40A 2CHFA 2WTNA 3THSA 2ZYIA 2AF3C 1JDZA 3MELA 3NBZC 2JIQA 4B6FA 4TWIA 3B1KA 4Z9BA 3HHPA 4QTYA 3STZC 2D5IA 1NG9A 2EEZA 1WSBA 1CF4A 1G8KA 4H0CA 2XXJA 1DAGA 2HRUA 1MJ5A 3C3JA 3UJ3X 3L3BA 3EAQA 2NZWA 1JDNA 3E9ZA 5IFKA 13PKA 4JDUA 2Q1YA 1RYMA 1H4QA 1N5KA 2YI9A 4MVJE 3PLNA 2IDJA 2D1SA 2QR5A 4Y6SA 3LSSA 1ZI6A 4PAOA 1SXJE 3I9JA 3W4KA 2VKQA 2QENA 4J0IA 2GCOB 1L5GB 5JYCA 3PJSK 2YZMA 3GVPA 4MTLA 4YX9A 3TB4A 3KS9A 3DEIA 3U4MA 4Q47A 2EZPA 3AI1A 3KVRA 1YZVA 4OI4A 4LA4A 5EQJB 2P6RA 4WGGA 4S2UA 1THMA 3RF6A 3MJCA 2VF4X 2BTOA 4MGIR 2ZIEA 3PZBA 3F5SA 2WPNA 2PQ6A 1MX3A 2E0IA 4H1HA 2VDRB 4V1CB 4NJMB 3R0IA 4M2LA 2GV9A 2Y71A 4MW8A 1UKYA 3IV6A 2GVDC 3UF0A 3CMMA 1L5LA 2YICA 3W3AA 3WYGA 2EWCA 2QMUA 3BA9A 3EFBA 3ZU5A 4FLTA 1CVIA 1P7YA 1N6RA 2F8MA 1H2FA 3NEYA 4MUYA 3AFOA 3GDWA 1NVAA 3AR7A 3TLJA 3MSCA 3X2SA 3KKNA 3OMNB 2WFAA 3NDIA 2HYDA 1FP1D 3DLHA 4ZZ1A 2YIBD 1DO2A 1FBTA 1SHTX 1TK2A 3LLCA 2WAAA 2CC2A 3ZQJA 3QUTA 2I6XA 1L7OA 2OV2A 2EFGA 4KXUA 5SYNA 1X14A 3SBXA 4N23A 1QK5A 1ND5A 1KH3A 4FHCA 1NXPA 4GUNA 1K8RA 1PVDA 4AG3A 5LWQA 4YYZA 1HR0B 1KC8W 4MS4A 5C34B 1YDMA 1LVGA 3KEOA 2ZJAA 2GKSA 3IT3A 4CDMA 1CUWA 2DBRA 5AOAA 1SOUA 4DCSA 3LXUX 1PWHA 1COZA 3ISTA 3OBIA 1V5GA 2QM4A 1IBCA 1JPJA 1YQQA 4RZQA 2VAMA 1GGHA 1Q0LA 2H9YA 4LDAA 2YCLA 4NWOB 5FI3A 2Z4SA 2ZXWB 4Q7LA 5TPWA 4MVQA 2CJWB 1NLYA 4JOBA 1C7QA 3ABQB 4LFAB 3GLIA 3P5SA 2R7AA 4U3JA 1G63A 4K8OA 2A14A 1UPCA 4DADA 1WJZA 5SY9A 1F06A 2FCAA 2A3NA 2ADPA 3FAZA 4M6WB 3W2HA 3GWKC 5HY2A 3B8EA 1ZQ1A 2CGEA 3NEJA 3KQMA 4Z51A 3T1QA 2QTGA 1ADGA 2X15A 3F0GA 4CVNA 3AVXA 4JBWA 3OGCC 4GKJO 1NTOA 1T0AA 2GEFA 1KP2A 3BD8A 3HZOA 4BVFA 3HVHA 2JEUA 3NP7A 3WDMA 1AU9A 3G6KA 4NMHA 2HWUA 1WMDA 2GVZC 1QG2A 2I4NA 1CQWA 1DT3A 5MGBA 4JVLA 3I2GA 1Q82H 3DLAA 5ARCA 2YV5A 4JL5A 5BRJA 2GHYA 3TI7A 1RQLA 3A9CA 4GL4A 3HNPA 3EBOA 4EPTA 1Q19A 5HM8A 4H31A 3LCJA 1U8AA 3TNJA 5JJ5A 2Z09A 4UJ5A 1G42A 1MW8X 2KTVA 3TIFA 4C7KA 4X6XA 3CLRD 2VBCA 3DYVA 3C6YA 1E2NA 2QTNA 5L3BA 2GM5A 3PQFA 1YF3A 2JGDB 4GRAA 3GYQA 3TGUH 3AR6A 1Q0SA 3ZX6A 3ES9A 3KCXA 4MW6A 2GETA 1HQYE 1N2BA 1E2LA 2OE2A 3D6FA 3INRA 4O4HB 1QAOA 3CNEA 4FDMA 1JIUA 1S5HC 2P9GA 4BMDA 2AW9A 4MW2A 4EKWA 3I9FA 3IMFA 3DE5X 1Y4UA 2O7RA 2YMLA 1R0LA 4LXTA 2XA9A 1DFIA 4V2UA 4YCNA 2HQOA 2OOSA 1ZUIA 3QVGB 4I0XA 5BXQC 4PTLA 1HURA 5EIXA 4BMZA 2BT4A 2OVBA 4TKUA 1OYVA 4KX3A 1ZVJA 1O9GA 1VQMV 4R9UC 3K05A 3M84A 4NENB 2CXSA 2ZVYA 4IWYA 3GJ7A 1VBNA 2JLVA 4N7MA 2BP7B 3VCZA 4LV8B 4MMZB 1S01A 4O1IA 1NAIA 2OV1A 3UO2A 5DO9A 4TTSA 1MQSA 3CNNA 3DDOA 1E2KA 2GLZA 3WNZA 2Z83A 3IQXA 2AMJA 3IPRA 3E22A 1Z5ZA 3LPMA 3CLKA 4G4SO 4GLOA 3C8MA 2A0KA 2RAUA 1UC4B 1DAMA 2NYVA 5IH3A 4ZJZA 1QGUA 1W5SA 4ZVTA 4IYRA 2AYYA 2J0VA 5FUVA 1C50A 2ENUA 4YGYA 3GEPA 3O6VA 1EK6A 4X91A 2OO3A 4IZHA 5H9CA 1PF7E 4P5DA 2JGNA 2D2IA 4L27A 2PRKA 1KKLA 3DAPA 2ZUEA 2QW1A 2VK1A 5AXBA 2IY7A 1NXOA 1AMUA 4DNPA 3L0ZA 4EZIA 1W5TA 5DI3A 3VVBA 2QTVA 3O75A 4P4SA 5JSKA 5JD5A 5DT2A 3VC7A 3ZOKA 2DC1A 2D5BA 2BISA 3SOZA 3CVOA 3FPLA 3QBTA 5IT9M 2LRHA 2GPBA 1EX6A 3LWPC 3F98A 3PWTA 5FWXB 4B3MB 2N0SA 3R7NA 4TMTA 1RW4A 2R1ZA 4ZHWA 3OIUA 1V96A 5JHGB 5EZSA 4MQBA 3JSXA 4Q93A 3SHQA 4B6GA 3DP7A 4NSNA 3UXHA 4XYLA 2ILMA 4U7HA 3N0XA 4NCXA 1KZ4A 4L51A 3M89A 1PT6A 4E2YA 5EWRA 4ZT5A 4Y6PA 2YDEA 3TMYA 3NATA 2C2ZA 2WDPA 4PYJA 3FPSA 4RSMA 5F5XA 4LRTB 2RHJA 1UJMA 2JCVA 2ZODA 4RKRA 2FZ4A 4US1R 2PXHA 4YHHO 4YCLA 1P2GA 3C48A 1QGYA 4EG0A 1DG9A 1XQ9A 1LQTA 4ZU1X 5EPUA 1FCJA 4XDYA 4GBED 4RDIA 3QE2A 2I4IA 5G0VA 3KQVA 1F20A 4OL9A 1NLUA 2HQ1A 3IDZA 2JFXA 2XCSB 1X1SA 4JR0A 5H9WA 4E30A 4X8AA 1FFBA 3DZJA 3HRIA 1G5QA 2P6JA 4TYYA 2H8KA 2UXCO 3KHNA 1X7XB 3HA5A 1UXOA 1VRWA 5L53A 1ZD5A 4JJFA 4GECA 3PUJA 1QE5A 1Y9AA 1T3HA 2X4DA 2FMUA 1ENPA 3SYRA 3DZBA 1TM7E 1TM2A 3SF8A 2XT0A 3TXQA 3DONA 4MQEA 3D7KA 5C81A 1X7YA 1RRPA 2QBYA 2VH1A 3W2EA 3HM2A 3DXRB 3U4GA 5CYFA 3WQRA 1TJPB 4FM0A 1X59A 1IAVA 4ENUA 4EI7A 3RHTA 4AO7A 2X6TA 3V3KA 2Z6AA 2FW6A 3QK7A 4GLLA 3W06A 5HKKD 1W29A 1D6NA 3WJ7A 1JL3A 4O4JB 4PCVA 3C3YA 5LQJA 3L7NA 3H9JA 3M5CA 2IYXA 3AVOA 3KL2A 5IY5B 1X1TA 1AC5A 4CFZA 1M8KA 3NCHA 3BMOA 5BN5A 2V6GA 2QTFA 2I78A 4V0QA 2XE8A 2AYXA 4KMRA 1OHHD 4YV7A 4WCFC 1CTQA 5H3CA 1L8AA 4RVDA 3MB5A 3RSSA 4NU0A 4FNOA 1BX0A 3P2YA 4X00A 1T1SA 1JIIA 2XGOA 3V2IA 5TMPA 1PP4A 5HZHA 3AJAA 5EC1C 1ZIOA 1GVNB 1KPHA 1TE2A 4TZ6A 5JDIC 4DW0A 3ASZA 2FWJA 3LCRA 2WG0A 4MKRA 3DLIA 5D1NA 1FE8A 2DYKA 1G20A 2B6NA 4ZCTA 1SWVA 5BSGA 2R8YA 2AK3A 4ZO9A 1Z26A 3W9UA 2I6TA 3R41A 1B3QA 1HETA 5FWNA 2DPHA 2VJQA 4B47A 4GZ3A 4MT8A 3OX4A 4I4CA 2X3UA 4KE7A 2CNKA 1GZ3A 1ZMTA 3QM1A 3QKSB 4J4TA 4W5HA 3KQSA 4QO8A 4P8RA 4HLDA 2V7UA 2QZZA 4X9QA 1OB2A 2MINA 2YCBA 5K8LA 2YUAA 2HWYA 5JXJA 3DL4A 3DKIA 2HV8A 3LCVB 1ZA2A 5DLPA 2RKBA 3M81A 3BK1A 1I36A 1PU2A 1Z6ZA 3EXFB 2XAUA 1Y4MA 2HI0A 1X7ZB 3HVIA 4ZYXA 3MN1A 1Z34A 1CY0A 1Y6FA 1IYZA 5DTIA 1FX0A 1AG9A 2BGIA 3G9QA 4YT4A 2PUAA 2JFZA 3P10A 4KYTA 4P58A 4UPDA 1D7AA 2WLIA 1W0KG 1EGHA 3H18A 5AXAA 1R3KC 3IERA 4URUR 3LRPA 4Y2QA 1F0NA 1ZIXA 5BVGB 3NOXA 1D9ZA 2DYSC 3VNQA 2G09A 3PYXA 4JOQA 3E89A 2B2CA 3B2QA 3FN4A 1XT6A 3K31A 2D3OW 3WYDA 4Y7CA 3UWPA 5CEEA 2XCTB 2WI8A 1Q86H 3EVKA 2C0CA 3T1CA 1FW8A 4WZZA 1ZN7A 2FKXA 1RP3B 3O31A 4G6ZA 1DTSA 1Z3CA 3SFVA 2TMKA 2CK3G 3A6EA 1M4UA 3PUYA 3CNBA 1YDXA 3VDQA 3ZGVA 2W48A 3H5VA 3QV2A 2JCXA 1J9ZA 5EBWC 1CRLA 4G5XA 1KR2A 4CETA 1FXUA 1CX9B 1O95C 4FMDB 1A9PA 4M36A 4YV2A 1BD3A 1YQUA 4BOYA 3ON1A 2AA3A 2LGJA 4LCKA 1EJBA 2JC3A 3EDQA 1F5NA 4D9JA 3LWOC 1SKQA 4ZYTA 4YRCA 1SD5A 1N5IA 4TTRA 3WY9A 1S8AA 2DFVA 5J4VA 1SOWA 2V7WA 2QE7D 1RRMA 4FXOA 2J5RA 4YP6A 3ELCA 1ZNXA 1NLMA 1TAQA 4RD4A 4K6FA 4X1YA 2OWDA 1P1FA 4EW1A 1Q16A 4RZXA 4X97A 3AYXB 4EFLA 5C5CA 3QI7A 4M9QA 4WOPA 4HRVA 4PDRA 2QV7A 2EX3A 1NQXA 3IEUA 4U6NA 3UG7A 3L7JA 3F7TA 1T9GS 2J7KA 1JEEA 4MS1B 5JR3A 3JCUZ 4RIEA 4FGLA 1NPTO 3EDRA 1ST3A 4CTKA 1ZN8A 5EIOA 1MOPA 3ENKA 1KARA 2JCBA 3ZDXB 4QICA 4NXMO 3RVLA 4UV8A 2VPXA 3QBDA 2XMQA 1XE3A 4OQLA 1G3QA 4L7QA 4DR3B 1YZHA 1DX4A 3DNMA 1ZN9A 1IIBA 3M5PA 1C0IA 1TQ4A 3DHEA 2YINC 1K0FA 1OLOA 4G88A 1X8XA 4FFBB 4LBVA 1MD9A 1XV2A 2O2GA 4C4YA 2TECE 4FYWA 1YKSA 3KRTA 2KX7A 4PR0A 4RPKA 2P11A 4IDQA 2JI6A 3PKIA 1P19A 1QIFA 1PFVA 4P4LA 4W1PA 3TLMA 3MUOA 1JIKA 4LXYA 2I67A 5AUQA 1KOJA 5KZMB 4V03A 2Z4RA 2FMHA 1KVTA 1Q6YA 4AQ7A 4HLNA 3SJAC 3DH0A 3SBDA 5A6VA 1XZCA 1ZO8A 3MGKA 3MGGA 1YUMA 4DCNA 5EBMC 5CNJA 1LDNA 2XIJA 4MDYA 3NWJA 4QT4A 1AKRA 5KTYA 3FB6C 3PLAE 2C42A 4MIOA 4LOJA 5EE5B 5F3RA 3UKDA 2J3QA 4P0PB 4FM9A 1O0BA 1WOMA 3ZQ4A 2QRHA 3P1JA 1EBUA 4KYVA 1Z35A 4NTWA 4RKEA 2E4YA 4F3NA 2WZDA 2QRPA 1VIBA 2ZB2A 4WFGA 5ES3A 4F97A 5BVHB 2QN1A 3K6JA 4HH4A 3ASOB 1AF7A 3UHOA 2AXPA 1A27A 4AUEA 1TZ2A 4XVUA 5P21A 2ZIOA 1XHLA 3KU1A 2CJFA 2XKJE 2X0FA 3AFMA 5K0JA 2G1UA 2PX6A 2X1LA 5A02A 4ZDWA 1XBLA 1IJFA 4HDNA 1L1QA 4FB5A 1S1MA 4IGAA 2IP1A 2ZWMA 1BTOA 4COOA 1WZ2A 5C5DA 3PPXA 5JNSA 2ZSEA 4YALA 3URKA 1Z74A 1QO9A 4KC0A 4I5GA 1IUPA 1XVUA 4FXPA 4R1PA 3AWIA 1U8CB 1F0YA 3F71A 4YN3A 5BR7A 3C16C 1OBHA 4HUJA 2DH5A 4XQ0A 1Y3AA 1RJFA 5JDIA 2B2XA 3CG0A 3E9YA 2B7CA 4LK3A 4PBRA 3WK9A 1IOWA 3NVMB 5A4AA 2ZS7A 4DV2O 2DFDA 3ZYCA 4E13A 2BJWA 3UZUA 2H2IA 1GNTA 1M1NB 1XREA 3CONA 5JZ9A 1H0KA 2DUMA 4CM8A 3AX6A 1E8NA 3S8EA 2PTGA 3QFTA 1GKIA 2P0AA 1OC4A 4EJ0A 3UANA 2P0YA 4YCCA 3WL6A 1OF1A 3R8XA 2D0IA 2R84A 3A6KA 1WDTA 4C1BA 4NVRA 2I54A 5DULA 1S9HA 1BC5A 4JYBA 5H0IA 3LFUA 3IXMA 3O74A 1NJ8A 1YWGO 2D7JA 4P9NA 4FLMA 2OM2A 4D9NA 4AM8A 4X60A 4DY6A 4FPPA 4DCVA 4RABA 4LHYA 1MOQA 3L6EA 4M9SA 3HKBB 3KTOA 3Q8HA 2BF4A 2N9UA 4UEJA 4E07A 4WXRA 3E70C 1P29A 2A1TS 3CUWA 4TSRA 2WG2A 4J90A 2Q6LA 4MITA 3WKDA 3RRXA 1JNYA 5KYVA 1XQ6A 3EXHB 4S1WA 3LDGA 4DQKA 5B4VA 2ECQA 4LMBA 4IVRA 3TKAA 1AA6A 3CC4F 3O8OA 3F5TA 1VI5A 4PO3X 4HVCA 2ZRHA 3GGGA 5K3OA 2UXBO 3CZPA 3OIGA 2WKPA 3CZAA 3V1NA 3FNBA 2WR8A 5JQGA 1SFRA 1ZH4A 5B2EA 1UJ6A 4RH0A 2BUCA 1TJ3A 3JZMA 1F2VA 1N33B 3PPYA 3AR2A 1RVDA 3EIWA 2F7SA 4RIFA 3QOXA 2FRDC 2WHRA 2CCJA 4XD2A 1Z6YA 1KJWA 3HUDA 4FHZA 4XQ9A 3K1ZA 5FPOA 4YA6A 3R66A 3IPLA 2AI1A 2HMTA 4D99A 2AW3A 1X1CA 4FYYA 4X84A 3NORA 4U1RA 3P0FA 4Q48A 2B4YA 3SZRA 1E2MA 3IXLA 2P9JA 2XBUA 3RBZA 3G1UA 1GNVA 4DVJA 4FLZA 3SEZA 1X39A 1H2BA 1L5FA 1O95A 3GMDA 5DCYA 4EKEA 1SZXA 2EZTA 2IS1A 3MWJA 3JRWA 3ON5A 4MW1A 4YDQA 3L6UA 4KHPB 3E8XA 3F5DA 2JH8A 5GONF 5JS6A 1GM9A 2CUKA 4RJTA 2DTEA 2PT6A 3BXGA 2NX2A 2Y0DA 1YGYA 2YRXA 3T9BA 5H5JA 5D6OA 3GJZA 1U7HA 3EA5A 4HS4A 1AKTA 3EA0A 3KLOA 1W36B 4ZGWA 1Q81H 1ZNWA 1MABG 2IEDA 3OE7D 2CKMA 1SXJC 5GV8A 1H42A 5DHFA 3DC2A 1DJOA 4XARA 2IW1A 2K2WA 3TEFA 4KWCA 1YJ9F 1P2BA 4RY9A 4BX2A 5DNAA 4AJEA 2FCRA 1KPGA 4JOCA 3SNKA 4IT5A 3LP5A 1DUVG 1TDJA 3FCUB 2HMWA 1JA1A 4PYIA 3ZWMA 4KO2S 1QH8A 5EJ6A 2CLOB 2B8EA 3NT4A 5GQSA 2QD5A 1JDBB 4N0PA 2J32A 3H2IA 3NIGB 1NJ5A 3H2SA 3GU3A 2NP7A 3PEVA 3FZNA 3GROA 4RTLA 4KW7A 3CCRF 5ALWA 1XKQA 2CWDA 2OZBA 3TW0A 2EIMB 1YQNA 1XTKA 2F1HA 3LL7A 1SKMA 1NMYA 2QTBA 5KWSA 1UC8A 5HBRA 4MROA 1ZU4A 3OM8A 2FR8C 4OBWA 2ZWAA 4U2BA 1P4SA 4N48A 3L4JA 4H3KB 3VU9A 1EBBA 1AUXA 3F6RA 1EDZA 2IOQA 4JLOA 5FR2A 3OTQA 4U2CA 3DS8A 1FFDA 3ADBA 2NT3A 3S1SA 2WJZB 1E2GA 3O4HA 2OTLF 3BGVA 3CJHA 3PQDA 3AF2A 4QTUB 2D13A 1XFAA 1KXJA 1CLUA 4PC6A 3OZWA 1IXZA 2ZYUX 3EDYA 4ID3A 1WU7A 3UC5A 5B57C 3DTVB 2IJIA 2HYIC 1K75A 1S4QA 2VOEA 2FQXA 2FU5C 1CY8A 4L4YA 4U4AA 5EIEA 4NTYA 2C4NA 2WD9A 3P9XA 4MVJI 1J8VA 3ABLC 3CPWF 1PD1A 4IGIA 3DT9A 3TCKA 2GRJA 1KYWA 1KY3A 4TZ0A 3M2TA 4D3YA 2C8JA 1KO1A 5FUYA 3M3DA 3KSDO 2EX0A 3NFRA 2IZ6A 1YJNF 2QEXF 1JQEA 1Y4DE 5E9JA 3FFXA 1MZEA 5LB2A 2QK4A 2BSXA 1H1LB 4PBSA 3NOOA 4KQWA 1X2EA 3OTFA 4RL4A 2CFSA 3QTLA 1CK2A 5CVEA 5SY6A 1LF0A 3NBQA 2Q28A 4EITA 4HDKA 3UMFA 2X86A 4UFPA 3RE3A 1X7GA 4OFXA 5IJXA 2D0OB 3D0OA 1YBVA 3UHPA 3WC4A 2BEJA 5CM8B 3P9QA 1J2UA 1YFLA 3IAM6 3HKEB 3DVAA 3OZRA 5AVYA 3T6KA 3T1HB 5KHAA 5DNWA 3UBTA 3CCUF 1MC1A 3QENA 1FKAO 3OX2A 3LTNC 3T9CA 4JASB 2O0JA 1K92A 5HIMA 1JP7A 5DW0A 2A5FA 5G41A 3OMLA 3UHFA 4EVSA 2JVIA 1TNDA 4KFTA 2LW7A 4WKNA 5IT5A 4A10A 1AF4A 1VLHA 3H11B 5FWYB 2W90A 3CEJA 4MTXA 4FEEA 4MUKA 2O52A 1HNWB 2WICA 5KJFA 1RM4A 1P1HA 3PENA 4EGFA 3B51X 4OHBA 4WKCA 3UGQA 3ZLTA 1UC5B 3RROA 1KYZA 1KDZA 1WNFA 1XRMA 2WJ4A 4XWKA 2G36A 1RPTA 4DIOA 4UHDA 2DR0A 1IHPA 4ON9A 1Z33A 4KP4A 2YI8A 5IEBA 3VHRA 4YRJA 3C98A 1RT9A 2HVKC 5DLEA 4ZZIA 3B2NA 3TGLA 2LWIA 3WLTA 1JDJA 1K6JA 2GBPA 1T3ZA 4E94A 1VBKA 3GVXA 3PUHA 1FFAA 5C2JB 5IKEA 4QRIA 3F0FA 1UKZA 3FETA 4A0HA 3CEHA 4NC9A 1Z0ZA 4RF2A 1CS0B 1ORDA 3JQPA 2ZI9A 3KD2A 5B1DA 4O4IB 2IBTA 1ULHA 1M57C 1B16A 3QXJA 5F2EA 2RHHA 3FNQA 4TMZA 4EY5A 2XNJA 4ER5A 3KHSA 1Z7WA 2ZTUA 2H18A 3W7SA 2BGGA 4M8NE 1FQKA 1IXKA 2PZ8A 2VDUE 3U81A 5DNUA 1GGKA 4JYAB 1XRQA 4TS1A 3ROXA 1T15A 2C2XA 3A06A 3P96A 3LD9A 3J81A 3A7DA 3BRSA 3ERCA 3E9MA 4HWOA 1O0CA 2OR3A 1I7SB 4FFMA 4DR1O 2DY0A 2YHBA 2GSMB 2FRDA 5DIFA 4WADA 1YS6A 3U1VA 3O2JA 5DCLA 3X1WA 3WYEA 3N7AA 3Q6NA 3ZHCA 3ZN2A 1E1QD 4MO2A 4ALJA 2JBHA 3A6PC 3IJ5A 4MUGA 3Q15C 4ALMA 2AC4A 3D4OA 1SQ5A 2O8VA 4MR8B 3JWHA 1NSTA 3DDHA 1SEVA 5T4EA 3C14C 2Z95A 1DP4A 1E5XA 1JG3A 1EFPB 5IVPA 4HEQA 1BXRB 4ZVVA 4YC7A 1C7EA 1LLQA 1LPOA 2FX2A 4KWEA 3MNFA 1PTJC 5NULA 4GVXA 3TXSA 4DRXA 4ZDIA 1QAQA 3NNDA 1NT2B 4A3SA 4DC9A 2F3RA 1IUKA 3CRNA 4MVJA 4EGJA 4OVKA 3O8QB 4B3FX 1RAAA 2R8OA 4EKGA 4GX0A 3K0BA 2FW7A 1SXJA 4NBRA 2JLWA 2B8JA 2VKTA 1EWVA 4LOAA 3GEGA 4CR7A 5JVDA 3ESYA 2WD7A 2ODAA 4AROA 2AJDA 4JYZA 3TNFA 1JX9A 2Q7XA 3OC6A 4UBMA 3CUEF 3IDAA 2HKOA 1HWYA 3L79A 3KQYA 4IXDA 1YUNA 5FTMA 1O6CA 2Q73A 2FFRA 1OJLA 4ITRC 1FZTA 2YWXA 1BQ0A 4AF8A 5ALHA 2VNAA 3EZYA 2PRYA 2GERA 1WB9A 1E7KA 5C3MA 4RYDA 2FAXA 1WOYA 5EJ9A 5I3CA 3Q7SA 4RA6A 2W00A 2Y4UA 1O97C 2QIOA 1NQOA 4RLQA 1A7JA 4B43A 1KEEB 2EZ4A 4ACBA 3JATA 5K0TA 4R9SA 1VQKV 3CJRA 1MA1A 1OYWA 3GJTA 3N8GA 4OGKA 2OHGA 4YO8A 2FR8A 4NECA 3QF7A 3BL8A 3JVDA 3G0CA 3DOEA 2HGZA 3ANNA 3F3MA 4XBFA 5JJCA 2XT6A 2X22A 4DC1A 4I36A 4DMCA 1E92A 3BPZA 4HZ3A 2PQ2A 4JV5O 4NAHA 3WG7B 1OPXA 4E1VA 3NDBB 3ZX4A 4QLOA 3WLIA 4QOFA 2BCGY 1S0VA 1EFCA 3IR5A 4FBMA 4YJGA 3RQSA 3UUGA 3I5MA 1YZUA 4C76A 1BWRA 1AVTA 3NTLA 4RD0A 5FFFA 4OMCA 4WASA 4MS4B 5KYGA 3VQYA 1ZC4A 1V54B 4BO1A 4KH1A 1NJGA 1JHOA 3C87A 4JEMA 3GQVA 2PJDA 1L4BA 1Y76A 4LY9A 1R9JA 3UMYA 1MNGA 1XK6A 5I7EA 3STTA 5HOQA 2ZDGA 3SPJA 1ZLXA 5D84A 2FPXA 1CQIB 3AF0A 4TXLA 4DREA 1Q3EA 3SDLA 3B1WA 4TKMA 5A4DA 5TPWB 4EZEA 2XMDA 5TGZA 5DHQA 3CO5A 2G1KA 3IB6A 1BSMA 1V71A 5JAUA 1PJZA 4UE3S 5DM0A 4N21A 4WOBA 3Q7EA 3R3WA 4BFVA 3G9XA 5JH7F 1R5NA 1BFKA 1WB8A 1N8SA 2JANA 5K0EA 3C0KA 1JR9A 2PKRA 3WICA 1FMJA 4X90A 5IKXA 2Q1UA 3QP9A 3T0GA 3A0BZ 2HCJB 1LK0A 1O08A 2PBRA 1CSEE 2GJ4A 3BZBA 4R68A 2AE2A 1AQLA 5C7LO 2EARA 2R62A 2ZK7A 4FJCC 2Q5EA 4Q6WA 4NYIQ 4JAUA 4Q9NA 4TZTA 2FUNB 4H9GA 3GAFA 1CUZA 3H6HA 3DE1X 1X9HA 4D8TA 4R3NA 2QN6A 3L1KA 4OAPA 3HXKA 4YRNA 4KREA 1TLLA 1O1YA 1OYYA 3ORHA 1Y1QA 5C8DA 3GHHA 1H6BA 5A4FS 1S3FA 3GFBA 3KKPA 3ZHRA 3CCFA 2Q3BA 3ZHBA 4R2JA 2B7LA 3GP3A 3UV7A 2MYUA 1ILEA 3KJFA 1M8FA 1F2UB 1CJBA 2WLLA 1PZMA 1E20A 2O57A 3T99A 2HR1A 4CIBA 3GUHA 3W5DA 1IXSB 4YK7A 1CUUA 4FT4A 1MUUA 2J3IA 4M88A 1K6XA 1M1YE 4JS0A 4A91A 1L7DA 2H4HA 3K79A 1M0SA 1OXMA 1M5RA 4DSZA 3JCZA 5GGXA 5KWEA 4QQRA 3T38A 4NCAA 1W2WB 3WV4A 4YV1A 3DEYX 3K2XA 3QEJA 2I7CA 4GL2A 4K1LA 4X24A 1UEXC 1W87A 4D3SA 4CTJA 1M83A 1E2EA 1O7JA 4OGQB 4H7FA 3R6WA 1R1BA 2GAJA 1B3RA 3C7AA 1OE0A 1Z37A 4KR0A 3ABIA 5HDBB 5BSTA 3CRRA 4ETMA 1RWNA 4OLBA 4DSOA 1EG7A 4EJMA 1MDBA 1NOIA 3DAHA 4C82A 4PTYA 1PBNA 4EJFA 4TT3G 4CQNA 3N6XA 2ZJBA 1T4MA 2ID8A 3D7LA 3LT5A 2YS7A 4R98A 1HYEA 3RSLA 3EFEA 3FOZA 4RJIA 1QS0A 3D8NA 1QUEA 2XAFA 1JTFA 4CIVA 3OLXA 2H51A 2CXTA 3V4FA 3K2BA 2RGAA 2NWQA 4DCUA 2NUBA 3WBBA 2GBGA 2QU8A 3UMVA 3HDYA 1I5OA 5EZ6B 3OO1A 3S8YA 3WLNA 1P9OA 3H9CA 2OHIA 1X1AA 2UYPA 4D9HA 4DZZA 5EFZA 1TM4E 1I0HA 2QTVB 5BQPA 4P4SB 2HDOA 1PTJA 3T3PB 2V7XA 1F4LA 1RXSA 2OMKA 2RHDA 2ZB7A 3T9FA 3P94A 4J3JA 1YA6A 3DFZA 4JBIA 2XGSA 1DPFA 4JUCA 3BHJA 3AR4A 4RO2A 3WGMA 4WSOA 1SGWA 3DE6X 1FDSA 4MCIA 3MCWA 4HYTA 3ABZA 2QI9F 1E79A 4EJSC 4CRWB 4CM4A 3TQTA 1P7GA 3RW9A 3X1ZA 3MLEA 5HRCA 4KGXA 5TR9A 3KUCA 4NCNA 3DULA 5DE3A 4B34A 2FVXA 4BFTA 4DE5A 5I7WA 4EPYA 3OAAG 3EDOA 3BWBA 3BB3A 1ACJA 2HADA 2XRZA 1LGYA 3QVUA 1KYXA 4EDFA 1U4OA 2D2CB 2IYAA 3OX3A 3OBWA 4B9EA 3CCEF 1SG9A 4MUAA 4AJIA 1N1EA 5CRIA 3QTTA 3NU1A 1CLIA 1IWOA 3Q4HA 3HI6A 3LBFA 3FCAA 3DZIA 2PKYX 2QA4F 3U31A 4KXQA 4N1AA 3PLAC 1QONA 4HGRA 1U63A 4PRKA 2V74B 1E66A 1TUEA 1KO7A 5IYZF 1NOJA 4J42A 3SF8B 4NAVA 4MAFA 3UAZA 4MQEB 2V7QD 2DPMA 1X7YB 3BY6A 1G0OA 3QY9A 4ER7A 4NVPA 2N1MA 1M56C 2JHAA 3MF4A 3FX7A 4TL6A 4B0OA 1B8VA 1J42A 1RI1A 4UVHA 4B6SA 4P3XA 3MTIA 1T3TA 1HK7A 3QXXA 3ME5A 4EMBA 4PXSA 3LHFA 3AFIA 2YJ5A 1V55B 3OT7A 1JLHA 2J59A 8MHTA 4HYQA 1W4CA 2EKBA 4Z9AA 2H94A 2B34A 2XWJI 5BN5B 3HV2A 2YJZA 4N6OA 4QDUA 4FMCB 3FZYA 2AUNA 3K9CA 3RS2A 4P82A 5F51A 5KNDH 4R01A 4RXMA 3OA2A 2GYYA 1S7GA 4HDMA 4KLZA 1WQ1R 5B1HA 3STXA 3W0LB 1KBOA 4LXXA 1JJBA 1F60A 3ZNNA 3K2EA 1AKNA 1NA5A 4I4TA 1A5ZA 4I9FA 5I9SA 5EO3A 3ITKA 1NN5A 2W93A 4CMAA 1E9SA 1POWA 2BE3A 3DO6A 2WSSA 2VP5A 1G20B 3TTXA 2RG1A 2Q5QA 1NV8A 3ICQB 4DIDA 4OSPA 4LW8A 5B8FA 4C14A 3O3NB 5DM60 5F76A 4KQJA 1OT3A 3BAZA 2DG2A 2HEGA 5E1AC 2GPYA 3WLLA 4H0LB 3D3WA 5FT9A 3B9PA 1JDTA 2XDWA 4LHVA 3IMKA 2BIFA 4ZOLA 2C4TA 1KH1A 1P39A 3VR5H 1H2LA 2ZETA 1GRCA 3EWIA 1F14A 5KU1A 2N75A 4OSOA 1AV6A 1VARA 4XASA 4JIGA 4KBFA 3E8BA 1U7OA 4YJHA 1XLTC 3OCJA 1JKIA 2CZGA 4JI1B 3UK2A 5EJ8A 3G8AA 1FX0B 2QM0A 2IUEA 1V3QE 3GLSA 1J2TA 2AG0A 4JLPA 2ZSAA 3NONA 3FFWA 1GM7A 1T8RA 1QIJA 4K6KA 2WLIB 3I64A 4IXMA 4YMLA 3ZD9A 1E9AA 1U8FO 1CUBA 1LB1B 1QX3A 3DE4X 4IGKA 1WHTA 3DEFA 4FVTA 1AD2A 4Q9DA 4YP0A 4KQ1A 5BOSB 2V45A 1E0AA 2HRQA 4OXXA 4D44A 1VDMA 3NGMA 4YT5A 3I5XA 3OBYA 4KWIA 3GRYA 1O54A 2C3MA 3A1UA 1I1NA 3B9RA 5EHXA 3IALA 1IQPA 4BZXA 1I5EA 4RXUA 1Y7PA 1F9AA 3JQGA 2AS0A 3G2IA 4LVUA 3NHZA 4CF4A 2JZCA 2Q5IA 2IZZA 2XVYA 2C61A 1GAJA 1DBVO 2FA9A 1M0WA 4B73A 1GTL1 2MWMA 3OLVA 2YASA 1XNRO 1Q3TA 2HSZA 1GZVA 2GCNA 3WL3A 5CDUA 2X0LA 1T9HA 2O8NA 4QTZA 3F74A 4HYYA 4BTVA 3DWEX 3DTTA 3NGLA 3H97A 4CG3A 1ODSA 2QP4A 3W34A 1IY9A 1FXSA 1NMQA 2Y1XA 2Q0AA 3U4IA 4K03A 4XCXA 3FD6A 3H8SA 4XVHA 3SC2A 2HEIA 4J1NA 2P9EA 1U0HC 2PUVA 1Q3KA 1IXMA 2JBWA 4I7EA 3FJ1A 3LY5A 2VFAA 4CKCA 3L6BA 2JLQA 2MMGA 3IUPA 2Q5ZA 3PNSA 4P2ZA 1SU8A 3COWA 4MP6A 4WUVA 5C7YA 2C3YA 3TIXB 4LQCA 4OI0A 5ABPA 1UJ2A 2ZJ5A 3G5TA 3D3NA 1BHSA 4S0ZA 3CLRC 3QUBA 5K8UA 1CIPA 1R0CA 1NDHA 5AKGA 1UPUA 1LSOA 4XPIA 1GX1A 2V98A 4OK6A 2PBFA 1XKLA 2JDIG 1DUSA 1OFUA 4Z4FA 4WFHA 3RVOA 4P3PA 4RQFA 1K8QA 1L7PA 3U19A 5A4IS 4JZ2A 3SM9A 2Z2YA 3U61B 3WZLA 3GB9A 4EJSA 5M7EA 1GZ0A 6YASA 1Z7YA 4ZYLA 3SX4A 2WK1A 2ZUFA 2OZVA 2JFPA 1DQYA 1EA7A 3T3MB 2M6YA 1MGPA 4QOGA 4L6IA 4EGQA 2JIZD 2JGRA 4LCUC 3IHWA 2JRIA 4HH1A 2KI5A 3A0UA 5TQ2A 3FPEA 2FE1A 4Z6KA 2WU4A 3KEFA 3E2EA 4HNTA 2Z8XA 1Q0PA 5CJPA 1UFRA 1VMIA 1CR1A 5EPOA 1BEZA 3T5GA 4ISBA 3CO0S 4IWXA 2Z57A 4I1IA 3KKEA 3L05A 4N6NA 5THXA 5B30A 4D0SA 2BKEA 5C1DA 1FPMA 4QWWA 4BMVA 5K3SA 2R6JA 3KXLA 3LMEA 3MLAA 1YHQV 1J2JA 3TQIA 1M1UA 5JQWA 1TA8A 3ZMUA 1UUFA 2BMFA 1EVKA 2WNHA 4ZJPA 2ISSD 4PFQA 5FAXA 1MEOA 3HDQA 4RQTA 1ZBQA 1QVGU 4BE9A 3ZRWA 2AZ4A 5CA1B 3CT4A 4R1MA 2GEKA 5THKA 4A7PA 3GFFA 3IV7A 1SETA 3GDOA 1DMRA 1LH0A 3RASA 1Y6RA 1ZNQO 4PW0A 4XB1A 2X8AA 5LKAA 4DILA 1CJMA 5LMNO 2WNSA 3HKCA 4FW9A 4ECEA 3GLRA 3PJDA 3ABUA 5K3AA 3A25A 4B6QA 5A7GA 3GFQA 2GO1A 2X9QA 1N1DA 1IJBA 5F1KA 1ML3A 2XD9A 2YOHA 3THYA 1C41A 2H8GA 2IJGX 3CKLA 5LP1A 1SH7A 3W7TA 4EGSA 1SJ9A 2VP4A 2NZXA 4DA7A 4P7BA 5E1OA 4BE4A 2X19A 4WERA 3K53A 2D7CA 3ESDA 1FXVA 2VPPA 1PV0A 1FYWA 4PDVA 3EX7C 1ESZA 1JJIA 5DCWA 4D8WA 1RU3A 1GZUA 3U80A 1UQRA 2JLBA 4K9PA 1P9WA 1DCMA 5AM3A 1WXWA 1ORRA 2XTMA 4PF1A 4RD6A 4JI2O 5D7NA 1MU0A 2V6FA 1SA0B 4HY3A 1BZKA 1ITZA 4B6RA 4LV6A 5EE1A 2HPZA 1VL0A 4CI0B 2MSLA 4EY7A 3W7BA 5DW3A 2B99A 10MHA 1UXKA 1SCNE 4YPOA 4CM8B 3TZHA 1R4MA 3ZVLA 2C2GA 5J40A 4ND6A 3OZUA 2WJIA 4RVGA 1MNQA 1P4HA 3V33A 1GQQA 1ZSNA 1I33A 1KQFA 2PGAA 4I19A 1QB8A 1NI4A 2YHUA 1R9MA 1EK1A 2GZ2A 3TQQA 4PC2A 1AMOA 5EKTA 1V8OA 4RCVA 1HXHA 5I5EA 2YVQA 3D81A 1RR6A 3UOGA 4LNUA 1R5BA 3HK2A 2FPGA 2R8BA 3AW8A 2O2HA 5DSZA 6NULA 4NG4A 4XH9B 4ZFNA 3V7NA 1RQXA 3QX9A 3W2IA 3W5BA 2VTEA 3N2LA 3HPQA 3PKZA 1XLTA 1U97A 3IQIX 5CPBA 1GYPA 2QWXA 2IAFA 1S7CA 1U3UA 4KEAA 4IDEA 3RIEA 2QNIA 2GCEA 1Y98A 4QECA 1KD1H 3MINB 3Q0TA 5AHXA 2FQWA 4TZZA 2YIBA 4L28A 4ZYWA 5A5EA 2AGAA 2VPTA 1OWLA 1FL9A 4F71A 1T91A 4JI0B 4OXRA 2YBEA 4GSYA 3SR4A 1TEHA 5JQGB 1GGFA 5BT9A 2P7TC 3DFFA 1I2AA 3OFNG 4AYWA 4ZAYA 2QTOA 4N3NA 2DYSB 4YT8A 2P1DA 4AVYA 3I2FA 4RPHA 2EFHB 2Q9LA 1PT7A 4XDLA 2MR6A 4MSWC 4EPRA 2BBSA 4A82A 5BW6B 1QLEB 1XQ8A 2EP5A 4NBLA 1I3NA 3ZZTA 2X2OA 2VUHB 1ZKDA 4XSGA 3VNRA 2DOKA 3HSKA 2C2BA 4ZHQB 2I1VB 4FI3C 5CMLA 1P49A 4U9UA 2EHDA 4A8PA 2GBCA 1YJCA 2M9MA 3UK7A 4XX0A 4KJXA 3KJNA 1JR6A 2EQAA 3QPBA 4KOEC 1A77A 2F4VB 1SD2A 3PD0A 1R6TA 4DMLA 1ZH6A 2CF5A 2R6GA 1JSRA 4D97A 4B3BA 3LA6A 5DYGA 3PVZA 3TZQA 4GI3A 2KG7A 3QKRB 2IXFA 3E5NA 2DBQA 3DZ8A 3DE3X 4I9NA 4HEA1 4PSDA 4XRRA 3FRJA 2F9MA 2GK4A 1ZGCA 4DLSA 3TFOA 3IBFA 1EEHA 2QSZA 1SUCA 2Q2VA 3AJRA 3FE2A 5IC5A 1U7TA 1MA3A 1MNAA 4NYMR 3TXAA 3OZDA 1CRWG 3DL7A 4QXRA 1GKFA 3NVKE 1U40A 4AK9A 1J23A 1DLJA 1WXQA 2P78A 5HK8A 1QH8B 3AL3A 4C4PA 3I04M 5JNWA 2R9RB 1M2GA 2L69A 4AD8A 5K1ZA 4AP9A 3AM1A 4Q39A 1BW9A 2R60A 4ZK2A 4JKOA 5BR1A 3PC8C 4YPVA 3VUFA 5CVUA 3H4TA 3H5TA 1E2DA 4K6CA 4OKNA 5LQMA 3T7CA 3OZ7A 2O7SA 4F5YA 5C52B 3U5ZB 5G4KB 1YJWV 1VE6A 2P2DA 1HI9A 1NP6A 1Y4SA 3HA2A 2J5KA 1GPNA 4LSWA 3MHTA 2J9YB 4DARA 5FO1A 1JQLB 1J7HA 2H7CA 1QBZA 4XM1A 2EIJB 3I72A 5JLAA 4BQEA 3RVQA 1E1MA 1FU7A 1ONPA 4DABA 1QLJA 1BE1A 1Z8NA 3KXKA 3RE1A 3DSQA 2P65A 3I01M 3ZWVA 4LZPA 2WYVA 2XODA 4ZV9A 4BV9A 3DW1X 2YXDA 5EKSA 3CJHB 4P3OA 3RAEC 1JJOA 1M90H 1UOQA 5KBYA 2EZUA 3LBIA 5EQTA 4Q24A 2O3TA 5IM4F 1Z7EA 2Q5FA 1XVAA 4AY2A 3H17A 4V0NA 1BRTA 3ND9A 2XB4A 4XYGA 2ZBUA 1DC5A 4YNBA 1LFDB 1R6BX 2FMFA 1GTZA 4BNDA 4ZT3A 2OZEA 4C5CA 4GT1A 3M4XA 3C97A 1L8LA 1WUJS 1QOPB 3NCTA 1IWBB 4IVQA 2MQEA 4C4RA 3SFTA 5B1EA 3HN2A 3RUDA 4GKKO 4JLUA 4EG6A 4G01B 1DGQA 4Q34A 5TF0A 2H6EA 1L4UA 2CL5A 4B80A 1YA8A 5AWFC 2FDXA 4DKJA 3VSDA 2P6OA 2Y0BA 1VRCA 5AKZA 2BHSA 1XZMA 1MJNA 1V9CA 3ZDCA 3R4CA 2P30A 3ECSA 4WV3A 3SYPA 3N2KA 4L95C 3OEWA 3D31A 1K08A 4OK3A 1XCOA 4IHJF 2VN8A 2ZSBA 1QO0D 1XDGA 2PKCA 1GO3F 3RJTA 1YTLA 5DP1A 3F90A 3K6SB 1I2MA 5CFPA 4AJ1A 4WOCA 1UWCA 1VKRA 4FP9A 5BN4A 1O4VA 3GLGB 2AUTA 4HRAA 1P2VA 1CB0A 5IAOA 3DV0B 3C85A 1DBQA 4NHOA 2O2CA 1R4ZA 1EIWA 3I6IA 2P2NA 2EZ8A 5K3FA 1OD6A 1XI2A 3ZXSA 3Q9LA 4NQRA 3KR1A 5FORA 2XUJA 1RYFA 4GBMA 1DEAA 1DLIA 3LX6A 4HV4A 5J4HA 3I5AA 1NXVA 5JRDS 2ZJ3A 4WCFA 1OXTA 2DQ4A 2YR0A 1AS0A 4DWJA 4LF6O 4BNFA 3HSSA 2DHRA 4K6OA 5LQCA 2J3EA 4OATA 3QWHA 4U5XA 3CZ5A 3T4UA 4IEFB 3CHXA 1CS4C 1ZAYA 4E51A 4M1SA 2OXTA 4AXXA 3JSAA 4UFOA 3SFZA 3E8MA 4AG6A 4C88A 3ADKA 3PEUA 1X92A 4J9YB 5CYGA 4FK5C 2D06A 3CPEA 4IOMA 4WKPA 5CT6A 1Z2CA 4LRQA 4MAAA 2GD0A 4I55A 1O96B 1OCRC 1DXQA 4JI6B 1CULC 4S3MA 1R9NA 4HQFA 4B6PA 3P2JA 3OQHA 1N8RH 3ZJUA 2I6GA 5LP6F 1HDCA 2WA3A 5K99A 1RFYA 3VTIC 2BMEA 2GEBA 2EFDB 4DYDA 3T5PA 4IMPA 4MMXB 4OHCA 1WAZA 3AB8A 1M1KW 3FMGA 3N2ZB 3G2PA 1FF9A 2CSXA 3WXBA 1QCCA 6REQA 1X9GA 3FUXA 1SQPH 1U1FA 3UPTA 4FGUA 2OAP1 4YTEA 1Y80A 1JLSA 1EUCA 1UJWB 3EGXA 3AVQA 3J80A 1FP4A 5I4CA 1NRJB 2QPOA 3ZI4A 3TIIA 5HKKA 2QG9A 1W96A 2X40A 1WCIB 4MVMA 5IUKC 4FSHA 3TD3A 3DBLA 1XCBA 2F1RA 3KWFA 3L4KA 2LUOA 4IL5A 2ZBDA 1JAXA 1ZU5A 2P5SA 4N65A 5EE9A 4ZMSA 4L78A 4BFWA 1SRYA 1CHDA 1DC4A 2P2YA 4EG1A 2UVQA 1DXYA 2J4FA 4C21A 1RHQA 2O5RA 3R0PA 2Q27A 3OKAA 1OHHA 4EY6A 1ZPDA 2E4VA 3DR3A 1RBZA 1C4KA 3GC6A 1OGJA