1SAUA

The gamma subunit of the dissimilatory sulfite reductase (dsrc) from archaeoglobus fulgidus at 1.1 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
114
structure length
114
Chain Sequence
PELEVKGKKLRLDEDGFLQDWEEWDEEVAEALAKDTRFSPQPIELTEEHWKIIRYLRDYFIKYGVAPPVRMLVKHCKKEVRPDCNLQYIYKLFPQGPAKDACRIAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sulfite reductase, desulfoviridin-type subunit gamma
publication title Determination of a novel structure by a combination of long-wavelength sulfur phasing and radiation-damage-induced phasing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 41
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1sauA02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1sauA01
1YX3A 1JI8A 2V4JC 1SAUA 2XSJC 3OR1C 3OR2C 2A5WA
chains in the Genus database with same CATH superfamily
1WH5A 4ASNA 2XAHA 2MH2A 1ON1A 4IOAF 4S0HB 3G2BA 5HNFA 4XQFA 5JHUA 2JJ7A 1WH7A 1MSFC 1J75A 2QM3A 4RDUA 3A4CA 4XSXF 2A3SA 4KDPA 2V6EA 5K5OA 3MFKA 2CQNA 2IXSA 3A2KA 1XGSA 3FK6A 2R7SA 1RUNA 1G59A 3AL0C 1LVKA 2XF5A 1AKHB 4RA2A 2ZJPF 4JX4A 1JE8A 5FKMA 1LB2A 2ZFWA 3B73A 3LSTA 2QUFA 4RAGA 1MMAA 2G7UA 3KP3A 1YJ9I 4G9YA 3ZXSA 1SFUA 1FZPB 2DJIA 2L54A 4NC6A 4II3A 3K4MA 4P96A 4AVPA 5EGOB 3CJTB 4BUPA 3VDXA 3PJRA 5KAIC 2DPUA 5TGTA 4PFOA 3H9GA 2OU2A 1AU7A 3S17J 3ABTA 3P9IA 4C2TA 4CSWA 5HDNA 2KJCA 5JR3A 4M9ZA 5C44J 3BTJA 4ESFA 4DYQA 1B72A 1LJ9A 4I7HA 2XASA 1XDUA 2K4BA 4JYKA 5E1ZB 3RDIA 1H89C 3OYNA 3BCBA 2ESNA 1WI9A 1Y1WJ 3I55I 4RAYA 2RAEA 4ZH4F 1WJAA 2AHQA 4GXOA 4U0VA 1RRJA 5LGUA 2VJ4A 3S1MJ 3SXYA 2JTVA 2FA5A 4W97A 1POGA 3LSRA 3HKZA 3QYEA 1SD7A 3LL7A 5IYCJ 1JT0A 4Y52J 2DA5A 3H92A 3K4JA 5CVIA 3IAS2 4XRMA 1W7PA 3LAJA 3B02A 5LEKA 4MTDA 3QPHA 5CVRA 3SYTA 4RGSA 3KEYA 3MCZA 1DU0A 3ELKA 2BY1A 5FKLA 4Y13A 3KZYA 3CP8A 5D5UB 1UHMA 3LFUA 3HOSA 2IGMA 1USSA 4XK4A 3A01B 3BPVA 4M9XA 1ZLKA 2CUZA 2EFPA 4B44A 4GCVA 1KONA 4LIVA 2OBPA 3MKZA 3CO6C 2HNHA 2LREA 4I0BA 5ILUA 4IX7A 3B6CA 2R5YA 2G7HA 3ZMSA 2GQQA 2LK2A 4MQVA 3ZN0A 4LK0F 5ED4A 2ZNYA 1J5YA 3NAUA 4YG2F 4ZDOA 3MKWB 3FXJA 1RETA 1F36A 5F1RA 4MGRA 4DYCA 3F6OA 2OPTA 1JUPA 3QAHA 3BQYA 1SC7A 2KRCA 3C2BA 2QEXI 3K9TA 3TW6A 5DUKA 2GZWA 3C3WA 2FMLA 3F3XA 2UV1A 1VF9A 3WU2C 2ISYA 4C3IJ 1APLC 1MGTA 1R58A 1XD7A 3BJAA 2ZXIA 3FXMA 4XICA 2GA2A 5HOOA 4PDKA 3FXLA 4KUMA 1AKHA 4IVNA 1FTZA 4JBAA 1H88C 1S3JA 2E34A 4C2UA 5IT9K 1TWAJ 5FKNA 2VI6A 3FISA 1UCRA 4ABZA 1U5TB 1Y0UA 4V2FA 3S2DJ 3GW2A 1KU2A 2WV0A 1JKPC 3ZN1A 4KIGA 1XMXA 1TWCJ 1TBXA 3ONQA 4AU7A 5EGOA 1U78A 3G4SI 1A04A 2ETHA 4EJTA 1DP3A 2H6BA 5M3MJ 3S3NA 2MC3A 5ICFA 4ENKA 1Q1HA 5D4RA 1OR7A 1LUJB 3RKWA 5FLMJ 1R00A 1HW2A 4BEHA 4BBSJ 1XC5A 2KJBA 5GAHJ 3HBLA 2V1NA 2W00A 1X2NA 1PUFA 4A3BJ 3K70D 1S29A 4KIBA 5GPCA 1IF1A 4PGHA 4IXAA 4RLQA 1LQ1A 1ZQ3P 4PUSA 3W6KB 2M3AA 2E1OA 3HEFA 1KQ9A 2GXGA 2L9SA 3UKGA 2QBYB 2F4MB 1LE8B 3LSIA 4XOPA 4BQQA 4P1WA 2KDZA 2BYVE 5IY5H 1Y6IA 5F27A 2EFWA 1TQIA 3IH2A 1I6XA 2V7FA 2IRFG 2FMYA 3CMYA 3TDZC 1S7OA 2O03A 2MBFA 2JMWA 3HOVJ 2CV1A 1VZ0A 3GFJA 3GTPJ 1SFEA 3ZQFA 1D1BA 2L01A 3BZ6A 1QVTA 4Y3OA 3J7ZI 1O57A 3A01A 2DO7A 2RGVA 1MBJA 5K1YA 1TW2A 3DTEA 1ZG1A 5LRRA 3L2QA 1GDTA 1GV5A 3CCLI 3IWFA 5IT9Z 1REPC 2L9VA 4WF2A 4F91B 1STZA 4UHTA 1F4KA 2JUCA 4N4NB 1WGXA 3H3VK 2XB0X 2E2IJ 1BW5A 3A03A 2JPCA 2DLLA 4D7NA 1YS6A 3MMYB 1XSVA 3WG9A 4GDFA 4PZJA 4MHGA 2WAQN 1Z9CA 1ETKA 2F2EA 2DI3A 5FLXK 4IKFA 3LA3A 2Z33A 2RDPA 3HOUJ 1JJ8C 1BI0A 1T38A 4G12A 2X1CA 3O3KA 1P9QC 4FHTA 1XCBA 4L9VA 1MDMB 1ZRDA 4X6AJ 3EPZA 3KEOA 1HW5A 2L02A 2VPRA 4HEA2 1T98A 4M72A 4CYCB 2H27A 1MMNA 3GFMA 2X85A 3GLLA 4KN7X 4U7DA 1SFKA 2LDUA 1XCVA 2FBHA 3WTWC 2A07F 3V7RA 2VE8A 4DOZA 4IO9F 4I2OA 3S3MA 1B8IB 4EQQA 1KU9A 2LBFA 1R9TJ 1UHWA 2R7ZJ 4DW6A 1OLTA 2W48A 2NVTJ 2DT6A 5DCMB 2BY2A 2CU7A 1FSHA 2FUG2 3A0HC 3E1SA 3JTGA 1JHFA 3HUGA 2OCCH 1IZ1A 3VPRA 2FJ1A 1IUYA 2XB5A 4M3GA 1YQAA 1OFCX 2V9VA 2VOPA 3EUHA 2OTJI 3TBIA 3N05A 4MIMA 4JOMA 5DM6F 4A3DJ 2K3PA 2Q1ZB 2Z9OA 1OKRA 1WZ2A 1X2MA 3PQJA 1XMAA 1TP4A 3CZ6A 3F8BA 1QA6A 4ZTJA 1X1PA 4II2A 3HTUA 5J4YA 4XORA 3M9AA 3OIPA 3DF8A 2P6SA 3ZQCA 3S32A 3OYKA 2IGKA 1U0JA 3V8LA 4ENMA 2GBYA 3MAJA 4HNVA 2QBYA 2Y0SA 4C3HJ 1LE8A 3DBHB 3RPUA 5FLXZ 2XPVA 5FB2A 2PQ8A 2X1EA 1GXPA 1FIAA 1T0FA 3U2RA 5D5XB 1HKSA 4CCNA 4Y4RA 2A5YB 1T39A 2DA2A 5CQGA 3OL4A 4M74A 5TJJA 4HZFA 1S8NA 1ZYRF 2HU9A 1ZAOA 2GAUA 5KVRA 2FXAA 3AG3H 4IQ4A 4GFBA 1Z7LA 2WAEA 5EEAA 2NOGA 3BC8A 2VKVA 3HGGA 4D9JA 4LD5A 3BG3A 3BJOA 1WRJA 2L7KA 3P9CA 1G8XA 5JVGF 3HRMA 1BL0A 4OIOF 4EM1A 1KZHA 4BE0A 4OU0A 2HVSA 2FRHA 2UWMA 2VJ5A 1S7AA 2XKPA 2YU3A 5KHDA 1IAWA 1NH3A 1I27A 2X6WA 1U8BA 4A69C 4NBQA 2COBA 4HF0A 4Q47A 1B6AA 1A5JA 4YRVA 1LEBA 4HDVA 3ZQLA 1NTCA 2VLAA 3DEUA 2IT0A 1MDMA 3M1EA 3RJPA 1BC7C 2M5WA 3RYRA 1RIOH 4CYCA 5JVTA 4IHSA 3BR0A 4JP0A 3JCUC 1YW9A 2G9WA 2QWWA 2GIVA 2H09A 1Y8QB 3OYHA 2R92J 4UVBA 5E79C 1K6OA 2F48A 5HNHA 2HWVA 2Z3YA 2ZSHB 2WAQA 2E5NA 2ZXJA 1LFBA 3LOCA 1W4MA 1T33A 2MABA 2RKHA 2DFHA 3OMYA 5J40A 1W36D 5DCMA 3I54A 2AXLA 2ZBKA 3DPTA 2BY0A 3Q9SA 4EM0B 4PJJA 3IH4A 1MH4A 3OV8A 5E8IA 5E1XA 1C0WA 2JUGA 1Y8RB 2DCEA 1PUEE 2RQQA 2DFEA 2WADA 3S1NJ 2XDVA 2IS1A 5K5RA 4D5CA 4E7SA 3WGHA 1FYMA 4HV6A 1X3UA 3HM5A 4OOIA 4LLLA 4L18B 3TW7A 3ABKH 2R5ZB 4FQGA 2DTRA 4XSZF 2HKOA 2EH3A 1MMDA 5LGTA 3J80K 2GLOA 4F55A 3I3LA 4A0ZA 1B1BA 1IXRC 3IAM2 1OMIA 1BOBA 2LVSA 2FEZA 3BP8A 2WC2A 4R1HA 2ADUA 4ZYHA 2K9LA 3GLXA 3M8FA 2R7UA 2R7DA 3GZ5A 2Y30A 5FGMA 5IYBJ 2DFFA 3E6DA 4IHXA 4KICA 1N78A 1W0TA 1G3YA 3HOWJ 2EIJH 4OMYA 1FMVA 1SFOJ 3ASOH 1FOXA 3SEQA 4HQEA 4J01A 2K9SA 3SDGA 1MMSA 5HLGA 3S8PA 4GYIA 2YX4A 2WV1A 3FMQA 1MNMC 1Z3XA 4YIIA 5H20A 1A35A 5J4VA 1OCOH 2IA1A 4BS9A 2XKOA 3NWTA 2L4AA 2EB7A 2XAUA 5FFXA 1QZZA 1LDKB 3HC7A 1YRNA 4DYRA 3IWZA 1AA7A 2R7QA 3MZHA 1A36A 3OYBA 4J00A 4B3AA 1VQ6I 1G3WA 1D8JA 2W1OA 5HLHA 2YPRA 1DUXC 3GXOA 1B59A 3DLAA 5IP7J 4WX9A 3SJMA 3PO3J 5FKOA 4U0YA 3OL3A 3FK7A 4MFEA 3ERED 3MQ0A 1FMWA 4FCYA 3CCVI 4RB2C 3OYEA 2WY8Q 2VJIA 1YW8A 3DCFA 4RGUA 2WBMA 1P4XA 2CQ7A 1D0XA 2O8KA 3HRSA 4PJNA 2DJNA 3WU0A 3CCQI 4NQWA 1PJRA 2Z16A 2BHYA 4ZYGA 3BR2A 3K4NA 3OS1A 4P5OA 1HBXG 4ZZLA 4BYYA 3FMSA 1U9OA 4G6QA 1DPRA 4FX4A 1OR7C 3ABLH 4XL9A 1SEUA 3EUAA 1RR7A 1I3QJ 3FF5A 2GIZA 4G6DA 2P81A 2QA4I 1SAUA 2KZGA 2MGQA 2ZO4A 3IUOA 2K3FA 3T5XA 2HOTA 4N9HA 2CMPA 1ZHFA 5ICCA 2HYJA 4G6TB 3LSPA 2V9PA 4GO1A 2VBWA 1W0UA 4CICA 2LR8A 4HAMA 4CXFA 3JSPA 3CMAI 2X4HA 2JVGA 4PJLA 2OC6A 1YIJI 2VT2A 1X4OA 3GTMJ 2JA6J 3ECOA 5DS9A 1WJFA 3RKYA 2W25A 3WGIA 3OR2C 3TMOA 5D8LB 2Z1DA 4IL6C 3F0CA 2R5ZA 1W7PB 4BHBA 3CDIA 4MTEA 4CCJA 3BQZA 1JTYA 2Y31A 5J3LA 2PI0A 3K1NA 2XPUA 1R6RA 3QODA 1I50J 1LKXA 4BNCA 4O3MA 3GZ6A 2F5DA 2H8RA 4MQ9F 1UHSA 4XN3A 3F23A 1BI1A 2DOEA 1G2HA 2JA8J 2R7VA 2IBDA 3QPTA 2RVCA 4UY8I 1JUSA 1D5VA 5EEHA 1MJAA 1MZBA 3LSKA 2B9SA 1V3FA 3R0JA 2QENA 3VSKA 2R5YB 1WQ2A 2LFBA 4DNCA 1FTTA 5FD5A 2IGOA 3MZ8A 2EZKA 4YEJA 1ZR2A 2CQKA 3QOPA 1Y0NA 2Z5UA 1IV8A 2TRTA 5LHGA 1FPQA 1G3TA 1WKMA 3ASNH 1U3EM 1OISA 4XLHA 3E7LA 2GM4A 4Q48A 5DD8A 3TKYA 4CH7A 1FYLA 1TZLA 1ZK8A 4O6JA 1IRZA 1YFHA 4BXUA 3VFZA 3CJNA 3F6VA 2VB6A 3SFZA 3G1OA 3BROA 2VPLA 2ZMEC 1RZ4A 5D5WB 2XGDA 1Z77A 2MFZA 3QP6A 3H3ZA 2R4GA 4HNUA 5HS7A 2A5WA 3E6BA 2PMZA 1ZELA 2VE9A 3GTJJ 3HDDA 3K0LA 1BOAA 2NVYJ 1U5TC 2UXXA 3DPUA 2M4KA 2NNYA 2DDBA 4A6DA 3T1BA 2R0QC 1VQLI 4PK4A 1TWHJ 2M0MA 1TNSA 1XX5A 2XSDC 1MMGA 5M3FJ 2V79A 5L3DA 4BDZA 4HNTA 5B1AH 1TTYA 2B63J 1ZRCA 1CF7B 1E3OC 5J8FA 4C2MJ 2K5CA 4HQMA 2I8DA 2F5FA 2PN6A 2M7BA 2GXAA 5M5YJ 3WGGA 3RKQA 4CHUA 4LITA 4QSHA 1R23A 4O5VA 3KETA 2IA2A 1BC8C 4BEHB 2W84A 5ILSA 4I99C 4ZYEA 1BM9A 5CYVA 2OCEA 1PUFB 5LD2C 2CH0A 3E5QA 3MN2A 3T8TA 1K6YA 1K4SA 1L3LA 3GEZA 3TP0A 3VYUB 4HV5A 4YIRX 4MNUA 3QQAA 1YOVB 2BVMA 1VQ9I 2PMUA 3OS2A 1SD4A 1S72I 3TQNA 4M6YA 2OQGA 1ERDA 4B4CA 2P7CB 4NNJA 1DGRM 4CCOA 5EJCA 3P7NA 3C7JA 3WTVC 2C6YA 1HF0A 5CKTA 2HGCA 2MD5A 4U0WA 1JT6A 2LY9A 3CJRB 3NWSA 2BVLA 4PCQA 1GUUA 2NS8A 1S6LA 3ABUA 5LBQA 3DLLF 3V8JA 2PEXA 3GO5A 2BHZA 2JRTA 2IS4A 1HCRA 1GXQA 2M7AA 3KX2A 3LMMA 1BBYA 4LLGF 2CRGA 1TW3A 3ZPLA 4N4OB 5IYDJ 1HW1A 2HYGD 2P0WA 2P6TA 4PSWA 4ZZDA 5BQTA 1YHQI 4XR6A 2DT5A 2L2OA 3KYCB 3R0AA 2HXIA 3CLOA 2BY3A 2W7NA 4ZTFA 2HZTA 2NYXA 4ZDLA 1DQUA 2EA2A 2WB1N 2OZUA 4IZZA 4UXNA 2DA3A 3UR3C 3CCJI 4HLXA 1P2FA 5FFZA 3CESA 2XGXA 2HTJA 2VBXA 1ODDA 2QYOA 2NRAC 2GWRA 4WXHA 4WXDA 4ANJA 2EFQA 1U9NA 3FHZA 1ETXA 1N25A 1OCRH 3M7GA 3RPQA 2LKXA 3O2PE 2CUFA 4OMZA 5KK1A 5DUIA 5B5EC 1DP7P 2MYSA 4L5IA 1FWZA 3BG5A 3OYDA 3I4NJ 4ZC3A 2F6CA 3GFLA 1YITI 5DCFA 2P5LC 1JKOC 5ERIA 3DBRB 4I98B 5HDGA 1PDNC 4Y7NJ 2G0EA 2DMNA 5KCMA 2ESHA 5J1YA 4FT8A 2CGPA 1JGGA 3HPHA 2HXOA 3UNGC 4LLNA 5HS9A 1CQTA 4CUGA 2JRMA 4AUXA 2LBFB 4G94A 2OV7A 4BHCA 4XONA 1FBQA 2KL4A 2CYYA 1N75A 4Q4ZF 1DU6A 5BPDA 4AC0A 2XRLA 3HUGB 3PUBA 5GADJ 1F43A 1XGNA 2K85A 5A2QK 3IP4B 1CF7A 4BACA 5LHHA 4JQFA 1UG0A 2LMDA 2M30A 2K9NA 2O5RA 1YI2I 3EETA 5GPAA 3FIWA 3JRIA 3F72A 4AIHA 4F93B 4UUSB 2JQ7A 1X19A 4B3XA 3BG9A 2Y69H 1OYYA 3LA7A 4FE4A 2OF7A 4WXCA 2V4JC 4UVAA 3FX3A 3WHCA 2EA4A 1TC3C 2VC1A 3CC2I 2XROA 4F52A 2KRHA 2VBZA 2E60A 1MNDA 2KDOA 3K2AA 4EATA 4B48A 3RI4A 4BU2A 3S2HJ 3TO6A 3HOZJ 4A5NA 2EZLA 5F0FA 2EV6A 4LFUA 2CUEA 1R4NB 5KNLA 2R7FA 3M3YJ 1ETVA 2A6TA 1BW6A 2ZB9A 1VQ5I 2ELHA 4RAZA 2CW0F 1IW7F 3RSNA 2CV0A 2HOAA 1YLFA 3DWLE 4QLCU 3CUQB 3OYJA 3ML6A 2VQGA 1YIOA 3M8JA 4H0EA 3H5NA 2VODA 2W24A 5F0HA 1QZEA 3ZQ7A 1SVLA 2E1MC 3L2UA 1K7AA 5IOZA 2OA4A 1V5FA 1O3RA 2HTSA 4NC8A 3H5RA 4IEJA 4HG2A 3HSRA 1JJ6C 2E35A 2VJJA 3TL4X 1FIPA 2X51A 3S3OA 2JK3A 5FO5A 2XAJA 2H94A 3GTOJ 2Z2SB 5A2QZ 4L0ZB 5FLVA 2YU9J 2ZJ2A 1FOWA 1RESA 1WJ5A 3OIOA 5HLTA 2EIMH 4F3QA 5DTDA 3V4GA 1XG1A 2I10A 2STWA 1O7FA 1T6SA 2M1BA 4B8XA 1WJCA 3S1QJ 3G3ZA 2Y75A 2O9LA 3OYGA 5K7ZA 3JRDA 4DZJA 4C9YA 3Q0VA 1L0OC 4FASD 2COMA 5CJ9A 4A3LJ 1FOKA 4Z6YA 3PFIA 1BI3A 3CO7C 1QQIA 2M9HA 1MBKA 1WHUA 3NARA 2Y9ZA 3ZOBA 2WB1A 3RQ4A 3HHGA 3DU5A 1ETWA 1X58A 2XUBA 1TT5B 3MVPA 1ZG3A 2RQPA 3J7YJ 2H1LA 2HPIA 4TV7A 3G73A 1USTA 2XRNA 2R7XA 1NK3P 3KYLA 1I3AA 4QTRA 3LWFA 2X48A 3WODF 2V1UA 3SEZA 3CTAA 1KYWA 3MKLA 2FF4A 1EH8A 1SMYF 3KLOA 2HVQA 2JWTA 1JHHA 3KP7A 4A0XA 3CUOA 2KIFA 1A31A 2K27A 2HQAA 4HX7A 5C3EJ 4JX5A 1A6IA 2QVOA 5EEGA 4UUSA 2WWYA 3OYLA 2D45A 1IG7A 1LFUP 3F8MA 3OIQA 3ZMTA 2LOOA 5E20A 4EJVA 2XIGA 2X6XA 1FX7A 3U1DA 2BXZA 3HRTA 4DGWB 1TWFJ 2PMHA 1DDNA 4ITVA 3G6EI 1EKEA 2FU4A 4Q5SF 2FQ3A 1R22A 1XDSA 5E3NA 3CCUI 4BBRJ 2UXNA 4RM3A 1FSEA 3H3UA 2A61A 4M6VA 3A1YA 1VI0A 2JPBA 2QCOA 2W85A 1D8KA 1MJ9A 2PBIA 2F4OB 4OIPF 5DDGA 1MW7A 3F9KA 3H9JA 5CVVA 2VUMJ 4XN0A 3BG6A 3ULQB 3GTLJ 1ZTRA 4A3GJ 3CUQA 2K40A 1H0MA 2H1KA 1X1DA 3PL8A 3NRVA 2UZKA 3A0BC 2HDWA 1ACIA 3TOAA 3I0TA 2DN0A 3FBIB 4IRGA 2JN6A 4X0GA 3ISPA 2QQAA 5BPIA 1BN5A 2D2WA 1ZRFA 2ZCWA 4RBOA 4QPQA 4Z2YA 3ZCOA 1IN5A 4I76A 1YRNB 2IEKA 2VQHA 2Y48A 2DQLA 4I09A 3ZMZA 4U88A 1MBGA 3Q5FA 3DU6A 3OWTA 4KFCA 4NDLA 1BIBA 3HSEA 4HX4A 3AKZA 5ICGA 2A6EF 1HKQA 5C4JJ 3ZQQA 2XSJC 5IOYA 3K4LA 1G3SA 1LDJA 4IPAA 4B43A 1R5HA 2O6GE 3BDDA 1MSEC 1OYIA 3IC7A 1X1BA 2YS9A 1ONVA 1QNTA 4AM3A 2EPFA 2K02A 1ENHA 4D7MA 1A6QA 2MH9A 5F08A 4NQWB 2W82A 4L9JA 3AG4H 4HW0A 5EDNA 4BJTA 1VQ8I 4M3FA 2PG4A 3V7CA 3D5SC 2JA5J 1O3SA 1Y39A 3KPHA 3E0JB 3GX4X 5LHIA 4E70A 3QP5A 4I02A 1S5LC 3W2VA 1VQMI 3K70C 2CV2A 2XF6A 2DPDA 3L9FA 2HFHA 3HGYA 1H9TA 1JXSA 3M1CA 5F64A 4IJAA 1D0YA 2KP6A 1R71A 4OINF 2IJLA 2M0CA 1X3WB 2EWNA 1EH7A 5HLIA 3LSHA 2KFDA 4A12A 5K5QA 4A2UA 1IC8A 2KZVA 1RUOA 2DK8A 2F5EA 4E7LA 2EFOA 2VIXA 3K69A 3GTGJ 3K1MA 1BA5A 2M8GX 2XV4S 3CCYA 2TDXA 4FX0A 2IS6A 2JT1A 5ICEA 1H8AC 4EMSA 2L3DA 1KA8A 3O6BB 3CF5F 2CS3A 2LF7A 3DTKA 4RB0A 1FYKA 4BE2A 2HDDA 3GVAA 4FISA 1G6NA 3RIRA 1P4AA 4OAZA 1K78B 4HA8A 3RQIA 5M5WJ 2HQNA 2MG4A 2YSRA 1V54H 3FM3A 2AS5F 1TT0A 2CQXA 2B7EA 2H6CA 1V5GA 1YO5C 3REOA 5HDKA 3ZMDA 5ILVA 3PQKA 2CW7A 2ZXWH 2K86A 4WK8F 4UV8A 2QSFX 3L2VA 5DM7F 4LK1F 2PJRA 4J19A 2XGEA 2IPQX 5D6EA 4A3FJ 3C18A 3V7SA 1SVMA 3QRFF 4E7JA 1SAXA 4BGDA 2O7OA 3VYTB 3WTTC 2V9KA 2CJJA 4H4KC 4XLAA 3I56I 1P4WA 3AAFA 3ESWB 4UUTA 2NS7A 2QQBA 2LTPA 2YX7A 2VONA 2MW8A 3KCCA 3ZGKA 3L2CA 3S15J 1FEXA 5L3FA 3LSMA 2KIUA 3DV8A 3WTYC 1OCCH 2DMTA 4G8XA 2D1HA 4XNFA 2K9MA 3K1PA 4B47A 1HA8A 2L9NA 1ORKA 1MH3A 4P9UA 5HODA 3SZPA 3GUDA 3RZDJ 2RNJA 2Q0OA 3M07A 4EV0A 4M3BA 1HXDA 2F5CA 4ON0A 3DKXA 4DBQA 1HC8A 2XAFA 3I4PA 5E3MA 1MKMA 1GLNA 3J81K 4ZJZA 1I6HJ 2EV5A 1OQYA 2BV6A 4MEXF 5AIPA 1I1SA 2E36A 2EZHA 1F1ZA 1WI3A 2HR3A 4IF4A 4N9IA 2D5VA 4RM2A 2NS0A 3CCSI 3J80Z 2W4SA 1W1WE 1T2KA 2OJED 2LP0A 2DQRA 3IHUA 3CC4I 5CVJA 3E97A 3HJEA 2DA1A 4A3EJ 1I39A 2Y2ZA 2X9DA 3ABMH 1RPWA 2VKHA 3VSLA 2Y9YA 1PP7U 1JUMA 3I5UA 5E17F 5D8KB 1QBJA 4A0YA 5B66C 3BOQA 1FT9A 1IN4A 3G71I 4RGXA 2HOSA 1D1AA 1OCZH 1X1AA 2EQRA 2F4IA 4S04A 2VT3A 4M3DA 4UVCA 1VQKI 5F0CA 3P9KA 2ZC2A 4CGZA 1NHAA 2KHMA 3E6CC 2ZSIB 4XRSG 1K78A 2JSPA 2KT0A 5CVUA 2TCTA 3WHBA 3S1RJ 1QU3A 3I59A 5CQEA 5LLQA 4EJUA 2N8GA 1FNNA 2FBKA 2DA6A 3GTKJ 3OOUA 3H0DA 2M34A 3CD6I 3GMEA 3OY9A 1BIAA 1V55H 4P55A 4PJ0C 4BH9A 2EFNA 5CLSA 4M73A 4CDGA 3D5LA 1KGSA 2XHKA 5JLXA 3CCMI 2CFXA 2LF8A 3BR3A 3GCMA 4XKVA 1ZREA 3R61A 3K4KA 1Z7UA 4Y17A 3J81Z 3EQLF 4XLNF 1YJNI 2DMPA 4OWRB 1IGNA 4NB5A 1QPMA 2CUJA 1HSTA 2KPMA 3DPLC 3JTHA 1K4TA 1HKTA 1UB9A 2NXNB 2XAGA 3Q9VA 4DZPA 5D6FA 2BW3B 5FROA 5D5VB 3GBGA 1GT0C 4PJMA 4LG0B 3E5XA 3C1DA 1B4AA 1PP8F 4UB8C 3TO7A 4BY7J 1X3ZB 3FZVA 4L0YB 4N0BA 1NG6A 4DIQA 1YYVA 5HVQC 2E7XA 2WAFA 3GYHX 2DAOA 3WTUC 2X0LA 4CZCA 1I5ZA 2D1VA 3BZKA 2FOKA 1Q1VA 1GHCA 3KLNA 3C2GA 1R5ID 1SMTA 1SVOA 2BE5F 2M2EA 1W36C 1HQCA 2OUMA 3LAPA 1IDYA 2YUSA 3OOPA 3QWLA 1LDDA 3NQOA 4I01A 2EJRA 3DEEA 3BWGA 3TDUC 1JKRC 2MSYA 1W5SA 4BQNA 4U7BA 4OIRF 2OTLI 1Z3YA 2QF7A 3PIPF 1O3QA 2LKSA 3FDYA 3S16J 3ZQGA 4KT6A 5EG0B 3FXOA 1SFXA 3Q0WA 5KAFC 3WG7H 1T95A 3EUHC 3ZQIA 2BEOA 3N4MA 4Y33A 3JSOA 5J1UA 3L2WA 4B09A 5E8GA 2R7TA 3LFKA 4HSRA 3ROUA 5GTIC 2X1DA 3JAMK 2DBBA 1Y56A 4XLCA 4XKBA 2L7FP 2ID3A 2QGUA 2EIKH 1UG2A 3I71A 2P5VA 2Q2EB 1OJLA 5CPRB 1W5CC 2AQEA 3FHNA 4LMYA 1TNTA 2ICWG 1Z91A 2IA0A 4JX6A 4BAYA 4KMFA 2E19A 4CA0A 1XN7A 1MD0A 3L2RA 4KITB 1BJAA 1HSJA 4A3IJ 1BR2A 1ON2A 2P5KA 2QQ9A 3QYBA 4WWCA 2ME6A 3LNQA 2WA0A 1XMKA 3GTQJ 1MJBA 1V5EA 2O0YA 2ZJRF 1WJDA 4V2GA 1T0FC 2EILH 2R3SA 3TOBA 2HOEA 2ECBA 2JZYA 3I4MJ 3F21A 1WCMJ 3CUQC 3VYRB 3H1CA 1Z21A 4MO7A 3JRCA 1J59A 1R1UA 4KT5C 5F04A 2DA7A 1EJ9A 2ZNZA 3HIFA 3K4BA 2XF7A 3GZNB 4WCGA 4XMYA 4BHPA 1WJEA 1YW7A 3DXJF 1FBUA 3F8NA 3WTZA 1QZYA 3TGNA 4E4HA 4A93J 2E7WA 3PNTA 3Q3SA 5B1BH 2NNNA 4HDUA 1OPCA 2ELKA 3ZR8X 3J7AY 1V4RA 4HRIA 3RYPA 2HPMA 2NOJB 3DTIA 4M3EA 2BW3A 5L3BA 4XKWA 4EM2A 4HF2A 1ZGJA 1ZGAA 4BJ5C 4LG0A 3OS0A 3ZRGA 1EH6A 3DQVC 1LEAA 1P92A 4M71A 1ZG5A 5EZHA 3X2QH 4FTHA 1R1VA 4ESBA 4Y15A 2ZXHA 2RNGA 2VQLA 3VB2A 5BS6A 2LSOA 1K61A 3BR6A 3V8KA 3JAMZ 3COAC 3ZQHA 3CJQB 3PSFA 4HF1A 1IDZA 4D1QA 2FX0A 1WSUA 4XLFA 1XGMA 9ANTA 5BOXA 5GTHC 3CC7I 2PJPA 1UELB 4PFPA 4A3JJ 3KYDB 2P4WA 4G7ZF 1K83J 1AHDP 3VYSB 3FBNB 3KP6A 3QPSA 3PM1A 3CDHA 4ENJA 2IAIA 1S9HA 2HQ5A 3HRUA 4ZDPA 2EK5A 2RN7A 3HZJA 3W2AA 2FNPA 5BNGA 1QRYA 2VXDA 3R4KA 1R1TA 3V42A 5EG0A 3PFYA 2ZMEB 3VOEA 1UAAA 1ZARA 3S14J 2VC0A 1WWXA 1J0RA 3AL0B 3JRGA 3FXQA 4EVIA 3B6AA 1S7EA 3WE2A 2A6HF 2VQCA 4DBRA 1QPIA 4BE1A 3QPLA 4JK1X 3S2WA 4ZYDA 4R79A 2OAZA 3WTXC 2Q2EA 1P6RA 1JI8A 3IKTA 3T8RA 3CCRI 1MBFA 1RC9A 2Y0MA 3L1PA 1U6GA 2HI3A 2QKMB 2Y0SN 3J7AO 3QU6A 2L7MP 3FMRA 2LLKA 2MC4A 1U8RA 1IRFA 1FY7A 3QU3A 2MD0A 5LFAA 2FE3A 3DBLB 5E1WA 4C30A 4FE7A 3IL2A 2KRFA 3VWBA 1NK2P 3DEWA 4BY1J 2CFOA 3LA2A 3D5RC 5K7HA 3OYCA 2KLOA 3H35A 4KIFA 1WFXA 6PAXA 4G7HF 1TQMA 2DODA 5DV5A 2LY2A 4G7OF 2PX9A 4HX8A 1JTXA 1E2XA 3LQQA 3I64A 4QPOA 5GAEJ 4I6ZA 3PO2J 1Z1DA 1DGWY 5B3SH 1SD5A 1KYZA 2P8TA 3Q0UA 4HPQA 4KMUX 4XKCA 3IH3A 1QHHD 2VOOA 2X6YA 3FKJA 1R4MB 3S93A 4BDYA 4A3KJ 3ZP5A 2VBYA 2ISZA 1W7PD 3ERMA 1XS9A 4S05A 4L5JA 1EV7A 4IHWA 3MKYB 3FM5A 4KA4A 3PUFA 2CQQA 2YR2A 3W6VA 3BZCA 4IHVA 4AD9A 1TL8A 2QKLB 5AONA 2FOWA 1ZN2A 2XPWA 3L7WA 1QHGA 2IGNA 3EUKL 5J47A 1OCPA 2EBIA 3A02A 1BI2A 1ZR4A 4RAFA 3H36A 1Z05A 4XOTA 2LG4A 2QQ8A 2JA2A 2FSWA 3HTSB 3N97A 2BGCA 2L4MA 4LB6B 4I0AA 4UNOA 1HDPA 1MNEA 4LIUA 2NVQJ 1W5TA 3F22A 4LGWA 1E3PA 1UJ8A 1DPUA 2HKXA 4AIJA 2OQRA 3W6JB 5IP6A 2CO5A 4OAYA 1VQ7I 2AO9A 3KZZA 4XRSA 2ZFUA 1RKWA 4A3MJ 4BXFA 3ECHA 1B9MA 4P9FA 4DQ2A 2DDAA 3SDBA 4YFKF 2ZMEA 3KP4A 3P5JA 5TRDA 5K7FA 3MD2A 5DD4A 2L0KA 1ITYA 3IRRA 3NEUA 1WPKA 1FBSA 3R6SA 1VQPI 4IRIA 1FLIA 1XSXA 2GOXB 2DU9A 2DXIA 2B0LA 3JW4A 1U5TA 5F6FA 1VTNC 3SFIA 2XC7A 4EJWA 1IN7A 1LFPA 1YX3A 1RR8C 5M5XJ 1P7IA 2ID6A 2O3FA 1J9IA 1IRXA 3W2WA 2LNBA 1FJLA 4BQAA 1J7KA 2JA7J 1O4XA 2ECCA 3GFIA 2STTA 3HG9A 3F8CA 1T8IA 1Z0XA 2HDCA 3AG2H 1E0EA 2LH9A 2M45A 4ENNA 1QGPA 3JRFA 3LSJA 4ZYAA 2NVUB 2BXYA 3I53A 2DA4A 2FQ4A 1TLHB 2X6OA 1KQ8A 2NAZA 4BXXJ 1J09A 2PJRB 4CCMA 3OSFA 3SZTA 1B9NA 3CMMA 2IP2A 3W3CA 2HYFA 2KMUA 2KQRA 4KNYA 1IJWC 3KP2A 5AIQA 4KJZA 3RKXA 3OYIA 3HB9A 3D0SA 4BJ6C 5EYRA 1UZCA 4UUVA 3PSIA 3CDLA 2V26A 2P7VB 3BY6A 1IUFA 3E3VA 3BR1A 1KQ0A 2AXTC 3M4OJ 3CCEI 2GXBA 4BQOA 5HS8A 2V1XA 2CSOA 2K7LA 2IS2A 1D0ZA 2CG4A 2MLKA 5C4XJ 3OYAA 4RB3C 3PNVA 4CZZA 1GVJA 1Z6TA 1T56A 4E6KG 4A3CJ 1I1GA 2HS5A 1LVAA 3U9GA 3SZGA 3FXKA 3HOXJ 4YFXF 3OYFA 5J1RA 1FP2A 1R36A 2LRDA 5FD6A 3EYYA 4AIKA 2DT7B 1VQ4I 3I58A 2E1MB 4FETA 2WTEA 4GYGA 1VFCA 4XM3A 2NVXJ 2LC2A 4L9NA 2R7OA 5DYMA 2E2JJ 1R7JA 3R60A 5L3EA 2WY7Q 3H9QA 4RGRA 3QYFA 3PNYA 2ZKZA 2DOFA 4HLYA 3TEDA 4KISA 3TO9A 3HSFA 2I5UA 3HOYJ 3BLYA 3T0YA 4EGZA 4KYWA 4A5MA 4L9TA 3M8EA 4XLPF 2VXZA 2EV0A 1LNWA 2AQFA 2KIQA 5JHFA 3BT9A 4RB1A 2DMQA 2BOLA 5E3OA 2E1NA 3DKYA 3RZOJ 2QSHX 4LOCA 1HLVA 3VEPA 1YE9A 1WVRA 4EJOA 5JI6A 3O8HA 1O7LA 2R93J 1QO0D 1AOYA 5LRSA 4IQJA 1R5GA 2E5ZA 3L09A 4AVZA 4YIFA 3CLQA 1UFMA 5JFRA 2V6CA 1B8IA 3BR5A 3C2HA 3MEXA 1OCTC 1GV2A 2J5OA 1E17A 4PGGA 4LB5A 3OSGA 4XLEA 5JLWA 1CGPA 1X4PA 1HOMA 4RMNA 2OZ6A 1TQPA 3SQNA 1N77A 1P7JA 4GGGA 2F5VA 2VKEA 3I59B 3RTRA 4HOBA 4OIQF 1OYWA 1IN6A 1Z6RA 3HHHA 4XRFA 3BCAA 1IV6A 2DMUA 2V1DA 1D5YA 1YTYA 5E18F 2QLZA 2DOAA 5H2FC 4IHYA 4AYBN 1SD6A 2E71A 3U21A 3K2ZA 2HEOA 4E7ZA 2UUZA 3HYIA 3KP5A 5LEJA 5GAGJ 3JRHA 3OR1C 2OD5A 3ZMVA 3O8GA 3CP2A 4NHJA 3K6GA 4IOCF 4E7HA 1XSDA 1RI7A 1KU3A 5D4SA 3KEQA 3F8FA 3HPGA 4D5FA 2LYCA 3DKWA 3JRAA 2ELJA 4F92B 2VL8A 2M87A 5H6RA 3HXLA 5EZGA 2K9QA 1LPQA 5FKKA 2JVHA 1RKTA 3K4CA 2RC4A 1J2XA 3FKIJ 1XGOA 2CWEA 2VASA 1D3YA 4L5EA 1ETOA 1ETQA 2DW4A 4MLOA 3U1KA 4R8HA 1IRGA 3RPUD 1YS7A 2A05A 2FD5A 5F1JA 3DFGA 1D1CA 2IVMA 1NG7A 2M8EA 4AWXB 3E5UA 3OYMA 3E6MA 5FJ8J 4EGYA 4ETSA 1YJWI 2CW8A 2PMZN 2QSGX 2E2HJ 2RV8A 1ULYA 3EYIA 4EEFG 3HOTA 4QWQA 2DK5A 4BL0B 2KIMA 4HBLA 5FRMA 5EF6A 2A69F 3LQRA 1JKQC 2BBYA 1X1CA 2VN2A 4XIDA 1MBEA 3GF2A 1BR4A 3JR9A 1YX5A 1MIJA 4IHTA 1RNLA 4V19K 3KE2A 3DP7A 3TP3A 5TISC 3FXRA 1YG2A 1JGSA 3AFHA 1PYVA 1K79A 5L3CA 2R7RA 2MA3A 2EINH 3WTSC 3BPXA 1O3TA 1T08B 2Q8KA 2Z99A 2LKPA 5BMZA 3LSGA 4CCKA 1Z67A 2HQRA 2XVCA 2ME0A 2ZJQF 2VKDA 1BR1A 2RREA 1VNDA 4MFDA 1TWGJ 4YFNF 4U87A 3SHFA 1KU7A 2HZDA 2KKOA 3L00A 2O8XA 1Y1VJ 3KFWX 1R49A 4NC7A 3BTIA 3VODA 4BKXA 5J8CA 1IO2A 4K2EA 2QZ8A 1ZLJA 2MLGA 4E7KA 3RCOA 5FRNA 4QIWN 2L7ZA 3K7AJ 3WU1B 3HKZN 2O61A 1XTAA 1F5TA 5L3GA 3GWZA 4D0PA 2K4JA 4CYDA 1EA3A 3JRBA 1PVEA 3BG7A 5LGNA 1XB4A 4M9SA 5H6QA 1B72B 1QVUA 2XAQA 4DJAA 3FWEA 3D1NI 3JREA 2GA1A 4CO8A 5IPAA 1IXSB 3K10A 1ZGWA 3KZIC 4MEYF 1IN8A 1ETYA 4F7ZA 1FC3A 3HL2A 4A6EA 3CQZJ 3IV5A 4E7IA 3BTCA 1ZH5A 1M1EB 2DYSH 3MZYA 4CCLA 4NUBA 2DFIA 4X1EA 4AIDA 1BJZA 3IKVA 3MWMA 1GVDA 1XPXA 3H0GJ 4UV9A 5GP9A 4YELA 3ZMUA 3G1MA 2ACJA 4ESJA 4RLFA 1VQNI 2PFBA 2H8WA 1F9NA 5J6XA 2FBIA 4XBFA 3I9V2 4UB6C 2E1CA 4LG3A 4RS8A 4W1UA 1ZKGA 3CF2A 3EDPA 3KIOA 2DYRH 3QOEA 5DEQA 2LD5A 1G4DA 2L9RA 4PSXA 1FP1D 4GRIA 1FOYA 2HVRA 2EZIA 1VQOI 2GOMA 3PIOF 1E3HA 2LY1A 2R7WA 2DTZA 4AYBA 3IRQA 3H5AA 2L5QA 2FNAA 3G1LA 5IP9J 2BZTA 1HDDC 2JSCA 3BTLA 2W57A 2IW5A 2M4GA 4IRHA 1MBHA 3FXUA 3AG1H 2KISA 3BJ6A 4M6XA 5IT3A 3WE3A 1SANA 4HSTA 3CMEI 2XGCA 4LJZF 4KN4X 5E3LA 1U2WA 1EF4A 1WJBA 1UMQA 2PLYA 2A68F 1IXCA 4B1RA 1AWCA 4C3JJ 2J5PA 1H9GA 4HYEA
chains in the Genus database with same CATH topology
1N78A 3AL0B 2X6XA 3G2BA 5HNFA 1FMVA 4XQFA 4DGWB 4ITVA 2VQCA 4DBRA 3SEQA 4BE1A 4J01A 3A4CA 3S8PA 2V6EA 4R79A 4RM3A 2IXSA 3A2KA 2R7SA 3A1YA 1Z3XA 1JI8A 1G59A 3AL0C 1LVKA 2XF5A 1MW7A 3F9KA 3H9JA 4BS9A 2QKMB 3NWTA 4XN0A 3BG6A 2MC4A 2XAUA 1LDKB 3HC7A 1MMAA 2MD0A 5LFAA 3ZXSA 1X1DA 1AA7A 3PL8A 4C30A 2R7QA 2DJIA 3OYBA 4J00A 2HDWA 3VWBA 2W1OA 4II3A 3FBIB 3DLAA 2CFOA 3K4MA 4X0GA 3D5RC 4BUPA 3VDXA 3PJRA 3OYCA 2KLOA 3OL3A 3H35A 5TGTA 1FMWA 4PFOA 3H9GA 1WFXA 4QPQA 4C2TA 3OYEA 2WY8Q 4CSWA 2VJIA 3ZCOA 2WBMA 2VQHA 2LY2A 1D0XA 3DU6A 3OWTA 4PJNA 4QPOA 3AKZA 1PJRA 2Z16A 1DGWY 3OYNA 3BCBA 3K4NA 4HPQA 2XSJC 4XKCA 4P5OA 1QHHD 3ZQQA 3OS1A 1WJAA 2X6YA 3FKJA 3K4LA 3S93A 4BDYA 4B43A 1OR7C 2VJ4A 4XL9A 3EUAA 1X1BA 3HKZA 1SAUA 3IUOA 3QYEA 3MKYB 3LL7A 4NQWB 2W82A 2CMPA 4BJTA 3K4JA 3IAS2 4G6TB 3D5SC 3E0JB 3SYTA 2QKLB 3W2VA 3KEYA 1QHGA 3K70C 2JVGA 4PJLA 2IGNA 3EUKL 2XF6A 2CV2A 3CP8A 2OC6A 1X4OA 3LFUA 3HOSA 1WJFA 3M1CA 4XOTA 2IGMA 2LG4A 2JA2A 1D0YA 2KP6A 3OR2C 3TMOA 2Z1DA 2CUZA 4B44A 1KONA 4LIVA 3MKZA 3LSHA 1MNEA 4LIUA 2KZVA 2HNHA 2LREA 4CCJA 4E7LA 2VIXA 4IX7A 1R6RA 3QODA 4OAYA 1LKXA 2IS6A 2ZFUA 2CS3A 3DTKA 4BE2A 4XN3A 4BXFA 4OAZA 3SDBA 4ZDOA 2R7VA 3MKWB 3MD2A 3LSKA 2GOXB 3VSKA 1TT0A 2KRCA 2DXIA 1V5GA 2IGOA 4YEJA 2XC7A 2CW7A 2UV1A 1LFPA 1YX3A 3L2VA 2PJRA 1IRXA 2ZXIA 3W2WA 5HOOA 3HG9A 4XLHA 4CH7A 4C2UA 1TZLA 4E7JA 1E0EA 4BGDA 3VYTB 2LH9A 2V9KA 4H4KC 4XLAA 4ZYAA 2VB6A 2VPLA 3ZGKA 2MFZA 1J09A 3LSMA 3ONQA 4AU7A 4CCMA 2R4GA 4XNFA 2PJRB 4HNUA 3CMMA 2A5WA 2K9MA 2PMZA 3W3CA 2KMUA 2KQRA 1ZELA 4B47A 1DP3A 1HA8A 4KJZA 2L9NA 3OYIA 3S3NA 4BJ6C 3DPUA 2M4KA 3PSIA 2V26A 4PK4A 2M0MA 4BEHA 1MMGA 2V1NA 2W00A 3DKXA 4BQOA 4BDZA 4HNTA 3K70D 4DBQA 2IS2A 4RLQA 1D0ZA 4PUSA 2K5CA 3OYAA 1GLNA 2I8DA 2M3AA 3PNVA 2M7BA 4ZJZA 4E6KG 4LITA 2L9SA 3SZGA 4BEHB 4RM2A 3LSIA 3OYFA 4XOPA 4BQQA 4P1WA 5LD2C 2W4SA 2CH0A 2LRDA 1K6YA 1Y6IA 3VYUB 2DT7B 2V7FA 2E1MB 4FETA 4XM3A 2BVMA 2LC2A 2R7OA 3OS2A 2VKHA 3VSLA 2CV1A 1VZ0A 2WY7Q 1ERDA 3H9QA 3QYFA 3PNYA 1D1BA 4NNJA 1DGRM 4CCOA 4Y3OA 4KISA 5CKTA 3DTEA 3BLYA 3L2QA 2VXZA 3CJRB 3NWSA 2BVLA 4F91B 2AQFA 1D1AA 1X1AA 5JHFA 4N4NB 2F4IA 2BOLA 3DKYA 2IS4A 2M7AA 3KX2A 3LMMA 3MMYB 2KHMA 2ZSIB 1YE9A 2JSPA 4N4OB 1QU3A 2P0WA 5CQEA 4PSWA 4IKFA 4IQJA 2E5ZA 4XR6A 2L2OA 4AVZA 3OOUA 3H0DA 3OY9A 4ZTFA 2W7NA 2X1CA 1P9QC 3C2HA 4ZDLA 1DQUA 3EPZA 4IZZA 3UR3C 4XLEA 4HEA2 1X4PA 3CESA 3D5LA 4RMNA 1N77A 4XKVA 3K4KA 1MMNA 2F5VA 3RTRA 2X85A 4ANJA 1SFKA 4OWRB 3BCAA 4DOZA 2CUJA 2KPMA 3DPLC 3S3MA 2DOAA 2LBFA 1OLTA 3U21A 2DT6A 4E7ZA 2UUZA 2BW3B 2MYSA 5FROA 3OYDA 3GBGA 4ZC3A 2F6CA 3OR1C 4PJMA 2FUG2 3E1SA 3CP2A 3K6GA 4E7HA 5KCMA 1NG6A 4DIQA 5HVQC 2WAFA 3HPHA 3UNGC 4CZCA 3TBIA 3N05A 3HPGA 4JOMA 2LYCA 4CUGA 2K3PA 2ELJA 2LBFB 4F92B 2Q1ZB 2OV7A 3C2GA 2VL8A 4XONA 2KL4A 1N75A 3HXLA 3CZ6A 4ZTJA 1W36C 3HUGB 3PUBA 2JVHA 2OUMA 3K4CA 4II2A 3IP4B 4XORA 2VASA 3OIPA 4BACA 4MLOA 3DEEA 3RPUD 4JQFA 1UG0A 3S32A 4BQNA 4U7BA 2IGKA 1U0JA 1Z3YA 3OYKA 1D1CA 1NG7A 3OYMA 2O5RA 2CW8A 2Y0SA 3HOTA 4F93B 4BL0B 3FDYA 5FRMA 1X19A 4B3XA 4KT6A 2X1EA 2V4JC 1T95A 3EUHC 1X1CA 4CCNA 4Y33A 4Y4RA 3L2WA 1BR4A 1YX5A 5CQGA 4HSRA 4F52A 2KRHA 3OL4A 2E60A 1MNDA 2KDOA 2R7TA 2X1DA 4EATA 4B48A 2HU9A 3AFHA 1PYVA 4XLCA 1Y56A 4IQ4A 4BU2A 2R7RA 1Z7LA 4XKBA 2WAEA 3BC8A 2Q2EB 4D9JA 5CPRB 5KNLA 2L7KA 1G8XA 2A6TA 2AQEA 3LSGA 3FHNA 4CCKA 2VKDA 1BR1A 2RREA 4BE0A 4U87A 4CA0A 2HVSA 2HZDA 3RSNA 2UWMA 2VJ5A 3L2RA 2CV0A 3DWLE 4KITB 3OYJA 1BR2A 3QYBA 5KHDA 2VQGA 3M8JA 2WA0A 4NC7A 1V5EA 3H5NA 2X6WA 1WJDA 1T0FC 4E7KA 2E1MC 3RCOA 3L2UA 5FRNA 4YRVA 1V5FA 4NC8A 3H5RA 2VLAA 4HG2A 3VYRB 1Z21A 1EA3A 2VJJA 3BG7A 3TL4X 2X51A 3S3OA 3K4BA 2Z2SB 2XF7A 4DJAA 4XMYA 1WJEA 1WJ5A 5HLTA 4F3QA 3K10A 3OYHA 4E4HA 3HL2A 3PNTA 5HNHA 4E7IA 2ZSHB 2WAQA 1WJCA 2E5NA 3ZR8X 2MABA 3OMYA 3OYGA 1W36D 3J7AY 4CCLA 4HRIA 2HPMA 2NOJB 4NUBA 4C9YA 3DTIA 2BW3A 4XKWA 4FASD 3DPTA 4BJ5C 3OS0A 3ZRGA 4PJJA 3DQVC 4YELA 2WB1A 2JUGA 2DCEA 2RQQA 2ZXHA 2RNGA 2VQLA 3RQ4A 4RLFA 2WADA 2XDVA 3DU5A 3CJQB 3PSFA 2IS1A 4D1QA 3I9V2 4LG3A 4XLFA 3CF2A 2HPIA 3QOEA 4E7SA 1UELB 4PFPA 2R7XA 4PSXA 4GRIA 3KYLA 2HVRA 2GOMA 2LY1A 3FBNB 3VYSB 2R7WA 4AYBA 3SEZA 3H5AA 2L5QA 1MMDA 2HVQA 4F55A 2M4GA 1S9HA 3I3LA 4ZDPA 3IAM2 1BOBA 3W2AA 2HQAA 4HSTA 1WJBA 2VXDA 3OYLA 2K9LA 3V42A 2R7UA 3PFYA 1UAAA 3OIQA 2LOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX3 A;  1JI8 A;  2V4J C;  1SAU A;  2XSJ C;  3OR1 C;  3OR2 C;  2A5W A; 
#chains in the Genus database with same CATH topology
 1WH5 A;  4ASN A;  2XAH A;  2MH2 A;  1ON1 A;  4IOA F;  4S0H B;  3G2B A;  5HNF A;  4XQF A;  5JHU A;  2JJ7 A;  1WH7 A;  1MSF C;  1J75 A;  2QM3 A;  4RDU A;  3A4C A;  4XSX F;  2A3S A;  4KDP A;  2V6E A;  5K5O A;  3MFK A;  2CQN A;  2IXS A;  3A2K A;  1XGS A;  3FK6 A;  2R7S A;  1RUN A;  1G59 A;  3AL0 C;  1LVK A;  2XF5 A;  1AKH B;  4RA2 A;  2ZJP F;  4JX4 A;  1JE8 A;  5FKM A;  1LB2 A;  2ZFW A;  3B73 A;  3LST A;  2QUF A;  4RAG A;  1MMA A;  2G7U A;  3KP3 A;  1YJ9 I;  4G9Y A;  3ZXS A;  1SFU A;  1FZP B;  2DJI A;  2L54 A;  4NC6 A;  4II3 A;  3K4M A;  4P96 A;  4AVP A;  5EGO B;  3CJT B;  4BUP A;  3VDX A;  3PJR A;  5KAI C;  2DPU A;  5TGT A;  4PFO A;  3H9G A;  2OU2 A;  1AU7 A;  3S17 J;  3ABT A;  3P9I A;  4C2T A;  4CSW A;  5HDN A;  2KJC A;  5JR3 A;  4M9Z A;  5C44 J;  3BTJ A;  4ESF A;  4DYQ A;  1B72 A;  1LJ9 A;  4I7H A;  2XAS A;  1XDU A;  2K4B A;  4JYK A;  5E1Z B;  3RDI A;  1H89 C;  3OYN A;  3BCB A;  2ESN A;  1WI9 A;  1Y1W J;  3I55 I;  4RAY A;  2RAE A;  4ZH4 F;  1WJA A;  2AHQ A;  4GXO A;  4U0V A;  1RRJ A;  5LGU A;  2VJ4 A;  3S1M J;  3SXY A;  2JTV A;  2FA5 A;  4W97 A;  1POG A;  3LSR A;  3HKZ A;  3QYE A;  1SD7 A;  3LL7 A;  5IYC J;  1JT0 A;  4Y52 J;  2DA5 A;  3H92 A;  3K4J A;  5CVI A;  3IAS 2;  4XRM A;  1W7P A;  3LAJ A;  3B02 A;  5LEK A;  4MTD A;  3QPH A;  5CVR A;  3SYT A;  4RGS A;  3KEY A;  3MCZ A;  1DU0 A;  3ELK A;  2BY1 A;  5FKL A;  4Y13 A;  3KZY A;  3CP8 A;  5D5U B;  1UHM A;  3LFU A;  3HOS A;  2IGM A;  1USS A;  4XK4 A;  3A01 B;  3BPV A;  4M9X A;  1ZLK A;  2CUZ A;  2EFP A;  4B44 A;  4GCV A;  1KON A;  4LIV A;  2OBP A;  3MKZ A;  3CO6 C;  2HNH A;  2LRE A;  4I0B A;  5ILU A;  4IX7 A;  3B6C A;  2R5Y A;  2G7H A;  3ZMS A;  2GQQ A;  2LK2 A;  4MQV A;  3ZN0 A;  4LK0 F;  5ED4 A;  2ZNY A;  1J5Y A;  3NAU A;  4YG2 F;  4ZDO A;  3MKW B;  3FXJ A;  1RET A;  1F36 A;  5F1R A;  4MGR A;  4DYC A;  3F6O A;  2OPT A;  1JUP A;  3QAH A;  3BQY A;  1SC7 A;  2KRC A;  3C2B A;  2QEX I;  3K9T A;  3TW6 A;  5DUK A;  2GZW A;  3C3W A;  2FML A;  3F3X A;  2UV1 A;  1VF9 A;  3WU2 C;  2ISY A;  4C3I J;  1APL C;  1MGT A;  1R58 A;  1XD7 A;  3BJA A;  2ZXI A;  3FXM A;  4XIC A;  2GA2 A;  5HOO A;  4PDK A;  3FXL A;  4KUM A;  1AKH A;  4IVN A;  1FTZ A;  4JBA A;  1H88 C;  1S3J A;  2E34 A;  4C2U A;  5IT9 K;  1TWA J;  5FKN A;  2VI6 A;  3FIS A;  1UCR A;  4ABZ A;  1U5T B;  1Y0U A;  4V2F A;  3S2D J;  3GW2 A;  1KU2 A;  2WV0 A;  1JKP C;  3ZN1 A;  4KIG A;  1XMX A;  1TWC J;  1TBX A;  3ONQ A;  4AU7 A;  5EGO A;  1U78 A;  3G4S I;  1A04 A;  2ETH A;  4EJT A;  1DP3 A;  2H6B A;  5M3M J;  3S3N A;  2MC3 A;  5ICF A;  4ENK A;  1Q1H A;  5D4R A;  1OR7 A;  1LUJ B;  3RKW A;  5FLM J;  1R00 A;  1HW2 A;  4BEH A;  4BBS J;  1XC5 A;  2KJB A;  5GAH J;  3HBL A;  2V1N A;  2W00 A;  1X2N A;  1PUF A;  4A3B J;  3K70 D;  1S29 A;  4KIB A;  5GPC A;  1IF1 A;  4PGH A;  4IXA A;  4RLQ A;  1LQ1 A;  1ZQ3 P;  4PUS A;  3W6K B;  2M3A A;  2E1O A;  3HEF A;  1KQ9 A;  2GXG A;  2L9S A;  3UKG A;  2QBY B;  2F4M B;  1LE8 B;  3LSI A;  4XOP A;  4BQQ A;  4P1W A;  2KDZ A;  2BYV E;  5IY5 H;  1Y6I A;  5F27 A;  2EFW A;  1TQI A;  3IH2 A;  1I6X A;  2V7F A;  2IRF G;  2FMY A;  3CMY A;  3TDZ C;  1S7O A;  2O03 A;  2MBF A;  2JMW A;  3HOV J;  2CV1 A;  1VZ0 A;  3GFJ A;  3GTP J;  1SFE A;  3ZQF A;  1D1B A;  2L01 A;  3BZ6 A;  1QVT A;  4Y3O A;  3J7Z I;  1O57 A;  3A01 A;  2DO7 A;  2RGV A;  1MBJ A;  5K1Y A;  1TW2 A;  3DTE A;  1ZG1 A;  5LRR A;  3L2Q A;  1GDT A;  1GV5 A;  3CCL I;  3IWF A;  5IT9 Z;  1REP C;  2L9V A;  4WF2 A;  4F91 B;  1STZ A;  4UHT A;  1F4K A;  2JUC A;  4N4N B;  1WGX A;  3H3V K;  2XB0 X;  2E2I J;  1BW5 A;  3A03 A;  2JPC A;  2DLL A;  4D7N A;  1YS6 A;  3MMY B;  1XSV A;  3WG9 A;  4GDF A;  4PZJ A;  4MHG A;  2WAQ N;  1Z9C A;  1ETK A;  2F2E A;  2DI3 A;  5FLX K;  4IKF A;  3LA3 A;  2Z33 A;  2RDP A;  3HOU J;  1JJ8 C;  1BI0 A;  1T38 A;  4G12 A;  2X1C A;  3O3K A;  1P9Q C;  4FHT A;  1XCB A;  4L9V A;  1MDM B;  1ZRD A;  4X6A J;  3EPZ A;  3KEO A;  1HW5 A;  2L02 A;  2VPR A;  4HEA 2;  1T98 A;  4M72 A;  4CYC B;  2H27 A;  1MMN A;  3GFM A;  2X85 A;  3GLL A;  4KN7 X;  4U7D A;  1SFK A;  2LDU A;  1XCV A;  2FBH A;  3WTW C;  2A07 F;  3V7R A;  2VE8 A;  4DOZ A;  4IO9 F;  4I2O A;  3S3M A;  1B8I B;  4EQQ A;  1KU9 A;  2LBF A;  1R9T J;  1UHW A;  2R7Z J;  4DW6 A;  1OLT A;  2W48 A;  2NVT J;  2DT6 A;  5DCM B;  2BY2 A;  2CU7 A;  1FSH A;  2FUG 2;  3A0H C;  3E1S A;  3JTG A;  1JHF A;  3HUG A;  2OCC H;  1IZ1 A;  3VPR A;  2FJ1 A;  1IUY A;  2XB5 A;  4M3G A;  1YQA A;  1OFC X;  2V9V A;  2VOP A;  3EUH A;  2OTJ I;  3TBI A;  3N05 A;  4MIM A;  4JOM A;  5DM6 F;  4A3D J;  2K3P A;  2Q1Z B;  2Z9O A;  1OKR A;  1WZ2 A;  1X2M A;  3PQJ A;  1XMA A;  1TP4 A;  3CZ6 A;  3F8B A;  1QA6 A;  4ZTJ A;  1X1P A;  4II2 A;  3HTU A;  5J4Y A;  4XOR A;  3M9A A;  3OIP A;  3DF8 A;  2P6S A;  3ZQC A;  3S32 A;  3OYK A;  2IGK A;  1U0J A;  3V8L A;  4ENM A;  2GBY A;  3MAJ A;  4HNV A;  2QBY A;  2Y0S A;  4C3H J;  1LE8 A;  3DBH B;  3RPU A;  5FLX Z;  2XPV A;  5FB2 A;  2PQ8 A;  2X1E A;  1GXP A;  1FIA A;  1T0F A;  3U2R A;  5D5X B;  1HKS A;  4CCN A;  4Y4R A;  2A5Y B;  1T39 A;  2DA2 A;  5CQG A;  3OL4 A;  4M74 A;  5TJJ A;  4HZF A;  1S8N A;  1ZYR F;  2HU9 A;  1ZAO A;  2GAU A;  5KVR A;  2FXA A;  3AG3 H;  4IQ4 A;  4GFB A;  1Z7L A;  2WAE A;  5EEA A;  2NOG A;  3BC8 A;  2VKV A;  3HGG A;  4D9J A;  4LD5 A;  3BG3 A;  3BJO A;  1WRJ A;  2L7K A;  3P9C A;  1G8X A;  5JVG F;  3HRM A;  1BL0 A;  4OIO F;  4EM1 A;  1KZH A;  4BE0 A;  4OU0 A;  2HVS A;  2FRH A;  2UWM A;  2VJ5 A;  1S7A A;  2XKP A;  2YU3 A;  5KHD A;  1IAW A;  1NH3 A;  1I27 A;  2X6W A;  1U8B A;  4A69 C;  4NBQ A;  2COB A;  4HF0 A;  4Q47 A;  1B6A A;  1A5J A;  4YRV A;  1LEB A;  4HDV A;  3ZQL A;  1NTC A;  2VLA A;  3DEU A;  2IT0 A;  1MDM A;  3M1E A;  3RJP A;  1BC7 C;  2M5W A;  3RYR A;  1RIO H;  4CYC A;  5JVT A;  4IHS A;  3BR0 A;  4JP0 A;  3JCU C;  1YW9 A;  2G9W A;  2QWW A;  2GIV A;  2H09 A;  1Y8Q B;  3OYH A;  2R92 J;  4UVB A;  5E79 C;  1K6O A;  2F48 A;  5HNH A;  2HWV A;  2Z3Y A;  2ZSH B;  2WAQ A;  2E5N A;  2ZXJ A;  1LFB A;  3LOC A;  1W4M A;  1T33 A;  2MAB A;  2RKH A;  2DFH A;  3OMY A;  5J40 A;  1W36 D;  5DCM A;  3I54 A;  2AXL A;  2ZBK A;  3DPT A;  2BY0 A;  3Q9S A;  4EM0 B;  4PJJ A;  3IH4 A;  1MH4 A;  3OV8 A;  5E8I A;  5E1X A;  1C0W A;  2JUG A;  1Y8R B;  2DCE A;  1PUE E;  2RQQ A;  2DFE A;  2WAD A;  3S1N J;  2XDV A;  2IS1 A;  5K5R A;  4D5C A;  4E7S A;  3WGH A;  1FYM A;  4HV6 A;  1X3U A;  3HM5 A;  4OOI A;  4LLL A;  4L18 B;  3TW7 A;  3ABK H;  2R5Z B;  4FQG A;  2DTR A;  4XSZ F;  2HKO A;  2EH3 A;  1MMD A;  5LGT A;  3J80 K;  2GLO A;  4F55 A;  3I3L A;  4A0Z A;  1B1B A;  1IXR C;  3IAM 2;  1OMI A;  1BOB A;  2LVS A;  2FEZ A;  3BP8 A;  2WC2 A;  4R1H A;  2ADU A;  4ZYH A;  2K9L A;  3GLX A;  3M8F A;  2R7U A;  2R7D A;  3GZ5 A;  2Y30 A;  5FGM A;  5IYB J;  2DFF A;  3E6D A;  4IHX A;  4KIC A;  1N78 A;  1W0T A;  1G3Y A;  3HOW J;  2EIJ H;  4OMY A;  1FMV A;  1SFO J;  3ASO H;  1FOX A;  3SEQ A;  4HQE A;  4J01 A;  2K9S A;  3SDG A;  1MMS A;  5HLG A;  3S8P A;  4GYI A;  2YX4 A;  2WV1 A;  3FMQ A;  1MNM C;  1Z3X A;  4YII A;  5H20 A;  1A35 A;  5J4V A;  1OCO H;  2IA1 A;  4BS9 A;  2XKO A;  3NWT A;  2L4A A;  2EB7 A;  2XAU A;  5FFX A;  1QZZ A;  1LDK B;  3HC7 A;  1YRN A;  4DYR A;  3IWZ A;  1AA7 A;  2R7Q A;  3MZH A;  1A36 A;  3OYB A;  4J00 A;  4B3A A;  1VQ6 I;  1G3W A;  1D8J A;  2W1O A;  5HLH A;  2YPR A;  1DUX C;  3GXO A;  1B59 A;  3DLA A;  5IP7 J;  4WX9 A;  3SJM A;  3PO3 J;  5FKO A;  4U0Y A;  3OL3 A;  3FK7 A;  4MFE A;  3ERE D;  3MQ0 A;  1FMW A;  4FCY A;  3CCV I;  4RB2 C;  3OYE A;  2WY8 Q;  2VJI A;  1YW8 A;  3DCF A;  4RGU A;  2WBM A;  1P4X A;  2CQ7 A;  1D0X A;  2O8K A;  3HRS A;  4PJN A;  2DJN A;  3WU0 A;  3CCQ I;  4NQW A;  1PJR A;  2Z16 A;  2BHY A;  4ZYG A;  3BR2 A;  3K4N A;  3OS1 A;  4P5O A;  1HBX G;  4ZZL A;  4BYY A;  3FMS A;  1U9O A;  4G6Q A;  1DPR A;  4FX4 A;  1OR7 C;  3ABL H;  4XL9 A;  1SEU A;  3EUA A;  1RR7 A;  1I3Q J;  3FF5 A;  2GIZ A;  4G6D A;  2P81 A;  2QA4 I;  1SAU A;  2KZG A;  2MGQ A;  2ZO4 A;  3IUO A;  2K3F A;  3T5X A;  2HOT A;  4N9H A;  2CMP A;  1ZHF A;  5ICC A;  2HYJ A;  4G6T B;  3LSP A;  2V9P A;  4GO1 A;  2VBW A;  1W0U A;  4CIC A;  2LR8 A;  4HAM A;  4CXF A;  3JSP A;  3CMA I;  2X4H A;  2JVG A;  4PJL A;  2OC6 A;  1YIJ I;  2VT2 A;  1X4O A;  3GTM J;  2JA6 J;  3ECO A;  5DS9 A;  1WJF A;  3RKY A;  2W25 A;  3WGI A;  3OR2 C;  3TMO A;  5D8L B;  2Z1D A;  4IL6 C;  3F0C A;  2R5Z A;  1W7P B;  4BHB A;  3CDI A;  4MTE A;  4CCJ A;  3BQZ A;  1JTY A;  2Y31 A;  5J3L A;  2PI0 A;  3K1N A;  2XPU A;  1R6R A;  3QOD A;  1I50 J;  1LKX A;  4BNC A;  4O3M A;  3GZ6 A;  2F5D A;  2H8R A;  4MQ9 F;  1UHS A;  4XN3 A;  3F23 A;  1BI1 A;  2DOE A;  1G2H A;  2JA8 J;  2R7V A;  2IBD A;  3QPT A;  2RVC A;  4UY8 I;  1JUS A;  1D5V A;  5EEH A;  1MJA A;  1MZB A;  3LSK A;  2B9S A;  1V3F A;  3R0J A;  2QEN A;  3VSK A;  2R5Y B;  1WQ2 A;  2LFB A;  4DNC A;  1FTT A;  5FD5 A;  2IGO A;  3MZ8 A;  2EZK A;  4YEJ A;  1ZR2 A;  2CQK A;  3QOP A;  1Y0N A;  2Z5U A;  1IV8 A;  2TRT A;  5LHG A;  1FPQ A;  1G3T A;  1WKM A;  3ASN H;  1U3E M;  1OIS A;  4XLH A;  3E7L A;  2GM4 A;  4Q48 A;  5DD8 A;  3TKY A;  4CH7 A;  1FYL A;  1TZL A;  1ZK8 A;  4O6J A;  1IRZ A;  1YFH A;  4BXU A;  3VFZ A;  3CJN A;  3F6V A;  2VB6 A;  3SFZ A;  3G1O A;  3BRO A;  2VPL A;  2ZME C;  1RZ4 A;  5D5W B;  2XGD A;  1Z77 A;  2MFZ A;  3QP6 A;  3H3Z A;  2R4G A;  4HNU A;  5HS7 A;  2A5W A;  3E6B A;  2PMZ A;  1ZEL A;  2VE9 A;  3GTJ J;  3HDD A;  3K0L A;  1BOA A;  2NVY J;  1U5T C;  2UXX A;  3DPU A;  2M4K A;  2NNY A;  2DDB A;  4A6D A;  3T1B A;  2R0Q C;  1VQL I;  4PK4 A;  1TWH J;  2M0M A;  1TNS A;  1XX5 A;  2XSD C;  1MMG A;  5M3F J;  2V79 A;  5L3D A;  4BDZ A;  4HNT A;  5B1A H;  1TTY A;  2B63 J;  1ZRC A;  1CF7 B;  1E3O C;  5J8F A;  4C2M J;  2K5C A;  4HQM A;  2I8D A;  2F5F A;  2PN6 A;  2M7B A;  2GXA A;  5M5Y J;  3WGG A;  3RKQ A;  4CHU A;  4LIT A;  4QSH A;  1R23 A;  4O5V A;  3KET A;  2IA2 A;  1BC8 C;  4BEH B;  2W84 A;  5ILS A;  4I99 C;  4ZYE A;  1BM9 A;  5CYV A;  2OCE A;  1PUF B;  5LD2 C;  2CH0 A;  3E5Q A;  3MN2 A;  3T8T A;  1K6Y A;  1K4S A;  1L3L A;  3GEZ A;  3TP0 A;  3VYU B;  4HV5 A;  4YIR X;  4MNU A;  3QQA A;  1YOV B;  2BVM A;  1VQ9 I;  2PMU A;  3OS2 A;  1SD4 A;  1S72 I;  3TQN A;  4M6Y A;  2OQG A;  1ERD A;  4B4C A;  2P7C B;  4NNJ A;  1DGR M;  4CCO A;  5EJC A;  3P7N A;  3C7J A;  3WTV C;  2C6Y A;  1HF0 A;  5CKT A;  2HGC A;  2MD5 A;  4U0W A;  1JT6 A;  2LY9 A;  3CJR B;  3NWS A;  2BVL A;  4PCQ A;  1GUU A;  2NS8 A;  1S6L A;  3ABU A;  5LBQ A;  3DLL F;  3V8J A;  2PEX A;  3GO5 A;  2BHZ A;  2JRT A;  2IS4 A;  1HCR A;  1GXQ A;  2M7A A;  3KX2 A;  3LMM A;  1BBY A;  4LLG F;  2CRG A;  1TW3 A;  3ZPL A;  4N4O B;  5IYD J;  1HW1 A;  2HYG D;  2P0W A;  2P6T A;  4PSW A;  4ZZD A;  5BQT A;  1YHQ I;  4XR6 A;  2DT5 A;  2L2O A;  3KYC B;  3R0A A;  2HXI A;  3CLO A;  2BY3 A;  2W7N A;  4ZTF A;  2HZT A;  2NYX A;  4ZDL A;  1DQU A;  2EA2 A;  2WB1 N;  2OZU A;  4IZZ A;  4UXN A;  2DA3 A;  3UR3 C;  3CCJ I;  4HLX A;  1P2F A;  5FFZ A;  3CES A;  2XGX A;  2HTJ A;  2VBX A;  1ODD A;  2QYO A;  2NRA C;  2GWR A;  4WXH A;  4WXD A;  4ANJ A;  2EFQ A;  1U9N A;  3FHZ A;  1ETX A;  1N25 A;  1OCR H;  3M7G A;  3RPQ A;  2LKX A;  3O2P E;  2CUF A;  4OMZ A;  5KK1 A;  5DUI A;  5B5E C;  1DP7 P;  2MYS A;  4L5I A;  1FWZ A;  3BG5 A;  3OYD A;  3I4N J;  4ZC3 A;  2F6C A;  3GFL A;  1YIT I;  5DCF A;  2P5L C;  1JKO C;  5ERI A;  3DBR B;  4I98 B;  5HDG A;  1PDN C;  4Y7N J;  2G0E A;  2DMN A;  5KCM A;  2ESH A;  5J1Y A;  4FT8 A;  2CGP A;  1JGG A;  3HPH A;  2HXO A;  3UNG C;  4LLN A;  5HS9 A;  1CQT A;  4CUG A;  2JRM A;  4AUX A;  2LBF B;  4G94 A;  2OV7 A;  4BHC A;  4XON A;  1FBQ A;  2KL4 A;  2CYY A;  1N75 A;  4Q4Z F;  1DU6 A;  5BPD A;  4AC0 A;  2XRL A;  3HUG B;  3PUB A;  5GAD J;  1F43 A;  1XGN A;  2K85 A;  5A2Q K;  3IP4 B;  1CF7 A;  4BAC A;  5LHH A;  4JQF A;  1UG0 A;  2LMD A;  2M30 A;  2K9N A;  2O5R A;  1YI2 I;  3EET A;  5GPA A;  3FIW A;  3JRI A;  3F72 A;  4AIH A;  4F93 B;  4UUS B;  2JQ7 A;  1X19 A;  4B3X A;  3BG9 A;  2Y69 H;  1OYY A;  3LA7 A;  4FE4 A;  2OF7 A;  4WXC A;  2V4J C;  4UVA A;  3FX3 A;  3WHC A;  2EA4 A;  1TC3 C;  2VC1 A;  3CC2 I;  2XRO A;  4F52 A;  2KRH A;  2VBZ A;  2E60 A;  1MND A;  2KDO A;  3K2A A;  4EAT A;  4B48 A;  3RI4 A;  4BU2 A;  3S2H J;  3TO6 A;  3HOZ J;  4A5N A;  2EZL A;  5F0F A;  2EV6 A;  4LFU A;  2CUE A;  1R4N B;  5KNL A;  2R7F A;  3M3Y J;  1ETV A;  2A6T A;  1BW6 A;  2ZB9 A;  1VQ5 I;  2ELH A;  4RAZ A;  2CW0 F;  1IW7 F;  3RSN A;  2CV0 A;  2HOA A;  1YLF A;  3DWL E;  4QLC U;  3CUQ B;  3OYJ A;  3ML6 A;  2VQG A;  1YIO A;  3M8J A;  4H0E A;  3H5N A;  2VOD A;  2W24 A;  5F0H A;  1QZE A;  3ZQ7 A;  1SVL A;  2E1M C;  3L2U A;  1K7A A;  5IOZ A;  2OA4 A;  1V5F A;  1O3R A;  2HTS A;  4NC8 A;  3H5R A;  4IEJ A;  4HG2 A;  3HSR A;  1JJ6 C;  2E35 A;  2VJJ A;  3TL4 X;  1FIP A;  2X51 A;  3S3O A;  2JK3 A;  5FO5 A;  2XAJ A;  2H94 A;  3GTO J;  2Z2S B;  5A2Q Z;  4L0Z B;  5FLV A;  2YU9 J;  2ZJ2 A;  1FOW A;  1RES A;  1WJ5 A;  3OIO A;  5HLT A;  2EIM H;  4F3Q A;  5DTD A;  3V4G A;  1XG1 A;  2I10 A;  2STW A;  1O7F A;  1T6S A;  2M1B A;  4B8X A;  1WJC A;  3S1Q J;  3G3Z A;  2Y75 A;  2O9L A;  3OYG A;  5K7Z A;  3JRD A;  4DZJ A;  4C9Y A;  3Q0V A;  1L0O C;  4FAS D;  2COM A;  5CJ9 A;  4A3L J;  1FOK A;  4Z6Y A;  3PFI A;  1BI3 A;  3CO7 C;  1QQI A;  2M9H A;  1MBK A;  1WHU A;  3NAR A;  2Y9Z A;  3ZOB A;  2WB1 A;  3RQ4 A;  3HHG A;  3DU5 A;  1ETW A;  1X58 A;  2XUB A;  1TT5 B;  3MVP A;  1ZG3 A;  2RQP A;  3J7Y J;  2H1L A;  2HPI A;  4TV7 A;  3G73 A;  1UST A;  2XRN A;  2R7X A;  1NK3 P;  3KYL A;  1I3A A;  4QTR A;  3LWF A;  2X48 A;  3WOD F;  2V1U A;  3SEZ A;  3CTA A;  1KYW A;  3MKL A;  2FF4 A;  1EH8 A;  1SMY F;  3KLO A;  2HVQ A;  2JWT A;  1JHH A;  3KP7 A;  4A0X A;  3CUO A;  2KIF A;  1A31 A;  2K27 A;  2HQA A;  4HX7 A;  5C3E J;  4JX5 A;  1A6I A;  2QVO A;  5EEG A;  4UUS A;  2WWY A;  3OYL A;  2D45 A;  1IG7 A;  1LFU P;  3F8M A;  3OIQ A;  3ZMT A;  2LOO A;  5E20 A;  4EJV A;  2XIG A;  2X6X A;  1FX7 A;  3U1D A;  2BXZ A;  3HRT A;  4DGW B;  1TWF J;  2PMH A;  1DDN A;  4ITV A;  3G6E I;  1EKE A;  2FU4 A;  4Q5S F;  2FQ3 A;  1R22 A;  1XDS A;  5E3N A;  3CCU I;  4BBR J;  2UXN A;  4RM3 A;  1FSE A;  3H3U A;  2A61 A;  4M6V A;  3A1Y A;  1VI0 A;  2JPB A;  2QCO A;  2W85 A;  1D8K A;  1MJ9 A;  2PBI A;  2F4O B;  4OIP F;  5DDG A;  1MW7 A;  3F9K A;  3H9J A;  5CVV A;  2VUM J;  4XN0 A;  3BG6 A;  3ULQ B;  3GTL J;  1ZTR A;  4A3G J;  3CUQ A;  2K40 A;  1H0M A;  2H1K A;  1X1D A;  3PL8 A;  3NRV A;  2UZK A;  3A0B C;  2HDW A;  1ACI A;  3TOA A;  3I0T A;  2DN0 A;  3FBI B;  4IRG A;  2JN6 A;  4X0G A;  3ISP A;  2QQA A;  5BPI A;  1BN5 A;  2D2W A;  1ZRF A;  2ZCW A;  4RBO A;  4QPQ A;  4Z2Y A;  3ZCO A;  1IN5 A;  4I76 A;  1YRN B;  2IEK A;  2VQH A;  2Y48 A;  2DQL A;  4I09 A;  3ZMZ A;  4U88 A;  1MBG A;  3Q5F A;  3DU6 A;  3OWT A;  4KFC A;  4NDL A;  1BIB A;  3HSE A;  4HX4 A;  3AKZ A;  5ICG A;  2A6E F;  1HKQ A;  5C4J J;  3ZQQ A;  2XSJ C;  5IOY A;  3K4L A;  1G3S A;  1LDJ A;  4IPA A;  4B43 A;  1R5H A;  2O6G E;  3BDD A;  1MSE C;  1OYI A;  3IC7 A;  1X1B A;  2YS9 A;  1ONV A;  1QNT A;  4AM3 A;  2EPF A;  2K02 A;  1ENH A;  4D7M A;  1A6Q A;  2MH9 A;  5F08 A;  4NQW B;  2W82 A;  4L9J A;  3AG4 H;  4HW0 A;  5EDN A;  4BJT A;  1VQ8 I;  4M3F A;  2PG4 A;  3V7C A;  3D5S C;  2JA5 J;  1O3S A;  1Y39 A;  3KPH A;  3E0J B;  3GX4 X;  5LHI A;  4E70 A;  3QP5 A;  4I02 A;  1S5L C;  3W2V A;  1VQM I;  3K70 C;  2CV2 A;  2XF6 A;  2DPD A;  3L9F A;  2HFH A;  3HGY A;  1H9T A;  1JXS A;  3M1C A;  5F64 A;  4IJA A;  1D0Y A;  2KP6 A;  1R71 A;  4OIN F;  2IJL A;  2M0C A;  1X3W B;  2EWN A;  1EH7 A;  5HLI A;  3LSH A;  2KFD A;  4A12 A;  5K5Q A;  4A2U A;  1IC8 A;  2KZV A;  1RUO A;  2DK8 A;  2F5E A;  4E7L A;  2EFO A;  2VIX A;  3K69 A;  3GTG J;  3K1M A;  1BA5 A;  2M8G X;  2XV4 S;  3CCY A;  2TDX A;  4FX0 A;  2IS6 A;  2JT1 A;  5ICE A;  1H8A C;  4EMS A;  2L3D A;  1KA8 A;  3O6B B;  3CF5 F;  2CS3 A;  2LF7 A;  3DTK A;  4RB0 A;  1FYK A;  4BE2 A;  2HDD A;  3GVA A;  4FIS A;  1G6N A;  3RIR A;  1P4A A;  4OAZ A;  1K78 B;  4HA8 A;  3RQI A;  5M5W J;  2HQN A;  2MG4 A;  2YSR A;  1V54 H;  3FM3 A;  2AS5 F;  1TT0 A;  2CQX A;  2B7E A;  2H6C A;  1V5G A;  1YO5 C;  3REO A;  5HDK A;  3ZMD A;  5ILV A;  3PQK A;  2CW7 A;  2ZXW H;  2K86 A;  4WK8 F;  4UV8 A;  2QSF X;  3L2V A;  5DM7 F;  4LK1 F;  2PJR A;  4J19 A;  2XGE A;  2IPQ X;  5D6E A;  4A3F J;  3C18 A;  3V7S A;  1SVM A;  3QRF F;  4E7J A;  1SAX A;  4BGD A;  2O7O A;  3VYT B;  3WTT C;  2V9K A;  2CJJ A;  4H4K C;  4XLA A;  3I56 I;  1P4W A;  3AAF A;  3ESW B;  4UUT A;  2NS7 A;  2QQB A;  2LTP A;  2YX7 A;  2VON A;  2MW8 A;  3KCC A;  3ZGK A;  3L2C A;  3S15 J;  1FEX A;  5L3F A;  3LSM A;  2KIU A;  3DV8 A;  3WTY C;  1OCC H;  2DMT A;  4G8X A;  2D1H A;  4XNF A;  2K9M A;  3K1P A;  4B47 A;  1HA8 A;  2L9N A;  1ORK A;  1MH3 A;  4P9U A;  5HOD A;  3SZP A;  3GUD A;  3RZD J;  2RNJ A;  2Q0O A;  3M07 A;  4EV0 A;  4M3B A;  1HXD A;  2F5C A;  4ON0 A;  3DKX A;  4DBQ A;  1HC8 A;  2XAF A;  3I4P A;  5E3M A;  1MKM A;  1GLN A;  3J81 K;  4ZJZ A;  1I6H J;  2EV5 A;  1OQY A;  2BV6 A;  4MEX F;  5AIP A;  1I1S A;  2E36 A;  2EZH A;  1F1Z A;  1WI3 A;  2HR3 A;  4IF4 A;  4N9I A;  2D5V A;  4RM2 A;  2NS0 A;  3CCS I;  3J80 Z;  2W4S A;  1W1W E;  1T2K A;  2OJE D;  2LP0 A;  2DQR A;  3IHU A;  3CC4 I;  5CVJ A;  3E97 A;  3HJE A;  2DA1 A;  4A3E J;  1I39 A;  2Y2Z A;  2X9D A;  3ABM H;  1RPW A;  2VKH A;  3VSL A;  2Y9Y A;  1PP7 U;  1JUM A;  3I5U A;  5E17 F;  5D8K B;  1QBJ A;  4A0Y A;  5B66 C;  3BOQ A;  1FT9 A;  1IN4 A;  3G71 I;  4RGX A;  2HOS A;  1D1A A;  1OCZ H;  1X1A A;  2EQR A;  2F4I A;  4S04 A;  2VT3 A;  4M3D A;  4UVC A;  1VQK I;  5F0C A;  3P9K A;  2ZC2 A;  4CGZ A;  1NHA A;  2KHM A;  3E6C C;  2ZSI B;  4XRS G;  1K78 A;  2JSP A;  2KT0 A;  5CVU A;  2TCT A;  3WHB A;  3S1R J;  1QU3 A;  3I59 A;  5CQE A;  5LLQ A;  4EJU A;  2N8G A;  1FNN A;  2FBK A;  2DA6 A;  3GTK J;  3OOU A;  3H0D A;  2M34 A;  3CD6 I;  3GME A;  3OY9 A;  1BIA A;  1V55 H;  4P55 A;  4PJ0 C;  4BH9 A;  2EFN A;  5CLS A;  4M73 A;  4CDG A;  3D5L A;  1KGS A;  2XHK A;  5JLX A;  3CCM I;  2CFX A;  2LF8 A;  3BR3 A;  3GCM A;  4XKV A;  1ZRE A;  3R61 A;  3K4K A;  1Z7U A;  4Y17 A;  3J81 Z;  3EQL F;  4XLN F;  1YJN I;  2DMP A;  4OWR B;  1IGN A;  4NB5 A;  1QPM A;  2CUJ A;  1HST A;  2KPM A;  3DPL C;  3JTH A;  1K4T A;  1HKT A;  1UB9 A;  2NXN B;  2XAG A;  3Q9V A;  4DZP A;  5D6F A;  2BW3 B;  5FRO A;  5D5V B;  3GBG A;  1GT0 C;  4PJM A;  4LG0 B;  3E5X A;  3C1D A;  1B4A A;  1PP8 F;  4UB8 C;  3TO7 A;  4BY7 J;  1X3Z B;  3FZV A;  4L0Y B;  4N0B A;  1NG6 A;  4DIQ A;  1YYV A;  5HVQ C;  2E7X A;  2WAF A;  3GYH X;  2DAO A;  3WTU C;  2X0L A;  4CZC A;  1I5Z A;  2D1V A;  3BZK A;  2FOK A;  1Q1V A;  1GHC A;  3KLN A;  3C2G A;  1R5I D;  1SMT A;  1SVO A;  2BE5 F;  2M2E A;  1W36 C;  1HQC A;  2OUM A;  3LAP A;  1IDY A;  2YUS A;  3OOP A;  3QWL A;  1LDD A;  3NQO A;  4I01 A;  2EJR A;  3DEE A;  3BWG A;  3TDU C;  1JKR C;  2MSY A;  1W5S A;  4BQN A;  4U7B A;  4OIR F;  2OTL I;  1Z3Y A;  2QF7 A;  3PIP F;  1O3Q A;  2LKS A;  3FDY A;  3S16 J;  3ZQG A;  4KT6 A;  5EG0 B;  3FXO A;  1SFX A;  3Q0W A;  5KAF C;  3WG7 H;  1T95 A;  3EUH C;  3ZQI A;  2BEO A;  3N4M A;  4Y33 A;  3JSO A;  5J1U A;  3L2W A;  4B09 A;  5E8G A;  2R7T A;  3LFK A;  4HSR A;  3ROU A;  5GTI C;  2X1D A;  3JAM K;  2DBB A;  1Y56 A;  4XLC A;  4XKB A;  2L7F P;  2ID3 A;  2QGU A;  2EIK H;  1UG2 A;  3I71 A;  2P5V A;  2Q2E B;  1OJL A;  5CPR B;  1W5C C;  2AQE A;  3FHN A;  4LMY A;  1TNT A;  2ICW G;  1Z91 A;  2IA0 A;  4JX6 A;  4BAY A;  4KMF A;  2E19 A;  4CA0 A;  1XN7 A;  1MD0 A;  3L2R A;  4KIT B;  1BJA A;  1HSJ A;  4A3I J;  1BR2 A;  1ON2 A;  2P5K A;  2QQ9 A;  3QYB A;  4WWC A;  2ME6 A;  3LNQ A;  2WA0 A;  1XMK A;  3GTQ J;  1MJB A;  1V5E A;  2O0Y A;  2ZJR F;  1WJD A;  4V2G A;  1T0F C;  2EIL H;  2R3S A;  3TOB A;  2HOE A;  2ECB A;  2JZY A;  3I4M J;  3F21 A;  1WCM J;  3CUQ C;  3VYR B;  3H1C A;  1Z21 A;  4MO7 A;  3JRC A;  1J59 A;  1R1U A;  4KT5 C;  5F04 A;  2DA7 A;  1EJ9 A;  2ZNZ A;  3HIF A;  3K4B A;  2XF7 A;  3GZN B;  4WCG A;  4XMY A;  4BHP A;  1WJE A;  1YW7 A;  3DXJ F;  1FBU A;  3F8N A;  3WTZ A;  1QZY A;  3TGN A;  4E4H A;  4A93 J;  2E7W A;  3PNT A;  3Q3S A;  5B1B H;  2NNN A;  4HDU A;  1OPC A;  2ELK A;  3ZR8 X;  3J7A Y;  1V4R A;  4HRI A;  3RYP A;  2HPM A;  2NOJ B;  3DTI A;  4M3E A;  2BW3 A;  5L3B A;  4XKW A;  4EM2 A;  4HF2 A;  1ZGJ A;  1ZGA A;  4BJ5 C;  4LG0 A;  3OS0 A;  3ZRG A;  1EH6 A;  3DQV C;  1LEA A;  1P92 A;  4M71 A;  1ZG5 A;  5EZH A;  3X2Q H;  4FTH A;  1R1V A;  4ESB A;  4Y15 A;  2ZXH A;  2RNG A;  2VQL A;  3VB2 A;  5BS6 A;  2LSO A;  1K61 A;  3BR6 A;  3V8K A;  3JAM Z;  3COA C;  3ZQH A;  3CJQ B;  3PSF A;  4HF1 A;  1IDZ A;  4D1Q A;  2FX0 A;  1WSU A;  4XLF A;  1XGM A;  9ANT A;  5BOX A;  5GTH C;  3CC7 I;  2PJP A;  1UEL B;  4PFP A;  4A3J J;  3KYD B;  2P4W A;  4G7Z F;  1K83 J;  1AHD P;  3VYS B;  3FBN B;  3KP6 A;  3QPS A;  3PM1 A;  3CDH A;  4ENJ A;  2IAI A;  1S9H A;  2HQ5 A;  3HRU A;  4ZDP A;  2EK5 A;  2RN7 A;  3HZJ A;  3W2A A;  2FNP A;  5BNG A;  1QRY A;  2VXD A;  3R4K A;  1R1T A;  3V42 A;  5EG0 A;  3PFY A;  2ZME B;  3VOE A;  1UAA A;  1ZAR A;  3S14 J;  2VC0 A;  1WWX A;  1J0R A;  3AL0 B;  3JRG A;  3FXQ A;  4EVI A;  3B6A A;  1S7E A;  3WE2 A;  2A6H F;  2VQC A;  4DBR A;  1QPI A;  4BE1 A;  3QPL A;  4JK1 X;  3S2W A;  4ZYD A;  4R79 A;  2OAZ A;  3WTX C;  2Q2E A;  1P6R A;  1JI8 A;  3IKT A;  3T8R A;  3CCR I;  1MBF A;  1RC9 A;  2Y0M A;  3L1P A;  1U6G A;  2HI3 A;  2QKM B;  2Y0S N;  3J7A O;  3QU6 A;  2L7M P;  3FMR A;  2LLK A;  2MC4 A;  1U8R A;  1IRF A;  1FY7 A;  3QU3 A;  2MD0 A;  5LFA A;  2FE3 A;  3DBL B;  5E1W A;  4C30 A;  4FE7 A;  3IL2 A;  2KRF A;  3VWB A;  1NK2 P;  3DEW A;  4BY1 J;  2CFO A;  3LA2 A;  3D5R C;  5K7H A;  3OYC A;  2KLO A;  3H35 A;  4KIF A;  1WFX A;  6PAX A;  4G7H F;  1TQM A;  2DOD A;  5DV5 A;  2LY2 A;  4G7O F;  2PX9 A;  4HX8 A;  1JTX A;  1E2X A;  3LQQ A;  3I64 A;  4QPO A;  5GAE J;  4I6Z A;  3PO2 J;  1Z1D A;  1DGW Y;  5B3S H;  1SD5 A;  1KYZ A;  2P8T A;  3Q0U A;  4HPQ A;  4KMU X;  4XKC A;  3IH3 A;  1QHH D;  2VOO A;  2X6Y A;  3FKJ A;  1R4M B;  3S93 A;  4BDY A;  4A3K J;  3ZP5 A;  2VBY A;  2ISZ A;  1W7P D;  3ERM A;  1XS9 A;  4S05 A;  4L5J A;  1EV7 A;  4IHW A;  3MKY B;  3FM5 A;  4KA4 A;  3PUF A;  2CQQ A;  2YR2 A;  3W6V A;  3BZC A;  4IHV A;  4AD9 A;  1TL8 A;  2QKL B;  5AON A;  2FOW A;  1ZN2 A;  2XPW A;  3L7W A;  1QHG A;  2IGN A;  3EUK L;  5J47 A;  1OCP A;  2EBI A;  3A02 A;  1BI2 A;  1ZR4 A;  4RAF A;  3H36 A;  1Z05 A;  4XOT A;  2LG4 A;  2QQ8 A;  2JA2 A;  2FSW A;  3HTS B;  3N97 A;  2BGC A;  2L4M A;  4LB6 B;  4I0A A;  4UNO A;  1HDP A;  1MNE A;  4LIU A;  2NVQ J;  1W5T A;  3F22 A;  4LGW A;  1E3P A;  1UJ8 A;  1DPU A;  2HKX A;  4AIJ A;  2OQR A;  3W6J B;  5IP6 A;  2CO5 A;  4OAY A;  1VQ7 I;  2AO9 A;  3KZZ A;  4XRS A;  2ZFU A;  1RKW A;  4A3M J;  4BXF A;  3ECH A;  1B9M A;  4P9F A;  4DQ2 A;  2DDA A;  3SDB A;  4YFK F;  2ZME A;  3KP4 A;  3P5J A;  5TRD A;  5K7F A;  3MD2 A;  5DD4 A;  2L0K A;  1ITY A;  3IRR A;  3NEU A;  1WPK A;  1FBS A;  3R6S A;  1VQP I;  4IRI A;  1FLI A;  1XSX A;  2GOX B;  2DU9 A;  2DXI A;  2B0L A;  3JW4 A;  1U5T A;  5F6F A;  1VTN C;  3SFI A;  2XC7 A;  4EJW A;  1IN7 A;  1LFP A;  1YX3 A;  1RR8 C;  5M5X J;  1P7I A;  2ID6 A;  2O3F A;  1J9I A;  1IRX A;  3W2W A;  2LNB A;  1FJL A;  4BQA A;  1J7K A;  2JA7 J;  1O4X A;  2ECC A;  3GFI A;  2STT A;  3HG9 A;  3F8C A;  1T8I A;  1Z0X A;  2HDC A;  3AG2 H;  1E0E A;  2LH9 A;  2M45 A;  4ENN A;  1QGP A;  3JRF A;  3LSJ A;  4ZYA A;  2NVU B;  2BXY A;  3I53 A;  2DA4 A;  2FQ4 A;  1TLH B;  2X6O A;  1KQ8 A;  2NAZ A;  4BXX J;  1J09 A;  2PJR B;  4CCM A;  3OSF A;  3SZT A;  1B9N A;  3CMM A;  2IP2 A;  3W3C A;  2HYF A;  2KMU A;  2KQR A;  4KNY A;  1IJW C;  3KP2 A;  5AIQ A;  4KJZ A;  3RKX A;  3OYI A;  3HB9 A;  3D0S A;  4BJ6 C;  5EYR A;  1UZC A;  4UUV A;  3PSI A;  3CDL A;  2V26 A;  2P7V B;  3BY6 A;  1IUF A;  3E3V A;  3BR1 A;  1KQ0 A;  2AXT C;  3M4O J;  3CCE I;  2GXB A;  4BQO A;  5HS8 A;  2V1X A;  2CSO A;  2K7L A;  2IS2 A;  1D0Z A;  2CG4 A;  2MLK A;  5C4X J;  3OYA A;  4RB3 C;  3PNV A;  4CZZ A;  1GVJ A;  1Z6T A;  1T56 A;  4E6K G;  4A3C J;  1I1G A;  2HS5 A;  1LVA A;  3U9G A;  3SZG A;  3FXK A;  3HOX J;  4YFX F;  3OYF A;  5J1R A;  1FP2 A;  1R36 A;  2LRD A;  5FD6 A;  3EYY A;  4AIK A;  2DT7 B;  1VQ4 I;  3I58 A;  2E1M B;  4FET A;  2WTE A;  4GYG A;  1VFC A;  4XM3 A;  2NVX J;  2LC2 A;  4L9N A;  2R7O A;  5DYM A;  2E2J J;  1R7J A;  3R60 A;  5L3E A;  2WY7 Q;  3H9Q A;  4RGR A;  3QYF A;  3PNY A;  2ZKZ A;  2DOF A;  4HLY A;  3TED A;  4KIS A;  3TO9 A;  3HSF A;  2I5U A;  3HOY J;  3BLY A;  3T0Y A;  4EGZ A;  4KYW A;  4A5M A;  4L9T A;  3M8E A;  4XLP F;  2VXZ A;  2EV0 A;  1LNW A;  2AQF A;  2KIQ A;  5JHF A;  3BT9 A;  4RB1 A;  2DMQ A;  2BOL A;  5E3O A;  2E1N A;  3DKY A;  3RZO J;  2QSH X;  4LOC A;  1HLV A;  3VEP A;  1YE9 A;  1WVR A;  4EJO A;  5JI6 A;  3O8H A;  1O7L A;  2R93 J;  1QO0 D;  1AOY A;  5LRS A;  4IQJ A;  1R5G A;  2E5Z A;  3L09 A;  4AVZ A;  4YIF A;  3CLQ A;  1UFM A;  5JFR A;  2V6C A;  1B8I A;  3BR5 A;  3C2H A;  3MEX A;  1OCT C;  1GV2 A;  2J5O A;  1E17 A;  4PGG A;  4LB5 A;  3OSG A;  4XLE A;  5JLW A;  1CGP A;  1X4P A;  1HOM A;  4RMN A;  2OZ6 A;  1TQP A;  3SQN A;  1N77 A;  1P7J A;  4GGG A;  2F5V A;  2VKE A;  3I59 B;  3RTR A;  4HOB A;  4OIQ F;  1OYW A;  1IN6 A;  1Z6R A;  3HHH A;  4XRF A;  3BCA A;  1IV6 A;  2DMU A;  2V1D A;  1D5Y A;  1YTY A;  5E18 F;  2QLZ A;  2DOA A;  5H2F C;  4IHY A;  4AYB N;  1SD6 A;  2E71 A;  3U21 A;  3K2Z A;  2HEO A;  4E7Z A;  2UUZ A;  3HYI A;  3KP5 A;  5LEJ A;  5GAG J;  3JRH A;  3OR1 C;  2OD5 A;  3ZMV A;  3O8G A;  3CP2 A;  4NHJ A;  3K6G A;  4IOC F;  4E7H A;  1XSD A;  1RI7 A;  1KU3 A;  5D4S A;  3KEQ A;  3F8F A;  3HPG A;  4D5F A;  2LYC A;  3DKW A;  3JRA A;  2ELJ A;  4F92 B;  2VL8 A;  2M87 A;  5H6R A;  3HXL A;  5EZG A;  2K9Q A;  1LPQ A;  5FKK A;  2JVH A;  1RKT A;  3K4C A;  2RC4 A;  1J2X A;  3FKI J;  1XGO A;  2CWE A;  2VAS A;  1D3Y A;  4L5E A;  1ETO A;  1ETQ A;  2DW4 A;  4MLO A;  3U1K A;  4R8H A;  1IRG A;  3RPU D;  1YS7 A;  2A05 A;  2FD5 A;  5F1J A;  3DFG A;  1D1C A;  2IVM A;  1NG7 A;  2M8E A;  4AWX B;  3E5U A;  3OYM A;  3E6M A;  5FJ8 J;  4EGY A;  4ETS A;  1YJW I;  2CW8 A;  2PMZ N;  2QSG X;  2E2H J;  2RV8 A;  1ULY A;  3EYI A;  4EEF G;  3HOT A;  4QWQ A;  2DK5 A;  4BL0 B;  2KIM A;  4HBL A;  5FRM A;  5EF6 A;  2A69 F;  3LQR A;  1JKQ C;  2BBY A;  1X1C A;  2VN2 A;  4XID A;  1MBE A;  3GF2 A;  1BR4 A;  3JR9 A;  1YX5 A;  1MIJ A;  4IHT A;  1RNL A;  4V19 K;  3KE2 A;  3DP7 A;  3TP3 A;  5TIS C;  3FXR A;  1YG2 A;  1JGS A;  3AFH A;  1PYV A;  1K79 A;  5L3C A;  2R7R A;  2MA3 A;  2EIN H;  3WTS C;  3BPX A;  1O3T A;  1T08 B;  2Q8K A;  2Z99 A;  2LKP A;  5BMZ A;  3LSG A;  4CCK A;  1Z67 A;  2HQR A;  2XVC A;  2ME0 A;  2ZJQ F;  2VKD A;  1BR1 A;  2RRE A;  1VND A;  4MFD A;  1TWG J;  4YFN F;  4U87 A;  3SHF A;  1KU7 A;  2HZD A;  2KKO A;  3L00 A;  2O8X A;  1Y1V J;  3KFW X;  1R49 A;  4NC7 A;  3BTI A;  3VOD A;  4BKX A;  5J8C A;  1IO2 A;  4K2E A;  2QZ8 A;  1ZLJ A;  2MLG A;  4E7K A;  3RCO A;  5FRN A;  4QIW N;  2L7Z A;  3K7A J;  3WU1 B;  3HKZ N;  2O61 A;  1XTA A;  1F5T A;  5L3G A;  3GWZ A;  4D0P A;  2K4J A;  4CYD A;  1EA3 A;  3JRB A;  1PVE A;  3BG7 A;  5LGN A;  1XB4 A;  4M9S A;  5H6Q A;  1B72 B;  1QVU A;  2XAQ A;  4DJA A;  3FWE A;  3D1N I;  3JRE A;  2GA1 A;  4CO8 A;  5IPA A;  1IXS B;  3K10 A;  1ZGW A;  3KZI C;  4MEY F;  1IN8 A;  1ETY A;  4F7Z A;  1FC3 A;  3HL2 A;  4A6E A;  3CQZ J;  3IV5 A;  4E7I A;  3BTC A;  1ZH5 A;  1M1E B;  2DYS H;  3MZY A;  4CCL A;  4NUB A;  2DFI A;  4X1E A;  4AID A;  1BJZ A;  3IKV A;  3MWM A;  1GVD A;  1XPX A;  3H0G J;  4UV9 A;  5GP9 A;  4YEL A;  3ZMU A;  3G1M A;  2ACJ A;  4ESJ A;  4RLF A;  1VQN I;  2PFB A;  2H8W A;  1F9N A;  5J6X A;  2FBI A;  4XBF A;  3I9V 2;  4UB6 C;  2E1C A;  4LG3 A;  4RS8 A;  4W1U A;  1ZKG A;  3CF2 A;  3EDP A;  3KIO A;  2DYR H;  3QOE A;  5DEQ A;  2LD5 A;  1G4D A;  2L9R A;  4PSX A;  1FP1 D;  4GRI A;  1FOY A;  2HVR A;  2EZI A;  1VQO I;  2GOM A;  3PIO F;  1E3H A;  2LY1 A;  2R7W A;  2DTZ A;  4AYB A;  3IRQ A;  3H5A A;  2L5Q A;  2FNA A;  3G1L A;  5IP9 J;  2BZT A;  1HDD C;  2JSC A;  3BTL A;  2W57 A;  2IW5 A;  2M4G A;  4IRH A;  1MBH A;  3FXU A;  3AG1 H;  2KIS A;  3BJ6 A;  4M6X A;  5IT3 A;  3WE3 A;  1SAN A;  4HST A;  3CME I;  2XGC A;  4LJZ F;  4KN4 X;  5E3L A;  1U2W A;  1EF4 A;  1WJB A;  1UMQ A;  2PLY A;  2A68 F;  1IXC A;  4B1R A;  1AWC A;  4C3J J;  2J5P A;  1H9G A;  4HYE A; 
#chains in the Genus database with same CATH homology
 1N78 A;  3AL0 B;  2X6X A;  3G2B A;  5HNF A;  1FMV A;  4XQF A;  4DGW B;  4ITV A;  2VQC A;  4DBR A;  3SEQ A;  4BE1 A;  4J01 A;  3A4C A;  3S8P A;  2V6E A;  4R79 A;  4RM3 A;  2IXS A;  3A2K A;  2R7S A;  3A1Y A;  1Z3X A;  1JI8 A;  1G59 A;  3AL0 C;  1LVK A;  2XF5 A;  1MW7 A;  3F9K A;  3H9J A;  4BS9 A;  2QKM B;  3NWT A;  4XN0 A;  3BG6 A;  2MC4 A;  2XAU A;  1LDK B;  3HC7 A;  1MMA A;  2MD0 A;  5LFA A;  3ZXS A;  1X1D A;  1AA7 A;  3PL8 A;  4C30 A;  2R7Q A;  2DJI A;  3OYB A;  4J00 A;  2HDW A;  3VWB A;  2W1O A;  4II3 A;  3FBI B;  3DLA A;  2CFO A;  3K4M A;  4X0G A;  3D5R C;  4BUP A;  3VDX A;  3PJR A;  3OYC A;  2KLO A;  3OL3 A;  3H35 A;  5TGT A;  1FMW A;  4PFO A;  3H9G A;  1WFX A;  4QPQ A;  4C2T A;  3OYE A;  2WY8 Q;  4CSW A;  2VJI A;  3ZCO A;  2WBM A;  2VQH A;  2LY2 A;  1D0X A;  3DU6 A;  3OWT A;  4PJN A;  4QPO A;  3AKZ A;  1PJR A;  2Z16 A;  1DGW Y;  3OYN A;  3BCB A;  3K4N A;  4HPQ A;  2XSJ C;  4XKC A;  4P5O A;  1QHH D;  3ZQQ A;  3OS1 A;  1WJA A;  2X6Y A;  3FKJ A;  3K4L A;  3S93 A;  4BDY A;  4B43 A;  1OR7 C;  2VJ4 A;  4XL9 A;  3EUA A;  1X1B A;  3HKZ A;  1SAU A;  3IUO A;  3QYE A;  3MKY B;  3LL7 A;  4NQW B;  2W82 A;  2CMP A;  4BJT A;  3K4J A;  3IAS 2;  4G6T B;  3D5S C;  3E0J B;  3SYT A;  2QKL B;  3W2V A;  3KEY A;  1QHG A;  3K70 C;  2JVG A;  4PJL A;  2IGN A;  3EUK L;  2XF6 A;  2CV2 A;  3CP8 A;  2OC6 A;  1X4O A;  3LFU A;  3HOS A;  1WJF A;  3M1C A;  4XOT A;  2IGM A;  2LG4 A;  2JA2 A;  1D0Y A;  2KP6 A;  3OR2 C;  3TMO A;  2Z1D A;  2CUZ A;  4B44 A;  1KON A;  4LIV A;  3MKZ A;  3LSH A;  1MNE A;  4LIU A;  2KZV A;  2HNH A;  2LRE A;  4CCJ A;  4E7L A;  2VIX A;  4IX7 A;  1R6R A;  3QOD A;  4OAY A;  1LKX A;  2IS6 A;  2ZFU A;  2CS3 A;  3DTK A;  4BE2 A;  4XN3 A;  4BXF A;  4OAZ A;  3SDB A;  4ZDO A;  2R7V A;  3MKW B;  3MD2 A;  3LSK A;  2GOX B;  3VSK A;  1TT0 A;  2KRC A;  2DXI A;  1V5G A;  2IGO A;  4YEJ A;  2XC7 A;  2CW7 A;  2UV1 A;  1LFP A;  1YX3 A;  3L2V A;  2PJR A;  1IRX A;  2ZXI A;  3W2W A;  5HOO A;  3HG9 A;  4XLH A;  4CH7 A;  4C2U A;  1TZL A;  4E7J A;  1E0E A;  4BGD A;  3VYT B;  2LH9 A;  2V9K A;  4H4K C;  4XLA A;  4ZYA A;  2VB6 A;  2VPL A;  3ZGK A;  2MFZ A;  1J09 A;  3LSM A;  3ONQ A;  4AU7 A;  4CCM A;  2R4G A;  4XNF A;  2PJR B;  4HNU A;  3CMM A;  2A5W A;  2K9M A;  2PMZ A;  3W3C A;  2KMU A;  2KQR A;  1ZEL A;  4B47 A;  1DP3 A;  1HA8 A;  4KJZ A;  2L9N A;  3OYI A;  3S3N A;  4BJ6 C;  3DPU A;  2M4K A;  3PSI A;  2V26 A;  4PK4 A;  2M0M A;  4BEH A;  1MMG A;  2V1N A;  2W00 A;  3DKX A;  4BQO A;  4BDZ A;  4HNT A;  3K70 D;  4DBQ A;  2IS2 A;  4RLQ A;  1D0Z A;  4PUS A;  2K5C A;  3OYA A;  1GLN A;  2I8D A;  2M3A A;  3PNV A;  2M7B A;  4ZJZ A;  4E6K G;  4LIT A;  2L9S A;  3SZG A;  4BEH B;  4RM2 A;  3LSI A;  3OYF A;  4XOP A;  4BQQ A;  4P1W A;  5LD2 C;  2W4S A;  2CH0 A;  2LRD A;  1K6Y A;  1Y6I A;  3VYU B;  2DT7 B;  2V7F A;  2E1M B;  4FET A;  4XM3 A;  2BVM A;  2LC2 A;  2R7O A;  3OS2 A;  2VKH A;  3VSL A;  2CV1 A;  1VZ0 A;  2WY7 Q;  1ERD A;  3H9Q A;  3QYF A;  3PNY A;  1D1B A;  4NNJ A;  1DGR M;  4CCO A;  4Y3O A;  4KIS A;  5CKT A;  3DTE A;  3BLY A;  3L2Q A;  2VXZ A;  3CJR B;  3NWS A;  2BVL A;  4F91 B;  2AQF A;  1D1A A;  1X1A A;  5JHF A;  4N4N B;  2F4I A;  2BOL A;  3DKY A;  2IS4 A;  2M7A A;  3KX2 A;  3LMM A;  3MMY B;  2KHM A;  2ZSI B;  1YE9 A;  2JSP A;  4N4O B;  1QU3 A;  2P0W A;  5CQE A;  4PSW A;  4IKF A;  4IQJ A;  2E5Z A;  4XR6 A;  2L2O A;  4AVZ A;  3OOU A;  3H0D A;  3OY9 A;  4ZTF A;  2W7N A;  2X1C A;  1P9Q C;  3C2H A;  4ZDL A;  1DQU A;  3EPZ A;  4IZZ A;  3UR3 C;  4XLE A;  4HEA 2;  1X4P A;  3CES A;  3D5L A;  4RMN A;  1N77 A;  4XKV A;  3K4K A;  1MMN A;  2F5V A;  3RTR A;  2X85 A;  4ANJ A;  1SFK A;  4OWR B;  3BCA A;  4DOZ A;  2CUJ A;  2KPM A;  3DPL C;  3S3M A;  2DOA A;  2LBF A;  1OLT A;  3U21 A;  2DT6 A;  4E7Z A;  2UUZ A;  2BW3 B;  2MYS A;  5FRO A;  3OYD A;  3GBG A;  4ZC3 A;  2F6C A;  3OR1 C;  4PJM A;  2FUG 2;  3E1S A;  3CP2 A;  3K6G A;  4E7H A;  5KCM A;  1NG6 A;  4DIQ A;  5HVQ C;  2WAF A;  3HPH A;  3UNG C;  4CZC A;  3TBI A;  3N05 A;  3HPG A;  4JOM A;  2LYC A;  4CUG A;  2K3P A;  2ELJ A;  2LBF B;  4F92 B;  2Q1Z B;  2OV7 A;  3C2G A;  2VL8 A;  4XON A;  2KL4 A;  1N75 A;  3HXL A;  3CZ6 A;  4ZTJ A;  1W36 C;  3HUG B;  3PUB A;  2JVH A;  2OUM A;  3K4C A;  4II2 A;  3IP4 B;  4XOR A;  2VAS A;  3OIP A;  4BAC A;  4MLO A;  3DEE A;  3RPU D;  4JQF A;  1UG0 A;  3S32 A;  4BQN A;  4U7B A;  2IGK A;  1U0J A;  1Z3Y A;  3OYK A;  1D1C A;  1NG7 A;  3OYM A;  2O5R A;  2CW8 A;  2Y0S A;  3HOT A;  4F93 B;  4BL0 B;  3FDY A;  5FRM A;  1X19 A;  4B3X A;  4KT6 A;  2X1E A;  2V4J C;  1T95 A;  3EUH C;  1X1C A;  4CCN A;  4Y33 A;  4Y4R A;  3L2W A;  1BR4 A;  1YX5 A;  5CQG A;  4HSR A;  4F52 A;  2KRH A;  3OL4 A;  2E60 A;  1MND A;  2KDO A;  2R7T A;  2X1D A;  4EAT A;  4B48 A;  2HU9 A;  3AFH A;  1PYV A;  4XLC A;  1Y56 A;  4IQ4 A;  4BU2 A;  2R7R A;  1Z7L A;  4XKB A;  2WAE A;  3BC8 A;  2Q2E B;  4D9J A;  5CPR B;  5KNL A;  2L7K A;  1G8X A;  2A6T A;  2AQE A;  3LSG A;  3FHN A;  4CCK A;  2VKD A;  1BR1 A;  2RRE A;  4BE0 A;  4U87 A;  4CA0 A;  2HVS A;  2HZD A;  3RSN A;  2UWM A;  2VJ5 A;  3L2R A;  2CV0 A;  3DWL E;  4KIT B;  3OYJ A;  1BR2 A;  3QYB A;  5KHD A;  2VQG A;  3M8J A;  2WA0 A;  4NC7 A;  1V5E A;  3H5N A;  2X6W A;  1WJD A;  1T0F C;  4E7K A;  2E1M C;  3RCO A;  3L2U A;  5FRN A;  4YRV A;  1V5F A;  4NC8 A;  3H5R A;  2VLA A;  4HG2 A;  3VYR B;  1Z21 A;  1EA3 A;  2VJJ A;  3BG7 A;  3TL4 X;  2X51 A;  3S3O A;  3K4B A;  2Z2S B;  2XF7 A;  4DJA A;  4XMY A;  1WJE A;  1WJ5 A;  5HLT A;  4F3Q A;  3K10 A;  3OYH A;  4E4H A;  3HL2 A;  3PNT A;  5HNH A;  4E7I A;  2ZSH B;  2WAQ A;  1WJC A;  2E5N A;  3ZR8 X;  2MAB A;  3OMY A;  3OYG A;  1W36 D;  3J7A Y;  4CCL A;  4HRI A;  2HPM A;  2NOJ B;  4NUB A;  4C9Y A;  3DTI A;  2BW3 A;  4XKW A;  4FAS D;  3DPT A;  4BJ5 C;  3OS0 A;  3ZRG A;  4PJJ A;  3DQV C;  4YEL A;  2WB1 A;  2JUG A;  2DCE A;  2RQQ A;  2ZXH A;  2RNG A;  2VQL A;  3RQ4 A;  4RLF A;  2WAD A;  2XDV A;  3DU5 A;  3CJQ B;  3PSF A;  2IS1 A;  4D1Q A;  3I9V 2;  4LG3 A;  4XLF A;  3CF2 A;  2HPI A;  3QOE A;  4E7S A;  1UEL B;  4PFP A;  2R7X A;  4PSX A;  4GRI A;  3KYL A;  2HVR A;  2GOM A;  2LY1 A;  3FBN B;  3VYS B;  2R7W A;  4AYB A;  3SEZ A;  3H5A A;  2L5Q A;  1MMD A;  2HVQ A;  4F55 A;  2M4G A;  1S9H A;  3I3L A;  4ZDP A;  3IAM 2;  1BOB A;  3W2A A;  2HQA A;  4HST A;  1WJB A;  2VXD A;  3OYL A;  2K9L A;  3V42 A;  2R7U A;  3PFY A;  1UAA A;  3OIQ A;  2LOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...