1SARA

Determination and restrained least-squares refinement of the crystal structures of ribonuclease sa and its complex with 3'-guanylic acid at 1.8 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination and restrained least-squares refinement of the structures of ribonuclease Sa and its complex with 3'-guanylic acid at 1.8 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase (endoribonuclease)
molecule keywords RIBONUCLEASE SA
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1990-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1sarA00
2BU4A 2KF3A 1X1WA 1X1UA 3Q3FA 1RGKA 1T2HA 1RGHA 1HYFA 1RGLA 2F5MA 1BRHA 5GSPA 1BNGA 1B2UA 1PYLA 1FZUA 1RGAA 1GMPA 3AHWA 4J5GA 1RNBA 1BSAA 1BIRA 1BRKA 1FUSA 1IYYA 1C54A 3WHOA 2F56A 1UCLA 1BSEA 1FYSA 2F5WA 1AY7A 1UCKA 4J5KA 9RNTA 4BIRA 1SARA 2ZA4A 1X1XA 3D5IA 6RNTA 2KF4A 4BU4A 1BRIA 8RNTA 1RDSA 1I2GA 1I2EA 1B3SA 1B2SA 1BANA 3AGNA 1YGWA 1RGGA 3KCHA 7GSPA 1LOYA 1I8VA 2KF6A 2HOHA 1BRJA 3D4AA 1RCKA 1ZGXA 4GHOA 3URPA 1BRNL 1TTOA 1HZ1A 1JBRA 1I2FA 1DETA 3DH2A 4RNTA 1UCJA 1RHLA 1R4YA 1MGRA 1B20A 1RGCA 1BNSA 1B2MA 1LOVA 1UCIA 2RNTA 1LNIA 1RN1A 1BNFA 3HOHA 1JBSA 1TRPA 1B2XA 5RNTA 1I0VA 4GSPA 3D5GA 1BNRA 2RBIA 1T2IA 3AGOA 1RLSA 2F4YA 1RGEA 1B27A 1A2PA 1GMQA 5BIRA 1TRQA 1RCLA 1DE3A 1LRAA 1BSBA 1RN4A 2GSPA 1YVSA 1I70A 1Q9EA 1LOWA 1BNJA 1MGWA 1RMSA 6GSPA 1BU4A 3GSPA 1GOYA 1FUTA 3SYUA 3A5EA 1BNIA 1YNVX 1BVIA 3AHSA 1BSCA 1RSNA 5BU4A 1B2ZA 1BSDA 1GOVA 1X1YA 1BGSA 2AAEA 1GSPA 1BUJA 2C4BA 2BIRA 2KF5A 3BU4A 1BNEA 2AADA 1G02A 1I3FA 4HAAA 1CH0A 1BOXA 1I3IA 1RGFA 1RTUA 1GMRA 2SARA 3RNTA 1BRGA 3DGYA 7RNTA 1JBTA 3BIRA 1B21A 1FW7A 5HOHA 3WR2A 1RNTA 1BRSA 1PY3A 2KAAA 1I0XA 4HOHA 1GOUA 1BAOA 1AQZA
chains in the Genus database with same CATH superfamily
3CCU3 1RRLA 2CX1A 3Q3FA 4IPBA 1RGKA 3HZPA 3NM2A 4R9LA 1E3VA 1RGLA 3NHXA 4QWTA 3EN1B 1TP6A 1B2UA 3LTBA 3OXAA 3N54B 4XBYA 1OHOA 3MPHA 1FZUA 1OUNA 1GMPA 3AHWA 4J5GA 1Q7Y4 2I9WA 2W56B 3CPOA 1BIRA 1A2KA 2YFIB 4K1VA 1TU5A 1UUWB 1FGMA 1ASKA 2CFWA 5AIHA 3OV4A 4LGQA 2KXGA 5CLKA 4RNYA 1GD4A 3B4PA 2CFLA 2CWVA 4R4KA 2XH9A 1T3BA 5AEWB 2W56A 5IG5A 1IQYA 1GY7A 3V98A 4HM6B 2KCDA 5M19A 3AGNA 3EBYA 4WYKA 4DKIA 1RGGA 3KCHA 1ZX2A 3CCJ3 3IMAB 4MMXB 1OHPA 4HJLB 3ROBA 1I8VA 1LOXA 2XGLA 4KZ1A 3RGAA 3KSPA 8CHOA 1NB5I 3PCSA 1YI23 1LXEA 2OWPA 1PFPA 1CYUA 1KWIA 2YFLB 1IDPA 3NV0B 1VZZA 4HM5B 3X41A 1EEJA 4WYKB 1HZ1A 5EEOA 3U97A 2XR8B 1M1XB 1UCJA 3FKAA 1RHLA 4FMBA 2H0HA 1MGRA 3N8BA 3FSDA 4R9KA 3F8XA 2RNTA 4HM1B 2Z7AA 3DM8A 1LNIA 4OK0A 5IEOA 3M8CA 3X3YA 1BNFA 1ULJB 1B2XA 1QVG2 3L0RA 2K3DA 1DYUA 3BNCA 1EKMA 2CK3H 4XB5A 3K5TA 2CWUA 3N9HA 2Z76A 4HM8B 1B27A 4H61A 5G1LA 1OACA 3K63A 2SBLA 4R1KA 1RN4A 3VF1A 1W01A 5CK6A 2ML5A 3X3XA 2CHCA 1DVDA 3D3LA 1BNJA 3MYTA 1RMSA 2WOHA 1GOYA 3FCSB 2Y74A 1U8CB 1BNIA 1NU3A 1YNVX 3H51A 1BVIA 2Q07A 1YGEA 1W00A 5M18A 1VQ83 1A2VA 3F40A 1FUWA 3G16A 3LT8A 4BTWA 1BSDA 1GOVA 3H3HA 4KT3B 3DGMA 2O3OA 1VQM3 4EV2A 5LC6A 1LNHA 2F99A 3PZWA 4BTYA 1G02A 2HMNB 4WP5A 4K90B 2CH9A 5ELJA 1I3FA 2D1WA 4HAAA 3HIIA 4HBRA 4PEJA 3CCR3 5BVBA 2BO9B 1N9EA 1I3IA 1ULIB 5JPPA 1A90A 1QJGA 1YHQ3 1W7CA 2UX0A 3CCS3 3OWYA 2SARA 1JBTA 3GAXA 3V92A 4N6V0 3FH1A 3ZG0A 5HOHA 2ZL8A 3DGOA 5FW5A 5G1KA 2HMOB 3A76A 4HM4B 1BAOA 3CD63 3BNEA 2BU4A 2FXTA 3D79A 1ISKA 1GYBA 2CG0A 3T8UA 1YJ93 2HMMB 2W0QA 1EG9B 1IVVA 1BNGA 1YIT3 3S67A 2STDA 3X3ZA 4EYCA 1JB5A 1BSAA 1GY5A 1J2BA 4XM4A 1IYYA 3WHOA 1OPYA 4HM2B 2P0XA 2W04A 5AEUB 5IERA 1AR0A 2V1LA 3I553 3PCRA 1UCKA 2BNGA 1N5PA 4BIRA 2OTJ3 2MF7A 3X40A 1WNHA 1X1XA 2QIYA 3D5IA 3GWRA 4LZIA 4EW5A 3F14A 3KN4A 8RNTA 1RDSA 3CPW2 1HKXA 3UL6A 3FF2A 1B3SA 4L7KA 3OW22 1US1A 2P38A 3DY5A 4ZM8A 1VQ93 1V57A 3STDA 1YGWA 1GS3A 1NNVA 4U13A 3NM7A 2OTL3 7GSPA 4FMAA 3CCM3 4AKZA 1OHSA 4RBNA 1LOYA 2IMJA 3AMOA 4HKVB 1Q40A 2OQEA 2KF6A 1VQN3 2CFKA 1UI7A 1ZGXA 1OF5A 3KZTA 4N6LA 1VQ53 1LQGC 2JDIH 3ER7A 1MOLA 1BRNL 3NUVA 1TTOA 3CCQ3 1K8A4 1JBRA 3CNXA 2CWTA 4RNTA 1NDOB 1UUGB 2O9UX 4N6MA 3CCV3 4O3VA 2YX9A 2OQEC 3DGLA 3NQYA 5IG4A 5EVHA 5KP1A 3NQZA 3CNMA 4K1UA 7STDA 1KSIA 1Q40B 3DXOA 4LYLB 3HOHA 3LTCA 1TRPA 1TUHA 2HMJB 4K61A 1CEWI 4N6OB 4ILFA 3WA2X 3BLZA 4BL3A 4MMYB 1BNRA 2XSHB 3J7Yd 3AGOA 1DVCA 4EXRA 1GY6A 3CC23 1TJDA 2F4YA 4JF8A 2GU1A 5CF2A 4O8SA 4O2HA 1VQQA 2RGQA 1GMQA 5CXOA 5LC7A 4JRFA 1OGZA 3MHEA 1DE3A 1BSBA 4EV5A 1IK3A 4L8PA 4STDA 5IG0A 1N5HA 3NBRA 4MMZB 3EJVA 1VQL3 1MGWA 2CKFB 4WHAA 2W03A 1FUTA 3A5EA 4NHFA 3KFQC 1IV7A 4HM0B 5D81A 2XGNA 2W2CA 3DUKA 1JZOA 2GBWB 3NV0A 1IVUA 2HMKB 2WGOA 3I563 3JUNA 1B2ZA 1IV9A 3G713 1GSPA 3FZWA 3GZYB 2C4BA 2YFJB 2BIRA 1AVLA 3IPTA 1OF5B 3Q2PA 1M1K4 1K734 4O02B 3CCL3 1L5GB 4CCVA 5KP3A 2XF3A 3VGNA 3FLJA 5JPUA 2B24B 2GU3A 3GZRA 4KFDA 3UNLA 1RGFA 4HM3B 3JVCA 1RTUA 4NREA 3HI7A 3RNTA 1BUQA 3BNBA 1TIJA 3LH4A 3NBBA 5AIIA 1BRSA 1PY3A 2CX0A 2W9QA 1N9JA 2BMRB 3MG1A 1W4NA 1GOUA 4HOHA 1IU7A 1FGOA 3CU3A 4ORLA 1C7HA 2KF3A 2E2VA 5M1AA 1GD3A 3KKGA 2GBXB 2OOVC 1T2HA 1DMMA 4I5QA 1TFKA 2Z6BA 1EA2A 1G96A 1HYFA 1OGXA 1BRHA 2F98A 4FR9A 3SVAA 4FCJA 2RCDA 3SEDA 3BNDA 1JJ22 2JQ5A 3WMDA 2J8XB 1RJOA 3OX9A 5D82A 1RNBA 1VQ63 3ZFZA 1FUSA 1E97A 3GZXB 3LOYA 1YJN3 1C54A 1S723 1UCLA 2XFTA 3WODG 3FG3A 1RKYA 1FYSA 1TFOA 2ML6A 3SXXA 1AY7A 3PGBA 3KIIA 3SOAA 4J5KA 3F7SA 1SARA 4LMIA 1IVXA 3S5CA 2L4VA 3SOYA 3EF8A 2KF4A 3EHCA 4XBTA 4BU4A 2F86B 4X2HA 4KFFA 1I2GA 1M904 3DGNA 3FG4A 3DZLA 4HZ9B 1BANA 5IW9A 5I97A 2OOVA 3MKIA 1N8R4 4R80A 4MEIA 3OWUA 3EBTA 3MG2A 2H0IA 1QVF2 1UGHI 5CF1A 1EQKA 5G2GA 4N6UA 5EQLA 1Y4KA 2HOHA 1BRJA 3D9RA 3EQQB 1O7HB 3GZBA 1STDA 4GHOA 1W2ZA 4J9AA 3URPA 2IYJA 3PXMA 2K54A 1UW1A 2XSOB 1JNQA 3DH2A 2RFRA 1WMPA 1D6YA 1R4YA 2HMLB 5D83A 4J8TA 1B20A 2BHMA 1BNSA 1N8QA 1B2MA 3SX1A 1IQXA 1LOVA 1SIHA 1JV2B 2INXA 3VSYA 2Z77A 1RN1A 1JB2A 1KQS2 1CYVA 3F9SA 4GB5A 5RNTA 4FCZA 1FGQA 5STDA 4XDWA 1D6ZA 1STFI 2C11A 4KFEA 4RZMA 5ELUA 1QALA 5AI1A 5AYSC 3CC73 2A15A 4RNZA 3WA3A 4N6TA 1ROAA 3EE1A 4G1MB 4IIAA 5KP4A 1TRQA 1K41A 1RCLA 1LRAA 2P09A 3U1WA 5BXQA 1U5OA 4X2OA 1LOWA 1YJW3 1JB4A 2M7OA 4CDLA 1IT7A 3CMA3 1LVNA 2RSXA 1O7NB 5AIFA 1BU4A 1W6GA 4AEQA 6GSPA 3EX9A 3SYUA 2WOFA 3AHSA 3HX8A 2L1SA 1RSNA 3K9MC 1Q864 1M9GA 2OCTA 3E99A 2E2TA 1IT8A 5AYRB 5BU4A 3I0YA 1FA3A 2BMOB 5IG3A 1KD14 1YIJ3 4GL6A 1LQMB 1VQ73 1O7PB 4Q53A 3UB1A 4HYZA 2CFDA 3B8LA 3MSOA 1CH0A 1EUIC 3F8HA 3KSED 4H3UA 1HU9A 4FMDA 1K9M4 1WMOA 1GMRA 3EC9A 1BRGA 2PZVA 3NXJA 2CG1A 7RNTA 1FW7A 1QAFA 4HM7B 3MWZA 3CME3 1RNTA 1MWSA 1WMNA 2KAAA 3AMOB 4WFOA 1X1WA 1W5ZA 1X1UA 3LTAA 3LMLA 4N3VA 3B7CA 3X42A 2ZHXB 1RGHA 2F5MA 3B4OA 3NX0A 1PYLA 3QK9A 1W02A 1RGAA 2GXFA 1NJI4 3O8YA 2GEXA 4BTXA 4EBGA 1KC84 3FF0A 1NO3A 1BRKA 1JKGB 2KRTA 1W6CA 3ECFA 2D42A 3K7CA 1DMQA 2F56A 3ALAA 5JBSA 1BSEA 3G0KA 1WTHA 1SIIA 2F5WA 3CXC2 3JUMA 9RNTA 1SJWA 3F7XA 3Q1CA 3QRDA 4NPBA 2ZA4A 3S28A 6RNTA 3CC43 1G0TA 1BRIA 1UI8A 1S5AA 3JUOA 1I2EA 4KVHA 3RDEA 1W6YA 1PU4A 1B2SA 2R41A 1MWTA 4CPKA 5IEPA 3IJEB 2CW9A 3V99A 3G4S3 5IENA 3PS8A 1R4CA 2BT3A 4WWUC 2MC8A 2C10A 2IA7A 1SPUA 2LQVA 2P05A 1D6UA 3ZG5A 1JN5A 2PNCA 4FCMA 1AV4A 2IUKA 1O7GB 4AKYA 3WDGB 2P0MA 2Y73A 3D4AA 1IQ8A 1RCKA 1ROVA 1Q824 1JKGA 2FGTA 1A67A 2B1XB 1ZO2A 2LYXA 2WGQA 4FMCA 1I2FA 1DETA 2W6JH 3KE7A 4LEHA 3MG3A 2W9PA 3Q90A 5FGOA 1Q814 1VQ43 1F8NA 3T0UA 4CJNA 1RGCA 3CCE3 1AVKA 3FGYA 4L8OA 1VQO3 2QGUA 3JUQA 1Z1SA 2QEX3 1UCIA 1JN5B 1MWUA 2BMQB 5A0OB 3LXUX 2XRXB 1JBSA 2H0GA 2WO0A 2CIUA 4I4KA 3LZAA 1I0VA 1NB3I 1SQWA 4GSPA 3D5GA 4OVMA 2IUJA 3UL5A 5IF6A 2RBIA 1T2IA 4IT7A 6STDA 3K0ZA 1RLSA 4MJDA 1RGEA 2K0MA 5DRVA 3LT9A 4LSOA 1A2PA 1V58A 1O7WB 5BIRA 4BL2A 4TX4A 3LTDA 4XBXA 2GSPA 1YVSA 1E3RA 1I70A 1Q9EA 1V74A 5DREA 1RN7A 3SLUA 3RGRA 1QAKA 3FG1A 1JRQA 5AIGA 1T5YA 4OUQA 1CQSA 3WOFB 1VQK3 1JZDA 5HGRA 3DMCA 3GSPA 1YVBI 2CFGA 1WQLB 1FGTA 1BSCA 3EN8A 3GRDA 3BB9A 4XDVA 2QA43 3G8ZA 5TGNA 3NBJA 1X1YA 3TDGA 1BGSA 2AAEA 2ZDJA 1K28A 1Q42A 1VQP3 3LYGA 1OCVA 1W2B2 3HIGA 1BUJA 1IVWA 2KF5A 3BU4A 1BNEA 2AADA 2IY2A 3WOEB 2FNQA 4HZBB 2GEYA 3UJMA 1UUVB 3EB8A 4HVNA 1UGIA 2UUGC 3T8NA 3HK4A 4EC6A 1BOXA 1DMNA 3G6E3 1NWWA 2XFSA 2XEPA 4N6NB 1OH0A 1Q7HA 1RRHA 3JUPA 2E2UA 1QMAA 1ZS7A 3DGYA 3BIRA 1MNLA 1B21A 1O7MB 1UDII 2UGIA 3PYJA 3S29A 3WR2A 1FGRA 3OWSA 1I0XA 3S27A 5GSPA 2CC3A 1MWRA 2R4IA 1AQZA
chains in the Genus database with same CATH topology
2BU4A 2KF3A 1X1WA 1X1UA 3Q3FA 1RGKA 1T2HA 1RGHA 1HYFA 1RGLA 2F5MA 1BRHA 5GSPA 1BNGA 1B2UA 1PYLA 1FZUA 1RGAA 1GMPA 3AHWA 4J5GA 1RNBA 1BSAA 1BIRA 1BRKA 1FUSA 1IYYA 1C54A 3WHOA 2F56A 1UCLA 1BSEA 1FYSA 2F5WA 1AY7A 1UCKA 4J5KA 9RNTA 4BIRA 1SARA 2ZA4A 1X1XA 3D5IA 6RNTA 2KF4A 4BU4A 1BRIA 8RNTA 1RDSA 1I2GA 1I2EA 1B3SA 1B2SA 1BANA 3AGNA 1YGWA 1RGGA 3KCHA 7GSPA 1LOYA 1I8VA 2KF6A 2HOHA 1BRJA 3D4AA 1RCKA 1ZGXA 4GHOA 3URPA 1BRNL 1TTOA 1HZ1A 1JBRA 1I2FA 1DETA 3DH2A 4RNTA 1UCJA 1RHLA 1R4YA 1MGRA 1B20A 1RGCA 1BNSA 1B2MA 1LOVA 1UCIA 2RNTA 1LNIA 1RN1A 1BNFA 3HOHA 1JBSA 1TRPA 1B2XA 5RNTA 1I0VA 4GSPA 3D5GA 1BNRA 2RBIA 1T2IA 3AGOA 1RLSA 2F4YA 1RGEA 1B27A 1A2PA 1GMQA 5BIRA 1TRQA 1RCLA 1DE3A 1LRAA 1BSBA 1RN4A 2GSPA 1YVSA 1I70A 1Q9EA 1LOWA 1BNJA 1MGWA 1RMSA 6GSPA 1BU4A 3GSPA 1GOYA 1FUTA 3SYUA 3A5EA 1BNIA 1YNVX 1BVIA 3AHSA 1BSCA 1RSNA 5BU4A 1B2ZA 1BSDA 1GOVA 1X1YA 1BGSA 2AAEA 1GSPA 1BUJA 2C4BA 2BIRA 2KF5A 3BU4A 1BNEA 2AADA 1G02A 1I3FA 4HAAA 1CH0A 1BOXA 1I3IA 1RGFA 1RTUA 1GMRA 2SARA 3RNTA 1BRGA 3DGYA 7RNTA 1JBTA 3BIRA 1B21A 1FW7A 5HOHA 3WR2A 1RNTA 1BRSA 1PY3A 2KAAA 1I0XA 4HOHA 1GOUA 1BAOA 1AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU4 A;  2KF3 A;  1X1W A;  1X1U A;  3Q3F A;  1RGK A;  1T2H A;  1RGH A;  1HYF A;  1RGL A;  2F5M A;  1BRH A;  5GSP A;  1BNG A;  1B2U A;  1PYL A;  1FZU A;  1RGA A;  1GMP A;  3AHW A;  4J5G A;  1RNB A;  1BSA A;  1BIR A;  1BRK A;  1FUS A;  1IYY A;  1C54 A;  3WHO A;  2F56 A;  1UCL A;  1BSE A;  1FYS A;  2F5W A;  1AY7 A;  1UCK A;  4J5K A;  9RNT A;  4BIR A;  1SAR A;  2ZA4 A;  1X1X A;  3D5I A;  6RNT A;  2KF4 A;  4BU4 A;  1BRI A;  8RNT A;  1RDS A;  1I2G A;  1I2E A;  1B3S A;  1B2S A;  1BAN A;  3AGN A;  1YGW A;  1RGG A;  3KCH A;  7GSP A;  1LOY A;  1I8V A;  2KF6 A;  2HOH A;  1BRJ A;  3D4A A;  1RCK A;  1ZGX A;  4GHO A;  3URP A;  1BRN L;  1TTO A;  1HZ1 A;  1JBR A;  1I2F A;  1DET A;  3DH2 A;  4RNT A;  1UCJ A;  1RHL A;  1R4Y A;  1MGR A;  1B20 A;  1RGC A;  1BNS A;  1B2M A;  1LOV A;  1UCI A;  2RNT A;  1LNI A;  1RN1 A;  1BNF A;  3HOH A;  1JBS A;  1TRP A;  1B2X A;  5RNT A;  1I0V A;  4GSP A;  3D5G A;  1BNR A;  2RBI A;  1T2I A;  3AGO A;  1RLS A;  2F4Y A;  1RGE A;  1B27 A;  1A2P A;  1GMQ A;  5BIR A;  1TRQ A;  1RCL A;  1DE3 A;  1LRA A;  1BSB A;  1RN4 A;  2GSP A;  1YVS A;  1I70 A;  1Q9E A;  1LOW A;  1BNJ A;  1MGW A;  1RMS A;  6GSP A;  1BU4 A;  3GSP A;  1GOY A;  1FUT A;  3SYU A;  3A5E A;  1BNI A;  1YNV X;  1BVI A;  3AHS A;  1BSC A;  1RSN A;  5BU4 A;  1B2Z A;  1BSD A;  1GOV A;  1X1Y A;  1BGS A;  2AAE A;  1GSP A;  1BUJ A;  2C4B A;  2BIR A;  2KF5 A;  3BU4 A;  1BNE A;  2AAD A;  1G02 A;  1I3F A;  4HAA A;  1CH0 A;  1BOX A;  1I3I A;  1RGF A;  1RTU A;  1GMR A;  2SAR A;  3RNT A;  1BRG A;  3DGY A;  7RNT A;  1JBT A;  3BIR A;  1B21 A;  1FW7 A;  5HOH A;  3WR2 A;  1RNT A;  1BRS A;  1PY3 A;  2KAA A;  1I0X A;  4HOH A;  1GOU A;  1BAO A;  1AQZ A; 
#chains in the Genus database with same CATH topology
 3CCU 3;  1RRL A;  2CX1 A;  3Q3F A;  4IPB A;  1RGK A;  3HZP A;  3NM2 A;  4R9L A;  1E3V A;  1RGL A;  3NHX A;  4QWT A;  3EN1 B;  1TP6 A;  1B2U A;  3LTB A;  3OXA A;  3N54 B;  4XBY A;  1OHO A;  3MPH A;  1FZU A;  1OUN A;  1GMP A;  3AHW A;  4J5G A;  1Q7Y 4;  2I9W A;  2W56 B;  3CPO A;  1BIR A;  1A2K A;  2YFI B;  4K1V A;  1TU5 A;  1UUW B;  1FGM A;  1ASK A;  2CFW A;  5AIH A;  3OV4 A;  4LGQ A;  2KXG A;  5CLK A;  4RNY A;  1GD4 A;  3B4P A;  2CFL A;  2CWV A;  4R4K A;  2XH9 A;  1T3B A;  5AEW B;  2W56 A;  5IG5 A;  1IQY A;  1GY7 A;  3V98 A;  4HM6 B;  2KCD A;  5M19 A;  3AGN A;  3EBY A;  4WYK A;  4DKI A;  1RGG A;  3KCH A;  1ZX2 A;  3CCJ 3;  3IMA B;  4MMX B;  1OHP A;  4HJL B;  3ROB A;  1I8V A;  1LOX A;  2XGL A;  4KZ1 A;  3RGA A;  3KSP A;  8CHO A;  1NB5 I;  3PCS A;  1YI2 3;  1LXE A;  2OWP A;  1PFP A;  1CYU A;  1KWI A;  2YFL B;  1IDP A;  3NV0 B;  1VZZ A;  4HM5 B;  3X41 A;  1EEJ A;  4WYK B;  1HZ1 A;  5EEO A;  3U97 A;  2XR8 B;  1M1X B;  1UCJ A;  3FKA A;  1RHL A;  4FMB A;  2H0H A;  1MGR A;  3N8B A;  3FSD A;  4R9K A;  3F8X A;  2RNT A;  4HM1 B;  2Z7A A;  3DM8 A;  1LNI A;  4OK0 A;  5IEO A;  3M8C A;  3X3Y A;  1BNF A;  1ULJ B;  1B2X A;  1QVG 2;  3L0R A;  2K3D A;  1DYU A;  3BNC A;  1EKM A;  2CK3 H;  4XB5 A;  3K5T A;  2CWU A;  3N9H A;  2Z76 A;  4HM8 B;  1B27 A;  4H61 A;  5G1L A;  1OAC A;  3K63 A;  2SBL A;  4R1K A;  1RN4 A;  3VF1 A;  1W01 A;  5CK6 A;  2ML5 A;  3X3X A;  2CHC A;  1DVD A;  3D3L A;  1BNJ A;  3MYT A;  1RMS A;  2WOH A;  1GOY A;  3FCS B;  2Y74 A;  1U8C B;  1BNI A;  1NU3 A;  1YNV X;  3H51 A;  1BVI A;  2Q07 A;  1YGE A;  1W00 A;  5M18 A;  1VQ8 3;  1A2V A;  3F40 A;  1FUW A;  3G16 A;  3LT8 A;  4BTW A;  1BSD A;  1GOV A;  3H3H A;  4KT3 B;  3DGM A;  2O3O A;  1VQM 3;  4EV2 A;  5LC6 A;  1LNH A;  2F99 A;  3PZW A;  4BTY A;  1G02 A;  2HMN B;  4WP5 A;  4K90 B;  2CH9 A;  5ELJ A;  1I3F A;  2D1W A;  4HAA A;  3HII A;  4HBR A;  4PEJ A;  3CCR 3;  5BVB A;  2BO9 B;  1N9E A;  1I3I A;  1ULI B;  5JPP A;  1A90 A;  1QJG A;  1YHQ 3;  1W7C A;  2UX0 A;  3CCS 3;  3OWY A;  2SAR A;  1JBT A;  3GAX A;  3V92 A;  4N6V 0;  3FH1 A;  3ZG0 A;  5HOH A;  2ZL8 A;  3DGO A;  5FW5 A;  5G1K A;  2HMO B;  3A76 A;  4HM4 B;  1BAO A;  3CD6 3;  3BNE A;  2BU4 A;  2FXT A;  3D79 A;  1ISK A;  1GYB A;  2CG0 A;  3T8U A;  1YJ9 3;  2HMM B;  2W0Q A;  1EG9 B;  1IVV A;  1BNG A;  1YIT 3;  3S67 A;  2STD A;  3X3Z A;  4EYC A;  1JB5 A;  1BSA A;  1GY5 A;  1J2B A;  4XM4 A;  1IYY A;  3WHO A;  1OPY A;  4HM2 B;  2P0X A;  2W04 A;  5AEU B;  5IER A;  1AR0 A;  2V1L A;  3I55 3;  3PCR A;  1UCK A;  2BNG A;  1N5P A;  4BIR A;  2OTJ 3;  2MF7 A;  3X40 A;  1WNH A;  1X1X A;  2QIY A;  3D5I A;  3GWR A;  4LZI A;  4EW5 A;  3F14 A;  3KN4 A;  8RNT A;  1RDS A;  3CPW 2;  1HKX A;  3UL6 A;  3FF2 A;  1B3S A;  4L7K A;  3OW2 2;  1US1 A;  2P38 A;  3DY5 A;  4ZM8 A;  1VQ9 3;  1V57 A;  3STD A;  1YGW A;  1GS3 A;  1NNV A;  4U13 A;  3NM7 A;  2OTL 3;  7GSP A;  4FMA A;  3CCM 3;  4AKZ A;  1OHS A;  4RBN A;  1LOY A;  2IMJ A;  3AMO A;  4HKV B;  1Q40 A;  2OQE A;  2KF6 A;  1VQN 3;  2CFK A;  1UI7 A;  1ZGX A;  1OF5 A;  3KZT A;  4N6L A;  1VQ5 3;  1LQG C;  2JDI H;  3ER7 A;  1MOL A;  1BRN L;  3NUV A;  1TTO A;  3CCQ 3;  1K8A 4;  1JBR A;  3CNX A;  2CWT A;  4RNT A;  1NDO B;  1UUG B;  2O9U X;  4N6M A;  3CCV 3;  4O3V A;  2YX9 A;  2OQE C;  3DGL A;  3NQY A;  5IG4 A;  5EVH A;  5KP1 A;  3NQZ A;  3CNM A;  4K1U A;  7STD A;  1KSI A;  1Q40 B;  3DXO A;  4LYL B;  3HOH A;  3LTC A;  1TRP A;  1TUH A;  2HMJ B;  4K61 A;  1CEW I;  4N6O B;  4ILF A;  3WA2 X;  3BLZ A;  4BL3 A;  4MMY B;  1BNR A;  2XSH B;  3J7Y d;  3AGO A;  1DVC A;  4EXR A;  1GY6 A;  3CC2 3;  1TJD A;  2F4Y A;  4JF8 A;  2GU1 A;  5CF2 A;  4O8S A;  4O2H A;  1VQQ A;  2RGQ A;  1GMQ A;  5CXO A;  5LC7 A;  4JRF A;  1OGZ A;  3MHE A;  1DE3 A;  1BSB A;  4EV5 A;  1IK3 A;  4L8P A;  4STD A;  5IG0 A;  1N5H A;  3NBR A;  4MMZ B;  3EJV A;  1VQL 3;  1MGW A;  2CKF B;  4WHA A;  2W03 A;  1FUT A;  3A5E A;  4NHF A;  3KFQ C;  1IV7 A;  4HM0 B;  5D81 A;  2XGN A;  2W2C A;  3DUK A;  1JZO A;  2GBW B;  3NV0 A;  1IVU A;  2HMK B;  2WGO A;  3I56 3;  3JUN A;  1B2Z A;  1IV9 A;  3G71 3;  1GSP A;  3FZW A;  3GZY B;  2C4B A;  2YFJ B;  2BIR A;  1AVL A;  3IPT A;  1OF5 B;  3Q2P A;  1M1K 4;  1K73 4;  4O02 B;  3CCL 3;  1L5G B;  4CCV A;  5KP3 A;  2XF3 A;  3VGN A;  3FLJ A;  5JPU A;  2B24 B;  2GU3 A;  3GZR A;  4KFD A;  3UNL A;  1RGF A;  4HM3 B;  3JVC A;  1RTU A;  4NRE A;  3HI7 A;  3RNT A;  1BUQ A;  3BNB A;  1TIJ A;  3LH4 A;  3NBB A;  5AII A;  1BRS A;  1PY3 A;  2CX0 A;  2W9Q A;  1N9J A;  2BMR B;  3MG1 A;  1W4N A;  1GOU A;  4HOH A;  1IU7 A;  1FGO A;  3CU3 A;  4ORL A;  1C7H A;  2KF3 A;  2E2V A;  5M1A A;  1GD3 A;  3KKG A;  2GBX B;  2OOV C;  1T2H A;  1DMM A;  4I5Q A;  1TFK A;  2Z6B A;  1EA2 A;  1G96 A;  1HYF A;  1OGX A;  1BRH A;  2F98 A;  4FR9 A;  3SVA A;  4FCJ A;  2RCD A;  3SED A;  3BND A;  1JJ2 2;  2JQ5 A;  3WMD A;  2J8X B;  1RJO A;  3OX9 A;  5D82 A;  1RNB A;  1VQ6 3;  3ZFZ A;  1FUS A;  1E97 A;  3GZX B;  3LOY A;  1YJN 3;  1C54 A;  1S72 3;  1UCL A;  2XFT A;  3WOD G;  3FG3 A;  1RKY A;  1FYS A;  1TFO A;  2ML6 A;  3SXX A;  1AY7 A;  3PGB A;  3KII A;  3SOA A;  4J5K A;  3F7S A;  1SAR A;  4LMI A;  1IVX A;  3S5C A;  2L4V A;  3SOY A;  3EF8 A;  2KF4 A;  3EHC A;  4XBT A;  4BU4 A;  2F86 B;  4X2H A;  4KFF A;  1I2G A;  1M90 4;  3DGN A;  3FG4 A;  3DZL A;  4HZ9 B;  1BAN A;  5IW9 A;  5I97 A;  2OOV A;  3MKI A;  1N8R 4;  4R80 A;  4MEI A;  3OWU A;  3EBT A;  3MG2 A;  2H0I A;  1QVF 2;  1UGH I;  5CF1 A;  1EQK A;  5G2G A;  4N6U A;  5EQL A;  1Y4K A;  2HOH A;  1BRJ A;  3D9R A;  3EQQ B;  1O7H B;  3GZB A;  1STD A;  4GHO A;  1W2Z A;  4J9A A;  3URP A;  2IYJ A;  3PXM A;  2K54 A;  1UW1 A;  2XSO B;  1JNQ A;  3DH2 A;  2RFR A;  1WMP A;  1D6Y A;  1R4Y A;  2HML B;  5D83 A;  4J8T A;  1B20 A;  2BHM A;  1BNS A;  1N8Q A;  1B2M A;  3SX1 A;  1IQX A;  1LOV A;  1SIH A;  1JV2 B;  2INX A;  3VSY A;  2Z77 A;  1RN1 A;  1JB2 A;  1KQS 2;  1CYV A;  3F9S A;  4GB5 A;  5RNT A;  4FCZ A;  1FGQ A;  5STD A;  4XDW A;  1D6Z A;  1STF I;  2C11 A;  4KFE A;  4RZM A;  5ELU A;  1QAL A;  5AI1 A;  5AYS C;  3CC7 3;  2A15 A;  4RNZ A;  3WA3 A;  4N6T A;  1ROA A;  3EE1 A;  4G1M B;  4IIA A;  5KP4 A;  1TRQ A;  1K41 A;  1RCL A;  1LRA A;  2P09 A;  3U1W A;  5BXQ A;  1U5O A;  4X2O A;  1LOW A;  1YJW 3;  1JB4 A;  2M7O A;  4CDL A;  1IT7 A;  3CMA 3;  1LVN A;  2RSX A;  1O7N B;  5AIF A;  1BU4 A;  1W6G A;  4AEQ A;  6GSP A;  3EX9 A;  3SYU A;  2WOF A;  3AHS A;  3HX8 A;  2L1S A;  1RSN A;  3K9M C;  1Q86 4;  1M9G A;  2OCT A;  3E99 A;  2E2T A;  1IT8 A;  5AYR B;  5BU4 A;  3I0Y A;  1FA3 A;  2BMO B;  5IG3 A;  1KD1 4;  1YIJ 3;  4GL6 A;  1LQM B;  1VQ7 3;  1O7P B;  4Q53 A;  3UB1 A;  4HYZ A;  2CFD A;  3B8L A;  3MSO A;  1CH0 A;  1EUI C;  3F8H A;  3KSE D;  4H3U A;  1HU9 A;  4FMD A;  1K9M 4;  1WMO A;  1GMR A;  3EC9 A;  1BRG A;  2PZV A;  3NXJ A;  2CG1 A;  7RNT A;  1FW7 A;  1QAF A;  4HM7 B;  3MWZ A;  3CME 3;  1RNT A;  1MWS A;  1WMN A;  2KAA A;  3AMO B;  4WFO A;  1X1W A;  1W5Z A;  1X1U A;  3LTA A;  3LML A;  4N3V A;  3B7C A;  3X42 A;  2ZHX B;  1RGH A;  2F5M A;  3B4O A;  3NX0 A;  1PYL A;  3QK9 A;  1W02 A;  1RGA A;  2GXF A;  1NJI 4;  3O8Y A;  2GEX A;  4BTX A;  4EBG A;  1KC8 4;  3FF0 A;  1NO3 A;  1BRK A;  1JKG B;  2KRT A;  1W6C A;  3ECF A;  2D42 A;  3K7C A;  1DMQ A;  2F56 A;  3ALA A;  5JBS A;  1BSE A;  3G0K A;  1WTH A;  1SII A;  2F5W A;  3CXC 2;  3JUM A;  9RNT A;  1SJW A;  3F7X A;  3Q1C A;  3QRD A;  4NPB A;  2ZA4 A;  3S28 A;  6RNT A;  3CC4 3;  1G0T A;  1BRI A;  1UI8 A;  1S5A A;  3JUO A;  1I2E A;  4KVH A;  3RDE A;  1W6Y A;  1PU4 A;  1B2S A;  2R41 A;  1MWT A;  4CPK A;  5IEP A;  3IJE B;  2CW9 A;  3V99 A;  3G4S 3;  5IEN A;  3PS8 A;  1R4C A;  2BT3 A;  4WWU C;  2MC8 A;  2C10 A;  2IA7 A;  1SPU A;  2LQV A;  2P05 A;  1D6U A;  3ZG5 A;  1JN5 A;  2PNC A;  4FCM A;  1AV4 A;  2IUK A;  1O7G B;  4AKY A;  3WDG B;  2P0M A;  2Y73 A;  3D4A A;  1IQ8 A;  1RCK A;  1ROV A;  1Q82 4;  1JKG A;  2FGT A;  1A67 A;  2B1X B;  1ZO2 A;  2LYX A;  2WGQ A;  4FMC A;  1I2F A;  1DET A;  2W6J H;  3KE7 A;  4LEH A;  3MG3 A;  2W9P A;  3Q90 A;  5FGO A;  1Q81 4;  1VQ4 3;  1F8N A;  3T0U A;  4CJN A;  1RGC A;  3CCE 3;  1AVK A;  3FGY A;  4L8O A;  1VQO 3;  2QGU A;  3JUQ A;  1Z1S A;  2QEX 3;  1UCI A;  1JN5 B;  1MWU A;  2BMQ B;  5A0O B;  3LXU X;  2XRX B;  1JBS A;  2H0G A;  2WO0 A;  2CIU A;  4I4K A;  3LZA A;  1I0V A;  1NB3 I;  1SQW A;  4GSP A;  3D5G A;  4OVM A;  2IUJ A;  3UL5 A;  5IF6 A;  2RBI A;  1T2I A;  4IT7 A;  6STD A;  3K0Z A;  1RLS A;  4MJD A;  1RGE A;  2K0M A;  5DRV A;  3LT9 A;  4LSO A;  1A2P A;  1V58 A;  1O7W B;  5BIR A;  4BL2 A;  4TX4 A;  3LTD A;  4XBX A;  2GSP A;  1YVS A;  1E3R A;  1I70 A;  1Q9E A;  1V74 A;  5DRE A;  1RN7 A;  3SLU A;  3RGR A;  1QAK A;  3FG1 A;  1JRQ A;  5AIG A;  1T5Y A;  4OUQ A;  1CQS A;  3WOF B;  1VQK 3;  1JZD A;  5HGR A;  3DMC A;  3GSP A;  1YVB I;  2CFG A;  1WQL B;  1FGT A;  1BSC A;  3EN8 A;  3GRD A;  3BB9 A;  4XDV A;  2QA4 3;  3G8Z A;  5TGN A;  3NBJ A;  1X1Y A;  3TDG A;  1BGS A;  2AAE A;  2ZDJ A;  1K28 A;  1Q42 A;  1VQP 3;  3LYG A;  1OCV A;  1W2B 2;  3HIG A;  1BUJ A;  1IVW A;  2KF5 A;  3BU4 A;  1BNE A;  2AAD A;  2IY2 A;  3WOE B;  2FNQ A;  4HZB B;  2GEY A;  3UJM A;  1UUV B;  3EB8 A;  4HVN A;  1UGI A;  2UUG C;  3T8N A;  3HK4 A;  4EC6 A;  1BOX A;  1DMN A;  3G6E 3;  1NWW A;  2XFS A;  2XEP A;  4N6N B;  1OH0 A;  1Q7H A;  1RRH A;  3JUP A;  2E2U A;  1QMA A;  1ZS7 A;  3DGY A;  3BIR A;  1MNL A;  1B21 A;  1O7M B;  1UDI I;  2UGI A;  3PYJ A;  3S29 A;  3WR2 A;  1FGR A;  3OWS A;  1I0X A;  3S27 A;  5GSP A;  2CC3 A;  1MWR A;  2R4I A;  1AQZ A; 
#chains in the Genus database with same CATH homology
 2BU4 A;  2KF3 A;  1X1W A;  1X1U A;  3Q3F A;  1RGK A;  1T2H A;  1RGH A;  1HYF A;  1RGL A;  2F5M A;  1BRH A;  5GSP A;  1BNG A;  1B2U A;  1PYL A;  1FZU A;  1RGA A;  1GMP A;  3AHW A;  4J5G A;  1RNB A;  1BSA A;  1BIR A;  1BRK A;  1FUS A;  1IYY A;  1C54 A;  3WHO A;  2F56 A;  1UCL A;  1BSE A;  1FYS A;  2F5W A;  1AY7 A;  1UCK A;  4J5K A;  9RNT A;  4BIR A;  1SAR A;  2ZA4 A;  1X1X A;  3D5I A;  6RNT A;  2KF4 A;  4BU4 A;  1BRI A;  8RNT A;  1RDS A;  1I2G A;  1I2E A;  1B3S A;  1B2S A;  1BAN A;  3AGN A;  1YGW A;  1RGG A;  3KCH A;  7GSP A;  1LOY A;  1I8V A;  2KF6 A;  2HOH A;  1BRJ A;  3D4A A;  1RCK A;  1ZGX A;  4GHO A;  3URP A;  1BRN L;  1TTO A;  1HZ1 A;  1JBR A;  1I2F A;  1DET A;  3DH2 A;  4RNT A;  1UCJ A;  1RHL A;  1R4Y A;  1MGR A;  1B20 A;  1RGC A;  1BNS A;  1B2M A;  1LOV A;  1UCI A;  2RNT A;  1LNI A;  1RN1 A;  1BNF A;  3HOH A;  1JBS A;  1TRP A;  1B2X A;  5RNT A;  1I0V A;  4GSP A;  3D5G A;  1BNR A;  2RBI A;  1T2I A;  3AGO A;  1RLS A;  2F4Y A;  1RGE A;  1B27 A;  1A2P A;  1GMQ A;  5BIR A;  1TRQ A;  1RCL A;  1DE3 A;  1LRA A;  1BSB A;  1RN4 A;  2GSP A;  1YVS A;  1I70 A;  1Q9E A;  1LOW A;  1BNJ A;  1MGW A;  1RMS A;  6GSP A;  1BU4 A;  3GSP A;  1GOY A;  1FUT A;  3SYU A;  3A5E A;  1BNI A;  1YNV X;  1BVI A;  3AHS A;  1BSC A;  1RSN A;  5BU4 A;  1B2Z A;  1BSD A;  1GOV A;  1X1Y A;  1BGS A;  2AAE A;  1GSP A;  1BUJ A;  2C4B A;  2BIR A;  2KF5 A;  3BU4 A;  1BNE A;  2AAD A;  1G02 A;  1I3F A;  4HAA A;  1CH0 A;  1BOX A;  1I3I A;  1RGF A;  1RTU A;  1GMR A;  2SAR A;  3RNT A;  1BRG A;  3DGY A;  7RNT A;  1JBT A;  3BIR A;  1B21 A;  1FW7 A;  5HOH A;  3WR2 A;  1RNT A;  1BRS A;  1PY3 A;  2KAA A;  1I0X A;  4HOH A;  1GOU A;  1BAO A;  1AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...