1SAVA

Human annexin v with proline substitution by thioproline
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
316
structure length
311
Chain Sequence
QVLRGTVTDFGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKSRLYDAYELKHALKGAGTNEKVLTEIIASRTEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN V
publication title Crystal and molecular structure of human annexin V after refinement. Implications for structure, membrane binding and ion channel formation of the annexin family of proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium/phospholipid binding
total genus 119
structure length 311
sequence length 316
ec nomenclature
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1savA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1savA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1savA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1savA03
2XO2A 1I4AA 1G5NA 1AVHA 1HVEA 2IE7A 1BCZA 1AVRA 1ANNA 1W3WA 1BO9A 1AEIA 1HAKA 2ZHJA 1SAVA 1W45A 1XJLA 1N00A 1BC3A 2H0LA 2II2A 1BC0A 1HVFA 2Q4CA 1BCYA 1MCXA 1N44A 3BRXA 1N42A 1A8BA 1DK5A 1ANWA 2IICA 4X9PA 1BCWA 1DM5A 2H0KA 4EVFA 1AXNA 2HYVA 1M9IA 1BC1A 1W7BA 2HYWA 1AVCA 1YJ0A 1AOWA 1ALAA 2XO3A 4HREA 1N41A 4MDUA 1AIIA 1YIIA 1A8AA 2HYUA 2RANA 4EVHA 2ZHIA 1YCNA 1ANXA 1HM6A 2ZOCA 4MDVA 2IE6A 2H0MA 1HVDA 1HVGA
chains in the Genus database with same CATH superfamily
2XO2A 3ANYA 1HVEA 2IE7A 4JXHA 1AVRA 1ANNA 3L8NA 2H0LA 2OY9A 2II2A 1BC0A 1XT0B 2Q4CA 3BRXA 1A8BA 4Z21A 4KMUX 1XSZA 3USWA 4X9PA 4JMIA 1S9DE 4OIYA 3HJLA 4C0AA 1M9IA 1W7BA 2HYWA 1YJ0A 1AOWA 1ALAA 3ABSA 4HREA 4MDUA 4EVHA 2HYUA 2RANA 3SOHB 2R09A 2H0MA 3LTLA 4FHRB 4A4PA 3ABQA 1AVHA 3TW5A 4JWLA 3ABOA 1HAKA 4JK1X 1SAVA 1N00A 2HSNA 1R4AE 1N44A 1N42A 1ANWA 3AJCA 1RE0B 2XO3A 1N41A 1AIIA 1YIIA 1A8AA 2ZHIA 1ANXA 1HM6A 1UPTB 2ZOCA 2IE6A 4JMOA 1HVGA 1I4AA 1BCZA 1W3WA 1AEIA 2ZHJA 4D7RA 1C1KA 1R8SE 1BCYA 4L5MA 1DK5A 2IICA 1R8ME 1BCWA 1DM5A 2H0KA 4EVFA 4KN4X 1R8QE 4C7PA 1LKVX 4MDVA 1G5NA 1Q8DA 3AO0A 2R0DA 4Q2SA 1BO9A 2QEZA 1W45A 1XJLA 1BC3A 1HVFA 4D7QA 1YGMA 1BC9A 4FQ0C 1MCXA 4KN7X 2K6XA 2VXGA 1AXNA 1PBVA 1QC7A 1BC1A 2HYVA 1AVCA 3USYA 3ABRA 3SWVA 1KU1A 1YCNA 1HVDA
chains in the Genus database with same CATH topology
2XO2A 1I4AA 1G5NA 1AVHA 1HVEA 2IE7A 1BCZA 1AVRA 1ANNA 1W3WA 1BO9A 1AEIA 1HAKA 2ZHJA 1SAVA 1W45A 1XJLA 1N00A 1BC3A 2H0LA 2II2A 1BC0A 1HVFA 2Q4CA 1BCYA 1MCXA 1N44A 3BRXA 1N42A 1A8BA 1DK5A 1ANWA 2IICA 4X9PA 1BCWA 1DM5A 2H0KA 4EVFA 1AXNA 2HYVA 1M9IA 1BC1A 1W7BA 2HYWA 1AVCA 1YJ0A 1AOWA 1ALAA 2XO3A 4HREA 1N41A 4MDUA 1AIIA 1YIIA 1A8AA 2HYUA 2RANA 4EVHA 2ZHIA 1YCNA 1ANXA 1HM6A 2ZOCA 4MDVA 2IE6A 2H0MA 1HVDA 1HVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XO2 A;  1I4A A;  1G5N A;  1AVH A;  1HVE A;  2IE7 A;  1BCZ A;  1AVR A;  1ANN A;  1W3W A;  1BO9 A;  1AEI A;  1HAK A;  2ZHJ A;  1SAV A;  1W45 A;  1XJL A;  1N00 A;  1BC3 A;  2H0L A;  2II2 A;  1BC0 A;  1HVF A;  2Q4C A;  1BCY A;  1MCX A;  1N44 A;  3BRX A;  1N42 A;  1A8B A;  1DK5 A;  1ANW A;  2IIC A;  4X9P A;  1BCW A;  1DM5 A;  2H0K A;  4EVF A;  1AXN A;  2HYV A;  1M9I A;  1BC1 A;  1W7B A;  2HYW A;  1AVC A;  1YJ0 A;  1AOW A;  1ALA A;  2XO3 A;  4HRE A;  1N41 A;  4MDU A;  1AII A;  1YII A;  1A8A A;  2HYU A;  2RAN A;  4EVH A;  2ZHI A;  1YCN A;  1ANX A;  1HM6 A;  2ZOC A;  4MDV A;  2IE6 A;  2H0M A;  1HVD A;  1HVG A; 
#chains in the Genus database with same CATH topology
 2XO2 A;  3ANY A;  1HVE A;  2IE7 A;  4JXH A;  1AVR A;  1ANN A;  3L8N A;  2H0L A;  2OY9 A;  2II2 A;  1BC0 A;  1XT0 B;  2Q4C A;  3BRX A;  1A8B A;  4Z21 A;  4KMU X;  1XSZ A;  3USW A;  4X9P A;  4JMI A;  1S9D E;  4OIY A;  3HJL A;  4C0A A;  1M9I A;  1W7B A;  2HYW A;  1YJ0 A;  1AOW A;  1ALA A;  3ABS A;  4HRE A;  4MDU A;  4EVH A;  2HYU A;  2RAN A;  3SOH B;  2R09 A;  2H0M A;  3LTL A;  4FHR B;  4A4P A;  3ABQ A;  1AVH A;  3TW5 A;  4JWL A;  3ABO A;  1HAK A;  4JK1 X;  1SAV A;  1N00 A;  2HSN A;  1R4A E;  1N44 A;  1N42 A;  1ANW A;  3AJC A;  1RE0 B;  2XO3 A;  1N41 A;  1AII A;  1YII A;  1A8A A;  2ZHI A;  1ANX A;  1HM6 A;  1UPT B;  2ZOC A;  2IE6 A;  4JMO A;  1HVG A;  1I4A A;  1BCZ A;  1W3W A;  1AEI A;  2ZHJ A;  4D7R A;  1C1K A;  1R8S E;  1BCY A;  4L5M A;  1DK5 A;  2IIC A;  1R8M E;  1BCW A;  1DM5 A;  2H0K A;  4EVF A;  4KN4 X;  1R8Q E;  4C7P A;  1LKV X;  4MDV A;  1G5N A;  1Q8D A;  3AO0 A;  2R0D A;  4Q2S A;  1BO9 A;  2QEZ A;  1W45 A;  1XJL A;  1BC3 A;  1HVF A;  4D7Q A;  1YGM A;  1BC9 A;  4FQ0 C;  1MCX A;  4KN7 X;  2K6X A;  2VXG A;  1AXN A;  1PBV A;  1QC7 A;  1BC1 A;  2HYV A;  1AVC A;  3USY A;  3ABR A;  3SWV A;  1KU1 A;  1YCN A;  1HVD A; 
#chains in the Genus database with same CATH homology
 2XO2 A;  1I4A A;  1G5N A;  1AVH A;  1HVE A;  2IE7 A;  1BCZ A;  1AVR A;  1ANN A;  1W3W A;  1BO9 A;  1AEI A;  1HAK A;  2ZHJ A;  1SAV A;  1W45 A;  1XJL A;  1N00 A;  1BC3 A;  2H0L A;  2II2 A;  1BC0 A;  1HVF A;  2Q4C A;  1BCY A;  1MCX A;  1N44 A;  3BRX A;  1N42 A;  1A8B A;  1DK5 A;  1ANW A;  2IIC A;  4X9P A;  1BCW A;  1DM5 A;  2H0K A;  4EVF A;  1AXN A;  2HYV A;  1M9I A;  1BC1 A;  1W7B A;  2HYW A;  1AVC A;  1YJ0 A;  1AOW A;  1ALA A;  2XO3 A;  4HRE A;  1N41 A;  4MDU A;  1AII A;  1YII A;  1A8A A;  2HYU A;  2RAN A;  4EVH A;  2ZHI A;  1YCN A;  1ANX A;  1HM6 A;  2ZOC A;  4MDV A;  2IE6 A;  2H0M A;  1HVD A;  1HVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...