1SAUA

The gamma subunit of the dissimilatory sulfite reductase (dsrc) from archaeoglobus fulgidus at 1.1 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
114
structure length
114
Chain Sequence
b'PELEVKGKKLRLDEDGFLQDWEEWDEEVAEALAKDTRFSPQPIELTEEHWKIIRYLRDYFIKYGVAPPVRMLVKHCKKEVRPDCNLQYIYKLFPQGPAKDACRIAGLPKPTGCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sulfite reductase, desulfoviridin-type subunit gamma
publication title Determination of a novel structure by a combination of long-wavelength sulfur phasing and radiation-damage-induced phasing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 41
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1sauA02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1sauA01
1SAUA 2XSJC 1JI8A 3OR2C 3OR1C 1YX3A 2V4JC 2A5WA
chains in the Genus database with same CATH superfamily
4ESBA 1IV8A 3A02A 3TP3A 2QENA 3B6CA 4BL0B 2BYVE 3I4MJ 3HDDA 4LLNA 4LG0A 1IC8A 2XAJA 5BQTA 2LY2A 1R58A 4PFPA 4BEHB 3I58A 1TW3A 4G6TB 3WTVC 1MBHA 2ZNZA 3K70C 2WV0A 2UXXA 2C6YA 2KIUA 4IVNA 3S3OA 2EZKA 1HLVA 2A69F 1WJ5A 5FJ8J 1FYKA 3N05A 3G1OA 4RA2A 2LF7A 4FE4A 3HKZN 3BJ6A 1ETVA 3M8FA 1X1CA 3I5UA 2QBYA 5GTIC 3MKWB 4GCVA 4C2MJ 1FJLA 4RM3A 4P9UA 1MMSA 1Y0UA 2M8EA 2M5WA 3HHGA 4HYEA 4BQNA 2CYYA 3OYAA 3WHBA 2R4GA 4D7NA 3ZQIA 1S72I 4L0ZB 5BPDA 2CH0A 3EQLF 2HKOA 3CJTB 2VLAA 5LRSA 3FHZA 1MJAA 1IXRC 4XR6A 1AKHB 4G7ZF 4RB3C 1SD4A 2VQLA 4R1HA 1X58A 2IEKA 5LGUA 1BIBA 2EILH 4FE7A 3NAUA 3RTRA 3L2UA 1YHQI 4HNVA 4U88A 3R4KA 2ZKZA 3FK7A 1MIJA 3I71A 3R0AA 1XGSA 1POGA 2QF7A 1QHHD 1DP7P 4WXDA 1EA3A 2E5ZA 2WB1A 3HUGA 1K83J 2FOWA 4NQWB 3JSPA 1IF1A 1JUMA 5CVJA 5TISC 3RSNA 4I2OA 2OZ6A 1Y0NA 1ZN2A 2XF6A 3K2ZA 2PJRA 2UUZA 5LHHA 4R79A 2HQNA 1HQCA 3DV8A 1RKTA 3OYMA 1Y8RB 3CMAI 1J5YA 5M5YJ 2XRLA 2NVXJ 5CQEA 1YW9A 3H1CA 4DIQA 4U87A 1WJAA 3LFKA 1AWCA 1LFUP 2Y31A 3KEOA 2A61A 2VE8A 4LMYA 2ZFWA 2PMUA 1O57A 5EZHA 2ELHA 2O8KA 4YELA 1KU2A 1HKTA 4XKVA 1WFXA 3OYIA 4Y17A 1YS7A 4ZYEA 3FXLA 4A5MA 2HU9A 4H4KC 4L9VA 3MZYA 1MMDA 2D1HA 5HNFA 9ANTA 3RQIA 4AIKA 2OCCH 4KN4X 4FQGA 4M6XA 3H0DA 1WWXA 3DPLC 3GLXA 2DT6A 2QKLB 1PYVA 2XV4S 2BHZA 4E7IA 1OCCH 2Y69H 5J4VA 5EEAA 3B73A 1R7JA 4M3DA 1WGXA 4EVIA 3OYEA 2G0EA 2ZJPF 3HOTA 2ZMEC 2EZHA 2JRMA 5KAIC 2DBBA 2KZVA 3CLQA 3E6MA 1NHAA 4XONA 4F55A 1SFXA 2EFOA 5D6EA 2MD5A 5GADJ 4CICA 2IS1A 4PGGA 2W48A 1N78A 3HBLA 4MQVA 1RZ4A 4XNFA 5DYMA 3VYUB 2XSDC 2JA6J 2HTJA 5E8IA 4MGRA 4PZJA 1CQTA 3HRUA 5TGTA 3I4PA 1ZG5A 5D8KB 2K4JA 5K7HA 1NH3A 4CHUA 1WHUA 3DCFA 4KN7X 3A01A 2K02A 3OIPA 5M3MJ 1O4XA 5IT9Z 4ZTFA 3D5RC 5JFRA 2RGVA 3QAHA 3FXKA 4WF2A 4Y4RA 1NTCA 2HKXA 1UHWA 1KU3A 3FHNA 4C2TA 2AXTC 1VQ6I 5IYDJ 2QGUA 2E1CA 3CC7I 1TWFJ 1F43A 2DA5A 1HW5A 2Y9YA 4I02A 3ZQQA 3BZCA 3RKQA 2L7MP 1D0ZA 1J0RA 3H9GA 3FBIB 3RJPA 2R5YA 1LE8A 5KK1A 1ZELA 2M1BA 4XRMA 1Z91A 1IXCA 4GO1A 1H89C 2GQQA 1IZ1A 3F8BA 1EH8A 4M6YA 4HZFA 3BR1A 4GFBA 5CYVA 5EF6A 1RUNA 1FTZA 2Y0MA 1U8RA 2DA1A 4RGRA 4EJUA 2H27A 1J59A 2X51A 1ZYRF 3KP3A 4IQJA 4HBLA 4BEHA 3CTAA 3HRSA 1R49A 4AIDA 2DW4A 5L3GA 3KP5A 4GXOA 2KT0A 2STWA 4DGWB 3C18A 4HAMA 3FKIJ 2X1CA 5H6RA 4BE1A 2OF7A 2V6CA 2XAFA 1FSHA 5IT3A 2Y0SA 5ICGA 3F72A 3BPXA 2JVHA 1YITI 4G6DA 4Y33A 3V7SA 5CVUA 2R7UA 2CS3A 3S14J 4FX0A 2DQLA 1T98A 3GFIA 5L3CA 1W36D 1JHHA 4BDYA 1FWZA 2AHQA 3K1NA 2V79A 2W7NA 2OBPA 3DKWA 1WJEA 4KUMA 4ENJA 1X2MA 3WHCA 1YW8A 1ZARA 4HLXA 1HKSA 4JQFA 5KHDA 4XKWA 5ERIA 2DA4A 2WAQN 1AKHA 4HDUA 2MABA 3GTPJ 2ACJA 3M7GA 4XSXF 4YFNF 4ZH4F 5FLVA 3ONQA 4L5EA 3AG3H 3CO7C 6PAXA 2HYJA 3VYSB 3SZPA 1B4AA 1ETQA 2J5PA 3GO5A 1XPXA 1RPWA 2EIJH 4DYRA 2YX4A 4IHTA 3B02A 4PSXA 3OIQA 3S17J 2DI3A 3RIRA 3ZMUA 1D5VA 4B48A 3IWFA 3ZQCA 3MKLA 5TRDA 2HZTA 3JRBA 3BY6A 5A2QK 4CGZA 4A3DJ 3F8CA 4EQQA 2ZMEB 3TOBA 4RAYA 3V8LA 5E1ZB 2VKVA 3CDLA 3PIOF 5FKMA 1V5EA 3GZ6A 3G73A 5LEKA 3RZOJ 4XQFA 1YLFA 2VBXA 2G7UA 2EZLA 3TDZC 2CQ7A 5DD4A 1DUXC 3W3CA 2OCEA 4L9TA 1IAWA 4A3BJ 3FWEA 2ISZA 1TTYA 2PI0A 1T33A 1P6RA 1C0WA 2LNBA 2IA1A 2KL4A 3Q0UA 4CO8A 1GXPA 1Y56A 2GBYA 3T8TA 4BXXJ 3K2AA 2XGEA 3VFZA 3I3LA 2W84A 4II3A 1N75A 5IOYA 4NC7A 4JOMA 3O8GA 2ZB9A 2DO7A 4F7ZA 1SFKA 4RS8A 2Y2ZA 3BLYA 1GLNA 2M8GX 2GXAA 2LY1A 2K4BA 4YEJA 2IS6A 3IH2A 5FB2A 4BHBA 3ECOA 1RKWA 1OYWA 1XMAA 1T6SA 1LUJB 1FBSA 2PLYA 1G2HA 3P5JA 1Y39A 2Z3YA 2IS2A 3LFUA 1OR7A 1YQAA 3L2WA 4EGYA 2DFHA 2CUFA 2H1KA 5J3LA 3I9V2 4Z2YA 4XLAA 5LHIA 3CF2A 4KIBA 2M4KA 3QQAA 2WB1N 2CV2A 2FUG2 3H5RA 5JLWA 3I59B 3FXJA 5FLMJ 3F6OA 5JLXA 1J9IA 2MW8A 1MMNA 2QKMB 3HG9A 2Q0OA 4HF0A 2A68F 1EV7A 2OD5A 2M87A 2XPWA 3QODA 1I1GA 2KFDA 2XVCA 2DQRA 3OYCA 1K6OA 1JJ8C 1Z67A 3ELKA 4L5IA 4ON0A 4A0ZA 1DP3A 2LDUA 2R7TA 4LGWA 3M8JA 1I27A 1MBFA 1R5ID 4IL6C 1ZH5A 4HX7A 3AKZA 2E2IJ 2DMQA 3FXOA 3PUFA 5GP9A 2Z33A 1JUSA 5E17F 4C9YA 3S1MJ 5AONA 4UB6C 4KITB 2QSFX 2I8DA 2M0CA 4II2A 4A0XA 1JGGA 1HW2A 2DDAA 1JXSA 4L5JA 1A36A 1V4RA 3BR5A 2M7BA 2CQKA 3F8FA 3Q9SA 1SEUA 4M73A 4IHVA 4LOCA 4YIIA 1Z21A 3P9CA 2F48A 2XKPA 2XAHA 4DBRA 2BY1A 4NNJA 1F4KA 4JK1X 2X6YA 4RB2C 2BVLA 2EB7A 3H9QA 4NC8A 4L9NA 1N77A 4GYGA 1BOBA 5E1WA 3ZN1A 3TOAA 1XCVA 4WWCA 1ETKA 1U5TB 3MN2A 3VPRA 1FZPB 1IRFA 3PL8A 4CCKA 4IZZA 1YX3A 1IUFA 4AYBN 5E3MA 1YJWI 2BW3B 4AWXB 4OIOF 4UUVA 1P7IA 3LNQA 1W5CC 3S8PA 1YIJI 1D5YA 5FLXZ 2DFEA 1TL8A 3CC4I 3TO7A 3OYFA 2HOSA 5LFAA 3NQOA 3ZQ7A 1ZLJA 4U7DA 1XX5A 1JKOC 5LGTA 1IG7A 2HOTA 3HIFA 3HYIA 1UMQA 4UV9A 5M3FJ 4HQEA 1EH7A 2FSWA 1QZEA 2Z2SB 2IXSA 1YX5A 5TJJA 3ZQHA 1T2KA 2LSOA 1QVUA 2MG4A 3IV5A 1T8IA 2Q2EB 3A1YA 2ZSIB 1JHFA 4RGSA 3FXRA 2HS5A 1U78A 1XSXA 4ASNA 4HRIA 2BGCA 1IN4A 1WH7A 1G3YA 2E1OA 4A6EA 1TNTA 3KZIC 4M9ZA 1MNMC 2HEOA 2JWTA 4M3GA 2E71A 3H36A 3ISPA 4KDPA 1GT0C 5BS6A 2L9RA 3F3XA 3P9IA 3E0JB 2P81A 4X1EA 4CZCA 3E6BA 3CCEI 5DDGA 3DPTA 2ZO4A 4Q48A 4B44A 2ETHA 1GUUA 5F1RA 5J8FA 2GOMA 2IGOA 2M0MA 4UVAA 2K3PA 2VIXA 2KMUA 1NG6A 1MJ9A 2QWWA 1XMKA 2VQHA 2ZMEA 3SZGA 2VBWA 2H94A 2XB5A 2LD5A 4YRVA 3KLNA 1ON1A 2R7DA 4BQAA 4M74A 4HF2A 2ELJA 4KMUX 2R7RA 2F6CA 5BPIA 2P7VB 4CUGA 1XCBA 4ZC3A 1E2XA 3E7LA 2E34A 4DW6A 1LNWA 3IHUA 5DV5A 2DA6A 2XAGA 2JA5J 2K5CA 1IJWC 2NVUB 5K1YA 4HPQA 1S5LC 2QQ8A 3ROUA 3F6VA 1ZRCA 5EJCA 3CMMA 3WGGA 2WV1A 4MQ9F 1OQYA 2DTZA 1G4DA 2FNAA 1FSEA 2L3DA 1P4XA 5KVRA 4KT5C 4PUSA 2WY7Q 4LB6B 4EV0A 4KT6A 2LR8A 2KLOA 4I01A 2CQNA 1QO0D 3G3ZA 3UNGC 2ZBKA 4N4NB 1G3TA 3E6CC 2HR3A 5EGOB 4D0PA 3LSMA 3HOYJ 2BY2A 2X1EA 4I98B 3JAMK 2OA4A 4GRIA 4RAFA 2XROA 1R5GA 4HNUA 3K69A 1R36A 4A3LJ 2V6EA 3PNYA 1USTA 1SD5A 3W2WA 5DTDA 4XL9A 1BC7C 2HZDA 2L9SA 3JRAA 2OU2A 1XN7A 1D0XA 1BC8C 5D5VB 3S1RJ 3G4SI 4Q47A 3ZQFA 3SXYA 2WA0A 5IP7J 1WZ2A 1R22A 1IRZA 2DDBA 2Q8KA 1K61A 3I59A 2QCOA 2HPIA 2YSRA 2DFIA 2CFOA 2XDVA 1I50J 3GFJA 2M3AA 3T0YA 1ACIA 2ZXWH 1OCZH 2XRNA 3HPGA 2PFBA 2IA2A 1RI7A 4Z6YA 4ZYGA 2AXLA 2D5VA 2V1DA 4OAYA 3REOA 1JT6A 3SQNA 3MFKA 4LITA 4PK4A 2JQ7A 4A3IJ 4HSTA 3HXLA 3M8EA 3PO2J 4RMNA 1AU7A 2A6HF 2E19A 2TDXA 2R5ZB 2H6CA 3K4BA 3MQ0A 1REPC 2NS0A 3S1NJ 1S7OA 2RDPA 2VJIA 4EJVA 3VOEA 4DQ2A 3PNVA 5KNLA 1P2FA 3P9KA 3MVPA 1O7FA 4ZZLA 1ZHFA 2DYRH 3DPUA 1JT0A 2EA4A 1TWGJ 2LF8A 2LOOA 2Y30A 2HXIA 1WJDA 2O3FA 2ADUA 2DA2A 3T5XA 3KFWX 1KQ9A 5LBQA 2IT0A 4U0WA 1T56A 2OQGA 3O2PE 3HSEA 1NG7A 3M1EA 2KDZA 1ZQ3P 1FY7A 3AG2H 1X4OA 4XM3A 2E1MB 3PFIA 1FOXA 4HOBA 3MMYB 4EEFG 4IOAF 2ZXHA 4B47A 2B9SA 4B43A 1U5TA 4L18B 3DQVC 3ULQB 3TQNA 2G7HA 2F5VA 3GW2A 2WTEA 1MKMA 1YTYA 1JKRC 3ECHA 2LP0A 4I76A 2M7AA 1I3QJ 3J80Z 3WTSC 4LK0F 4I09A 4YIRX 5JVTA 1NK3P 5K5OA 2M4GA 2VKHA 2RQPA 1P9QC 2L7FP 4LLLA 5D4SA 4B1RA 2DFFA 3TW7A 3MZHA 1HCRA 3I0TA 1B8IB 4EGZA 1V5FA 4Y52J 1BW5A 1R23A 5HLTA 3MCZA 2Q2EA 2KHMA 3BQYA 4HA8A 3L2RA 2EFWA 1XTAA 2KJCA 3HC7A 1ENHA 4A6DA 5EYRA 2ESNA 1EF4A 2CUEA 2KRFA 1FPQA 2FJ1A 3RQ4A 3HOZJ 5JR3A 1P4AA 2COBA 3RZDJ 2YX7A 2HYGD 3LA3A 2HOEA 3LQRA 1H88C 4XRFA 1YYVA 4RAZA 3Q3SA 1TC3C 2L5QA 3OR2C 5CLSA 5EDNA 3RPUA 1QPMA 3DEEA 3GYHX 3GMEA 3OS1A 1L3LA 4DBQA 1RETA 4I0AA 3V8KA 4IX7A 1YJ9I 2UWMA 4MLOA 1XGNA 1K4SA 2V9VA 3OV8A 3FMQA 3U21A 3KYLA 1FNNA 1N25A 1EH6A 1OYIA 2XPUA 1B72A 3HOUJ 4ZTJA 2YPRA 4ZYAA 2PEXA 2X85A 5F0CA 3RKYA 4G7OF 1Y8QB 5K5QA 3K7AJ 4C3HJ 3KP6A 3DKYA 2ZJQF 2JA7J 2VJ4A 1W5TA 2PMZN 3AG1H 4LIVA 5HODA 1Z7LA 3AL0B 2BBYA 1ETOA 3M1CA 1SD7A 3J7YJ 1F5TA 2TRTA 5D6FA 5ICEA 4UY8I 1Z05A 4A0YA 2E60A 3H3UA 5B3SH 2F5FA 2R7QA 3WGHA 4M9SA 4F93B 4I7HA 3ASOH 1R4MB 3CESA 3LA2A 3KZYA 1HOMA 3IWZA 3X2QH 1ONVA 1MDMB 5A2QZ 5KCMA 1FTTA 2OJED 4DYQA 4UV8A 4F52A 3P7NA 1T39A 2QVOA 3VSLA 4P1WA 3HSRA 2ID6A 1I39A 2DMUA 3D5SC 5IY5H 3ZPLA 4KIGA 4I99C 4MEXF 2EIKH 4XLEA 1Q1VA 3GTMJ 3BR0A 3IP4B 1HSTA 2CJJA 1ZGJA 2DK8A 5ED4A 1K78B 1L0OC 2R7OA 4HX4A 2KIMA 5FD6A 1B9MA 2V26A 4OOIA 4F92B 3KZZA 3BJAA 3V42A 4ESFA 4IHYA 1U0JA 2UZKA 4IPAA 2STTA 1W36C 4JP0A 5DCFA 3ABTA 2EFNA 1X1PA 3RPQA 4ZYHA 5FD5A 4G94A 2P4WA 3J80K 4BDZA 1R4NB 2HQAA 4CH7A 3CUQB 2BOLA 4E7ZA 4KA4A 5DM7F 1FOKA 4ABZA 4Y7NJ 2R5ZA 1I1SA 2HXOA 1LPQA 2Q1ZB 1YFHA 3L9FA 4O3MA 1VQ7I 1MH4A 3K4CA 1RNLA 2L4AA 2VB6A 4BJ6C 5KAFC 2GM4A 1DU6A 4BE0A 5HLGA 3OYLA 1FEXA 4XLPF 1MNEA 4I6ZA 1LFPA 2DCEA 4X6AJ 2KQRA 4OWRB 4NUBA 4BHCA 1QPIA 4J00A 4UVBA 5K7FA 3ZXSA 5J1YA 5B66C 5F04A 4LB5A 2W24A 3LQQA 2R0QC 2NAZA 1ORKA 2HQ5A 1T38A 1LJ9A 4A3EJ 1J09A 1I5ZA 1ITYA 4G7HF 2GLOA 4E6KG 1MBGA 2WWYA 2HVQA 3W2VA 1HXDA 2D45A 2CO5A 3LSGA 1HA8A 4HSRA 5M5WJ 2PBIA 2MFZA 2RREA 3RI4A 1JGSA 2OV7A 3OOUA 2VOPA 1S3JA 3KEQA 4MFEA 2IGMA 1WJCA 5D8LB 4XRSA 1PJRA 2RQQA 3HTUA 2RV8A 1KYWA 2VASA 1Y6IA 4XN3A 3C7JA 3PFYA 3DTIA 2NOJB 2MH2A 4W1UA 1FP1D 1FBUA 4WX9A 1HC8A 4YG2F 3SDGA 3Q0WA 3ABKH 3K4NA 2EWNA 3SYTA 1IDZA 4RGXA 2CQXA 2LKXA 2XB0X 3GZNB 4IXAA 4UUTA 3BG3A 5CQGA 4DNCA 2VPRA 3BR6A 1CF7B 2JT1A 4KJZA 2ICWG 5ILSA 5IPAA 2RC4A 3LSPA 4CCJA 2QZ8A 3HTSB 1XMXA 5D5WB 1HDDC 4NBQA 3L2QA 2QYOA 1XB4A 2O5RA 5FFZA 3OYHA 3JR9A 2MA3A 2W82A 5E3OA 5HS9A 2FBHA 3A03A 3JRHA 3WG9A 1WVRA 2FE3A 2VT3A 3SDBA 1U5TC 4NQWA 1DGRM 3BG5A 2NVQJ 3BOQA 4BY1J 2ZCWA 1SANA 3IAS2 1APLC 3MWMA 3NEUA 1QZZA 2J5OA 4ZDPA 4LK1F 1K4TA 3BPVA 5FRNA 3ZP5A 3ZQLA 4UB8C 3S16J 3HOSA 4A3JJ 1D1BA 4G9YA 5E79C 5IP9J 1DQUA 4YIFA 2QA4I 1JI8A 4FX4A 5J40A 4E7KA 3LAPA 3JRFA 3M07A 3DBLB 1O3RA 3TL4X 1OKRA 3ZMVA 1W1WE 4PJMA 1OLTA 1VF9A 2BV6A 4IKFA 2EV0A 2TCTA 4C3JJ 4JX4A 1SD6A 5HOOA 3BR3A 3G2BA 1D0YA 2VXZA 3KEYA 3HPHA 5ICCA 2L2OA 2WBMA 4B3AA 2LMDA 2AO9A 3QOEA 2KDOA 3BP8A 3FM3A 5ILVA 2KIQA 5C44J 5DUKA 5LLQA 3PM1A 3L00A 1XC5A 3MAJA 3HOXJ 2LLKA 3K4MA 1IRGA 1KQ0A 4I0BA 3AG4H 4P9FA 4XOTA 1G3WA 4IEJA 4OIQF 4KICA 1G3SA 2JTVA 5FKNA 4BJ5C 1OCPA 3PQKA 4DOZA 2DA7A 1Z6RA 3TGNA 2Z5UA 3DU6A 1ZKGA 3RCOA 3WTYC 1B6AA 1WCMJ 1S7EA 1MDMA 3TMOA 4PGHA 3CMEI 4KFCA 5EG0B 2VQCA 3CCJI 3ZMTA 1IGNA 1Z3YA 5JHFA 4FTHA 3J7ZI 2FRHA 3ZMZA 3CP8A 1TT0A 3ESWB 2O6GE 2RNGA 1ZGWA 4B09A 2Z1DA 1UG2A 2KISA 3PUBA 3WE2A 3OYJA 5C4JJ 1T08B 3H9JA 3W6JB 1JJ6C 4ENNA 4BBSJ 1LDKB 1K78A 4PFOA 3DEWA 1VI0A 4HG2A 2VONA 2P7CB 2LRDA 3HKZA 3ZGKA 2W85A 2DU9A 3E1SA 4EJTA 3G1LA 1TWAJ 4KYWA 1U3EM 5H6QA 3CUQA 5E3NA 2MC4A 1HBXG 1R1UA 1PP7U 3GUDA 3H5NA 1SFOJ 4HQMA 4B4CA 3J81K 1JKQC 2HI3A 3NWTA 4L9JA 3WU0A 3ZMSA 3S32A 3IKTA 4IRHA 2CW0F 3JAMZ 4OMZA 2GXBA 1RESA 1OISA 2JPBA 3LL7A 2YU9J 1UZCA 1TNSA 5GPCA 2L9NA 3L1PA 1HF0A 4A2UA 1XSDA 1YRNB 1VQ4I 2QQ9A 1D8KA 5L3DA 1SVMA 1F36A 4AVPA 3S15J 1NK2P 2NVTJ 1W0UA 1ZLKA 2XPVA 5K5RA 1ODDA 3BQZA 3BTJA 1QVTA 3HRMA 1FMWA 2JMWA 2JJ7A 3RDIA 3JTHA 5CVIA 3F22A 2VKEA 3ABLH 2YUSA 1G6NA 4UXNA 3DEUA 4V2GA 1FIPA 3KETA 3R6SA 1ZG1A 3JREA 1ZR4A 3JSOA 2IGNA 1YE9A 1MGTA 2ESHA 1VQKI 4LLGF 4GGGA 4BXFA 3F9KA 3O8HA 4RLFA 1YO5C 4LG0B 1PP8F 5B1BH 2YR2A 4B8XA 3QYEA 3TDUC 4PJJA 3FKJA 5EZGA 1S29A 3WODF 2FA5A 5H2FC 2ZXJA 3DF8A 2V1XA 3ZOBA 1W5SA 5DM6F 1KU9A 1SVOA 1OJLA 2CSOA 1ZGAA 3AFHA 2NOGA 3E6DA 1O3TA 2QLZA 2HYFA 1V55H 2PN6A 3E97A 5FO5A 3OMYA 4A3CJ 3CZ6A 2VC0A 4V19K 4N0BA 2OPTA 1CF7A 2FEZA 4HW0A 2FQ3A 1H9TA 2JA8J 4CCNA 1BJZA 4Y13A 2LKPA 2M30A 3PNTA 3LSIA 1A6IA 2E1MC 4CCMA 5B1AH 4RB0A 2CGPA 5DUIA 4BACA 1LVKA 2XHKA 1DU0A 1B9NA 1FC3A 5J1UA 1RRJA 5E3LA 4NHJA 2ELKA 1BIAA 1W7PD 1D3YA 1XGMA 1P4WA 3CMYA 3CDIA 4C2UA 1I6XA 4XLHA 2ZXIA 4X0GA 5BMZA 2IA0A 3A4CA 3MEXA 1VQLI 3CD6I 3DLAA 3WTUC 2JVGA 1A04A 2WY8Q 1MNDA 3TBIA 2XUBA 2VBZA 3SEZA 4QSHA 1IW7F 2CW8A 1LDJA 3EYIA 2A6TA 2R7FA 3HUGB 4CDGA 1WRJA 3MKYB 2HTSA 1QBJA 2DN0A 4F91B 2PJRB 2RKHA 1HW1A 2NVYJ 3BDDA 3GFMA 1B59A 1OYYA 2NS7A 1JE8A 3H3ZA 2HPMA 2Y0SN 2GIZA 4A69C 3UKGA 2QQBA 2EA2A 2VN2A 3HHHA 2HWVA 3IRRA 2P6TA 2EK5A 3WE3A 4CXFA 1AOYA 2AQFA 2VJJA 2MC3A 2R3SA 3KX2A 2R92J 3G6EI 1VNDA 2ID3A 2ZC2A 3OY9A 4EMSA 3KIOA 5DCMB 2NXNB 1YG2A 1X3ZB 3H0GJ 3K4JA 4G12A 4JX5A 1K7AA 1EJ9A 3KP7A 3I54A 5FRMA 4LFUA 5H20A 5ILUA 2L4MA 5M5XJ 4XICA 2DJIA 1GXQA 4WXCA 1HSJA 3I64A 2K9QA 3L09A 5EG0A 4LJZF 4RM2A 1UG0A 3K4KA 4JBAA 4EM0B 4ENKA 1DDNA 1XDUA 2L02A 1QNTA 3F8NA 3G1MA 1VQ5I 3O3KA 4E4HA 3SEQA 3OYGA 1VZ0A 2IP2A 3L2CA 2H09A 2VL8A 3MZ8A 3HGGA 1W7PB 3HZJA 3K0LA 4UUSB 5E18F 2XC7A 1BR2A 3QYFA 4UNOA 1KA8A 3NRVA 4OINF 1X1AA 3AL0C 2UV1A 1D1AA 5D5UB 3NWSA 3I55I 4XLFA 3QYBA 4EJOA 3GX4X 3E3VA 1UCRA 2M2EA 3LSJA 1UJ8A 5LD2C 4P55A 3FISA 2EPFA 1PDNC 5C4XJ 4ZDOA 3VEPA 2B7EA 3OYBA 3HOWJ 2M34A 2F2EA 1QRYA 2IBDA 1TBXA 2EBIA 2D2WA 1R1TA 2JPCA 2GIVA 3OSFA 1MSEC 4XKBA 5HDNA 4MO7A 1IO2A 1H0MA 3A01B 2K9LA 4HF1A 3JCUC 5AIPA 5CPRB 4NDLA 3BZKA 2WAQA 1VQOI 4D9JA 3CCUI 5F0FA 1YRNA 1U2WA 1J2XA 5LEJA 1UHSA 3VODA 2I10A 4PJNA 4BS9A 1QGPA 3OS2A 2M45A 2VQGA 3D5LA 2XASA 2R7ZJ 3C2GA 4HV6A 1V5GA 4TV7A 1JKPC 2LBFB 4FISA 1U6GA 3GTOJ 2CV1A 2W00A 2JZYA 3IAM2 4W97A 1R5HA 3IH4A 4CYCB 4Q5SF 2HOAA 2F4OB 5BOXA 4PSWA 2UXNA 2JUGA 3QPHA 2L01A 5GAGJ 2K3FA 3ASNH 2E5NA 2JSCA 3ZR8X 2FXAA 2JN6A 3E5QA 5HDKA 1WJFA 3DTEA 3IL2A 1BOAA 4BAYA 2BW3A 2V4JC 2DAOA 3CUQC 3OYNA 1ZREA 2PG4A 3RYPA 4S05A 3KPHA 2KPMA 4A5NA 3W2AA 2BHYA 3PIPF 2KP6A 2VE9A 3D0SA 4OIPF 2Y48A 4KMFA 2P0WA 3S1QJ 2MLKA 1KYZA 2X9DA 2I5UA 2AS5F 2XF7A 3S3NA 1R1VA 2X4HA 3PQJA 1YOVB 3BZ6A 4A3MJ 4NC6A 2XGDA 3VDXA 2WAEA 4QPQA 4XORA 3KCCA 3R60A 1O3SA 2XSJC 1ZAOA 3CCSI 3QP5A 2F4MB 1W4MA 3DBRB 2DJNA 2MYSA 3KLOA 2IGKA 4M3FA 5L3BA 2Z9OA 2DTRA 3FF5A 2O9LA 1VQNI 3SJMA 2HGCA 2ZSHB 2LFBA 2LYCA 2PJPA 4XBFA 1IN7A 2IVMA 2K40A 2D1VA 1OPCA 4XLCA 4AVZA 2H1LA 5L3EA 4E7LA 2W57A 3V4GA 2P5VA 4OIRF 4WXHA 4HLYA 2O03A 3H35A 3O6BB 4BQOA 3QPTA 2P5LC 2ZJ2A 5F1JA 2FOKA 3CCQI 1LB2A 4XIDA 3LA7A 2QM3A 1D1CA 3F21A 4XLNF 2O7OA 1BI0A 4P5OA 5J47A 1A5JA 2FF4A 1MZBA 1MBJA 1YI2I 2G9WA 3GVAA 2EINH 2K9NA 4CYDA 5EEHA 1SFEA 3U9GA 3K70D 2CWEA 4G6QA 3N4MA 3S2DJ 2F5EA 2QQAA 2L0KA 4M9XA 3Q9VA 1ON2A 4RDUA 5J4YA 4GYIA 2ISYA 5IP6A 3HM5A 2ZNYA 3MKZA 2DT7B 3GWZA 3GTLJ 4O6JA 2HDDA 4JYKA 1HDPA 2OTJI 5DCMA 1PUEE 1BL0A 4ZDLA 3CCYA 3HSFA 2NNNA 4ANJA 1MJBA 1F9NA 5EGOA 1K6YA 3CJRB 1GHCA 3DU5A 3CCMI 1TQIA 3ML6A 3DFGA 2CG4A 2ECCA 2LK2A 1HKQA 4S0HB 1SMTA 1H8AC 5DS9A 5GAEJ 3K9TA 1B1BA 1RC9A 3JW4A 1V54H 5E1XA 4IJAA 2X6XA 3OL3A 3R0JA 2A5YB 2LC2A 3I56I 1GVDA 4M72A 1QU3A 1XGOA 2XGCA 2DMPA 3WTWC 1VFCA 4IRIA 1Y1WJ 1X2NA 5L3FA 4AM3A 4RGUA 1PVEA 4XRSG 1ZK8A 1G59A 1TQMA 2LY9A 2IW5A 4OAZA 3S3MA 2FMYA 4FETA 5AIQA 4F3QA 1W7PA 1GV5A 4UUSA 2XAUA 1E0EA 3Q5FA 2EQRA 1WI9A 4RAGA 3SHFA 4IQ4A 4AYBA 2JUCA 2GZWA 4CCLA 4PJLA 3S2HJ 1IV6A 4IRGA 2KKOA 1X3WB 4LD5A 4MIMA 2R7VA 1KONA 2VKDA 3CO6C 3C3WA 3EETA 4ZJZA 2PMHA 3BG6A 3FXMA 1O3QA 2DMNA 3LMMA 3M3YJ 1FX7A 1MSFC 2BEOA 4E7SA 3TO6A 2CRGA 4AC0A 3KP4A 3WU2C 2X6WA 5JHUA 4QWQA 3OYDA 3ZRGA 2HFHA 1P92A 3GEZA 5HVQC 2COMA 2F5DA 2EIMH 4Y15A 2K9SA 5DEQA 2DPUA 1U9OA 2CU7A 1M1EB 3RKXA 1WH5A 3KP2A 4AD9A 3WTXC 4ENMA 2DPDA 3L7WA 4BNCA 1TT5B 3QU3A 5FFXA 4A93J 4YFXF 3OYKA 3Q0VA 5CKTA 3HRTA 1ULYA 1Q1HA 2L54A 2EV5A 2KIFA 3N97A 2PQ8A 2MH9A 2LBFA 2IRFG 3GTGJ 2YS9A 2K7LA 1I6HJ 4G8XA 1D8JA 1EKEA 1G8XA 2BE5F 4FASD 2EZIA 2V1NA 4CYCA 4E7HA 2VPLA 4N9HA 2OZUA 1T0FA 3LSHA 3E5XA 1BW6A 4XOPA 3RKWA 4E7JA 2GA1A 3BCAA 4XK4A 3FZVA 3HL2A 1F1ZA 2NRAC 4Y3OA 4BU2A 4FT8A 1SAXA 3ABMH 3KE2A 4C3IJ 4M6VA 4U0YA 1E3OC 2N8GA 5IYBJ 5HS8A 1OCOH 4BYYA 2W25A 5FKOA 2QSHX 4UVCA 3FM5A 2RAEA 4N9IA 2XGXA 4IHXA 2BY3A 3J81Z 4UHTA 2P8TA 3GTJJ 1TLHB 2NS8A 1BI1A 1Z6TA 1B8IA 5JI6A 3GXOA 3AAFA 4A3FJ 1SC7A 5E8GA 1ETWA 2AQEA 2ME6A 3L2VA 3UR3C 2E7XA 1T95A 2HNHA 2CUJA 1E17A 3FBNB 3HB9A 4WK8F 2OAZA 2LG4A 1MH3A 1R9TJ 3CUOA 3TP0A 4A12A 1PUFB 5D4RA 3DWLE 2EFQA 4QIWN 3BTLA 5HNHA 1S9HA 1KQ8A 4MTEA 1FP2A 1TWHJ 4JX6A 3HGYA 2VBYA 2FD5A 4BHPA 3V8JA 3COAC 3DLLF 5DD8A 3EDPA 4MTDA 1FT9A 2GAUA 4HV5A 2RN7A 1GDTA 3CF5F 4KNYA 1TZLA 1FBQA 2ZFUA 1K79A 1FMVA 3BTIA 2K9MA 3M9AA 3OWTA 3BCBA 1Z1DA 1WQ2A 2V7FA 4CSWA 1IDYA 1VQPI 2VI6A 2IPQX 3EUHA 3A2KA 5BNGA 2GXGA 4ZYDA 2DODA 2W1OA 3K6GA 3CC2I 3LSTA 3LSKA 1MMGA 5F0HA 3JTGA 1E3HA 3U1KA 2EJRA 2O0YA 3BJOA 2OC6A 1SMYF 2BXYA 5E20A 2GA2A 3R61A 2RNJA 3FXUA 3FMRA 3VYRB 5LRRA 3IC7A 3WTTC 4QPOA 5CVVA 1BM9A 2DYSH 3DBHB 5FROA 3IH3A 2OUMA 5F27A 1UB9A 2H8WA 4HEA2 2MLGA 1FYLA 2K86A 3LWFA 2L9VA 2JRTA 2K85A 3OR1C 4BY7J 3PSIA 1TP4A 2HVSA 4A3GJ 4CZZA 4BKXA 1YS6A 2VJ5A 3ZCOA 1LKXA 4RLQA 2HDWA 1XDSA 4D5FA 2V9KA 3C2HA 1X4PA 4LG3A 3TKYA 3QOPA 2RVCA 5IT9K 2HQRA 2LKSA 1WSUA 2E2JJ 2Z16A 3NARA 5LGNA 3CLOA 3ZMDA 5J1RA 3F23A 4AIJA 3K1MA 5D5XB 1BJAA 3ABUA 3EUKL 2X1DA 2X6OA 4QTRA 3BG9A 5J8CA 2DOEA 4OU0A 1JTYA 3LSRA 1QZYA 1RR7A 2JA2A 3QU6A 4IHWA 1ERDA 2OTLI 4BH9A 4PCQA 2DOFA 3M4OJ 2E36A 2VT2A 2DMTA 3BROA 2LH9A 2E7WA 4PDKA 3S93A 1Z9CA 1WPKA 2MBFA 2A05A 1IN8A 1LVAA 3VSKA 2MD0A 3KYDB 4MFDA 2WADA 3VB2A 3WU1B 2EV6A 3OIOA 4D7MA 4XKCA 4J19A 3IRQA 1E3PA 1WI3A 1STZA 3A0BC 1Z3XA 3CJNA 5F64A 3RYRA 3F0CA 2KRHA 1JUPA 3FXQA 3H92A 1TQPA 2Y9ZA 4KIFA 5J6XA 1SFUA 2IJLA 5FGMA 1BR4A 2FBIA 4J01A 1AHDP 3T8RA 2DLLA 4GDFA 1IN5A 3HJEA 3CCRI 1VQ8I 2E1NA 4BJTA 4HDVA 5CJ9A 3CJQB 3CDHA 2ME0A 3F8MA 1J75A 1Z77A 1ZRFA 1TW2A 3DXJF 4ETSA 4RB1A 4V2FA 2EH3A 2LTPA 1XG1A 2JK3A 1V3FA 3QPLA 1MW7A 4BXUA 2E35A 1LDDA 1R00A 2F5CA 2XKOA 2O8XA 2DOAA 3IUOA 4ZZDA 2CMPA 1I3AA 4YFKF 2MGQA 3BR2A 1YJNI 2R7XA 2HDCA 2R7WA 3EPZA 1WJBA 5CVRA 5IYCJ 2XF5A 3I53A 3RPUD 1UHMA 1Z7UA 1DPRA 5F6FA 2CQQA 2F4IA 3SFZA 2FBKA 3CCVI 3QRFF 4OMYA 4DZJA 2IS4A 2CV0A 1ETYA 3U2RA 3QPSA 1A35A 4CA0A 1UAAA 1QHGA 5C3EJ 4MEYF 4MHGA 3HOVJ 2XAQA 1LEAA 2VXDA 1X1DA 2GOXB 2ZJRF 4FCYA 3J7AY 1VTNC 5GPAA 1FLIA 4M3BA 3GTQJ 5FKLA 3FK6A 2FX0A 2P5KA 3JRIA 1RR8C 2KRCA 2BVMA 2PX9A 2KJBA 3HEFA 1DPUA 2X48A 4D5CA 1TWCJ 5F08A 1FOYA 2OQRA 2DA3A 3PJRA 1OCRH 2FNPA 1DGWY 2PMZA 4U7BA 4DZPA 1XD7A 3B6AA 1BI3A 3JRDA 2QBYB 3WTZA 4BQQA 3JRGA 3DTKA 1PUFA 1YIOA 3U1DA 2WAFA 1J7KA 2B0LA 2Z99A 1WKMA 2A5WA 1KU7A 1VQ9I 4MNUA 2L7KA 1Y1VJ 1Z0XA 4P96A 4BBRJ 1ZR2A 1MD0A 4BGDA 2BZTA 2CFXA 5HLIA 2B63J 2LVSA 3CP2A 5IOZA 5EEGA 5K7ZA 1JTXA 4HX8A 1T0FC 2YU3A 3K1PA 3ERMA 4PJ0C 1QA6A 1LQ1A 1XS9A 3A0HC 5ICFA 2DXIA 4QLCU 4FHTA 2H6BA 2QUFA 4RBOA 3TEDA 1A6QA 4IO9F 1LFBA 1ZRDA 1UELB 2BXZA 2JSPA 1RIOH 1ETXA 4CCOA 1S8NA 3I4NJ 3FMSA 3LAJA 4S04A 3W6KB 2X0LA 2P6SA 4R8HA 2VC1A 3T1BA 3FX3A 2VODA 3ZN0A 3BG7A 4WCGA 1ZG3A 2LREA 1P7JA 1GV2A 3GFLA 5LHGA 3PO3J 2K27A 3GF2A 2DK5A 3IKVA 3SFIA 3ERED 5GTHC 2A6EF 3H5AA 1S6LA 4Q4ZF 3WGIA 3OL4A 1CGPA 4DYCA 4H0EA 1W0TA 4N4OB 3H3VK 4HNTA 2FQ4A 1BI2A 1B72B 2GWRA 1X19A 3TO9A 3ZQGA 2ECBA 4E70A 2KZGA 4M71A 5GAHJ 4U0VA 3OOPA 2IAIA 3BWGA 1X3UA 5JVGF 4XMYA 3VYTB 4XSZF 3MD2A 1R6RA 4EM2A 3BTCA 3GBGA 3KYCB 3J7AO 4A3KJ 4AUXA 1ZTRA 2MSYA 3CCLI 1O7LA 3EUHC 2DT5A 2EFPA 2Y75A 1IRXA 4XN0A 1QQIA 1RUOA 2VUMJ 3GZ5A 1X1BA 2FU4A 4NB5A 2V1UA 1A31A 3BC8A 2NNYA 2A07F 1MBEA 1FOWA 1U9NA 1LEBA 3W6VA 4B3XA 4AU7A 3JRCA 3LOCA 1MBKA 4AIHA 2A3SA 2M9HA 1H9GA 1S7AA 2NYXA 3C1DA 3FDYA 4C30A 3E5UA 3FIWA 4EATA 3QP6A 4EM1A 2HVRA 1IUYA 2FMLA 3GCMA 1U8BA 2R93J 1BN5A 1IXSB 2H8RA 2L7ZA 3GTKJ 2O61A 3V7CA 3K10A 4IOCF 1FYMA 1MMAA 1FIAA 3CQZJ 5B5EC 4KISA 3OS0A 3V7RA 1USSA 2WC2A 2XIGA 3G71I 2V9PA 1KGSA 1BR1A 5FKKA 4D1QA 4IF4A 2W4SA 4BUPA 2BY0A 4M3EA 4DJAA 1YW7A 4ESJA 3D1NI 1UFMA 2QEXI 3GLLA 1AA7A 1R71A 2R7SA 4K2EA 3EUAA 4IHSA 3C2BA 3VWBA 3QWLA 2VOOA 5FLXK 3K4LA 2CUZA 3PSFA 4LIUA 3DP7A 4L0YB 1XSVA 2E2HJ 1OFCX 5HDGA 3S2WA 1SAUA 3SZTA 3TW6A 4EJWA 5HS7A 1SVLA 5HLHA 2QSGX 3DKXA 2R5YB 1LE8B 1KZHA 1OCTC 1BA5A 4O5VA 1GVJA 3EYYA 3BT9A 1BBYA 1VQMI 4BE2A 1OR7C 3WG7H 2CW7A 1IN6A 3OSGA 1OMIA 4ITVA
chains in the Genus database with same CATH topology
3A1YA 3QOEA 2KDOA 2ZSIB 4IQ4A 4AYBA 4CCLA 4PJLA 4BL0B 4HRIA 2R7VA 1KONA 2VKDA 4ZJZA 2LY2A 3BG6A 3K4MA 4PFPA 4BEHB 4XOTA 3LMMA 4G6TB 3E0JB 3K70C 4BJ5C 4E7SA 4CZCA 3DPTA 3S3OA 2X6WA 4DOZA 3OYDA 3ZRGA 1WJ5A 4B44A 3DU6A 2GOMA 3RCOA 3N05A 5HVQC 2IGOA 2M0MA 3TMOA 2K3PA 2VIXA 2KMUA 1NG6A 2VQCA 1X1CA 2VQHA 3SZGA 3MKWB 1Z3YA 5JHFA 4YRVA 4RM3A 3OYKA 3CP8A 5CKTA 1TT0A 4BQNA 3OYAA 2RNGA 2ELJA 2R7RA 2F6CA 2R4GA 4CUGA 4ZC3A 2Z1DA 2CH0A 2LBFA 3PUBA 3OYJA 2VLAA 3H9JA 2K5CA 1G8XA 1LDKB 4FASD 4PFOA 2V1NA 4HPQA 4HG2A 4XR6A 4E7HA 2VPLA 2LRDA 3CMMA 3HKZA 3ZGKA 2VQLA 3LSHA 4XOPA 4E7JA 3E1SA 3BCAA 3HL2A 4Y3OA 4BU2A 3L2UA 3RTRA 4PUSA 2WY7Q 4KT6A 2KLOA 2MC4A 3UNGC 3H5NA 1QHHD 4N4NB 1EA3A 2E5ZA 2WB1A 4NQWB 3LSMA 3NWTA 3RSNA 2X1EA 3S32A 2XF6A 2PJRA 2UUZA 4GRIA 4R79A 2AQEA 3L2VA 3UR3C 4HNUA 3LL7A 1T95A 2HNHA 2CUJA 2L9NA 3OYMA 3FBNB 2V6EA 2LG4A 3PNYA 5CQEA 4DIQA 4U87A 1WJAA 3W2WA 3DWLE 4XL9A 2HZDA 2L9SA 5HNHA 1FMWA 1D0XA 1S9HA 2WA0A 4YELA 2HPIA 2CFOA 2XDVA 2M3AA 4XKVA 2IGNA 1WFXA 1TZLA 1YE9A 3HPGA 2ZFUA 3OYIA 1FMVA 4BXFA 2HU9A 4H4KC 3F9KA 4RLFA 2K9MA 4OAYA 1MMDA 5HNFA 3OWTA 3BCBA 3QYEA 4LITA 2V7FA 4PJJA 4PK4A 3FKJA 4HSTA 4CSWA 3H0DA 3DPLC 3HXLA 2DT6A 2QKLB 4RMNA 1PYVA 3A2KA 2W1OA 3K4BA 4E7IA 3K6GA 3LSKA 1MMGA 2OC6A 3AFHA 2VJIA 3OYEA 3VYRB 3PNVA 3OMYA 5KNLA 3CZ6A 4QPOA 3HOTA 3DPUA 5FROA 2KZVA 2LOOA 2OUMA 4HEA2 1WJDA 4XONA 4CCNA 4F55A 2IS1A 3OR1C 3PSIA 1N78A 2HVSA 3PNTA 3LSIA 4XNFA 2E1MC 3VYUB 1NG7A 4CCMA 2VJ5A 3ZCOA 1LKXA 4RLQA 1X4OA 2HDWA 4BACA 4XM3A 2E1MB 1LVKA 5TGTA 3MMYB 2V9KA 3C2HA 1X4PA 4LG3A 2ZXHA 4B47A 4B43A 3OIPA 3DQVC 4ZTFA 4C2UA 3D5RC 4XLHA 2ZXIA 4X0GA 2Z16A 2F5VA 3A4CA 4Y4RA 4C2TA 3FHNA 3DLAA 2JVGA 2WY8Q 3TBIA 1MNDA 2M7AA 3EUKL 2X1DA 3SEZA 3ZQQA 2CW8A 1D0ZA 2A6TA 2M4GA 2VKHA 3HUGB 3H9GA 3FBIB 2JA2A 3MKYB 1ERDA 1P9QC 4F91B 2PJRB 1V5FA 1ZELA 2LH9A 3S93A 3VSKA 2MD0A 2HPMA 5HLTA 2WADA 2KHMA 3L2RA 3HC7A 4XKCA 2AQFA 2VJJA 3RQ4A 1Z3XA 3KX2A 2X51A 3OY9A 4IQJA 2KRHA 4BEHA 1BR4A 3K4JA 4DGWB 2X1CA 4J01A 2L5QA 4BE1A 3OR2C 5FRMA 3DEEA 4BJTA 3OS1A 2Y0SA 3CJQB 2DJIA 4DBQA 2JVHA 4Y33A 4IX7A 2UWMA 4MLOA 4RM2A 2R7UA 1UG0A 2CS3A 3K4KA 1MW7A 4E4HA 3U21A 1W36D 3SEQA 3KYLA 4BDYA 3OYGA 1VZ0A 2DOAA 3IUOA 4ZTJA 2W7NA 2CMPA 2VL8A 2R7XA 4ZYAA 1WJEA 2R7WA 3EPZA 1WJBA 2XC7A 2XF5A 5KHDA 2X85A 1BR2A 3QYFA 4JQFA 3RPUD 4XKWA 1X1AA 3AL0C 2UV1A 1D1AA 3DKYA 2F4IA 2MABA 2VJ4A 4LIVA 1Z7LA 3AL0B 3NWSA 2IS4A 2CV0A 4XLFA 3QYBA 3M1CA 3ONQA 4CA0A 1UAAA 1QHGA 5LD2C 3VYSB 2VXDA 1X1DA 2GOXB 4ZDOA 3OYBA 3J7AY 2E60A 4PSXA 3OIQA 2KRCA 2R7QA 4B48A 4XKBA 4F93B 2BVMA 2K9LA 5CPRB 3CESA 3PJRA 2WAQA 4D9JA 1DGWY 2PMZA 4U7BA 5KCMA 4BQQA 4F52A 3DTKA 4BS9A 4PJNA 3VSLA 4P1WA 3OS2A 2WAFA 2VQGA 3D5LA 1V5EA 2A5WA 3D5SC 3C2GA 1V5GA 2L7KA 4XQFA 2LBFB 4XLEA 4BGDA 2CV1A 2W00A 3IP4B 3CP2A 3W3CA 3IAM2 1T0FC 2R7OA 2V26A 4PSWA 4F92B 2JUGA 2E5NA 3V42A 2DXIA 2KL4A 3ZR8X 1U0JA 1Y56A 1WJFA 3DTEA 1W36C 2BW3A 2V4JC 3I3LA 3OYNA 4II3A 1N75A 4NC7A 4JOMA 1UELB 2JSPA 4BDZA 2KPMA 3W2AA 2HQAA 4CCOA 4CH7A 2BOLA 1SFKA 4E7ZA 3BLYA 2KP6A 1GLNA 2LY1A 2P0WA 2Q1ZB 4YEJA 2IS6A 2XF7A 3K4CA 3S3NA 2VB6A 4BJ6C 4BE0A 3BG7A 3VDXA 3OYLA 2WAEA 1MNEA 2LREA 2IS2A 1LFPA 3LFUA 2DCEA 4QPQA 3L2WA 2KQRA 4OWRB 4NUBA 4XORA 4J00A 3H5AA 2XSJC 3ZXSA 3I9V2 3OL4A 4XLAA 2MYSA 2IGKA 4N4OB 3CF2A 2M4KA 4HNTA 2CV2A 1J09A 1X19A 2FUG2 3H5RA 2ZSHB 4E6KG 2LYCA 2HVQA 3W2VA 3LSGA 4XMYA 3VYTB 1HA8A 4HSRA 4XLCA 3MD2A 4AVZA 2MFZA 1R6RA 2RREA 2OV7A 4E7LA 3OOUA 2IGMA 1WJCA 3GBGA 1MMNA 2QKMB 1PJRA 3HG9A 2RQQA 4BQOA 3H35A 2VASA 1Y6IA 3EUHC 4XN3A 3QODA 3PFYA 1IRXA 4XN0A 3OYCA 3DTIA 2NOJB 1X1BA 1D1CA 4P5OA 3BC8A 1DP3A 2R7TA 3M8JA 3K4NA 3SYTA 4B3XA 4AU7A 3AKZA 3K70D 3FDYA 4C9YA 5CQGA 4C30A 4EATA 4KITB 2HVRA 4KJZA 2I8DA 4II2A 4CCJA 2M7BA 3L2QA 1Z21A 2DT7B 2O5RA 3K10A 3OYHA 1MMAA 3MKZA 4DBRA 4KISA 3OS0A 4NNJA 2W82A 2X6YA 4ZDLA 1BR1A 2BVLA 3H9QA 4NC8A 4D1QA 4ANJA 3SDBA 2W4SA 4BUPA 1N77A 1DGRM 1BOBA 4DJAA 1K6YA 3CJRB 3IAS2 3DU5A 3PL8A 4ZDPA 4CCKA 4IZZA 5FRNA 1AA7A 1YX3A 2R7SA 3HOSA 3EUAA 3VWBA 1D1BA 2BW3B 3S8PA 1DQUA 1JI8A 4E7KA 2X6XA 3OL3A 3OYFA 3K4LA 2CUZA 3PSFA 4LIUA 5LFAA 2LC2A 1QU3A 3TL4X 4PJMA 1OLTA 1SAUA 4IKFA 3DKXA 1G59A 5HOOA 4OAZA 3S3MA 2Z2SB 3G2BA 2IXSA 1YX5A 4FETA 4F3QA 1D0YA 2VXZA 4BE2A 1OR7C 2XAUA 1E0EA 3KEYA 3HPHA 2CW7A 2L2OA 2WBMA 4ITVA 2Q2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAU A;  2XSJ C;  1JI8 A;  3OR2 C;  3OR1 C;  1YX3 A;  2V4J C;  2A5W A; 
#chains in the Genus database with same CATH topology
 4ESB A;  1IV8 A;  3A02 A;  3TP3 A;  2QEN A;  3B6C A;  4BL0 B;  2BYV E;  3I4M J;  3HDD A;  4LLN A;  4LG0 A;  1IC8 A;  2XAJ A;  5BQT A;  2LY2 A;  1R58 A;  4PFP A;  4BEH B;  3I58 A;  1TW3 A;  4G6T B;  3WTV C;  1MBH A;  2ZNZ A;  3K70 C;  2WV0 A;  2UXX A;  2C6Y A;  2KIU A;  4IVN A;  3S3O A;  2EZK A;  1HLV A;  2A69 F;  1WJ5 A;  5FJ8 J;  1FYK A;  3N05 A;  3G1O A;  4RA2 A;  2LF7 A;  4FE4 A;  3HKZ N;  3BJ6 A;  1ETV A;  3M8F A;  1X1C A;  3I5U A;  2QBY A;  5GTI C;  3MKW B;  4GCV A;  4C2M J;  1FJL A;  4RM3 A;  4P9U A;  1MMS A;  1Y0U A;  2M8E A;  2M5W A;  3HHG A;  4HYE A;  4BQN A;  2CYY A;  3OYA A;  3WHB A;  2R4G A;  4D7N A;  3ZQI A;  1S72 I;  4L0Z B;  5BPD A;  2CH0 A;  3EQL F;  2HKO A;  3CJT B;  2VLA A;  5LRS A;  3FHZ A;  1MJA A;  1IXR C;  4XR6 A;  1AKH B;  4G7Z F;  4RB3 C;  1SD4 A;  2VQL A;  4R1H A;  1X58 A;  2IEK A;  5LGU A;  1BIB A;  2EIL H;  4FE7 A;  3NAU A;  3RTR A;  3L2U A;  1YHQ I;  4HNV A;  4U88 A;  3R4K A;  2ZKZ A;  3FK7 A;  1MIJ A;  3I71 A;  3R0A A;  1XGS A;  1POG A;  2QF7 A;  1QHH D;  1DP7 P;  4WXD A;  1EA3 A;  2E5Z A;  2WB1 A;  3HUG A;  1K83 J;  2FOW A;  4NQW B;  3JSP A;  1IF1 A;  1JUM A;  5CVJ A;  5TIS C;  3RSN A;  4I2O A;  2OZ6 A;  1Y0N A;  1ZN2 A;  2XF6 A;  3K2Z A;  2PJR A;  2UUZ A;  5LHH A;  4R79 A;  2HQN A;  1HQC A;  3DV8 A;  1RKT A;  3OYM A;  1Y8R B;  3CMA I;  1J5Y A;  5M5Y J;  2XRL A;  2NVX J;  5CQE A;  1YW9 A;  3H1C A;  4DIQ A;  4U87 A;  1WJA A;  3LFK A;  1AWC A;  1LFU P;  2Y31 A;  3KEO A;  2A61 A;  2VE8 A;  4LMY A;  2ZFW A;  2PMU A;  1O57 A;  5EZH A;  2ELH A;  2O8K A;  4YEL A;  1KU2 A;  1HKT A;  4XKV A;  1WFX A;  3OYI A;  4Y17 A;  1YS7 A;  4ZYE A;  3FXL A;  4A5M A;  2HU9 A;  4H4K C;  4L9V A;  3MZY A;  1MMD A;  2D1H A;  5HNF A;  9ANT A;  3RQI A;  4AIK A;  2OCC H;  4KN4 X;  4FQG A;  4M6X A;  3H0D A;  1WWX A;  3DPL C;  3GLX A;  2DT6 A;  2QKL B;  1PYV A;  2XV4 S;  2BHZ A;  4E7I A;  1OCC H;  2Y69 H;  5J4V A;  5EEA A;  3B73 A;  1R7J A;  4M3D A;  1WGX A;  4EVI A;  3OYE A;  2G0E A;  2ZJP F;  3HOT A;  2ZME C;  2EZH A;  2JRM A;  5KAI C;  2DBB A;  2KZV A;  3CLQ A;  3E6M A;  1NHA A;  4XON A;  4F55 A;  1SFX A;  2EFO A;  5D6E A;  2MD5 A;  5GAD J;  4CIC A;  2IS1 A;  4PGG A;  2W48 A;  1N78 A;  3HBL A;  4MQV A;  1RZ4 A;  4XNF A;  5DYM A;  3VYU B;  2XSD C;  2JA6 J;  2HTJ A;  5E8I A;  4MGR A;  4PZJ A;  1CQT A;  3HRU A;  5TGT A;  3I4P A;  1ZG5 A;  5D8K B;  2K4J A;  5K7H A;  1NH3 A;  4CHU A;  1WHU A;  3DCF A;  4KN7 X;  3A01 A;  2K02 A;  3OIP A;  5M3M J;  1O4X A;  5IT9 Z;  4ZTF A;  3D5R C;  5JFR A;  2RGV A;  3QAH A;  3FXK A;  4WF2 A;  4Y4R A;  1NTC A;  2HKX A;  1UHW A;  1KU3 A;  3FHN A;  4C2T A;  2AXT C;  1VQ6 I;  5IYD J;  2QGU A;  2E1C A;  3CC7 I;  1TWF J;  1F43 A;  2DA5 A;  1HW5 A;  2Y9Y A;  4I02 A;  3ZQQ A;  3BZC A;  3RKQ A;  2L7M P;  1D0Z A;  1J0R A;  3H9G A;  3FBI B;  3RJP A;  2R5Y A;  1LE8 A;  5KK1 A;  1ZEL A;  2M1B A;  4XRM A;  1Z91 A;  1IXC A;  4GO1 A;  1H89 C;  2GQQ A;  1IZ1 A;  3F8B A;  1EH8 A;  4M6Y A;  4HZF A;  3BR1 A;  4GFB A;  5CYV A;  5EF6 A;  1RUN A;  1FTZ A;  2Y0M A;  1U8R A;  2DA1 A;  4RGR A;  4EJU A;  2H27 A;  1J59 A;  2X51 A;  1ZYR F;  3KP3 A;  4IQJ A;  4HBL A;  4BEH A;  3CTA A;  3HRS A;  1R49 A;  4AID A;  2DW4 A;  5L3G A;  3KP5 A;  4GXO A;  2KT0 A;  2STW A;  4DGW B;  3C18 A;  4HAM A;  3FKI J;  2X1C A;  5H6R A;  4BE1 A;  2OF7 A;  2V6C A;  2XAF A;  1FSH A;  5IT3 A;  2Y0S A;  5ICG A;  3F72 A;  3BPX A;  2JVH A;  1YIT I;  4G6D A;  4Y33 A;  3V7S A;  5CVU A;  2R7U A;  2CS3 A;  3S14 J;  4FX0 A;  2DQL A;  1T98 A;  3GFI A;  5L3C A;  1W36 D;  1JHH A;  4BDY A;  1FWZ A;  2AHQ A;  3K1N A;  2V79 A;  2W7N A;  2OBP A;  3DKW A;  1WJE A;  4KUM A;  4ENJ A;  1X2M A;  3WHC A;  1YW8 A;  1ZAR A;  4HLX A;  1HKS A;  4JQF A;  5KHD A;  4XKW A;  5ERI A;  2DA4 A;  2WAQ N;  1AKH A;  4HDU A;  2MAB A;  3GTP J;  2ACJ A;  3M7G A;  4XSX F;  4YFN F;  4ZH4 F;  5FLV A;  3ONQ A;  4L5E A;  3AG3 H;  3CO7 C;  6PAX A;  2HYJ A;  3VYS B;  3SZP A;  1B4A A;  1ETQ A;  2J5P A;  3GO5 A;  1XPX A;  1RPW A;  2EIJ H;  4DYR A;  2YX4 A;  4IHT A;  3B02 A;  4PSX A;  3OIQ A;  3S17 J;  2DI3 A;  3RIR A;  3ZMU A;  1D5V A;  4B48 A;  3IWF A;  3ZQC A;  3MKL A;  5TRD A;  2HZT A;  3JRB A;  3BY6 A;  5A2Q K;  4CGZ A;  4A3D J;  3F8C A;  4EQQ A;  2ZME B;  3TOB A;  4RAY A;  3V8L A;  5E1Z B;  2VKV A;  3CDL A;  3PIO F;  5FKM A;  1V5E A;  3GZ6 A;  3G73 A;  5LEK A;  3RZO J;  4XQF A;  1YLF A;  2VBX A;  2G7U A;  2EZL A;  3TDZ C;  2CQ7 A;  5DD4 A;  1DUX C;  3W3C A;  2OCE A;  4L9T A;  1IAW A;  4A3B J;  3FWE A;  2ISZ A;  1TTY A;  2PI0 A;  1T33 A;  1P6R A;  1C0W A;  2LNB A;  2IA1 A;  2KL4 A;  3Q0U A;  4CO8 A;  1GXP A;  1Y56 A;  2GBY A;  3T8T A;  4BXX J;  3K2A A;  2XGE A;  3VFZ A;  3I3L A;  2W84 A;  4II3 A;  1N75 A;  5IOY A;  4NC7 A;  4JOM A;  3O8G A;  2ZB9 A;  2DO7 A;  4F7Z A;  1SFK A;  4RS8 A;  2Y2Z A;  3BLY A;  1GLN A;  2M8G X;  2GXA A;  2LY1 A;  2K4B A;  4YEJ A;  2IS6 A;  3IH2 A;  5FB2 A;  4BHB A;  3ECO A;  1RKW A;  1OYW A;  1XMA A;  1T6S A;  1LUJ B;  1FBS A;  2PLY A;  1G2H A;  3P5J A;  1Y39 A;  2Z3Y A;  2IS2 A;  3LFU A;  1OR7 A;  1YQA A;  3L2W A;  4EGY A;  2DFH A;  2CUF A;  2H1K A;  5J3L A;  3I9V 2;  4Z2Y A;  4XLA A;  5LHI A;  3CF2 A;  4KIB A;  2M4K A;  3QQA A;  2WB1 N;  2CV2 A;  2FUG 2;  3H5R A;  5JLW A;  3I59 B;  3FXJ A;  5FLM J;  3F6O A;  5JLX A;  1J9I A;  2MW8 A;  1MMN A;  2QKM B;  3HG9 A;  2Q0O A;  4HF0 A;  2A68 F;  1EV7 A;  2OD5 A;  2M87 A;  2XPW A;  3QOD A;  1I1G A;  2KFD A;  2XVC A;  2DQR A;  3OYC A;  1K6O A;  1JJ8 C;  1Z67 A;  3ELK A;  4L5I A;  4ON0 A;  4A0Z A;  1DP3 A;  2LDU A;  2R7T A;  4LGW A;  3M8J A;  1I27 A;  1MBF A;  1R5I D;  4IL6 C;  1ZH5 A;  4HX7 A;  3AKZ A;  2E2I J;  2DMQ A;  3FXO A;  3PUF A;  5GP9 A;  2Z33 A;  1JUS A;  5E17 F;  4C9Y A;  3S1M J;  5AON A;  4UB6 C;  4KIT B;  2QSF X;  2I8D A;  2M0C A;  4II2 A;  4A0X A;  1JGG A;  1HW2 A;  2DDA A;  1JXS A;  4L5J A;  1A36 A;  1V4R A;  3BR5 A;  2M7B A;  2CQK A;  3F8F A;  3Q9S A;  1SEU A;  4M73 A;  4IHV A;  4LOC A;  4YII A;  1Z21 A;  3P9C A;  2F48 A;  2XKP A;  2XAH A;  4DBR A;  2BY1 A;  4NNJ A;  1F4K A;  4JK1 X;  2X6Y A;  4RB2 C;  2BVL A;  2EB7 A;  3H9Q A;  4NC8 A;  4L9N A;  1N77 A;  4GYG A;  1BOB A;  5E1W A;  3ZN1 A;  3TOA A;  1XCV A;  4WWC A;  1ETK A;  1U5T B;  3MN2 A;  3VPR A;  1FZP B;  1IRF A;  3PL8 A;  4CCK A;  4IZZ A;  1YX3 A;  1IUF A;  4AYB N;  5E3M A;  1YJW I;  2BW3 B;  4AWX B;  4OIO F;  4UUV A;  1P7I A;  3LNQ A;  1W5C C;  3S8P A;  1YIJ I;  1D5Y A;  5FLX Z;  2DFE A;  1TL8 A;  3CC4 I;  3TO7 A;  3OYF A;  2HOS A;  5LFA A;  3NQO A;  3ZQ7 A;  1ZLJ A;  4U7D A;  1XX5 A;  1JKO C;  5LGT A;  1IG7 A;  2HOT A;  3HIF A;  3HYI A;  1UMQ A;  4UV9 A;  5M3F J;  4HQE A;  1EH7 A;  2FSW A;  1QZE A;  2Z2S B;  2IXS A;  1YX5 A;  5TJJ A;  3ZQH A;  1T2K A;  2LSO A;  1QVU A;  2MG4 A;  3IV5 A;  1T8I A;  2Q2E B;  3A1Y A;  2ZSI B;  1JHF A;  4RGS A;  3FXR A;  2HS5 A;  1U78 A;  1XSX A;  4ASN A;  4HRI A;  2BGC A;  1IN4 A;  1WH7 A;  1G3Y A;  2E1O A;  4A6E A;  1TNT A;  3KZI C;  4M9Z A;  1MNM C;  2HEO A;  2JWT A;  4M3G A;  2E71 A;  3H36 A;  3ISP A;  4KDP A;  1GT0 C;  5BS6 A;  2L9R A;  3F3X A;  3P9I A;  3E0J B;  2P81 A;  4X1E A;  4CZC A;  3E6B A;  3CCE I;  5DDG A;  3DPT A;  2ZO4 A;  4Q48 A;  4B44 A;  2ETH A;  1GUU A;  5F1R A;  5J8F A;  2GOM A;  2IGO A;  2M0M A;  4UVA A;  2K3P A;  2VIX A;  2KMU A;  1NG6 A;  1MJ9 A;  2QWW A;  1XMK A;  2VQH A;  2ZME A;  3SZG A;  2VBW A;  2H94 A;  2XB5 A;  2LD5 A;  4YRV A;  3KLN A;  1ON1 A;  2R7D A;  4BQA A;  4M74 A;  4HF2 A;  2ELJ A;  4KMU X;  2R7R A;  2F6C A;  5BPI A;  2P7V B;  4CUG A;  1XCB A;  4ZC3 A;  1E2X A;  3E7L A;  2E34 A;  4DW6 A;  1LNW A;  3IHU A;  5DV5 A;  2DA6 A;  2XAG A;  2JA5 J;  2K5C A;  1IJW C;  2NVU B;  5K1Y A;  4HPQ A;  1S5L C;  2QQ8 A;  3ROU A;  3F6V A;  1ZRC A;  5EJC A;  3CMM A;  3WGG A;  2WV1 A;  4MQ9 F;  1OQY A;  2DTZ A;  1G4D A;  2FNA A;  1FSE A;  2L3D A;  1P4X A;  5KVR A;  4KT5 C;  4PUS A;  2WY7 Q;  4LB6 B;  4EV0 A;  4KT6 A;  2LR8 A;  2KLO A;  4I01 A;  2CQN A;  1QO0 D;  3G3Z A;  3UNG C;  2ZBK A;  4N4N B;  1G3T A;  3E6C C;  2HR3 A;  5EGO B;  4D0P A;  3LSM A;  3HOY J;  2BY2 A;  2X1E A;  4I98 B;  3JAM K;  2OA4 A;  4GRI A;  4RAF A;  2XRO A;  1R5G A;  4HNU A;  3K69 A;  1R36 A;  4A3L J;  2V6E A;  3PNY A;  1UST A;  1SD5 A;  3W2W A;  5DTD A;  4XL9 A;  1BC7 C;  2HZD A;  2L9S A;  3JRA A;  2OU2 A;  1XN7 A;  1D0X A;  1BC8 C;  5D5V B;  3S1R J;  3G4S I;  4Q47 A;  3ZQF A;  3SXY A;  2WA0 A;  5IP7 J;  1WZ2 A;  1R22 A;  1IRZ A;  2DDB A;  2Q8K A;  1K61 A;  3I59 A;  2QCO A;  2HPI A;  2YSR A;  2DFI A;  2CFO A;  2XDV A;  1I50 J;  3GFJ A;  2M3A A;  3T0Y A;  1ACI A;  2ZXW H;  1OCZ H;  2XRN A;  3HPG A;  2PFB A;  2IA2 A;  1RI7 A;  4Z6Y A;  4ZYG A;  2AXL A;  2D5V A;  2V1D A;  4OAY A;  3REO A;  1JT6 A;  3SQN A;  3MFK A;  4LIT A;  4PK4 A;  2JQ7 A;  4A3I J;  4HST A;  3HXL A;  3M8E A;  3PO2 J;  4RMN A;  1AU7 A;  2A6H F;  2E19 A;  2TDX A;  2R5Z B;  2H6C A;  3K4B A;  3MQ0 A;  1REP C;  2NS0 A;  3S1N J;  1S7O A;  2RDP A;  2VJI A;  4EJV A;  3VOE A;  4DQ2 A;  3PNV A;  5KNL A;  1P2F A;  3P9K A;  3MVP A;  1O7F A;  4ZZL A;  1ZHF A;  2DYR H;  3DPU A;  1JT0 A;  2EA4 A;  1TWG J;  2LF8 A;  2LOO A;  2Y30 A;  2HXI A;  1WJD A;  2O3F A;  2ADU A;  2DA2 A;  3T5X A;  3KFW X;  1KQ9 A;  5LBQ A;  2IT0 A;  4U0W A;  1T56 A;  2OQG A;  3O2P E;  3HSE A;  1NG7 A;  3M1E A;  2KDZ A;  1ZQ3 P;  1FY7 A;  3AG2 H;  1X4O A;  4XM3 A;  2E1M B;  3PFI A;  1FOX A;  4HOB A;  3MMY B;  4EEF G;  4IOA F;  2ZXH A;  4B47 A;  2B9S A;  4B43 A;  1U5T A;  4L18 B;  3DQV C;  3ULQ B;  3TQN A;  2G7H A;  2F5V A;  3GW2 A;  2WTE A;  1MKM A;  1YTY A;  1JKR C;  3ECH A;  2LP0 A;  4I76 A;  2M7A A;  1I3Q J;  3J80 Z;  3WTS C;  4LK0 F;  4I09 A;  4YIR X;  5JVT A;  1NK3 P;  5K5O A;  2M4G A;  2VKH A;  2RQP A;  1P9Q C;  2L7F P;  4LLL A;  5D4S A;  4B1R A;  2DFF A;  3TW7 A;  3MZH A;  1HCR A;  3I0T A;  1B8I B;  4EGZ A;  1V5F A;  4Y52 J;  1BW5 A;  1R23 A;  5HLT A;  3MCZ A;  2Q2E A;  2KHM A;  3BQY A;  4HA8 A;  3L2R A;  2EFW A;  1XTA A;  2KJC A;  3HC7 A;  1ENH A;  4A6D A;  5EYR A;  2ESN A;  1EF4 A;  2CUE A;  2KRF A;  1FPQ A;  2FJ1 A;  3RQ4 A;  3HOZ J;  5JR3 A;  1P4A A;  2COB A;  3RZD J;  2YX7 A;  2HYG D;  3LA3 A;  2HOE A;  3LQR A;  1H88 C;  4XRF A;  1YYV A;  4RAZ A;  3Q3S A;  1TC3 C;  2L5Q A;  3OR2 C;  5CLS A;  5EDN A;  3RPU A;  1QPM A;  3DEE A;  3GYH X;  3GME A;  3OS1 A;  1L3L A;  4DBQ A;  1RET A;  4I0A A;  3V8K A;  4IX7 A;  1YJ9 I;  2UWM A;  4MLO A;  1XGN A;  1K4S A;  2V9V A;  3OV8 A;  3FMQ A;  3U21 A;  3KYL A;  1FNN A;  1N25 A;  1EH6 A;  1OYI A;  2XPU A;  1B72 A;  3HOU J;  4ZTJ A;  2YPR A;  4ZYA A;  2PEX A;  2X85 A;  5F0C A;  3RKY A;  4G7O F;  1Y8Q B;  5K5Q A;  3K7A J;  4C3H J;  3KP6 A;  3DKY A;  2ZJQ F;  2JA7 J;  2VJ4 A;  1W5T A;  2PMZ N;  3AG1 H;  4LIV A;  5HOD A;  1Z7L A;  3AL0 B;  2BBY A;  1ETO A;  3M1C A;  1SD7 A;  3J7Y J;  1F5T A;  2TRT A;  5D6F A;  5ICE A;  4UY8 I;  1Z05 A;  4A0Y A;  2E60 A;  3H3U A;  5B3S H;  2F5F A;  2R7Q A;  3WGH A;  4M9S A;  4F93 B;  4I7H A;  3ASO H;  1R4M B;  3CES A;  3LA2 A;  3KZY A;  1HOM A;  3IWZ A;  3X2Q H;  1ONV A;  1MDM B;  5A2Q Z;  5KCM A;  1FTT A;  2OJE D;  4DYQ A;  4UV8 A;  4F52 A;  3P7N A;  1T39 A;  2QVO A;  3VSL A;  4P1W A;  3HSR A;  2ID6 A;  1I39 A;  2DMU A;  3D5S C;  5IY5 H;  3ZPL A;  4KIG A;  4I99 C;  4MEX F;  2EIK H;  4XLE A;  1Q1V A;  3GTM J;  3BR0 A;  3IP4 B;  1HST A;  2CJJ A;  1ZGJ A;  2DK8 A;  5ED4 A;  1K78 B;  1L0O C;  2R7O A;  4HX4 A;  2KIM A;  5FD6 A;  1B9M A;  2V26 A;  4OOI A;  4F92 B;  3KZZ A;  3BJA A;  3V42 A;  4ESF A;  4IHY A;  1U0J A;  2UZK A;  4IPA A;  2STT A;  1W36 C;  4JP0 A;  5DCF A;  3ABT A;  2EFN A;  1X1P A;  3RPQ A;  4ZYH A;  5FD5 A;  4G94 A;  2P4W A;  3J80 K;  4BDZ A;  1R4N B;  2HQA A;  4CH7 A;  3CUQ B;  2BOL A;  4E7Z A;  4KA4 A;  5DM7 F;  1FOK A;  4ABZ A;  4Y7N J;  2R5Z A;  1I1S A;  2HXO A;  1LPQ A;  2Q1Z B;  1YFH A;  3L9F A;  4O3M A;  1VQ7 I;  1MH4 A;  3K4C A;  1RNL A;  2L4A A;  2VB6 A;  4BJ6 C;  5KAF C;  2GM4 A;  1DU6 A;  4BE0 A;  5HLG A;  3OYL A;  1FEX A;  4XLP F;  1MNE A;  4I6Z A;  1LFP A;  2DCE A;  4X6A J;  2KQR A;  4OWR B;  4NUB A;  4BHC A;  1QPI A;  4J00 A;  4UVB A;  5K7F A;  3ZXS A;  5J1Y A;  5B66 C;  5F04 A;  4LB5 A;  2W24 A;  3LQQ A;  2R0Q C;  2NAZ A;  1ORK A;  2HQ5 A;  1T38 A;  1LJ9 A;  4A3E J;  1J09 A;  1I5Z A;  1ITY A;  4G7H F;  2GLO A;  4E6K G;  1MBG A;  2WWY A;  2HVQ A;  3W2V A;  1HXD A;  2D45 A;  2CO5 A;  3LSG A;  1HA8 A;  4HSR A;  5M5W J;  2PBI A;  2MFZ A;  2RRE A;  3RI4 A;  1JGS A;  2OV7 A;  3OOU A;  2VOP A;  1S3J A;  3KEQ A;  4MFE A;  2IGM A;  1WJC A;  5D8L B;  4XRS A;  1PJR A;  2RQQ A;  3HTU A;  2RV8 A;  1KYW A;  2VAS A;  1Y6I A;  4XN3 A;  3C7J A;  3PFY A;  3DTI A;  2NOJ B;  2MH2 A;  4W1U A;  1FP1 D;  1FBU A;  4WX9 A;  1HC8 A;  4YG2 F;  3SDG A;  3Q0W A;  3ABK H;  3K4N A;  2EWN A;  3SYT A;  1IDZ A;  4RGX A;  2CQX A;  2LKX A;  2XB0 X;  3GZN B;  4IXA A;  4UUT A;  3BG3 A;  5CQG A;  4DNC A;  2VPR A;  3BR6 A;  1CF7 B;  2JT1 A;  4KJZ A;  2ICW G;  5ILS A;  5IPA A;  2RC4 A;  3LSP A;  4CCJ A;  2QZ8 A;  3HTS B;  1XMX A;  5D5W B;  1HDD C;  4NBQ A;  3L2Q A;  2QYO A;  1XB4 A;  2O5R A;  5FFZ A;  3OYH A;  3JR9 A;  2MA3 A;  2W82 A;  5E3O A;  5HS9 A;  2FBH A;  3A03 A;  3JRH A;  3WG9 A;  1WVR A;  2FE3 A;  2VT3 A;  3SDB A;  1U5T C;  4NQW A;  1DGR M;  3BG5 A;  2NVQ J;  3BOQ A;  4BY1 J;  2ZCW A;  1SAN A;  3IAS 2;  1APL C;  3MWM A;  3NEU A;  1QZZ A;  2J5O A;  4ZDP A;  4LK1 F;  1K4T A;  3BPV A;  5FRN A;  3ZP5 A;  3ZQL A;  4UB8 C;  3S16 J;  3HOS A;  4A3J J;  1D1B A;  4G9Y A;  5E79 C;  5IP9 J;  1DQU A;  4YIF A;  2QA4 I;  1JI8 A;  4FX4 A;  5J40 A;  4E7K A;  3LAP A;  3JRF A;  3M07 A;  3DBL B;  1O3R A;  3TL4 X;  1OKR A;  3ZMV A;  1W1W E;  4PJM A;  1OLT A;  1VF9 A;  2BV6 A;  4IKF A;  2EV0 A;  2TCT A;  4C3J J;  4JX4 A;  1SD6 A;  5HOO A;  3BR3 A;  3G2B A;  1D0Y A;  2VXZ A;  3KEY A;  3HPH A;  5ICC A;  2L2O A;  2WBM A;  4B3A A;  2LMD A;  2AO9 A;  3QOE A;  2KDO A;  3BP8 A;  3FM3 A;  5ILV A;  2KIQ A;  5C44 J;  5DUK A;  5LLQ A;  3PM1 A;  3L00 A;  1XC5 A;  3MAJ A;  3HOX J;  2LLK A;  3K4M A;  1IRG A;  1KQ0 A;  4I0B A;  3AG4 H;  4P9F A;  4XOT A;  1G3W A;  4IEJ A;  4OIQ F;  4KIC A;  1G3S A;  2JTV A;  5FKN A;  4BJ5 C;  1OCP A;  3PQK A;  4DOZ A;  2DA7 A;  1Z6R A;  3TGN A;  2Z5U A;  3DU6 A;  1ZKG A;  3RCO A;  3WTY C;  1B6A A;  1WCM J;  1S7E A;  1MDM A;  3TMO A;  4PGH A;  3CME I;  4KFC A;  5EG0 B;  2VQC A;  3CCJ I;  3ZMT A;  1IGN A;  1Z3Y A;  5JHF A;  4FTH A;  3J7Z I;  2FRH A;  3ZMZ A;  3CP8 A;  1TT0 A;  3ESW B;  2O6G E;  2RNG A;  1ZGW A;  4B09 A;  2Z1D A;  1UG2 A;  2KIS A;  3PUB A;  3WE2 A;  3OYJ A;  5C4J J;  1T08 B;  3H9J A;  3W6J B;  1JJ6 C;  4ENN A;  4BBS J;  1LDK B;  1K78 A;  4PFO A;  3DEW A;  1VI0 A;  4HG2 A;  2VON A;  2P7C B;  2LRD A;  3HKZ A;  3ZGK A;  2W85 A;  2DU9 A;  3E1S A;  4EJT A;  3G1L A;  1TWA J;  4KYW A;  1U3E M;  5H6Q A;  3CUQ A;  5E3N A;  2MC4 A;  1HBX G;  1R1U A;  1PP7 U;  3GUD A;  3H5N A;  1SFO J;  4HQM A;  4B4C A;  3J81 K;  1JKQ C;  2HI3 A;  3NWT A;  4L9J A;  3WU0 A;  3ZMS A;  3S32 A;  3IKT A;  4IRH A;  2CW0 F;  3JAM Z;  4OMZ A;  2GXB A;  1RES A;  1OIS A;  2JPB A;  3LL7 A;  2YU9 J;  1UZC A;  1TNS A;  5GPC A;  2L9N A;  3L1P A;  1HF0 A;  4A2U A;  1XSD A;  1YRN B;  1VQ4 I;  2QQ9 A;  1D8K A;  5L3D A;  1SVM A;  1F36 A;  4AVP A;  3S15 J;  1NK2 P;  2NVT J;  1W0U A;  1ZLK A;  2XPV A;  5K5R A;  1ODD A;  3BQZ A;  3BTJ A;  1QVT A;  3HRM A;  1FMW A;  2JMW A;  2JJ7 A;  3RDI A;  3JTH A;  5CVI A;  3F22 A;  2VKE A;  3ABL H;  2YUS A;  1G6N A;  4UXN A;  3DEU A;  4V2G A;  1FIP A;  3KET A;  3R6S A;  1ZG1 A;  3JRE A;  1ZR4 A;  3JSO A;  2IGN A;  1YE9 A;  1MGT A;  2ESH A;  1VQK I;  4LLG F;  4GGG A;  4BXF A;  3F9K A;  3O8H A;  4RLF A;  1YO5 C;  4LG0 B;  1PP8 F;  5B1B H;  2YR2 A;  4B8X A;  3QYE A;  3TDU C;  4PJJ A;  3FKJ A;  5EZG A;  1S29 A;  3WOD F;  2FA5 A;  5H2F C;  2ZXJ A;  3DF8 A;  2V1X A;  3ZOB A;  1W5S A;  5DM6 F;  1KU9 A;  1SVO A;  1OJL A;  2CSO A;  1ZGA A;  3AFH A;  2NOG A;  3E6D A;  1O3T A;  2QLZ A;  2HYF A;  1V55 H;  2PN6 A;  3E97 A;  5FO5 A;  3OMY A;  4A3C J;  3CZ6 A;  2VC0 A;  4V19 K;  4N0B A;  2OPT A;  1CF7 A;  2FEZ A;  4HW0 A;  2FQ3 A;  1H9T A;  2JA8 J;  4CCN A;  1BJZ A;  4Y13 A;  2LKP A;  2M30 A;  3PNT A;  3LSI A;  1A6I A;  2E1M C;  4CCM A;  5B1A H;  4RB0 A;  2CGP A;  5DUI A;  4BAC A;  1LVK A;  2XHK A;  1DU0 A;  1B9N A;  1FC3 A;  5J1U A;  1RRJ A;  5E3L A;  4NHJ A;  2ELK A;  1BIA A;  1W7P D;  1D3Y A;  1XGM A;  1P4W A;  3CMY A;  3CDI A;  4C2U A;  1I6X A;  4XLH A;  2ZXI A;  4X0G A;  5BMZ A;  2IA0 A;  3A4C A;  3MEX A;  1VQL I;  3CD6 I;  3DLA A;  3WTU C;  2JVG A;  1A04 A;  2WY8 Q;  1MND A;  3TBI A;  2XUB A;  2VBZ A;  3SEZ A;  4QSH A;  1IW7 F;  2CW8 A;  1LDJ A;  3EYI A;  2A6T A;  2R7F A;  3HUG B;  4CDG A;  1WRJ A;  3MKY B;  2HTS A;  1QBJ A;  2DN0 A;  4F91 B;  2PJR B;  2RKH A;  1HW1 A;  2NVY J;  3BDD A;  3GFM A;  1B59 A;  1OYY A;  2NS7 A;  1JE8 A;  3H3Z A;  2HPM A;  2Y0S N;  2GIZ A;  4A69 C;  3UKG A;  2QQB A;  2EA2 A;  2VN2 A;  3HHH A;  2HWV A;  3IRR A;  2P6T A;  2EK5 A;  3WE3 A;  4CXF A;  1AOY A;  2AQF A;  2VJJ A;  2MC3 A;  2R3S A;  3KX2 A;  2R92 J;  3G6E I;  1VND A;  2ID3 A;  2ZC2 A;  3OY9 A;  4EMS A;  3KIO A;  5DCM B;  2NXN B;  1YG2 A;  1X3Z B;  3H0G J;  3K4J A;  4G12 A;  4JX5 A;  1K7A A;  1EJ9 A;  3KP7 A;  3I54 A;  5FRM A;  4LFU A;  5H20 A;  5ILU A;  2L4M A;  5M5X J;  4XIC A;  2DJI A;  1GXQ A;  4WXC A;  1HSJ A;  3I64 A;  2K9Q A;  3L09 A;  5EG0 A;  4LJZ F;  4RM2 A;  1UG0 A;  3K4K A;  4JBA A;  4EM0 B;  4ENK A;  1DDN A;  1XDU A;  2L02 A;  1QNT A;  3F8N A;  3G1M A;  1VQ5 I;  3O3K A;  4E4H A;  3SEQ A;  3OYG A;  1VZ0 A;  2IP2 A;  3L2C A;  2H09 A;  2VL8 A;  3MZ8 A;  3HGG A;  1W7P B;  3HZJ A;  3K0L A;  4UUS B;  5E18 F;  2XC7 A;  1BR2 A;  3QYF A;  4UNO A;  1KA8 A;  3NRV A;  4OIN F;  1X1A A;  3AL0 C;  2UV1 A;  1D1A A;  5D5U B;  3NWS A;  3I55 I;  4XLF A;  3QYB A;  4EJO A;  3GX4 X;  3E3V A;  1UCR A;  2M2E A;  3LSJ A;  1UJ8 A;  5LD2 C;  4P55 A;  3FIS A;  2EPF A;  1PDN C;  5C4X J;  4ZDO A;  3VEP A;  2B7E A;  3OYB A;  3HOW J;  2M34 A;  2F2E A;  1QRY A;  2IBD A;  1TBX A;  2EBI A;  2D2W A;  1R1T A;  2JPC A;  2GIV A;  3OSF A;  1MSE C;  4XKB A;  5HDN A;  4MO7 A;  1IO2 A;  1H0M A;  3A01 B;  2K9L A;  4HF1 A;  3JCU C;  5AIP A;  5CPR B;  4NDL A;  3BZK A;  2WAQ A;  1VQO I;  4D9J A;  3CCU I;  5F0F A;  1YRN A;  1U2W A;  1J2X A;  5LEJ A;  1UHS A;  3VOD A;  2I10 A;  4PJN A;  4BS9 A;  1QGP A;  3OS2 A;  2M45 A;  2VQG A;  3D5L A;  2XAS A;  2R7Z J;  3C2G A;  4HV6 A;  1V5G A;  4TV7 A;  1JKP C;  2LBF B;  4FIS A;  1U6G A;  3GTO J;  2CV1 A;  2W00 A;  2JZY A;  3IAM 2;  4W97 A;  1R5H A;  3IH4 A;  4CYC B;  4Q5S F;  2HOA A;  2F4O B;  5BOX A;  4PSW A;  2UXN A;  2JUG A;  3QPH A;  2L01 A;  5GAG J;  2K3F A;  3ASN H;  2E5N A;  2JSC A;  3ZR8 X;  2FXA A;  2JN6 A;  3E5Q A;  5HDK A;  1WJF A;  3DTE A;  3IL2 A;  1BOA A;  4BAY A;  2BW3 A;  2V4J C;  2DAO A;  3CUQ C;  3OYN A;  1ZRE A;  2PG4 A;  3RYP A;  4S05 A;  3KPH A;  2KPM A;  4A5N A;  3W2A A;  2BHY A;  3PIP F;  2KP6 A;  2VE9 A;  3D0S A;  4OIP F;  2Y48 A;  4KMF A;  2P0W A;  3S1Q J;  2MLK A;  1KYZ A;  2X9D A;  2I5U A;  2AS5 F;  2XF7 A;  3S3N A;  1R1V A;  2X4H A;  3PQJ A;  1YOV B;  3BZ6 A;  4A3M J;  4NC6 A;  2XGD A;  3VDX A;  2WAE A;  4QPQ A;  4XOR A;  3KCC A;  3R60 A;  1O3S A;  2XSJ C;  1ZAO A;  3CCS I;  3QP5 A;  2F4M B;  1W4M A;  3DBR B;  2DJN A;  2MYS A;  3KLO A;  2IGK A;  4M3F A;  5L3B A;  2Z9O A;  2DTR A;  3FF5 A;  2O9L A;  1VQN I;  3SJM A;  2HGC A;  2ZSH B;  2LFB A;  2LYC A;  2PJP A;  4XBF A;  1IN7 A;  2IVM A;  2K40 A;  2D1V A;  1OPC A;  4XLC A;  4AVZ A;  2H1L A;  5L3E A;  4E7L A;  2W57 A;  3V4G A;  2P5V A;  4OIR F;  4WXH A;  4HLY A;  2O03 A;  3H35 A;  3O6B B;  4BQO A;  3QPT A;  2P5L C;  2ZJ2 A;  5F1J A;  2FOK A;  3CCQ I;  1LB2 A;  4XID A;  3LA7 A;  2QM3 A;  1D1C A;  3F21 A;  4XLN F;  2O7O A;  1BI0 A;  4P5O A;  5J47 A;  1A5J A;  2FF4 A;  1MZB A;  1MBJ A;  1YI2 I;  2G9W A;  3GVA A;  2EIN H;  2K9N A;  4CYD A;  5EEH A;  1SFE A;  3U9G A;  3K70 D;  2CWE A;  4G6Q A;  3N4M A;  3S2D J;  2F5E A;  2QQA A;  2L0K A;  4M9X A;  3Q9V A;  1ON2 A;  4RDU A;  5J4Y A;  4GYI A;  2ISY A;  5IP6 A;  3HM5 A;  2ZNY A;  3MKZ A;  2DT7 B;  3GWZ A;  3GTL J;  4O6J A;  2HDD A;  4JYK A;  1HDP A;  2OTJ I;  5DCM A;  1PUE E;  1BL0 A;  4ZDL A;  3CCY A;  3HSF A;  2NNN A;  4ANJ A;  1MJB A;  1F9N A;  5EGO A;  1K6Y A;  3CJR B;  1GHC A;  3DU5 A;  3CCM I;  1TQI A;  3ML6 A;  3DFG A;  2CG4 A;  2ECC A;  2LK2 A;  1HKQ A;  4S0H B;  1SMT A;  1H8A C;  5DS9 A;  5GAE J;  3K9T A;  1B1B A;  1RC9 A;  3JW4 A;  1V54 H;  5E1X A;  4IJA A;  2X6X A;  3OL3 A;  3R0J A;  2A5Y B;  2LC2 A;  3I56 I;  1GVD A;  4M72 A;  1QU3 A;  1XGO A;  2XGC A;  2DMP A;  3WTW C;  1VFC A;  4IRI A;  1Y1W J;  1X2N A;  5L3F A;  4AM3 A;  4RGU A;  1PVE A;  4XRS G;  1ZK8 A;  1G59 A;  1TQM A;  2LY9 A;  2IW5 A;  4OAZ A;  3S3M A;  2FMY A;  4FET A;  5AIQ A;  4F3Q A;  1W7P A;  1GV5 A;  4UUS A;  2XAU A;  1E0E A;  3Q5F A;  2EQR A;  1WI9 A;  4RAG A;  3SHF A;  4IQ4 A;  4AYB A;  2JUC A;  2GZW A;  4CCL A;  4PJL A;  3S2H J;  1IV6 A;  4IRG A;  2KKO A;  1X3W B;  4LD5 A;  4MIM A;  2R7V A;  1KON A;  2VKD A;  3CO6 C;  3C3W A;  3EET A;  4ZJZ A;  2PMH A;  3BG6 A;  3FXM A;  1O3Q A;  2DMN A;  3LMM A;  3M3Y J;  1FX7 A;  1MSF C;  2BEO A;  4E7S A;  3TO6 A;  2CRG A;  4AC0 A;  3KP4 A;  3WU2 C;  2X6W A;  5JHU A;  4QWQ A;  3OYD A;  3ZRG A;  2HFH A;  1P92 A;  3GEZ A;  5HVQ C;  2COM A;  2F5D A;  2EIM H;  4Y15 A;  2K9S A;  5DEQ A;  2DPU A;  1U9O A;  2CU7 A;  1M1E B;  3RKX A;  1WH5 A;  3KP2 A;  4AD9 A;  3WTX C;  4ENM A;  2DPD A;  3L7W A;  4BNC A;  1TT5 B;  3QU3 A;  5FFX A;  4A93 J;  4YFX F;  3OYK A;  3Q0V A;  5CKT A;  3HRT A;  1ULY A;  1Q1H A;  2L54 A;  2EV5 A;  2KIF A;  3N97 A;  2PQ8 A;  2MH9 A;  2LBF A;  2IRF G;  3GTG J;  2YS9 A;  2K7L A;  1I6H J;  4G8X A;  1D8J A;  1EKE A;  1G8X A;  2BE5 F;  4FAS D;  2EZI A;  2V1N A;  4CYC A;  4E7H A;  2VPL A;  4N9H A;  2OZU A;  1T0F A;  3LSH A;  3E5X A;  1BW6 A;  4XOP A;  3RKW A;  4E7J A;  2GA1 A;  3BCA A;  4XK4 A;  3FZV A;  3HL2 A;  1F1Z A;  2NRA C;  4Y3O A;  4BU2 A;  4FT8 A;  1SAX A;  3ABM H;  3KE2 A;  4C3I J;  4M6V A;  4U0Y A;  1E3O C;  2N8G A;  5IYB J;  5HS8 A;  1OCO H;  4BYY A;  2W25 A;  5FKO A;  2QSH X;  4UVC A;  3FM5 A;  2RAE A;  4N9I A;  2XGX A;  4IHX A;  2BY3 A;  3J81 Z;  4UHT A;  2P8T A;  3GTJ J;  1TLH B;  2NS8 A;  1BI1 A;  1Z6T A;  1B8I A;  5JI6 A;  3GXO A;  3AAF A;  4A3F J;  1SC7 A;  5E8G A;  1ETW A;  2AQE A;  2ME6 A;  3L2V A;  3UR3 C;  2E7X A;  1T95 A;  2HNH A;  2CUJ A;  1E17 A;  3FBN B;  3HB9 A;  4WK8 F;  2OAZ A;  2LG4 A;  1MH3 A;  1R9T J;  3CUO A;  3TP0 A;  4A12 A;  1PUF B;  5D4R A;  3DWL E;  2EFQ A;  4QIW N;  3BTL A;  5HNH A;  1S9H A;  1KQ8 A;  4MTE A;  1FP2 A;  1TWH J;  4JX6 A;  3HGY A;  2VBY A;  2FD5 A;  4BHP A;  3V8J A;  3COA C;  3DLL F;  5DD8 A;  3EDP A;  4MTD A;  1FT9 A;  2GAU A;  4HV5 A;  2RN7 A;  1GDT A;  3CF5 F;  4KNY A;  1TZL A;  1FBQ A;  2ZFU A;  1K79 A;  1FMV A;  3BTI A;  2K9M A;  3M9A A;  3OWT A;  3BCB A;  1Z1D A;  1WQ2 A;  2V7F A;  4CSW A;  1IDY A;  1VQP I;  2VI6 A;  2IPQ X;  3EUH A;  3A2K A;  5BNG A;  2GXG A;  4ZYD A;  2DOD A;  2W1O A;  3K6G A;  3CC2 I;  3LST A;  3LSK A;  1MMG A;  5F0H A;  3JTG A;  1E3H A;  3U1K A;  2EJR A;  2O0Y A;  3BJO A;  2OC6 A;  1SMY F;  2BXY A;  5E20 A;  2GA2 A;  3R61 A;  2RNJ A;  3FXU A;  3FMR A;  3VYR B;  5LRR A;  3IC7 A;  3WTT C;  4QPO A;  5CVV A;  1BM9 A;  2DYS H;  3DBH B;  5FRO A;  3IH3 A;  2OUM A;  5F27 A;  1UB9 A;  2H8W A;  4HEA 2;  2MLG A;  1FYL A;  2K86 A;  3LWF A;  2L9V A;  2JRT A;  2K85 A;  3OR1 C;  4BY7 J;  3PSI A;  1TP4 A;  2HVS A;  4A3G J;  4CZZ A;  4BKX A;  1YS6 A;  2VJ5 A;  3ZCO A;  1LKX A;  4RLQ A;  2HDW A;  1XDS A;  4D5F A;  2V9K A;  3C2H A;  1X4P A;  4LG3 A;  3TKY A;  3QOP A;  2RVC A;  5IT9 K;  2HQR A;  2LKS A;  1WSU A;  2E2J J;  2Z16 A;  3NAR A;  5LGN A;  3CLO A;  3ZMD A;  5J1R A;  3F23 A;  4AIJ A;  3K1M A;  5D5X B;  1BJA A;  3ABU A;  3EUK L;  2X1D A;  2X6O A;  4QTR A;  3BG9 A;  5J8C A;  2DOE A;  4OU0 A;  1JTY A;  3LSR A;  1QZY A;  1RR7 A;  2JA2 A;  3QU6 A;  4IHW A;  1ERD A;  2OTL I;  4BH9 A;  4PCQ A;  2DOF A;  3M4O J;  2E36 A;  2VT2 A;  2DMT A;  3BRO A;  2LH9 A;  2E7W A;  4PDK A;  3S93 A;  1Z9C A;  1WPK A;  2MBF A;  2A05 A;  1IN8 A;  1LVA A;  3VSK A;  2MD0 A;  3KYD B;  4MFD A;  2WAD A;  3VB2 A;  3WU1 B;  2EV6 A;  3OIO A;  4D7M A;  4XKC A;  4J19 A;  3IRQ A;  1E3P A;  1WI3 A;  1STZ A;  3A0B C;  1Z3X A;  3CJN A;  5F64 A;  3RYR A;  3F0C A;  2KRH A;  1JUP A;  3FXQ A;  3H92 A;  1TQP A;  2Y9Z A;  4KIF A;  5J6X A;  1SFU A;  2IJL A;  5FGM A;  1BR4 A;  2FBI A;  4J01 A;  1AHD P;  3T8R A;  2DLL A;  4GDF A;  1IN5 A;  3HJE A;  3CCR I;  1VQ8 I;  2E1N A;  4BJT A;  4HDV A;  5CJ9 A;  3CJQ B;  3CDH A;  2ME0 A;  3F8M A;  1J75 A;  1Z77 A;  1ZRF A;  1TW2 A;  3DXJ F;  4ETS A;  4RB1 A;  4V2F A;  2EH3 A;  2LTP A;  1XG1 A;  2JK3 A;  1V3F A;  3QPL A;  1MW7 A;  4BXU A;  2E35 A;  1LDD A;  1R00 A;  2F5C A;  2XKO A;  2O8X A;  2DOA A;  3IUO A;  4ZZD A;  2CMP A;  1I3A A;  4YFK F;  2MGQ A;  3BR2 A;  1YJN I;  2R7X A;  2HDC A;  2R7W A;  3EPZ A;  1WJB A;  5CVR A;  5IYC J;  2XF5 A;  3I53 A;  3RPU D;  1UHM A;  1Z7U A;  1DPR A;  5F6F A;  2CQQ A;  2F4I A;  3SFZ A;  2FBK A;  3CCV I;  3QRF F;  4OMY A;  4DZJ A;  2IS4 A;  2CV0 A;  1ETY A;  3U2R A;  3QPS A;  1A35 A;  4CA0 A;  1UAA A;  1QHG A;  5C3E J;  4MEY F;  4MHG A;  3HOV J;  2XAQ A;  1LEA A;  2VXD A;  1X1D A;  2GOX B;  2ZJR F;  4FCY A;  3J7A Y;  1VTN C;  5GPA A;  1FLI A;  4M3B A;  3GTQ J;  5FKL A;  3FK6 A;  2FX0 A;  2P5K A;  3JRI A;  1RR8 C;  2KRC A;  2BVM A;  2PX9 A;  2KJB A;  3HEF A;  1DPU A;  2X48 A;  4D5C A;  1TWC J;  5F08 A;  1FOY A;  2OQR A;  2DA3 A;  3PJR A;  1OCR H;  2FNP A;  1DGW Y;  2PMZ A;  4U7B A;  4DZP A;  1XD7 A;  3B6A A;  1BI3 A;  3JRD A;  2QBY B;  3WTZ A;  4BQQ A;  3JRG A;  3DTK A;  1PUF A;  1YIO A;  3U1D A;  2WAF A;  1J7K A;  2B0L A;  2Z99 A;  1WKM A;  2A5W A;  1KU7 A;  1VQ9 I;  4MNU A;  2L7K A;  1Y1V J;  1Z0X A;  4P96 A;  4BBR J;  1ZR2 A;  1MD0 A;  4BGD A;  2BZT A;  2CFX A;  5HLI A;  2B63 J;  2LVS A;  3CP2 A;  5IOZ A;  5EEG A;  5K7Z A;  1JTX A;  4HX8 A;  1T0F C;  2YU3 A;  3K1P A;  3ERM A;  4PJ0 C;  1QA6 A;  1LQ1 A;  1XS9 A;  3A0H C;  5ICF A;  2DXI A;  4QLC U;  4FHT A;  2H6B A;  2QUF A;  4RBO A;  3TED A;  1A6Q A;  4IO9 F;  1LFB A;  1ZRD A;  1UEL B;  2BXZ A;  2JSP A;  1RIO H;  1ETX A;  4CCO A;  1S8N A;  3I4N J;  3FMS A;  3LAJ A;  4S04 A;  3W6K B;  2X0L A;  2P6S A;  4R8H A;  2VC1 A;  3T1B A;  3FX3 A;  2VOD A;  3ZN0 A;  3BG7 A;  4WCG A;  1ZG3 A;  2LRE A;  1P7J A;  1GV2 A;  3GFL A;  5LHG A;  3PO3 J;  2K27 A;  3GF2 A;  2DK5 A;  3IKV A;  3SFI A;  3ERE D;  5GTH C;  2A6E F;  3H5A A;  1S6L A;  4Q4Z F;  3WGI A;  3OL4 A;  1CGP A;  4DYC A;  4H0E A;  1W0T A;  4N4O B;  3H3V K;  4HNT A;  2FQ4 A;  1BI2 A;  1B72 B;  2GWR A;  1X19 A;  3TO9 A;  3ZQG A;  2ECB A;  4E70 A;  2KZG A;  4M71 A;  5GAH J;  4U0V A;  3OOP A;  2IAI A;  3BWG A;  1X3U A;  5JVG F;  4XMY A;  3VYT B;  4XSZ F;  3MD2 A;  1R6R A;  4EM2 A;  3BTC A;  3GBG A;  3KYC B;  3J7A O;  4A3K J;  4AUX A;  1ZTR A;  2MSY A;  3CCL I;  1O7L A;  3EUH C;  2DT5 A;  2EFP A;  2Y75 A;  1IRX A;  4XN0 A;  1QQI A;  1RUO A;  2VUM J;  3GZ5 A;  1X1B A;  2FU4 A;  4NB5 A;  2V1U A;  1A31 A;  3BC8 A;  2NNY A;  2A07 F;  1MBE A;  1FOW A;  1U9N A;  1LEB A;  3W6V A;  4B3X A;  4AU7 A;  3JRC A;  3LOC A;  1MBK A;  4AIH A;  2A3S A;  2M9H A;  1H9G A;  1S7A A;  2NYX A;  3C1D A;  3FDY A;  4C30 A;  3E5U A;  3FIW A;  4EAT A;  3QP6 A;  4EM1 A;  2HVR A;  1IUY A;  2FML A;  3GCM A;  1U8B A;  2R93 J;  1BN5 A;  1IXS B;  2H8R A;  2L7Z A;  3GTK J;  2O61 A;  3V7C A;  3K10 A;  4IOC F;  1FYM A;  1MMA A;  1FIA A;  3CQZ J;  5B5E C;  4KIS A;  3OS0 A;  3V7R A;  1USS A;  2WC2 A;  2XIG A;  3G71 I;  2V9P A;  1KGS A;  1BR1 A;  5FKK A;  4D1Q A;  4IF4 A;  2W4S A;  4BUP A;  2BY0 A;  4M3E A;  4DJA A;  1YW7 A;  4ESJ A;  3D1N I;  1UFM A;  2QEX I;  3GLL A;  1AA7 A;  1R71 A;  2R7S A;  4K2E A;  3EUA A;  4IHS A;  3C2B A;  3VWB A;  3QWL A;  2VOO A;  5FLX K;  3K4L A;  2CUZ A;  3PSF A;  4LIU A;  3DP7 A;  4L0Y B;  1XSV A;  2E2H J;  1OFC X;  5HDG A;  3S2W A;  1SAU A;  3SZT A;  3TW6 A;  4EJW A;  5HS7 A;  1SVL A;  5HLH A;  2QSG X;  3DKX A;  2R5Y B;  1LE8 B;  1KZH A;  1OCT C;  1BA5 A;  4O5V A;  1GVJ A;  3EYY A;  3BT9 A;  1BBY A;  1VQM I;  4BE2 A;  1OR7 C;  3WG7 H;  2CW7 A;  1IN6 A;  3OSG A;  1OMI A;  4ITV A; 
#chains in the Genus database with same CATH homology
 3A1Y A;  3QOE A;  2KDO A;  2ZSI B;  4IQ4 A;  4AYB A;  4CCL A;  4PJL A;  4BL0 B;  4HRI A;  2R7V A;  1KON A;  2VKD A;  4ZJZ A;  2LY2 A;  3BG6 A;  3K4M A;  4PFP A;  4BEH B;  4XOT A;  3LMM A;  4G6T B;  3E0J B;  3K70 C;  4BJ5 C;  4E7S A;  4CZC A;  3DPT A;  3S3O A;  2X6W A;  4DOZ A;  3OYD A;  3ZRG A;  1WJ5 A;  4B44 A;  3DU6 A;  2GOM A;  3RCO A;  3N05 A;  5HVQ C;  2IGO A;  2M0M A;  3TMO A;  2K3P A;  2VIX A;  2KMU A;  1NG6 A;  2VQC A;  1X1C A;  2VQH A;  3SZG A;  3MKW B;  1Z3Y A;  5JHF A;  4YRV A;  4RM3 A;  3OYK A;  3CP8 A;  5CKT A;  1TT0 A;  4BQN A;  3OYA A;  2RNG A;  2ELJ A;  2R7R A;  2F6C A;  2R4G A;  4CUG A;  4ZC3 A;  2Z1D A;  2CH0 A;  2LBF A;  3PUB A;  3OYJ A;  2VLA A;  3H9J A;  2K5C A;  1G8X A;  1LDK B;  4FAS D;  4PFO A;  2V1N A;  4HPQ A;  4HG2 A;  4XR6 A;  4E7H A;  2VPL A;  2LRD A;  3CMM A;  3HKZ A;  3ZGK A;  2VQL A;  3LSH A;  4XOP A;  4E7J A;  3E1S A;  3BCA A;  3HL2 A;  4Y3O A;  4BU2 A;  3L2U A;  3RTR A;  4PUS A;  2WY7 Q;  4KT6 A;  2KLO A;  2MC4 A;  3UNG C;  3H5N A;  1QHH D;  4N4N B;  1EA3 A;  2E5Z A;  2WB1 A;  4NQW B;  3LSM A;  3NWT A;  3RSN A;  2X1E A;  3S32 A;  2XF6 A;  2PJR A;  2UUZ A;  4GRI A;  4R79 A;  2AQE A;  3L2V A;  3UR3 C;  4HNU A;  3LL7 A;  1T95 A;  2HNH A;  2CUJ A;  2L9N A;  3OYM A;  3FBN B;  2V6E A;  2LG4 A;  3PNY A;  5CQE A;  4DIQ A;  4U87 A;  1WJA A;  3W2W A;  3DWL E;  4XL9 A;  2HZD A;  2L9S A;  5HNH A;  1FMW A;  1D0X A;  1S9H A;  2WA0 A;  4YEL A;  2HPI A;  2CFO A;  2XDV A;  2M3A A;  4XKV A;  2IGN A;  1WFX A;  1TZL A;  1YE9 A;  3HPG A;  2ZFU A;  3OYI A;  1FMV A;  4BXF A;  2HU9 A;  4H4K C;  3F9K A;  4RLF A;  2K9M A;  4OAY A;  1MMD A;  5HNF A;  3OWT A;  3BCB A;  3QYE A;  4LIT A;  2V7F A;  4PJJ A;  4PK4 A;  3FKJ A;  4HST A;  4CSW A;  3H0D A;  3DPL C;  3HXL A;  2DT6 A;  2QKL B;  4RMN A;  1PYV A;  3A2K A;  2W1O A;  3K4B A;  4E7I A;  3K6G A;  3LSK A;  1MMG A;  2OC6 A;  3AFH A;  2VJI A;  3OYE A;  3VYR B;  3PNV A;  3OMY A;  5KNL A;  3CZ6 A;  4QPO A;  3HOT A;  3DPU A;  5FRO A;  2KZV A;  2LOO A;  2OUM A;  4HEA 2;  1WJD A;  4XON A;  4CCN A;  4F55 A;  2IS1 A;  3OR1 C;  3PSI A;  1N78 A;  2HVS A;  3PNT A;  3LSI A;  4XNF A;  2E1M C;  3VYU B;  1NG7 A;  4CCM A;  2VJ5 A;  3ZCO A;  1LKX A;  4RLQ A;  1X4O A;  2HDW A;  4BAC A;  4XM3 A;  2E1M B;  1LVK A;  5TGT A;  3MMY B;  2V9K A;  3C2H A;  1X4P A;  4LG3 A;  2ZXH A;  4B47 A;  4B43 A;  3OIP A;  3DQV C;  4ZTF A;  4C2U A;  3D5R C;  4XLH A;  2ZXI A;  4X0G A;  2Z16 A;  2F5V A;  3A4C A;  4Y4R A;  4C2T A;  3FHN A;  3DLA A;  2JVG A;  2WY8 Q;  3TBI A;  1MND A;  2M7A A;  3EUK L;  2X1D A;  3SEZ A;  3ZQQ A;  2CW8 A;  1D0Z A;  2A6T A;  2M4G A;  2VKH A;  3HUG B;  3H9G A;  3FBI B;  2JA2 A;  3MKY B;  1ERD A;  1P9Q C;  4F91 B;  2PJR B;  1V5F A;  1ZEL A;  2LH9 A;  3S93 A;  3VSK A;  2MD0 A;  2HPM A;  5HLT A;  2WAD A;  2KHM A;  3L2R A;  3HC7 A;  4XKC A;  2AQF A;  2VJJ A;  3RQ4 A;  1Z3X A;  3KX2 A;  2X51 A;  3OY9 A;  4IQJ A;  2KRH A;  4BEH A;  1BR4 A;  3K4J A;  4DGW B;  2X1C A;  4J01 A;  2L5Q A;  4BE1 A;  3OR2 C;  5FRM A;  3DEE A;  4BJT A;  3OS1 A;  2Y0S A;  3CJQ B;  2DJI A;  4DBQ A;  2JVH A;  4Y33 A;  4IX7 A;  2UWM A;  4MLO A;  4RM2 A;  2R7U A;  1UG0 A;  2CS3 A;  3K4K A;  1MW7 A;  4E4H A;  3U21 A;  1W36 D;  3SEQ A;  3KYL A;  4BDY A;  3OYG A;  1VZ0 A;  2DOA A;  3IUO A;  4ZTJ A;  2W7N A;  2CMP A;  2VL8 A;  2R7X A;  4ZYA A;  1WJE A;  2R7W A;  3EPZ A;  1WJB A;  2XC7 A;  2XF5 A;  5KHD A;  2X85 A;  1BR2 A;  3QYF A;  4JQF A;  3RPU D;  4XKW A;  1X1A A;  3AL0 C;  2UV1 A;  1D1A A;  3DKY A;  2F4I A;  2MAB A;  2VJ4 A;  4LIV A;  1Z7L A;  3AL0 B;  3NWS A;  2IS4 A;  2CV0 A;  4XLF A;  3QYB A;  3M1C A;  3ONQ A;  4CA0 A;  1UAA A;  1QHG A;  5LD2 C;  3VYS B;  2VXD A;  1X1D A;  2GOX B;  4ZDO A;  3OYB A;  3J7A Y;  2E60 A;  4PSX A;  3OIQ A;  2KRC A;  2R7Q A;  4B48 A;  4XKB A;  4F93 B;  2BVM A;  2K9L A;  5CPR B;  3CES A;  3PJR A;  2WAQ A;  4D9J A;  1DGW Y;  2PMZ A;  4U7B A;  5KCM A;  4BQQ A;  4F52 A;  3DTK A;  4BS9 A;  4PJN A;  3VSL A;  4P1W A;  3OS2 A;  2WAF A;  2VQG A;  3D5L A;  1V5E A;  2A5W A;  3D5S C;  3C2G A;  1V5G A;  2L7K A;  4XQF A;  2LBF B;  4XLE A;  4BGD A;  2CV1 A;  2W00 A;  3IP4 B;  3CP2 A;  3W3C A;  3IAM 2;  1T0F C;  2R7O A;  2V26 A;  4PSW A;  4F92 B;  2JUG A;  2E5N A;  3V42 A;  2DXI A;  2KL4 A;  3ZR8 X;  1U0J A;  1Y56 A;  1WJF A;  3DTE A;  1W36 C;  2BW3 A;  2V4J C;  3I3L A;  3OYN A;  4II3 A;  1N75 A;  4NC7 A;  4JOM A;  1UEL B;  2JSP A;  4BDZ A;  2KPM A;  3W2A A;  2HQA A;  4CCO A;  4CH7 A;  2BOL A;  1SFK A;  4E7Z A;  3BLY A;  2KP6 A;  1GLN A;  2LY1 A;  2P0W A;  2Q1Z B;  4YEJ A;  2IS6 A;  2XF7 A;  3K4C A;  3S3N A;  2VB6 A;  4BJ6 C;  4BE0 A;  3BG7 A;  3VDX A;  3OYL A;  2WAE A;  1MNE A;  2LRE A;  2IS2 A;  1LFP A;  3LFU A;  2DCE A;  4QPQ A;  3L2W A;  2KQR A;  4OWR B;  4NUB A;  4XOR A;  4J00 A;  3H5A A;  2XSJ C;  3ZXS A;  3I9V 2;  3OL4 A;  4XLA A;  2MYS A;  2IGK A;  4N4O B;  3CF2 A;  2M4K A;  4HNT A;  2CV2 A;  1J09 A;  1X19 A;  2FUG 2;  3H5R A;  2ZSH B;  4E6K G;  2LYC A;  2HVQ A;  3W2V A;  3LSG A;  4XMY A;  3VYT B;  1HA8 A;  4HSR A;  4XLC A;  3MD2 A;  4AVZ A;  2MFZ A;  1R6R A;  2RRE A;  2OV7 A;  4E7L A;  3OOU A;  2IGM A;  1WJC A;  3GBG A;  1MMN A;  2QKM B;  1PJR A;  3HG9 A;  2RQQ A;  4BQO A;  3H35 A;  2VAS A;  1Y6I A;  3EUH C;  4XN3 A;  3QOD A;  3PFY A;  1IRX A;  4XN0 A;  3OYC A;  3DTI A;  2NOJ B;  1X1B A;  1D1C A;  4P5O A;  3BC8 A;  1DP3 A;  2R7T A;  3M8J A;  3K4N A;  3SYT A;  4B3X A;  4AU7 A;  3AKZ A;  3K70 D;  3FDY A;  4C9Y A;  5CQG A;  4C30 A;  4EAT A;  4KIT B;  2HVR A;  4KJZ A;  2I8D A;  4II2 A;  4CCJ A;  2M7B A;  3L2Q A;  1Z21 A;  2DT7 B;  2O5R A;  3K10 A;  3OYH A;  1MMA A;  3MKZ A;  4DBR A;  4KIS A;  3OS0 A;  4NNJ A;  2W82 A;  2X6Y A;  4ZDL A;  1BR1 A;  2BVL A;  3H9Q A;  4NC8 A;  4D1Q A;  4ANJ A;  3SDB A;  2W4S A;  4BUP A;  1N77 A;  1DGR M;  1BOB A;  4DJA A;  1K6Y A;  3CJR B;  3IAS 2;  3DU5 A;  3PL8 A;  4ZDP A;  4CCK A;  4IZZ A;  5FRN A;  1AA7 A;  1YX3 A;  2R7S A;  3HOS A;  3EUA A;  3VWB A;  1D1B A;  2BW3 B;  3S8P A;  1DQU A;  1JI8 A;  4E7K A;  2X6X A;  3OL3 A;  3OYF A;  3K4L A;  2CUZ A;  3PSF A;  4LIU A;  5LFA A;  2LC2 A;  1QU3 A;  3TL4 X;  4PJM A;  1OLT A;  1SAU A;  4IKF A;  3DKX A;  1G59 A;  5HOO A;  4OAZ A;  3S3M A;  2Z2S B;  3G2B A;  2IXS A;  1YX5 A;  4FET A;  4F3Q A;  1D0Y A;  2VXZ A;  4BE2 A;  1OR7 C;  2XAU A;  1E0E A;  3KEY A;  3HPH A;  2CW7 A;  2L2O A;  2WBM A;  4ITV A;  2Q2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...