1SA0B

Tubulin-colchicine: stathmin-like domain complex
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into tubulin regulation from a complex with colchicine and a stathmin-like domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 127
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1sa0B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1sa0B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1sa0B01
3WGKA 4EI7A 3M8KA 4TUYA 2Q1XA 5KMGB 5EIBC 5JQGA 2VAMA 3JARA 5CB4A 5ITZB 1RQ2A 1JFFA 2XKAA 5IJ0B 5LA6B 4YJ2B 2RHLA 4X1KB 5EYPB 5LOVB 4FFBB 2Q1YA 5IYZB 2VXYA 4X20A 4I4TB 4LNUB 3ZIDA 4TV8B 4TUYB 5KMGA 4O2BB 3VOAA 1FFXB 3VO8A 3HKDB 1TUBA 2VAPA 4O4HB 4EB6B 3RYCA 1FFXA 5KX5B 3VPAA 5JH7B 3CB2A 4IHJB 5JVDB 1JFFB 5C8YA 5EZYB 4WBNA 3JATB 2RHHA 3VOBA 4WBNB 5C8YB 5LP6A 4YJ3B 5MN6A 3HKEA 4KWEA 3JASB 4TV9A 5J2TB 1W5BA 2BTQA 4U3JA 1TVKA 4TV8A 5LXTB 4X1IA 3M89A 3JAKA 4YJ2A 5EYPA 3WGNA 3JALB 3HKEB 3UT5A 5JQGB 1W5FA 5GONB 4I55A 4O4HA 5JCOA 1TUBB 3HKDA 5KX5A 4IIJA 4EB6A 5LA6A 3HKCA 3RYCB 4M8IA 4B45A 4DRXA 1Z5WA 3HKCB 3RYIA 5LP6C 4YJ3A 5LP6B 5IYZA 4I4TA 4LNUA 3WGLA 3N2KB 3E22A 4X1YA 3UT5B 4ZHQB 4E6EA 5BMVB 4O2BA 3E22B 4X1YB 4ZHQA 5CA0B 2GVIA 3V3TA 5IJ0A 5CB4B 3JAKB 5ITZA 4O4JB 3RYHB 4ZI7A 3C8LA 4U39A 1RLUA 4O4JA 3JAWA 3RYHA 4FFBA 4ZI7B 4DRXB 5IJ9A 3JALA 1W5AA 5M7EA 5LOVA 4O4IA 3JASA 4TV9B 1TVKB 1SA0B 2BTQB 1Z5VA 4I50B 3RYFB 4O4LA 1FSZA 3N2KA 4F6RB 4I55B 4X1IB 5MN4A 4EI9A 4HNAA 5JH7A 3JARB 3HKBA 4ZOLA 3WGMA 5FNVA 3JATA 5JCOC 3R4VA 5CA1A 1W5EA 1W581 5LYJB 5CA1B 3N2GA 5J2UA 2RHOA 4O2AA 4DXDA 2XKBA 3ZBPA 5GONA 2BTOA 3ZBQA 4O2AB 4X20B 4O4LB 2RHJA 4I50A 3RYFA 4U3JB 5LXTA 2VAWA 4F6RA 2R751 4XCQA 3JAWB 1W59A 5IJ9B 1RQ7A 5EIBD 2R6R1 1OFUA 5MN5A 3N2GB 5J2UB 4B46A 5BMVA 5J2TA 3WGJA 5CA0A 4IIJB 3HKBB 4HNAB 5FNVB 4EI8A 4ZOLB 4IHJA 5JVDA 5EZYA 4X1KA 5LYJA 3RB8A 3VO9A 3RYIB 4O4IB 1SA0A
chains in the Genus database with same CATH superfamily
1GR0A 3BFVA 1XXLA 4WY8A 2H8EA 5E9QA 2H5EA 3FE2A 2EIJC 4RL6A 2HIGA 3U0BA 2NU9B 1Z06A 1ZL2A 1CZNA 3DJYA 4M76B 1K3UB 4QDJA 2CLSA 2ONZA 1UKVY 3OKPA 4X89A 2QJRA 3Q12A 1GUZA 2ZF8A 2AEJA 3ANSA 4F6EA 1V1JA 5B55A 1J0BA 3K1AA 1K7SN 4MJLA 2ARKA 3A4TA 4WNAA 4U7FA 1SY7A 2FPIA 1PEYA 1NXVA 1E2JA 5LD2B 4ZYUA 2CH7B 4RVCA 1PR3A 3AETA 3WB0A 4GR5A 3FWPA 1T5BA 3U6KA 4R2KA 4ZI3A 1XOUA 2FR0A 4JLOA 2G80A 3TW0A 4KU4A 3KHSA 3HO8A 2PZ8A 2EYQA 1XOIA 2IIPA 4HEA6 4QICA 5K0ZA 4W7SA 2NAPA 3KOOA 4DC9A 1T6BY 5KWJA 1C0EA 4NCXA 2BDTA 3GLFB 3IUYA 4RMNA 4PFSA 4HWGA 4WK0B 3GI1A 1YHYA 2P2SA 3D7RA 4IINA 4URWR 5CRIA 5AJZA 1NN3A 2Y1FA 4D6YA 4ZAVA 3IDAA 4B7KA 4M1QA 2H94A 2CLIB 4QREA 1XZDA 2HLDA 1QQBA 4G3XA 3O8CA 1IEWA 4MVCA 3DFUA 1G1XB 1J5XA 2ADFA 3TINA 1OLXA 5DCLA 4BQIA 3SXUA 1IIBA 1OASA 2SCUA 1Q83A 4GMXA 2JH9A 5EXTA 3UAOA 4KQKA 5IS2A 3P7MA 3EZYA 1B15A 2G0NA 2YMQA 2B6HA 4J49A 4LX8A 3RBAA 1PR1A 2HW8A 4WCVA 1P8JA 5HFMA 1H8HD 5BR4A 3RVPA 3SFTA 1T4DA 2D6FA 1TK3A 1GRQA 3CZ4A 4D9JA 3S2FA 3SC2A 5J4YA 1RKVA 1Z6ZA 1WW3A 2XI4A 1BVHA 3OKAA 4FGWA 1B8PA 3AHFA 4UDNA 4RZHA 3C3PA 5C4GB 3W2FA 2NSJA 2AKYA 3O1IC 2VRNA 1A82A 2BIFA 3FNBA 3GUYA 3HCNA 4RHEA 5E2BA 2QTAA 5HMMA 1WXFA 1FYJA 2Q6VA 3D4OA 4IKPA 4KUGA 1CJUC 3W7AA 2HEPA 2REQA 2ERCA 1SQSA 3LMKA 3KQVA 1M2GA 1TLLA 3KB1A 4U2EA 3PCTA 4WVFA 3TLZA 3VUFA 3BMQB 4WXRA 1CZOA 2GUGA 3HYSA 4RVOA 1I4WA 5CB8A 2PZFA 1YS9A 4HAYA 5KTNA 5LP1A 4HXGA 3PSAA 1Q3EA 5AT1A 2KWIA 4M1YA 4C07A 3UMMA 2I7VA 4I1VA 3WYBA 2I2WA 5K0GA 3DVAA 4ZA2A 3EEOA 1E0KA 1GN3A 4X7PA 1BSMA 4D9BA 5IN4A 2RH9B 1PNKA 3PC2A 4KWHA 1LTQA 5DF1A 1DAOA 4YAFA 1CS4C 5E6UB 2YZNA 3K70B 4Q18A 5EE1A 1U96A 4L02A 4RY2A 4YRDA 1GKIA 3ELYA 4V2UA 1CVLA 3V4VB 1TOAA 1E2LA 1NTZH 1GG2A 2A5YB 3A25A 3RARA 2H1FA 3E58A 4X65B 4Y2UA 5LU8A 2Z1NA 4Q9LA 4I5DA 4R2JA 4E4EA 1N4AA 3V5NA 1EK1A 1B7GO 3NT5A 3RSFA 1KYQA 3U0ZA 1E79D 3BYZA 1U7WA 1ISIA 1Q44A 1R5NA 1C9NA 2WM2A 4IIVA 3ZYCA 1RXEA 2ID9A 4IY1A 3LHKA 2IHVA 2NU6B 3ZOPA 3BCHA 3HKBB 3C6QA 4YMGA 5AVSA 3TZKA 2FUG1 2PBZA 2YJ5A 1UMCA 3I04M 2GEBA 1VIYA 4GQIA 1MEOA 3AHCA 4B0OA 4EG3A 3H01A 2Z5UA 3QNMA 4TLBA 1L5QA 5C37A 4XWYA 3FYEB 3RVQA 3T3HA 1HEYA 1G1MA 1RI3A 3AONB 3UJPA 4YDQA 1SVSA 1Z0AA 1PXWA 2X8LA 1JJFA 4LMBA 3EGXB 3MJTA 3ZZNA 1MEEA 1ESMA 2EJBA 5I5GA 3SWWA 1GPLA 3GDFA 3U7GA 4X0EA 3J7AR 1D0SA 1B6SA 3AEUA 4TYMA 4II2A 1CJVC 1B8VA 2OY0A 3QTLA 4KI7A 1IQUA 4MKIA 2XDQA 1PJQA 4QXPA 3O8RA 5FLXN 4RESA 3S06A 2FFRA 4OL9A 1SUBA 2VIIA 1QR2A 2R1UA 1JNXX 5B2FA 2JAUA 4GVPA 4P2ZA 1FF9A 3PJDA 2PUEA 4E14A 5ECYA 1Y9AA 2Z5FA 3KR2A 5HIMA 1XT6A 1YC2A 3AP1A 5DT2A 5F73A 2ISQA 5GMOA 4CCYB 3E15A 2X9QA 1RWNA 3ZIAA 1QHYA 4E3WA 3A6HA 3CKKA 3D36A 2G9ZA 5DI9A 1NI3A 1SQ6A 4X71A 4MWTA 4OL0A 3ZCUA 3OEHD 2VJMB 1H2YA 1GN9A 3OECA 1F8FA 3CLSC 3B8NA 3B6NA 1ZDMA 5JXGA 1W9MA 2AR9A 1WP8A 2ZB7A 1P4GA 3LPCA 4H1HA 1UK9A 3FPJA 5FLKA 4KIJA 3QVLA 5FUBA 3V7YA 4EUNA 3G9TA 2OESA 5JC8A 3TXYA 3ZWBA 1R0BA 3ZP7A 1BH2A 3IBYA 1WUYA 4AKEA 2QGZA 3HN7A 1G9TA 2OFFA 1IY9A 2D3TA 1PQPA 1QVAA 4OXNA 1BZKA 3KSRA 4IIJA 2OFOA 5FUQA 4PLVA 4RZ2A 1KKDA 5LBIA 3EXG1 3KWFA 1G4AE 2XR1A 3ZJ5A 2PH7A 1Z6AA 1OWNA 5C5CA 5IFLA 1CF9A 3HJTA 4D4LA 5LBUA 3F5QA 2OQVA 5BNTA 1X1BA 2CDAA 1KQFA 1YJWF 1K68A 1L4EA 2BFBB 4KWIA 5F5XA 4ALMA 2CZGA 3G17A 1PV1A 1YBAA 1KGDA 2XMGA 3PQ6A 3Q3GE 2PQ6A 1Q17A 1UWVA 1K0FA 1N1DA 1VRWA 2MIIA 2WUFA 1E2KA 2JFWA 5CYPA 2EG5A 2AZMA 3VO2A 5CBKA 3D4IA 3PE4A 4MSWC 1QOQB 1G8YA 3WQSB 3JQ9A 4B8YA 2V9YA 4JKIA 3LVFO 4H9GA 2YH2A 4YH1A 3VKVA 4BX3A 1U3UA 2P90A 2FKAA 2QRNA 3C7AA 1FLNA 4IUDS 4F1WA 2XLBA 1SZJG 1GM8A 3WJRA 1QIJA 4MPPA 1AG9A 1PFQA 4U7GA 3W7TA 2E4WA 3KB6A 3P5SA 1PI3A 1AKYA 3WP0A 5KWEA 1KARA 2IP2A 2Z09A 2M6YA 2O57A 2Y9MB 3I4LA 1J2JA 4JCOA 4J9ZB 3BGVA 4OHMA 4B32A 2C2WA 3K72B 1A96A 4L5BA 3AG4B 2A9OA 5DGCA 3HLYA 1P4JA 3Q1KA 5IBQA 1F2UA 4CFYA 1M6EX 2Z9DA 4FX2A 3KQYA 1P6QA 2IYUA 3DT6A 3RIXA 2ZODA 1TLTA 1RRGA 3K0GA 4F3NA 3ZHOA 4PZDA 5BSVA 3CMAV 1RRFA 1Q6ZA 2FTKA 2H8GA 5IYCO 3KPYA 1NJ5A 2RDCA 4TKUB 1EQAA 1C9EA 1A4IA 1K4YA 4G5OA 4UHHA 2C61A 3H1HH 4UUJC 3WGJA 2P9GA 2PJZA 1XB2A 1PK8A 4MYUA 4PYMA 4JLUA 5I45A 5P8WA 1GG8A 5AW1A 4URHA 3IURA 2ITDC 4QU8A 4TL6A 2TSYB 3ZIAG 3BSFA 2FPKA 2GOYA 5IJXA 4X1KA 1KU9A 4GPTA 5L6LB 4CU5A 3ML0A 2L0XA 4ICGA 4PBRA 2QJTA 3QOWA 3APOA 1KK2A 1NT2A 3IRUA 4UCFA 3USCS 4AJKA 2YOFA 1NF8A 1MIOA 3PUJA 4JZKA 5JQGA 2W2KA 1MAVA 1XCPA 1GU0A 1U02A 2C1XA 3ORSA 4YRGA 1WUIS 3Q9LA 4KX3A 1VYTA 2VTVA 3D8NA 2J85A 2BFCA 3FUVA 4ZBMA 5LOVB 1YJQA 2WPNA 3C5CA 3DEJA 3B9RA 4IL5A 4PLWA 4AJ1A 1SZQA 2VS1A 3W9YA 3GAFA 4H17A 1T34A 4EG5A 4TTRA 2JI9A 3GDHA 3MWDB 2Y1GA 3M4YA 5I7FA 4BRSA 2WAMA 2JIZA 2LR0A 1A4XA 4G89A 4LQDA 4FEYA 4MCHA 5JVDB 5CVVA 5E7IA 3E35A 3RU9A 4YRMA 2XB2A 4R68A 1BVYF 3BFRA 1LDEA 2ZZKA 3PDIA 2H2GA 1Y8RB 3KQSA 4HMQA 4IR7A 1WHTB 1EWKA 2ENUA 3LNCA 1F4PA 2O2GA 1ENOA 3FMFA 4YREA 3BSWA 3K1ZA 2EWWA 4HVTA 3EWNA 4KR9A 2W93A 3L8GA 3T5DA 3WRWA 4LN1A 1RACA 4U6NA 4HXYA 1PS0A 4EB3A 3U3DA 5KTKA 1PQ4A 1ZD5A 1DTWA 2FFJA 2P1ZA 4UV8A 3BJMA 1JR3A 1XUOA 3H1PA 5EUMA 3L74H 4XW2A 5L3QB 1NU6A 1P1CA 4G4WA 1S4MA 3MAQA 4R8SA 2GXQA 5CUQA 5CAEB 1ZPDA 3M34A 1MOZA 2B30A 4AMZA 3DHNA 4A6XA 4BDSA 1OAOC 3IQWA 2CVPA 1XHZA 2YRFA 1V47A 3U9SA 3GGCA 2DQYA 4GL4A 1RJFA 4GVXA 5KTSA 4B4KA 4A6EA 1T4GA 1XZGA 3RM3A 3TJRA 4BZQA 1DBRA 4V24A 5HHTA 4A0HA 5JD3A 2GDSA 2B5WA 3WHLA 2IU0A 2QTRA 1SQVH 3UAWA 4DCUA 2PGDA 4W7IA 1XNQB 1J0XO 1ZQ9A 1VBKA 4E6EA 2ZIXB 2XCRB 4OHYA 5FA6A 4UNPA 5DM1A 1X1SA 2C82A 2Q29A 1GAXA 3AU9A 3VNQA 1HLGA 3OLVA 2C3YA 1E69A 1K3TA 1O5TA 3HK2A 5CU7A 1XNHA 1L4LA 2HQBA 1DIAA 1GGVA 2VNIA 3EODA 3GH1A 4KBFA 5GIPE 2E4XA 2UUCB 2LCAA 2ZG6A 4N1AA 3BB4A 4D0NA 3UK1A 1SHZA 2R44A 2V6FA 5CK5A 4F6RB 3P30A 2BEWA 2B7CA 3HHPA 5HQJA 1NA5A 2HQ1A 3EULA 4Q01A 3ZJUA 9LDTA 5BV7A 2VUIB 3E18A 3S5UA 1A2OA 2J3IA 2O2XA 3U1BA 2OHHA 1RC0A 4R40B 4R69A 5LLTA 3Q8LA 1M7BA 2QD2A 3TOZA 4M6WA 2DHEA 2OM6A 3EF1A 1COMA 3OONA 1Y1PA 3LZDA 2FPPA 3QPDA 3WFZA 5D85A 2X0JA 3IEVA 3ML1A 2YYSA 1UKBA 2G82A 3ZBQA 4ER3A 1EM8A 3P2OA 1J90A 4LOKA 3T06B 3AT1A 4POOA 1U3DA 4IFBA 5FYDA 1W88A 4U3JB 2HMYB 3ET5A 3ZIUA 4LXIA 3FBAA 3CSXA 1PK9A 1VPVA 2VTDA 4Y7DA 4FGKA 1R8YA 1PSWA 1RRVA 3A9UA 4KL8S 1L7EA 2GK7A 3WQQA 3X1WA 3AOEC 3KO8A 5PNTA 1WX1A 4P4SB 5LR6A 1TF7A 3AIIA 3D4PA 3UGKA 4FZRA 5D5HA 3ZRSA 1XZAA 4BY9D 1II8A 4IJQA 4C4SA 2WABA 4G8JA 2WFAA 3EN0A 4XVCA 1XSEA 4EI8A 2XWJI 2JIZG 2PLNA 3D6HA 3TQTA 3ZY6A 4HB3A 3V8QA 2YJGA 2QLBA 4X45A 5SZKB 4PN3A 1QVVA 3RB8A 2L26A 1P19A 2YYAA 4DJAA 4F46A 4CKWB 4QUDA 1BNCA 2MSLA 2D5CA 4DPMA 3TBHA 2UXCO 5GJCA 4CDGA 4UM5A 2NU9A 1S3IA 1L3IA 4XYMA 2ZAGA 3A2LA 3L1JA 2IHUA 5KHGA 2UKDA 4O3MA 3KQTA 3UB4A 1RHUA 4Z0HO 3SE0A 5KQSA 2UYHA 3U4IA 2R6HA 1UAGA 4NHOA 3LDFA 2GTAA 4OSPA 3ZOZA 2YWHA 4JL5A 2GM9A 3RVBA 1OB5A 4LRSB 4TWJA 1W25A 3C5EA 4ZN6A 3BY6A 2K9PA 1KJZA 2QUJA 1U8CB 3CR8A 1U3VA 1Q1NA 4GICA 4A2CA 5C2JB 2V7PA 1YA6A 3GRKA 3BJRA 3K09C 1I8TA 2DTXA 2GASA 3VVBA 1QCYA 5IAEA 4YAJA 1ZUHA 5AKKA 1L5HA 3N3BC 2UXBO 1BHO1 4ZT3A 3ON1A 3OI7A 4EY4A 2FW1A 3HBLA 1DJOA 2C2MA 3NBYC 1QUFA 1IEXA 1NAHA 1NLMA 2MYTA 3PFIA 4GEGA 5CTAA 1YS7A 1BQ0A 4CMEC 8LDHA 1DXHA 5F2NA 1I3LA 2CVOA 1MZFA 4Q3CA 3DE2X 5J47A 4G0NA 3O2QB 4WHMA 4KV7A 4JAUA 3T4EA 4YRKA 3R9WA 1NVKA 3OLXA 4FM0A 4MRSA 2B0JA 3P27A 3P2MA 1ST2A 4U3FH 3BTOA 4RV5A 3HZRA 2IU4A 1CG6A 1A9XB 3IUQA 2X76A 5F3WB 5SZIA 3WIDA 1FAFA 1UJ5A 3H5VA 1C3OA 2WIFA 3KM0A 4LF8O 5LHIA 4O4HA 2JCGA 5LNK1 4AZWA 1XL6A 1BE6A 2A6PA 3QO8A 2HF8A 2XYGA 4B45A 4X8LA 4B84A 1ZINA 1FDWA 3ZHUA 4N0EA 1O6CA 2IDKA 5ERGB 1YIDA 1J7HA 4ZXFA 1L6IA 4A8JA 2CZQA 2N1BA 2OEPA 2O2ZA 2P77A 3FLEA 4A10A 3HGTA 3C43A 2AQIA 1EBUA 1NRWA 2XKKA 5CBHA 3DDHA 4QRHA 4ZVMA 4ZHQA 1MVOA 3EIOA 3OMXA 1GKUB 1AZLA 2YHSA 3TLKA 3TNYA 4QOEA 5IC6A 1CUEA 5B36A 4JFAA 3VOTA 3WR5A 2DX7A 2ZWVA 1ZI6A 3G59A 5CT9A 4QEDA 5JZ9A 4ZVSA 1EUYA 3GJ0A 3IQZA 3PPYA 2C7PA 3HGMA 3ZCTA 5EXEA 4WERA 5EWLA 2H51A 1GNSA 3V2GA 2I6XA 4YMLA 2LBWA 4I55B 1BGWA 1G0OA 1YJBA 2K87A 2GEJA 1C4OA 1E3TA 4KHPB 3MC1A 4KWCA 2FWRA 5FFNA 4F4CA 1VJ5A 1GDTA 3HVKA 4TQAA 4Q3LA 1UADA 2ZZMA 2I6RA 1WHSB 2ICAA 1IMJA 3BPZA 2WSIA 3B2NA 2CLKB 1UC8A 4BJHB 1IOZA 2C5SA 1CVRA 1GNPA 2P9EA 4RVDA 1UM8A 1MR3F 1OBOA 3AIKA 4TMWA 5E7QA 5AR1A 3ZBPA 4B8ZA 1JN0A 1Y89A 2PZEA 3INGA 5EE9A 1NN5A 4FFKA 1E4YA 1PP4A 1QRUA 5EAZA 1P49A 1Y6ZA 1IG3A 2FN9A 2XNKA 1U1IA 1CR2A 3EMVA 4FR0A 4OKIA 4OIMA 4OQMA 5AWFC 1PVOA 1K8AW 1FB5A 3V8VA 2ZSIA 2GHTA 3GLUA 3T41A 5DYNA 2R6R1 1NW7A 3PNPA 4AQDA 2HGSA 4WXMA 4AYTA 1VXRA 5EQTA 4AN0A 5LNK6 2FKXA 1E9EA 1U0OC 3FCUB 1OT5A 4NU0A 4CEIB 1UEJA 2FN8A 3IAS1 4HXFB 4N7JA 3EH1A 1R00A 4WY5A 4Z4HA 5CMLA 5BOSB 4DNQA 1OX4A 3AUJB 3IMPA 1RLGA 2VNSA 5GGYA 1QPZA 3QFHA 4V0RA 5BV1A 1E1QG 1F12A 3W2GA 3GCGA 5G4KA 3RUEA 5BYAA 3O83A 3FPFA 1Y9EA 3MTEA 3GCDA 2OO5C 3BJZA 2IHYA 2Q0AA 1AA6A 3S68A 4KE6A 4AUKA 2R48A 3DMTC 2HKOA 3CLUC 4ZVOA 3ZY2A 3R41A 4KNYA 1HDGO 4DA8A 3ZKWA 4JYCA 1F48A 3MFQA 2DWOA 2GDZA 4AJHA 3K59A 2EFDB 5GPBA 1R6AA 1H0RA 3SEZA 2CVFA 1VQPV 2DYRB 4FI3F 1Z36A 1ABBA 3TBKA 1BHSA 2YIDA 2OHIA 2Q4EA 3EZNA 2VZLA 1TUBA 1IVNA 2G28A 3T1HO 5DU2A 3SFVA 3H97A 5ETJA 2C9YA 2WE7A 3UENA 1XHOA 2ZIFA 5AJXA 2A9HA 4ZYWA 1E1KA 4U2BA 5KNCH 4BV8A 4ICIA 1ORIA 1L8LA 2QUZA 2FEKA 4IIUA 2FZKA 3ICVA 5F77A 1V7ZA 4BCCA 4U3JA 1JT2A 2HHJA 2Q1WA 3NYWA 5JLAA 2OXIA 1L5VA 1C4WA 1CUDA 2FK7A 5DK4A 3U4GA 3URKA 4C5AA 4HFRA 2RBEA 1G7TA 1MQAA 4RPJA 2JD0A 4B35A 5KYWA 1B76A 5BSTA 2Q2OA 3Q3CA 3NC4A 4II3A 1M6WA 3DCJA 3HG7A 5JQGB 4PU0A 3AK3A 2R6DA 2WEKA 3DONA 4KMRA 4UEWA 1TF5A 1KNQA 1IBRA 2DR0A 4TYWA 4TVOA 2XYHA 4WBXC 7ADHA 1TKCA 2HQOA 3QYPA 1IXSB 2Q73A 4MAFA 3RYIA 1BU8A 4DV4B 4WOJA 1DKMA 4XKJA 2HMAA 3DOUA 2YKGA 1UKAA 3D81A 3VMFB 2Y0EA 4GPBA 5BT8A 3JWGA 2YIAA 4P22A 5CX1A 1JWBB 1TMKA 3KKEA 3DSRA 2G06A 4YN3A 3BEHA 5CB4B 1GYQA 1N2IA 3IBFA 4WX2B 4PQRA 3E1SA 4FFBA 5L7TA 3PX3A 3UJBA 1UFKA 3RRJA 4C4OA 5L4NA 5JD5A 3GLGE 2IITA 3D6FA 3MLEA 2QSAA 3W7WA 2C77A 4EZBA 4ERNA 2R9IA 2CXRA 1QK3A 1UDCA 1V71A 1XAIA 3CCUF 1G5FA 1TX4B 1WB4A 2OO5A 2Q9BA 3HVJA 2P3QA 3ABOB 5K0SA 1XQ8A 5AG2A 3WPWA 1GRVA 1OHHA 3BEDA 3ZHQA 4Y9UA 5FPPA 5G3ZA 5JUWA 1M54A 2QQEA 1I6KA 4D44A 3HTXA 1OLUA 3RS7A 3ED5A 4DY4A 1AP5A 3DUFB 2QEXF 3HO6A 5EOVA 3CNOA 3TI9A 4W4LA 2GBCA 4FDTA 3UHOA 1OGJA 3ADCA 2Y76A 2YXHA 2DYRC 2R751 4QFMA 2D5AA 4PVDA 1F5SA 4WASA 4MYTA 3BZBA 3K96A 1C50A 1XV5A 4IQFA 2HSDA 5HX7A 5HZGA 3AZOA 2OZBA 1A9YA 1RJEA 1U9CA 2WLIA 2DFTA 2I54A 2VHEA 3OCWA 3Q85A 3ZV7A 1QYRA 4NXMO 3KJKA 2QV0A 1PS8A 5J2UB 2NSLA 2C9MA 1PR9A 2H3EA 2UVQA 2ZTSA 4Q03A 3WIEA 4DO2A 4JLVA 4AROA 1Z22A 3NP7A 4R8CA 1GQRA 2N3ZA 3LBYA 3GH3A 4TV8F 5J58A 3ANMA 3GEIA 4C3ZA 3KIPA 3OESA 4MKZA 3RVNA 1CDOA 2GJSA 1M6VB 4NENB 4KPUB 2HRQA 1GTL1 3DD5A 5ADVA 5IH7A 1W46A 4RV9A 3FSJX 4HQ6A 3G88A 3V1YA 3ZYZA 1X7XA 1ADYA 4XIGS 3DV0A 4RAQA 5CLGA 3ZU2A 1GKKA 4X1KB 1HZJA 4ZHVA 2IQ5A 3IHLA 4DYDA 3RC7A 4BLOA 3L7NA 3VR0A 4ODIA 1WPQA 1POXA 1KEVA 1KMQA 2ZOSA 3I6ZA 3PEUA 4QG7A 1AUQA 1EA7A 3K08A 3HU1A 3JYNA 4HDSA 3QA9A 4WLOA 3ZIDA 1AMOA 3AOGA 4B3CA 1JHOA 4UCWA 3HWSA 4KEAA 1SXHA 4RTNA 4TMFA 9MHTA 4RCZA 3K0KA 5BSRA 3UWKA 2Q6AA 2R68A 1OY1A 2I1LA 6ABPA 2QR5A 3O47A 3B8MA 3HKEA 1EFTA 2C2ZA 3L01A 4JBWA 4NZOA 1TAQA 3ACDA 1JTFA 4BNFA 2FPGA 2Y0IA 4OM8A 5E4YA 3A05A 1UFIA 5JJCA 2NNLD 3FHCB 1KEUA 2D7JA 3MDSA 4H7DA 5DASA 5HQTA 4MXDA 4ALNA 3Q2IA 5EKSA 2CB9A 3LY8A 4F4UA 1OAPA 1DJQA 4YUXA 1KE1A 1AQJA 1XVIA 3SJUA 4BCBA 3G13A 4CV0A 3NHLA 4B79A 4RHYA 4RENA 2QZ9A 2PBFA 2WJ3A 3O73A 4PCUA 1OHHG 5L3FA 3SMVA 4ZI2A 3L4KA 5AVMA 1P9RA 3GLQA 3H11A 3IAM1 4K9KA 2Q07A 1PP9H 1AX9A 1SUPA 4L57A 4ARCA 4TWBA 3CRCA 5LMUO 2AQHA 1ZJ5A 2QMUA 3CLVA 3ED1A 3LH5A 3M9WA 2VGMA 1CUGA 2VDQB 2WLKA 1PL0A 1ZD4A 1P7BA 1XEFA 2BDEA 2GD1O 5HS6A 1GCAA 3CJHB 3OFND 4IHAA 4K6OA 3RJ5A 2Q46A 2ZS8A 1NGSA 1KQ3A 3H9JA 4ZDJA 4GL2A 3W4JA 2ZM6O 2UXDO 3WKDA 1K1EA 4OUDA 4ZI7A 4ISCA 4MW3A 5FL7G 1UODA 1W6RA 1VE7A 1NW9B 5ES3A 2VRCA 5ANRB 3T3EA 4CKBB 1M6YA 1YQNA 3OEWA 5CEFA 1KSFX 3DBLA 3DMNA 4CT0A 3I42A 2JHCA 1WF3A 3BSYA 5J9PC 3CB4A 4P2GA 3VI4B 4C5BA 4EY5A 4YROA 3U7QA 1JYEA 4XWAA 4TN1A 4F8JA 1BKSB 1QH0A 2W0MA 2WR8A 3N87A 4CIVA 4EQZA 4AJ2A 3O9MA 2H7XA 3FCYA 1YFKA 3WGGA 3FWHA 4OPAA 2BISA 2AMLA 4BNUA 4DBLC 1MNGA 3LYBA 1VMAA 3DC2A 4QGBA 3UM9A 4COKA 2XAHA 4D8XA 5FQOA 5BP7A 3PBKA 2B83A 1TK2A 2X77A 2I8LA 3DB1A 3E82A 3ZZUA 2RD2A 1I80A 3RN4A 1SU8A 1MW8X 4DAEA 4D9MA 1T1JA 1G6HA 4LH6A 1YGYA 4D74A 4O2BF 3LD9A 3ZDEA 3SHFA 3GFVA 1Y37A 3GLTA 3P3NA 4QHTA 3ZD9A 1P74A 1VHWA 3CC4V 1WY7A 3MJDA 4QU0A 4B6PA 2QN1A 1VOTA 4BGDA 3H05A 5HR5A 1MFZA 3K0FA 4Q4LA 3MOGA 2ZT5A 4B3HA 4D3DA 4R31A 3GWKC 1KEPA 3A4MA 2RH4A 3IAM6 1ORWA 1VMKA 3CONA 3F5SA 3P2YA 1FDUA 4QL3A 3C1TA 4LY6A 3FFXA 5EPOA 1LW6E 3REQA 4P7GA 5B7PA 4MV0A 4OGKA 4UQOA 3B36A 1YV9A 2CXHA 4GPD1 4EH1A 1HL3A 2AN4A 1AI7A 1I08A 2XAQA 3HWUA 2O3JA 5FWNA 1P5RA 3JXEA 5CMUA 3QFSA 2V5VA 3LPMA 5TQ0A 5B3KA 1GEEA 3V7QA 4IKEA 1V5IA 1NW4A 3MK31 3CD6F 2OAQ1 2WP0A 1F7UA 2VNHA 3VYVA 1EFRD 3KR0A 1PL8A 1R27A 2AEMA 3A04A 3C4VA 3MTQA 3O1LA 4JEIA 5D87A 5ALLA 5G2OA 4R71A 3AC0A 4UQLA 3ZWNA 1IBKO 2VJLA 3O84A 3RFUA 3OWXA 2BMWA 5IF9A 3FVQA 4OHPA 4B40A 5TGTA 1J21A 2XWQA 3CINA 1Z7WA 2EOAA 5KMGA 2Z9BA 1K8QA 2ZWOA 4G25A 1MGPA 2ZTUA 1FMFA 4Q1EA 5JH7F 4XYBA 1Q0TA 2JFHA 3O7WA 4F2GA 1HLPA 3TLGB 4BB9A 4FBMA 4U2GA 1IV3A 2QX8A 3OOJA 1Q0RA 4QRDA 4N76A 3A6GA 5GW7A 3KKLA 2FWJA 2QWOB 5K0BA 4KFCA 2LDXA 3AJAA 3S2UA 2CMGA 4E4RA 3KQQA 1L4UA 3PC4A 1ZXLA 5HP7A 4HZIA 4N7RA 3MD9A 4Y6LA 3F73A 4FW8A 2C8JA 1OD6A 1TYZA 3L7AA 1DADA 2CDRA 2GM5A 4E5NA 3CSUA 3BGSA 3KOWA 3GVIA 2C5BA 2WPDA 3K1AB 1M1YB 1DB3A 3ZXYA 5KNDH 1PV0A 1X1AA 1Z5NA 3K5HA 4GWKA 2M2IA 4WRRA 4HTAA 4EFEA 1DL5A 2KBEA 3IE0A 1L8AA 2BEUB 2KQXA 1WLSA 3JYLA 4G5YA 4M60A 4UJ3A 5ECDA 2C00A 4DN6A 4NY1A 1KJ9A 3OY2A 2Q9LA 3WGVA 4QUHA 3IEQA 2ANBA 2OQRA 4O8ZA 4C7MA 1KMNA 1CE8B 2JGNA 3QUCA 4P83A 1J99A 5DW3A 3V97A 3S0HA 1IY2A 2CLCX 2WIGA 4E70A 3W7UA 3ZE1B 1KJYA 2P78A 1QMGA 3MFYA 5EUQB 4RFSA 4NCBA 1CQJB 3LW7A 5IJ0A 1HE3A 1MRZA 3EZXA 5KQMA 4B3BA 3ES9A 4LYYA 3K31A 4BN4A 4DRXB 3IV6A 3U4QB 4RHFA 4WKBA 3U7JA 1RPRA 2GARA 2W71A 4TMKA 4YRBA 2HLPA 1JU4A 3K9GA 3MMSA 3AKZA 1DAGA 1W36C 4PC3A 4AY2A 5LBTA 1UMBA 2O0HA 4HBZA 4MRAA 4E5UA 3WV5A 2AW9A 1M1NA 2NO1A 3NV9A 1QHHB 3NALA 4G88A 1IV1A 4D9HA 4DJFC 5DNYB 2VJQA 3RRYA 1S7CA 5BVHB 4BQSA 2N47A 2IUFA 3RAPR 1T4CB 2QGNA 1YUNA 4Y2QA 3PRHA 1HK7A 5FTKA 1EESA 2IH1C 1HDOA 1SHUX 1VGVA 3AM3A 5A3SA 3HGQA 1Z15A 2OCGA 4FXPA 3MHPA 1PE0A 2D5IA 3PFKA 1U2TA 2H8PC 2P6MA 3OFJA 2Q99A 3Q88A 4YASA 5LXTF 1SGWA 1ULAA 1JEEA 4DIUA 1FVFA 4H7FA 4LOJA 1U1CA 4X94A 1PR6A 2AJDA 1QZ3A 2JBHA 5FPHA 3QXJA 4NFLA 5DNCA 4LYFA 4B46A 4ILKA 4WFJA 1GD1O 5LCXA 2OHFA 3FTFA 1HE2A 1KGSA 2NUPA 1JV2B 2INGX 4IV8A 1QRSA 1PT8A 2A84A 3MG9A 1WW8A 4M9UA 1F0YA 1N8RW 3DE0X 3BE6A 4R2WA 1EEHA 4KE9A 2EIJB 3GU3A 4GOOD 3OPYB 4N6OA 4IEFB 5TC4A 1HG1A 2JZCA 2GMWA 1M5UA 1L5KA 3T1NA 1I3CA 5F1OA 3A1TA 3L4BC 4MDYA 5C3UA 2R9RB 4TT8A 4ZT6A 4FIPC 3M1AA 4UMDA 4MIKA 1ULUA 2Q3BA 1D5NA 2WPDG 2H7VA 2Z8XA 4MIEA 3R6WA 3BIXA 3Q7TA 1GU7A 4WEOA 2ZQ5A 1H3EA 3U3KA 3UGQA 2COUA 1TCBA 4BVQA 2L82A 1PQWA 1RYEA 1ZN9A 2H1VA 3DBRA 3KVOA 1AURA 3CRRA 4H7KA 4DBLE 3NWEA 3E5NA 1T0HB 2GFHA 4KG7A 4FYKA 3SIXA 4Q3BA 5EZYB 1JLSA 1TYBE 2FYTA 4FSXA 1QUEA 3T0FA 3TBFA 1EHYA 3OPYI 1JXAA 1TECE 3OOYA 4MUIA 3ZWWA 1SKVA 2E7ZA 4IF6A 1M56C 1IJEA 3LQ4A 4Y9TA 4CH4A 1K6EA 5AVYA 1E77A 5A04A 1TO1E 2FB5A 1T3HA 2OLKA 3EGEA 3PC7A 1C8VB 4GOXA 4LJ5A 5JAUA 5JQWA 1TA9A 4A8JC 1U8AA 1VBMA 4H3KB 2CN1A 3KCYA 2AZDA 2W43A 4MUHA 5E1DA 2QPOA 3TAXA 2PKQO 4LXHA 3ZHZA 4CGZA 3KKYA 1VYHA 1IYZA 2X1LA 3PKZA 4WNCA 2G4CA 3G8YA 1W0KG 2A7WA 4G0XA 4U2CA 2PRIA 2WU1A 2ZBRA 3H5WA 4DNPA 4CS3A 3DFFA 3J81N 3KVNA 3ORQA 4L78A 3UQ8A 5IVHA 3BH6A 4O0LA 1OV9A 3GRUA 3N59A 1S8AA 2WINI 2GPNA 2F3RA 1AR5A 3ENWA 3K9BA 1ZM2A 1HFWA 3AERB 3O8BA 1H2HA 4BE4A 4BRWA 4D4JA 2O8CB 1FBNA 3OBWA 1M34A 2A33A 2VUHB 3AY3A 5DTJA 5JXHA 3AI1A 4EOGA 1VM6A 3CHYA 5B1EA 3PGVA 1YD7A 1D3AA 4R2MA 5CDGA 4CV2A 5EXPA 3G0BA 5FBQB 3R3WA 1XN4A 4P9OA 2EJVA 3ILVA 3IEUA 3MJ4A 1U4NA 4J0JA 3T5BA 4BO4A 5AK0A 1T8UA 2ZJ0A 3VKUA 2FE4A 4U2FA 1NJ6A 4NB5A 3M83A 3RC8A 2AXTZ 1TVKB 3I12A 4L5JA 2VAVA 1L3CA 4MUMA 4BVEA 2WBLC 5KTRA 4KN5A 2UXDB 1RPNA 1QGUA 5DYIA 4DB2A 4JJFA 3HKBA 4WFGA 1BS2A 1TJ4A 1W52X 2WWFA 3BWCA 4JB8A 3QI2A 3S6JA 4UPEA 2LRHA 3Q8MA 3OA2A 3OZCA 2EZPA 3FCOA 2XB9A 3A3OA 1J09A 2F62A 2H7YA 2QM0A 2QU7A 3H13A 3GEDA 1MG0A 4OGGA 3QVNA 2G83A 3DOEA 4Q21A 4R5HA 3S8MA 2G09A 2VK2A 2YV2A 2NXCA 1RCTE 1CCWA 4E88A 4EBBA 5KS2A 5F3DA 4M7WA 4LFCO 2WRZA 1NQUA 4GOJA 4HB0A 5HY2A 4N0PA 4ND5A 4X3CA 3IFXA 3JD1A 1IHYA 4FGZA 2RI1A 4KAJA 3SQNA 2JLVA 1WM1A 2XZTA 2OVFA 1QPBA 1CUIA 1XTSA 1A3CA 5FI0B 3VFDA 5JNWA 5L3BA 1XI1A 4EA8A 5DYTA 5FEUA 3HVIA 2IPAB 4Z51A 4KLAA 1SKYB 3TCKA 1ZKMA 1XMPA 2YV5A 4RZIA 5EG5A 3CC7F 3I8OA 3KP1A 4DR3O 2IFTA 3OMWA 2ALEA 4B43A 4C4YA 4EKEA 1EVEA 1U2EA 3CLKA 2QHXA 3D8RA 2XVZA 5JR3A 2DYSB 4I2VA 1XEXB 2FJPA 4PEVA 1DAIA 2P2GA 3G1WA 3Q7PA 4X24A 2X22A 3ZU4A 1H85A 4L2IB 2OIEA 2X6QA 1TM1E 4J75A 5AHWA 2UUBB 1M8GA 4QGGA 4FX5A 4GYJA 3GVPA 3BWEA 4V0ME 3RUIA 3SVTA 2JLRA 1JAHA 3TLEA 3LS2A 4FFPA 1NMZA 4IIDA 4PICA 4RV4A 3MHSC 4FLXA 4I9GA 4IVQA 5CHYA 3G8CA 3IP5A 2AHOA 2WHYA 3DE1X 1XVUA 1YL6A 3B85A 4JCCA 3SXUB 3TSZA 5MHTA 5FORA 3OTOO 4NVPA 2FA9A 1K2VN 1WA5A 3SBEA 1Q57A 2ZDIA 5TEVA 1ZEJA 2IH3C 4OQEA 4EX6A 5FL3A 4I9QA 3OM1A 4YP5A 3ZWOA 1JXQA 1LW7A 4S1TA 1ZCZA 1WD5A 2BWJA 2WF7A 3FFAA 3PXEA 5THQA 4KOEC 3WSVA 2VI5A 3NRBA 2ZIOA 1Y7PA 2XAGA 1E3WA 1T9HA 1XMVA 2FMFA 2G04A 4AW9A 3NIWA 4CM9A 1Y81A 1R0CA 3QU2A 4PX2A 1XRRA 3BKXA 3FUWA 4L74A 2WD9A 2QMOA 3A3NA 1RPOA 2ZYWX 1KXZA 4L72A 3I58A 1B3RA 1P2BA 1G5RA 2DGDA 3CKYA 3SI7A 1AB3A 1F4MA 3I2KA 2BI8A 5DBHX 3F47A 2PMWB 4M88A 4IX1A 3IQEA 1NJIW 1BSVA 1NYRA 3P96A 4N54A 4BMZA 4D8YA 1ZJ4A 5JCJD 3VQWA 3TVDA 2A3QA 2C0CA 3S55A 1Y4AE 1QZXA 4EJSC 5B7QA 4J1NA 2VAXA 4CMHA 2KLHA 1RM0A 3ZMZA 3VBCA 3D0OA 1GZ4A 3WBKA 2HCBA 4J7ZA 1NI5A 4K9QA 4F97A 2DFDA 1QPGA 2XX3A 1IV2A 3FSGA 3H65A 3OCVA 1K4DC 1N2CA 3C6XA 3CCSV 4EVQA 1N1GA 3R9XB 4Y1FA 1ZN7A 4FT2A 3R0VA 3TB4A 3CMCO 4Y2XA 1WB8A 2VFAA 2IWRA 1DF4A 3C8LA 3CLRD 1ODKA 3O3MB 4WKNA 4QGAA 3HY4A 2QM4A 1UPBA 4WAUA 2BCGY 1EVLA 3I52A 1BHQ1 2YRWA 5A1JA 2EBOA 3A6FA 2XJ9A 3OZFA 1L5OA 4M4SA 1M9NA 3ROGA 1H6AA 4R9VA 1UFYA 5EZYF 1B00A 1ODIA 1X1DA 5JJLA 2KSQA 1IOWA 1NVAA 1N6OA 1NXWA 3UFBA 5KYXB 4IVNA 3OJXA 2F43G 3ZWYA 3WA7A 2ZTVA 1W0JA 2ODWA 3K0SA 3T7JA 3CCMV 4FM2A 4IM7A 5IH3A 4LDPA 3G7SA 4KE8A 3R5KA 5AIAA 1RFGE 4EECA 3LWOC 1M74A 2A06H 1M1UA 3IEMA 4JSRA 3E03A 2PWAA 2ZJ3A 1N7JA 5FOVA 3QI7A 2VHYA 5HW0A 1YFLA 2F8TA 5DNEA 4ER5A 4OK5A 1HV8A 2XMBA 3AEXA 2M9MA 4LDZA 5CT8A 1D2MA 5I3CA 1O0CA 1BFUA 4HGPA 4MA5A 3WLJA 3M1XA 2QR2A 4ATNA 2W2PA 2BOVA 4HDOB 3GMDA 5LOVF 1DC3A 2VDUE 3F4KA 4MUAA 2ZWPA 3UXHA 4EUEA 3R66A 2TYSB 5EJGA 2O9JA 2QVLA 2IYSA 3EORA 4JJ6A 1MXHA 1R18A 3PR3A 3RJ9A 4Y6QA 3THWA 1QAOA 5B3JA 4JS0A 1MDFA 1W4LA 4A3SA 4ZCMA 5FQNA 3K9WA 3LUAA 4JI8B 2F6RA 4QFDA 3P9YA 2IEZA 4LCUC 2XA1A 4PWTA 3B6EA 3OIVA 2QV7A 3C74A 2ENWA 5J9FA 3TL2A 2A9RA 4RABA 1QNMA 3UK0A 3I64A 1Q5OA 1XK7A 3DTVA 3B3FA 4Q4JA 1TJ5A 4LQ4A 4FDMA 5ECWA 4C20A 3DEKA 5JRJA 3NJRA 4RZSA 3GRVA 2BFAA 1EJ6A 4JJAA 3L04A 2GF2A 3ND6A 4Q15A 5H7XA 4DA6A 3D31A 1W44A 2D2IA 2FFAA 5LA6B 1GQOA 2C03A 2UVDA 1ZK1A 2FYUH 1E3SA 2PCLA 4F9GA 4KFSA 3WIBA 3H75A 2O8CA 3FFMA 2B4AA 2E0IA 1ZICA 1VC2A 2OUKA 2ZM5A 1TUEA 3CX5F 3AVPA 3DLCA 4KAXA 4PO8A 4RW0A 5ALZA 4C6HA 5DN6D 2XCTB 5K4HA 4W99A 2BHLA 4NCIA 1E2FA 1MFPA 2HWXA 3AG5A 2PFGA 3WYDA 1HKUA 4ZJUA 2RG7A 1JECA 2ZXWB 3OEHG 1DWPA 2EBFX 3F3KA 3OZGA 4FYMA 5TE9A 4DV1O 2X5OA 4GZMA 5TEWA 2QXTA 4HV4A 5KOHB 1X8JA 4M54A 2ATCA 3JQ8B 4B76A 2J5BA 1PV4A 4ECAA 2KKWA 2FCRA 2V9ZA 2BGIA 4C6SA 2BR4A 4GPAA 3VSEA 1A77A 1QTNA 3DBRB 3HDQA 4BUCA 5K3SA 2QWQB 1EMDA 4H37A 2ZULA 1EFPA 3CZQA 3KXDA 5EHIA 8AT1A 4WKGA 1KAMA 4IYHA 3DTYA 3HA7A 3U9TA 3ZHBA 1NPYA 2R5WA 4H6XA 3NRCA 4UU0A 1D4FA 4P80A 2VDLB 2PH3A 1W8DA 1JA0A 3GNTA 4OMDA 4U6QA 4XCXA 3E8SA 3NWJA 3P97A 4AY3A 3UJ8A 1TVCA 3Q7IA 3OTFA 1JLLA 1GZ3A 1DDOA 1KS9A 2CLEB 1JR2A 2GEFA 2H18A 3LVRE 4Z4IA 4P6VF 3VYUB 3PFHA 4BP9A 1QQTA 5ITSA 2KB1A 1DG1G 2Z43A 4A15A 4X93A 1DG3A 3AP3A 4BMYA 4QT4A 1Q12A 2F1OA 4WF9V 2HHHO 3P9IA 1NL3A 3ZCXA 3ZVLA 1OH6A 5DP1A 4XEUA 3SIRA 9ABPA 4ND1A 2IBZH 6AT1A 3CBQA 1B74A 3HYCA 2I2DA 3HRHA 4DW8A 4BW0B 2AV6A 2O8DB 2LKCA 4P4UA 3JALA 1JPNA 1ZVMA 2E87A 3H83A 1JFLA 5M7EA 1XZEA 1AROP 4I50B 4UCOA 5E1AC 3OQJA 2F8LA 3QXSA 3ESCA 3I56V 3IDSA 3KU1A 2B4KA 1V6AA 1ZL8B 1XCMA 5AKLA 3SQDA 4NTZA 2JLUA 4HVCA 4CNBA 4ARBA 5K0JA 2JJ1G 1VGRA 5JASA 1H1TA 2QORA 4KP4A 4FYXA 3HVRA 5ALSA 1GLVA 3OD1A 5BSGA 1YF2A 4DQLA 1JDVA 2O4CA 3ZWMA 1OZHA 3CCRF 2QF7A 2H9IA 2VZEA 3KPUA 4K5QA 1VJ0A 2N1MA 4IGGA 1FMTA 4OHWA 2JI4A 1T5TA 3GZJA 5E1OA 1T9BA 5U4QA 1QBZA 2QTCA 1QZZA 1K08A 4GSKA 1RE1A 4RA6A 4JY7A 3IALA 3Q0TA 3ZNQA 4CM1A 4WFAV 1UWLA 1X1CA 2IHBA 3ZX5A 3G68A 5LDGA 4OBBA 3DLAA 3T3IA 2GWRA 1QV9A 2D4HA 3V1LA 4BKPA 1HQCA 3J7AU 5J40A 2H3OA 1IEVA 1YZ3A 1ND6A 2HNBA 3B6JA 3OD5A 1JFRA 1ZWZA 2QTWB 3HQ4O 5G4LA 1H9AA 2Q2WA 4AM8A 4DR5B 2Z1FA 3F6BX 1D03A 2IYQA 1JIIA 1JPUA 1J24A 4GKKB 1E8NA 2H9YA 3ABKB 4BHTA 4AO8A 3RRNA 1GM7A 3LWVC 3JVIA 3HBNA 3EG5A 2DR2A 2C4NA 4ZO8A 2OZEA 2Q0OC 3ZGNA 4H4EA 4C2AA 3G0IA 4EJSA 1C7FA 4JAAA 3SK0A 5CDSA 2I9KA 2WWVD 5IHXA 3SYKA 1OA0A 3DE4X 5FUMA 2FW6A 4TTTS 5BWOA 5AVQA 1NXOA 1S2GA 4U7HA 3AINA 4NKGB 4K9NA 3E1YA 2OT3B 3VR5A 1BKYA 5GAPK 1EG2A 3BHMA 3KRTA 2AI2A 2C4WA 3I37X 4LK3A 5EZQA 4WY2A 3DKPA 1ZLZA 1YOVB 1SDSA 2AOUA 3J7AC 1KQNA 2HSGA 4IO1A 1Y7HA 4RPHA 4MT8A 1Z6TA 2IKQA 2LGJA 3B1KA 3ENZA 3NYIA 3WWCA 2TMKA 2ZWAA 4P31A 3FCAA 3IEXA 1LC3A 3DLPX 3EXIB 2BM9A 3N86A 3GGPA 3P2EA 4ZREA 1R74A 1Z4QA 1QFZA 2R2AA 3ZZTA 2YI9A 3B77A 1CP9A 1S02A 1IUKA 1JGTA 4RD4A 2QTZA 5JCXA 2IC5A 3EQ7A 1N3YA 3AVYA 5DI3A 1R66A 2WM9B 4HHEA 3MGCA 4EO4A 4B2PA 1ECJA 1HWYA 4K8RB 1WF6A 2BHTA 2FF5A 1RR6A 2ETVA 2R6JA 3FPEA 4WCDA 4UNIA 3S70A 3UC5A 1YZNA 3ZN2A 1ZWLA 2GNOA 5AHOA 1GN2A 5J1TB 5EHQA 3AIMA 7GPBA 3BIFA 4WZAA 5JCOA 2VRZA 5IYBO 1SRYA 4PIMA 3TTTA 3KOMA 5GIOE 2D4AA 2XE8A 1JH8A 1JI0A 4HQNA 4CJXA 5CD1A 1VQPF 3CNBA 4OBEA 3LF1A 2V74B 2WHXA 2HY7A 3QYJA 4D6XA 3O1JC 3MLBA 2FSPA 2DBRA 5KHJA 4MVJE 4UCQA 5IVDA 4BE9A 3CLTC 4DLKA 1UOPA 4AWBA 3CYQA 3G0GA 3ESAA 3DGEC 4NMLA 4D26A 3JYCA 1X13A 1YRYE 5IABA 5KINB 5KYWB 1ZNXA 1UFOA 4O2LA 5H9WA 1EUZA 5HE8A 5F64A 4MUEA 1S2LA 2WUGA 4ZK2A 3OBBA 2O2DA 1QLEC 2X4GA 1AHIA 2MSEB 3M3PA 1Y4ZA 3OFVA 4HRYA 2I34A 2XVXA 1YTFD 2X15A 4GRDA 3KT3A 4LJ6A 5EAIA 4LWOA 4MDEA 2ZCEA 2Z8YM 3ANXA 1DJMA 1BWPA 4XQEA 2RGWA 4FYVA 5IT4A 3FIUA 4JLNA 5JDCC 4F2HA 4UBOA 4ND2A 3GDOA 1OXVA 4IQGA 3DW1X 3JQ8A 5CA1B 1IPAA 3N2GA 1KMHA 2WSSD 4GH5A 1NW5A 1W96A 4NFSA 4JITA 3OPVA 4J4TA 3N4YA 3X1ZA 3LCCA 1L4NA 1Q1BA 2HF7A 4ZPXA 4EHFA 2C5GA 3VC7A 2LP4Y 5E4TA 4DR6O 4ALKA 2EZ4A 1SZDA 1R6BX 4ENRA 5JMOA 4GG1A 3CF2A 2RBGA 3BD9A 5BV8A 1CB7A 1N5KA 5BQ3A 3ABMB 5I5EA 1OH7A 3WQHA 3F3MA 2XVAA 4RKWA 3V1TC 2P27A 4RK0A 2VK1A 2BEVA 4FLYA 2V55B 1Z25A 2B0CA 4ECEA 1BDMA 1BMDA 4DBVO 1V55C 1IN4A 3EDOA 4IXNA 5JADA 3DCIA 3RFXA 4UOZA 3IELA 4UD2A 3VDRA 2JAQA 5FNVB 5HUJA 4Q20A 4CH6A 1JLMA 1ZH2A 1ZTEA 1AS3A 4LNAA 3VR2A 1XX6A 1KL7A 1Y33E 1RADA 4J2TA 3UANA 4I5EA 2EZOA 1EBFA 4TKUA 1IXKA 1Z0DA 3H9QA 4U7TB 1JQKA 5H9VA 4DPLA 1RWOA 2GZ2A 3MTBA 4HB4A 5KZMB 1YAJA 4KL1A 4YY3O 2XZPA 3WBJA 4B6GA 4GI2A 2FSHA 4Q7JB 3VPXA 2XIQA 5IJ0B 2OV4A 3O26A 4OREX 4CODB 3EFBA 4HVAA 1U0SY 3LDAA 2ITCC 3TM5A 1G8JA 1XZJA 5JJJB 3TZHA 1C2TA 1CJBA 3B9BA 5LDHA 2JGLA 4KBYA 3ROMA 3TM4A 3UMJA 2JI8A 2XTZA 1OX6A 4O2BB 1TRHA 1FNNA 1FX0B 2XNSA 4YI5A 5KQLA 1J8QA 1JHZA 2KI5A 1AQIA 3BGOS 3ASOB 3ZG6A 3LY5A 1S1CA 2QUBA 4G8CA 5JJKA 4RSHA 4ZVKA 5JZMA 1RNLA 1Y1RA 3OUTA 3JASB 1QV7A 5FTJA 1YZYA 1MW9X 2H17A 2O50A 4HDQB 4BZZA 4OOEA 3P9CA 4DNOA 5ICGA 2CL6X 2CJPA 3WGYA 3QA3E 2YY7A 2QNBA 2YWFA 2JFVA 2ZJBA 4G67A 4B2YA 1YZBA 3RSHA 4XDKA 1SHJA 2QUKA 3T52A 5K8IA 1Z33A 5H5NA 3SOZA 3TR5A 5I3ZA 1XV2A 4CZZA 1VIVA 5K3CA 1E63A 3F7TA 5K03A 3BCCH 1LLFA 4HATA 4I55A 2AMYA 5EIOA 2IYTA 1VQ7V 2WTXA 4ALLA 4YUWA 4KMSA 4DXWA 2RAVA 1DSSG 1DI0A 4S0ZA 2R6FA 3BAZA 3W0LB 3SIUA 2FJ0A 3U3RA 1E1CB 4EJMA 3DEZA 1QP7A 2W6MA 1IXMA 4PV1B 3LLMA 2ZRJA 3P0HA 3QUSA 1W75A 4HNSA 4I99A 4O1MA 4ZICA 2EW8A 3L8EA 1P2SA 4KVGA 3LHSA 3GFSA 3MGKA 4TS9A 3NJ8A 3RWMB 2ZVZA 2QP4A 3OF2A 4ARZA 4DR4B 2CSXA 5BQ5A 1CXZA 3CYPB 2G70A 4AZVA 2NTJA 3MS7A 3OM8A 1YBFA 1XQXA 2AUTA 4RY0A 3TQIA 4BEJA 1E6EA 3LRXA 2YFKA 4JP3A 5D7NA 1ZNYA 5E7JA 5FB3A 4QE9A 2OGUA 4HRVA 4HWSA 5KYKA 1MHTA 1H4VB 4ARIA 4G0PA 4LF7B 1UDRA 3IKMB 3E86A 4JU8A 5ESXA 2LBPA 5ALIA 5K51A 1GU1A 2PD3A 2ZLBA 1A2QA 3DQZA 4MGIR 4KDEA 3BDVA 2GJKA 1W1IA 3MTGA 4YALA 3WRXC 4DLPA 4WGGA 3OJFA 1J00A 5AHXA 4ZAXA 5G0WA 4QJ4A 1LJLA 4EFMA 1HBJA 4YA6A 3JYPA 2AXQA 2JLWA 4WADA 3ZVNA 2D74A 2IXGA 2VCHA 4L9WA 4Z7OB 3BHPA 3C8MA 3M4JA 3QKTA 3R7WB 5JWOA 2E75B 3PFGA 5J4KA 3WGIA 3VJRA 2BGMA 3B7PA 1Y98A 2HF9A 3QFFA 4ZT7A 3OQIA 3VH1A 1IX9A 5B1BC 1E7WA 2Y1KA 1SKUA 3B2EE 2I76A 4RJTA 3S8YA 2AG5A 2DHQA 1BXGA 4N9WA 1M56B 1SVMA 1TUIA 4RZ3A 5LQDA 5CBGA 2PTHA 1EXVA 1ZA1A 2XCOA 1R4AA 1DIOB 2CFRA 2FB9A 3WJ7A 4P0QB 4Q9DA 4PAGA 2GKOA 2FX5A 3KPVA 4OK3A 4ZVQA 5KX5F 1S2OA 4G26A 4I19A 4C08A 5CVUA 3EXHA 1COWA 3GOHA 3OEED 3TZCA 3VTAA 3AKYA 3BE8A 5J5AA 3W05A 4B6QA 1I4LD 3LUCA 1G38A 2OLJA 3VMMA 3QLUC 1UBLS 5GOZA 4KKVA 1V8BA 1KY2A 2OO7A 3HJFA 4JP2A 1OXBB 4BVBA 1UBMS 4E0BA 1AH2A 3WG7B 3ZW8A 5JV5A 3DBOB 4XPIA 1KZ9A 4FVTA 5D2CA 4HZ3A 2C99A 4HSEA 4O3FA 4A0SA 3JCMM 2F00A 2ERYA 3IT3A 3VYWA 3TMKA 4BFXA 2GETA 1YVEI 2Q6OA 2YV1A 4MI3A 2X0EA 1YQEA 4OG2A 1TO6A 3IAUA 2DWUA 2OO3A 2P7TC 1KO7A 3GV0A 3ZRWA 3LQ1A 3HJHA 4J3JA 1SVIA 3CXRA 1XEAA 5HKLA 4EDHA 5T3UA 3VU3A 3KQLA 1GPUA 5DJ5A 2J32A 5L3CA 2FGYA 2PS0A 2R4UA 1Q2UA 3N3AC 4MI9A 1M3SA 4ZT4A 7ABPA 1MC8A 2G3YA 1LLQA 1PZGA 1LPNA 2YZGA 1W5BA 2HMSA 4KLRA 2OTLV 2JIOA 2VBFA 4G81A 2C42A 3P9XA 4LYAA 5C46F 4X95A 4URFA 1H5QA 1ZHFA 1SCQA 1XCGB 3E3NA 2ZKIA 1C0KA 5ISMA 4JQSA 1FS0G 1O95A 1TA0A 4AZ3A 4TXLA 3TRKA 4MVZA 2JJ8A 2WQZA 3MN1A 3QUQA 2QN9A 4ZVRA 2HK9A 3UJ9A 3WNZA 1KRWA 4Y2TA 4A0QA 1Y5LA 1RI1A 2ZUSA 4KMMA 4WIAA 2V65A 4MRNA 1RKUA 1LF5A 4TL8A 1TUBB 1KJWA 3A1SA 3OU2A 2WWIA 2Y4OA 1Z38A 3LXRA 1B0PA 3PXXA 3LLUA 4GKVA 5AIBA 3PPIA 2W2MA 3VYUC 3H0EA 4NYIR 1WNTA 5EP1A 3EVZA 3V4ZA 3S4YA 4EKNB 3O3OB 2LFSA 1HC7A 4DARA 1R50A 1XE3A 4HGOA 4XH9B 2MJLA 1OT3A 4JLWA 2O5EA 1H1LB 5DE3A 4JI2O 5F2VO 4DIDA 1CW2B 2GZ3A 5A5DA 1RJDA 1VKNA 2C4TA 2HA4A 1S2IA 4ID9A 3JQPA 4IJ6A 3ZY5A 3JR3A 2R60A 5IJ9A 3AHGA 5AW5A 3RGBA 2B5VA 3L82B 3JSNA 1NKDA 2IPOA 4W6QA 3HXKA 2PX2A 2O54A 1HEIA 1ZOOA 3NBFA 1NIPA 3H9BA 3RGGA 5IXYA 3C24A 3UUFA 1REQB 4QIHA 4HNAA 3DCNA 3ZGLA 1W2BF 4DXHA 4JXXA 4PPGA 4EAAA 5DBIA 5TNXA 3NMUC 3BA6A 3TZLA 2A1TS 3L6OO 2Q5OA 3PQ8A 5LYJB 2ZVJA 4S35A 1EFDN 3QELA 4F2PA 1H8HA 1VJRA 3IOEA 3CE2A 5G0VA 5EP4A 1QU2A 1KJ8A 5E2AA 7MHTA 1JZSA 3K6KA 2HHAA 1AHNA 1Q3TA 1UP7A 2PUWA 2ZBQA 2ZUUA 2C4KA 1Q5PA 5CD9A 1WBDA 2EP5A 1CY2A 1H2KA 1CQIA 4H7JA 5FH9A 1B73A 4R16A 4FZ1A 1ES9A 1EYZA 1NZDA 4FFNA 1DKLA 5EIHA 3ITKA 1R8QA 1P18A 4BNMA 3RVMA 5EJ4A 1I4EB 1R0WA 1YB4A 3M6FA 4BVKA 1YJ5A 3H5LA 4IICA 3CLHA 4F3RA 2MCFA 4ADSG 2J48A 2J07A 1TCUA 2XTMA 4BMVA 3G5MA 2HRUA 4N5NA 4UBIA 3WGQA 3WNBA 4E2YA 4DLUA 3AEQA 3I9OA 4A1FA 4MKRA 1EH5A 1Y6FA 4K40A 1XYVA 2HWYA 3M33A 4HK4A 4MWCA 4PCVA 3LK6A 5E8JA 4FR2A 3H8JA 4LR3A 5KMGB 2J6HA 1E1RD 1CLIA 4R7CA 5EIBC 1GYRA 2MDTA 1L8DA 3C7CB 1OW3B 3OX1A 3BREA 3LBFA 4L27A 2Q1UA 1KZYC 4L8GA 2HX0A 4RFVA 4V39A 3A3KA 4QUAA 3I1FA 3OUZA 1CNEA 4R1NA 4CKEB 3TXSA 1OB2A 3IQFA 2HYDA 5EYPB 2BM8A 1DQNA 1GO3F 2MW2B 2EATA 2FW9A 4BC1A 1O9HA 2C1ZA 1RM5A 1FDTA 1YDFA 2QX4A 2YJ3A 4MUYA 4Y2VA 4KITB 2VQFO 4M9CA 3OO0A 3DBHA 5JWRA 4RWEA 1TZKA 4WFQA 4UVEA 3O95A 4CRWB 1Q0SA 2NQTA 2CLFB 2O07A 5BNWA 5BR1A 3WTCA 3MA0A 4KSYA 2QTPA 4LSZA 3UFXA 4CL0A 4YJ3B 1IY1A 1I01A 2P4SA 4C0LA 2AA3A 3T2MA 1M93A 1DBFA 3KZCA 3UOAB 3PFWO 3LYAA 4E5SA 2OPHA 3K0CC 4QEZA 1JKJA 5HXUA 3EA0A 1U43A 1EINA 3MJVA 1G42A 2FQYA 2W6JD 2V7EA 2XMCA 2Q7GA 1TEHA 3VNVA 1RWKA 1E60A 1YNOA 2FEOA 4IV5A 4CKYA 3U44A 3DF9A 4GBJA 1NLFA 1SVWA 3T5CA 3PGA1 4EB8A 4Q4HA 5B3LA 1DBVO 1EUDB 1V1MA 4P7JA 2OCDA 2O3UA 1K5PA 3M2TA 1YQXA 3TLAA 4C29A 4B81A 2X1MA 4PN7A 2PUTA 3L8HA 1KAGA 1P7WA 2SKEA 4CEJA 4CIYA 1P2UA 4JHXA 2P7HA 4ITVA 1H8HG 4CH5A 1EDBA 1QO9A 1EHIA 2BEKA 1A4UA 3FYUC 5F51A 1GNQA 2CXNA 2UYKA 2H2AA 3B82A 4AN1A 2VCEA 3E22A 1CJMA 4YJ2F 3CR3C 1X0XA 3LQQA 3TL6A 3Q3VA 2CVHA 2WFZA 2HAEA 1QO0A 3FBWA 4W5JA 2R25B 3FTCA 5EXDA 2IY8A 2NQ2C 1W93A 2JPDA 4NICA 4NOKA 1ONSA 4BUZA 3RG8A 3GUVA 3EXFB 4BXOB 3JQAD 4V0LA 2KTUA 2VJMA 5JECA 3BMQA 2M6LA 3OP4A 3WFJA 2OXCA 1BVUA 3T4PA 1M90H 1GTOA 1A50B 1T24A 1ZKDA 3HWX1 4KMOA 1SHTX 3JD0A 1K7YA 2DHRA 3PJFA 3PWTA 4FBLA 4ZAFA 4C3UA 3JATA 3GFOA 1NNSA 4UKDA 5AW7A 2HZ7A 5F3RA 3J81M 2R7MA 3KFVA 4UMVA 3RVDA 3UHAA 3W6OA 4BECA 3ER6A 4CWAA 4EX7A 5AK6A 1G2QA 5J59A 3NUGA 1QVFU 3ZVRA 4A5SA 3R9XA 3VHXA 4YR7A 1JLRA 1WCIA 3PFBA 2BE3A 1OI3A 1Z4LA 3TD2A 4CLOB 1HG0A 1IZ9A 3NQ41 1WBJB 3NASA 4M1ZA 5T8KC 3NVDA 1LLDA 2NUTB 1TXGA 1STOA 4FMDB 4EW3A 3CZCA 4DMRA 3NNNA 5HWSA 1KIFA 2RNBA 4RADA 2CGEA 2D06A 4MVJA 5B58T 4URYR 1SCUA 4G9BA 3TJZA 3T5MA 3O85A 1EWRA 1GGNA 4OA5A 4V0QA 5CBPA 4JNCA 1KOGA 4UUBA 5AVWA 4OCZA 1ZM9A 3H0KA 3DXRB 1EJBA 1N9GB 1VLZA 3HR4A 4FJ1A 3S40A 2N04A 2FX2A 2WYIA 4JQOA 4ABTA 5EN4A 2FV8A 3EHDA 3N07A 3FTNA 3FOZA 3OR7C 3AEKB 3SQOA 2ZJ4A 4YQZA 5JNTA 2NV6A 4OXYA 4UTOA 5CITA 2JHPA 1PLKA 1DQZA 2XAAA 2XODA 1V1RB 3HWRA 2I1WA 4JP8A 3WGKA 4IP0A 4KK4A 2YS6A 3OZUA 5B3AA 5EPUA 1MX9A 1U28A 1K3FA 5IASA 2I8AA 2GN1A 3IJRA 3OURA 1EZ1A 2DERA 2WU8A 2I3BA 1ZR2A 3GJRA 2H4FA 5T7BA 1M2FA 1UR5A 3C6ZA 4LJ4A 3LO5A 3UCFA 2VKTA 2H92A 3ZQ6A 2VXOA 4G84A 4JDPA 3H5RA 5F76A 1P8AA 4R1TA 3ZN0A 1HF3A 1IHDA 4HY3A 4PW0A 2PRYA 2FPUA 3DZIA 5K3DA 2RIRA 4QGHA 1YR2A 2FMHA 4YRAA 3Q8WA 3PHLA 3EIUA 3ZNNA 4BQOA 3I92A 3PWSA 2Z3VA 1PK7A 4LPSA 3H1LH 3LSYA 1K8YB 3MMZA 1T29A 4P0TA 1Q7YH 4J8PA 2GTHA 3ODGA 4YACA 3NTVA 4FS8A 1ZGGA 4EY7A 5K0NA 1RBYA 4ZC1A 4FM1A 4QLOA 4TN5A 2X1VA 4H3HB 3TSAA 1GOTA 5JY1A 2WWWA 2EULA 1I0ZA 2XNJA 3H3JA 3WGHA 3U40A 1Y1SA 1XQ1A 1T43A 3QX8A 2ONCA 2QI9C 3A9SA 4L8LA 2DBZA 4XIIA 4UU1A 3CH7A 3R3JA 2UXNA 1XLTC 4AJIA 1W4BA 3I53A 4Q1BA 5FWYB 1DGQA 5F1KA 1W6UA 3QIAA 4W1RA 3AF2A 1TT5A 5AP9A 4KX5A 2TMDA 3P8ZA 4R8VA 5T4FA 1CF4A 1AKQA 2LKDA 2YWXA 3T54A 2IZZA 4E1VA 4ZC8A 3KPJA 1I2MA 1JQ5A 1QGDA 2C8KA 4HTFB 2VA8A 4GT1A 3EUFA 4YYZA 1Y5IA 3AQIA 2ZVPX 4EKWA 5TMPA 3VNAA 3WIOA 1GZSA 4G5QA 4GPIB 2YXYA 4P5EA 4RXMA 5T8KA 4EHDA 3O4HA 1TQ8A 2JH8A 4IH4A 5HBRA 5HF8A 3RC3A 4UE2A 5M2QA 2REOA 4UNQA 2EIMB 2IU6A 2WV9A 5E6RB 4Z4EA 2WHEA 4MVJG 1QQ5A 3S2EA 3BCRA 4ZHSA 4YXFA 4KW7A 4NEHB 3I5DA 3AGKA 1CB0A 1QCCA 2IEIA 2W4IA 3LXXA 4QULA 4F56A 1N5DA 5KA5A 4RVNA 3ESZA 3ZU6A 3FNGA 3SDSA 3WPXA 2YASA 1VSTA 1L4FA 2Z5LA 1FFEA 3D8TA 4ZOLA 3L7IA 4RPCA 2VP3A 3FZYA 2HCTA 5DTRA 1KQGA 2ZB3A 3LDHA 4U8HA 5FV4A 4D46A 2NO4A 1LPBB 4WINA 4GNRA 2NU8A 4ZFNA 4EJ0A 1XALA 2CL0X 2G1PA 5BN5B 4UU8A 4LZOA 3VSBA 3V2UA 4MVJF 4B17A 2DSNA 3WI7A 2VHTA 3LCJA 2YFHA 4KAFA 4EYGA 1H93A 1N0WA 3FMOB 4IDPA 4LZLA 4EK9A 3CC4F 3DMYA 5CPBA 3K9AA 1G1AA 3FMGA 4L7VA 3ZI7A 2UXCB 2QLNA 4GKJO 1J9EA 4Y6OA 1HDZA 2VEOA 3IKTA 2DSTA 1J42A 2ONKA 3P0IA 2BH2A 4EPYA 3B52X 3WQBA 2WYVA 1CEYA 3EXHB 4JYPA 3FROA 2W2VA 3NOQA 4FB4A 2P6OA 2QSUA 3DAFA 3NDPA 2DFLA 1VA5A 2CTPA 2WJAA 4QOSA 1WSWA 2HBRA 5JZVA 8ADHA 2HXSA 1OOEA 1W2BU 4MTGA 1S3SA 2ZAYA 4D7AA 1WMSA 4XJXA 4CQMA 1YZHA 5DSXA 1NAIA 4IRMA 4Q48A 4WGFA 1MMMA 1EDZA 1JHPA 1OA1A 5JG7A 2V7TA 3RHFA 3VA7A 5WRFA 4G0WA 4WOKA 1FRZA 4M0EA 1VQ1A 5BSMA 2OC9A 3NRJA 3VKWA 2CXQA 3LWZA 1UJNA 4E7OA 2QAIA 2Q1YA 2V8BA 1CUVA 4MGYR 2BKVA 3MQWA 2YOGA 3R76A 5A2QA 1RHMA 3DP9A 2XRZA 1BE1A 3HA2A 1M90W 2KBFA 3ADOA 4S2EA 1BE8A 5K01A 1DT3A 1L7OA 5DPMA 3FWKA 2AKAB 1QO7A 1DEAA 4X62B 3EWSA 3MBOA 4FWTA 1FXWF 2O2IA 3QVXA 1JFFB 2XRYA 4FINA 3RG2A 8OHMA 4NC9A 4DMFA 1XD2A 4WBSA 3CC8A 2LE0A 4I4LA 2E6UX 7REQA 4C0KA 1G21A 5EWMB 4BB5A 3THXB 3LO8A 4NPHA 3S2GA 4R0MA 9ATCA 4RHCA 2KW5A 2VYNA 5D86A 4GR9A 1P91A 5FPSA 4U7PB 2Q6TA 2EJCA 3C1UA 3QSGA 1RSOA 3WLMA 1AB6A 1T36B 5EYPA 2LGWA 1MAHA 2PLWA 2QRVB 2AFIE 3FI9A 1VI5A 4JC0A 5K0EA 1FP6A 2EP7A 4IDAA 3TW6A 2N46A 1MJNA 1N7HA 3NDRA 3MT9A 1RQPA 5EC8A 1RWWA 1WPXA 1CLEA 4CM9D 1QC5B 4GE3A 3HSSA 4H59A 3OQNA 3EFHA 4MP3A 1ESEA 2EX3A 5JZOA 4QDXA 2IKSA 5AQEA 5GV7A 2JAXA 5PGMA 5T6BA 3UPUA 2DYKA 5L51A 5JARA 3ASUA 5BPFA 1QOPB 3JQDA 3RC9A 2RKBA 3WDKA 3L8CA 4PBTA 2PY6A 4YLEA 2B9ZA 4JI2B 1AA9A 1XJ5A 4MYRA 4CDMA 5LHGA 1RHKA 3LQFA 1PJZA 1U0HC 2I0FA 5K0CA 2HLDG 1NOKA 1RAIA 1ZR4A 2YL2A 3UV6A 3ZBTA 5REQA 3ZMUA 2I4NA 4AYXA 2AE1A 3CX4A 4X88A 3K5WA 1W8IA 2B8NA 4GOMD 2QTGA 4EF4A 4RTQA 4Q19A 4LV5B 5AH0A 2EIHA 5LQKA 2C4HA 1E64A 3EBOA 1JYFA 3KUDA 2EHJA 3EGOA 1Z74A 4XIFA 1NVWQ 5FWXB 5IT9A 5INTA 1SBNE 4RQAA 2B8JA 4MW6A 4ZGGA 1RAHA 1BDJA 5F78A 3THXA 1I5OA 4CLXA 1OZGA 1XAJA 5AW2A 5K99A 2NUAB 1KR5A 1Q7CA 2FG5A 4X5OA 1ILWA 4BQFA 2X0RA 1RCFA 1N7GA 1U0BB 4HAZA 1MB2A 3REFA 4NU6A 5JXJA 4YXWG 5IDVA 2VYCA 5D5PA 3TE7A 1NW3A 1NFRA 4BT5A 4K6GA 4B3RB 3OZAA 5AVVA 1XD8A 3OU7A 1J0DA 3HUEA 4RFLA 3G2NA 3ROEA 3SJBA 3WWOA 2P6YA 1OCRB 1DDGA 1N1MA 5HOQA 2E9SA 3EK2A 5KNDA 3BWMA 2QN2A 1BN7A 1PRYA 3QWAA 1VE3A 2ZATA 5ELLA 3SF0A 5LZ2A 3LA6A 1UPCA 3H2HA 4XIYA 3T1HB 1WTAA 2YXLA 1UBUS 5EE5B 2ZXFA 1HA3A 1X2EA 2I3GA 2UYOA 4IX9A 4LIPD 2BSKB 4F6CA 4MV1A 2P9CA 1N75A 5MGNA 5DMXA 3RK0A 3RRXA 3L0CA 3KU4A 2GN6A 4RKEA 3GD5A 1Y8QA 3PCXA 1ZAKA 4G1CA 4BIIA 3LGAA 1JG1A 1TT5B 3O4IA 3EPRA 3G4SV 1JAIA 5CB4A 1K0UA 3OAAD 2FDRA 3EVBA 4JUFA 5LZ8A 4IXDA 3M5CA 1GTG1 3OLWA 4NEQA 4TLDA 4OM7A 4YIOA 3F8TA 4ZQHA 5IUKC 4DV5O 3K9QO 2GPSA 2X0IA 3STHA 4MDFA 1DJPA 1H6CA 3A9VA 1VQOV 1TDJA 1XP8A 3MB8A 1MQ9A 2FW0A 2KM1A 2Z04A 3SZOA 4B6JA 5DHPA 3QE2A 3EZLA 521PA 1RWVA 3TMYA 3L7CA 1Y4UA 3F3YA 3U62A 1XTBA 4RANA 3CU5A 1UK8A 4C3VA 2Y1WA 5GJVC 2FOLA 2WILA 1P7GA 3EA4A 3NNDA 1WB5A 2XCLA 3E5MA 5CXXA 4ETNA 1G3UA 2WQ7A 4J3NA 2O1WA 2UZ4A 5BVGA 4K0KB 5MN6A 2CFOA 2V6MA 4X66O 4EMTA 1YACA 2WDZA 1NJGA 3QX7A 1RIIA 3NHKA 1CZLA 2UUPA 1XDGA 5AUPB 3N70A 3O0DA 4ZO6A 3SJZA 1E1DA 1UT6A 1Z68A 2A8YA 3CC2F 3HAXD 2XA2A 1QKKA 2QRMA 4NG5A 1SD1A 1CX9B 5KOJA 4B7AA 4RHTA 1VDMA 3A7EA 4URZR 1SUFA 2PUJA 2WTBA 4GRIA 1Z6QA 4HQKA 4KXYA 5KHAA 4BU1A 2ZR3A 1A0OA 4KPEC 4JHLA 3RSCA 5AW3A 4XLLA 1YJXA 2POQX 2BRUA 3QP9A 1WMDA 4L75A 4PFQA 3BXHA 3BD8A 2Q9CA 3VOUA 1PTJA 1VZ2A 2WU3A 3COWA 3EEYA 4LW8A 2N48A 3GRZA 3DJFA 3HKCB 4OYLA 1DC5A 4S1PA 1R88A 3MGAA 5DCUA 4M1EA 1KYWA 1MX1A 1TZJA 2FWBA 2W6ZA 3TSCA 2J0SA 4AI8A 1JYSA 4U7OA 1XQWA 3D6JA 5K3FB 4X1YA 1RP3B 1SIWA 4HYYA 1XXHA 3NAGA 4RIGA 3VPCA 2J3MA 2FDXA 1NVDA 2QW0X 1KWKA 2D1SA 2GD6A 3S1LA 3L6RA 3WGZA 4GMHA 5DI3B 2UYYA 1LTHR 3R3YA 5FUWA 2HR1A 3MCAB 1K3EA 3WRYA 4MQLA 3HACA 2BFOA 3NHWA 4TQUS 5H81A 3ZHCA 4CNQA 5GVSA 4OHUA 5C7OO 3N2IA 4PLYA 1LBTA 4Y2JA 4EKIA 5HIJA 3IMKA 5IANA 1VIAA 1Z5GA 5H59A 1R3LC 4PHGA 1J0EA 3HFGA 2C4MA 1ESCA 3D3WB 4UDYX 2G1JA 4ZYLA 3LUPA 1FNSA 3FOEC 4LA4A 2XY4A 3QVGA 4HDCA 3REGA 1SPXA 4ZEVA 4UM8B 4US1R 1ZJYA 3NM6B 4P9NA 4Q9IA 3B2EA 1ZVJA 2O3RA 1H2SB 4KXQA 1S3JA 1HETA 2PD4A 1NMXA 2PLAA 4US0R 3BB1A 4WCFC 1H2MA 2YW2A 3PRJA 1QU7A 4LXTA 3DHEA 2AC2A 4C21A 2PVCA 5AW0A 4L9AA 1FS6A 4ZKDA 1NOIA 1T10A 4AO7A 1Z4JA 4NBUA 4ZCRA 4ZOAA 2H59A 2Z4TA 3CSSA 4BR6A 1P1HA 3DC7A 4F92B 4O8CA 1C7JA 4KB5A 1KOJA 2PYLA 1YUBA 1EFAA 3GEEA 1ML3A 2RDMA 3ZV5A 4UB6Z 1JFTA 2I4TA 5HZHA 2RGXA 4R6XA 4DWOA 1E32A 4KOAA 1PS9A 1G6KA 1VLMA 4DEVA 1FTGA 2FR1A 2V96A 4RETA 4LE2A 2ORYA 3DOJA 4PO3X 5EQFA 4BFUA 1XG5A 3P0EA 4G97A 3DDSA 4BGUA 3IMEA 3OKCA 3JAMM 1FD9A 4EI7A 1RJ9B 4E46A 4UFPA 4CFZA 3A27A 2C98A 1S96A 2CXSA 3KZIZ 4JUCA 3ZDRA 5KREA 2EJ7A 3DKVA 2P9FA 3KHTA 4QQRA 5FT9A 3U16A 2J31A 1G98A 2VP4A 1HE4A 1H1LA 3A31A 3SJCC 1MAAA 2AN9A 4LTDA 3RE1A 4YAEA 3RIYA 3ZR4B 3UV3A 1ZD2P 1U9YA 3F3SA 2Y1LA 4FC6A 4A2QA 4HQFA 3WO0A 1VTKA 3GNSA 2WLLA 1XFAA 2JLCA 1ZRNA 3DZKA 4LDJA 1CIVA 3SC2B 1BX1A 1NDQA 3UJCA 3FCXA 3KVYA 3IKLA 2ZWIA 4EB6B 1HKHA 4JD5A 3G9ZA 3AEUB 4MROA 2XSZD 3B6KA 5B6IA 4I9WA 2V4ZA 3DZFA 3CMAF 3ISJA 3D0RA 5FJ4C 1WL8A 3O2SB 3K94A 4G27B 1S01A 3HCCA 4D96A 3HSYA 3U13A 1GILA 1ULHA 4A9AA 4KE7A 4WJLA 3FD5A 5C7YA 4JA0A 2X5JO 4ZDIA 1BT8A 2EAUA 4TUYF 1CYDA 1M66A 5C9ZA 2CAZC 1J2RA 5HF5A 2XUJA 3E8MA 3FRHA 5D3KA 4B4UA 1KO8A 4DLBA 2PJDA 3QO7A 1OPXA 2DC1A 1P1KA 4R9UC 4L7QA 1E1YA 1KA9H 2FEMA 1GZVA 5K9ZA 4CEHB 5TT1A 3C9TA 2XH8A 1QTRA 1GLNA 4JBYA 5KWIA 4WL0A 3H1GA 2PHZA 3EQ6A 4ITUA 4JAVC 4PYLA 4I3GA 4KUMA 2W6CX 1NWHA 2H4HA 3PXCX 1A8IA 1OLOA 2Z6AA 3AOEA 5KYUB 1JWLA 3QWFA 4E1BA 5ECGC 2JDID 4BIUA 1XD2B 4PZEA 4HTFA 4B83A 3RIEA 1NJ1A 3IUSA 3KB2A 4NBKA 4DR6B 1DELA 1YJWV 2JI7A 1JCHA 3W5SA 2LIPA 1VSVA 3E3AA 3OFKA 1FNKA 1JBKA 4N3NA 2F3SA 2D2CB 5T4BA 3G5LA 1RZUA 2E82A 2HU2A 4X8AA 2F66C 2V97A 4EAQA 1DKUA 4MVXA 2JS7A 2NM0A 3ACBA 4LKOA 3F46A 2Z1EA 2JVKA 2QLLA 3FNQA 2F1RA 3QKWA 5SZHB 2C8LA 3H2IA 3KJFA 3EOAI 4GO1A 1TNDA 1WO8A 2EDAA 3EVAA 3GFPA 5K45A 1NJIH 3ISVA 3H0CA 5CLLA 2QRHA 5JCZA 3HI6A 5IEJA 2CTQA 3VDMA 1QHNA 3WTBA 5CH3A 1OF1A 1Q1ZA 3RVOA 3TX6A 2UZ3A 2BEVB 3PDHA 5LJIA 1NVEA 4EIWA 2IS2A 1WA8B 3PR2B 2WD7A 4RD0A 3L46A 4UQPA 1YF3A 2CUTA 3LCMA 3L2OB 1ZA2A 3C8DA 5JY6A 4LDAA 2JJYA 3EBPA 3ILHA 2OT5A 3A58B 4RKRA 3TTVA 4N3CA 1KKLA 1S2DA 4W1QA 2D3WA 2NYRA 3UQZA 4ZCTA 1GTMA 2PMDA 2RHTA 4EGCB 5HJ5A 2HMWA 3KQHA 3N8GA 4YP1A 1P2FA 3AH8A 3CZPA 1G3IA 3EPPA 2V58A 1U7UA 1NZJA 3H5TA 4R1OA 3SYNA 1M6NA 1P7ZA 3ESXA 3EARA 3Q4GA 3ZBUA 1SQBH 4Y1RB 4ZJYA 1KH1A 1YU6A 1L4BA 3BOSA 3EQZA 1BJKA 2ZKLA 3DMPA 2C7QA 2WM3A 2QE7G 5LHHA 3KBOA 1ZOLA 3PTLA 4CMIB 2XKJE 4DGQA 2ZQZA 2RI0A 3GWZA 2ZI4A 4GZ5A 4W8GA 4DY6A 3LDCA 1UBGA 3F7MA 1YQWA 1ZUWA 4OMUA 3SG0A 1TE2A 1CZHA 1WDMA 4RCVA 3D3NA 3D7LA 2JIBA 2I99A 3HJWC 3QWIA 4HDSB 1MIHA 1QVWA 2OCXA 3OF3A 3F90A 2H63A 3UCXA 3F8WA 2UU9O 2P3SA 5EJFA 2OWOA 4Q24A 1FUYB 1MT3A 3NI2A 1QP0A 1SQ5A 3PL5A 5C8DA 2P06A 3EPLA 3DV0B 1AJQA 3HUUA 4TMTA 5TPZA 1EN4A 1GDHA 1ITZA 4M49A 1S72V 1GEGA 2VK8A 2DF8A 5ALNA 1VIBA 4DZZA 1U8FO 3COSA 4TYNA 4FFOA 1KU6A 1VZ3A 1QHHA 3GDWA 1PO7A 1H0KA 2HA7A 1GQ2A 3MWKA 4MB2A 1JDBC 4P3NA 3A6ZA 4QU9A 2WJ4A 2WU0A 4CTMA 1UPFA 5B1HA 2I2CA 4I55F 4XA8A 2W8BC 2BMAA 2MTBA 3ZCPA 1R6DA 4PXAA 3ULKA 3W34A 3M0EA 4G5HA 2BKUA 5ESDA 2D1TA 1JZTA 5JO9A 3W8EA 7REQB 5JANA 2VPIA 2X9LA 3E84A 5HDBB 4DR1O 1QE3A 2JCBA 1A27A 1E5VA 2L42A 2PBRA 3EXEB 3F6RA 5IAGA 2EFEB 2ZIMA 4JJIA 5DBFA 1R9GA 5IJZA 4NSNA 4WT7A 1GTRA 1YITV 1XTIA 4BVRA 3F7YC 1P62B 1T5IA 2FP4A 4MI6A 4TXNA 4JYAO 4WDRA 2FSVC 4YRRA 1PJRA 3TTWA 4YMWA 3I5MA 3RV3A 1GGJA 4J7CA 5HRCA 1RJWA 3KT6A 4RULA 5LP6C 2HIMA 3IBTA 4XUEA 1N2ZA 4EEQA 1QKIA 3R3ZA 1OU0A 2PUGA 4P86A 1XR3A 3FPAA 2H0AA 1W85B 3BL6A 5C7LO 2B4TO 1GV0A 5CA0B 2AIFA 1MGOA 4MOWA 2RHMA 5HGXA 3SS9X 1F9EA 3AHDA 2GTPA 4PONA 3JW8A 2DLNA 1P3JA 1YH3A 1PF5A 2W11A 1OH5A 5BW8A 4PTYA 4H44B 1CPYA 4QQ8A 4DLWA 2ZAUA 1BS9A 3H9VA 3UH1A 3ELUA 1YNSA 3T1CA 4RWZA 2PRSA 3PEYA