1SB0A

Solution structure of the kix domain of cbp bound to the transactivation domain of c-myb
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
87
structure length
87
Chain Sequence
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the KIX Domain of CBP Bound to the Transactivation Domain of c-Myb
pubmed doi rcsb
molecule keywords protein CBP
molecule tags Transcription
source organism Mus musculus
total genus 39
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02172 KIX KIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.20 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Coactivator CBP, KIX domain 1sb0A00
2KWFA 4I9OA 1SB0A 2K0NA 2LQIA 2LQHA 2LXSA 2LXTA 1KDXA 4D7XA 2AGHB 2GUTA
chains in the Genus database with same CATH superfamily
2DBWA 3M99C 1N5UA 3G9KD 2BXGA 3H37A 3FWBC 4IW2A 2BXAA 4LUHA 4I9OA 1TF0A 4GG2A 1BM0A 1AO6A 1LOTA 3ECPA 2BXQA 4S1YA 2JUHA 5ID9A 4F5SA 3V09A 1E7IA 1LNSA 2BXEA 4L8UA 2XVQA 1JNBA 2BXKA 4ZCGA 5GIPA 2BXLA 3LU7A 4J2VA 4DM0A 3V08A 1J7EA 4G01A 5HOZA 5IJEA 4LB2A 4NAWB 3TDLA 4OT2A 3B9MA 3WHQA 2EFHA 1TXUA 2VUEA 3NVMA 1MIWA 3KJLA 4EMXA 1SB0A 5IJ5A 1E7BA 4LA0A 5ID7A 2OT3A 2QM6A 4L9KA 1MM8A 2XVUA 4M70B 2DYMA 4ZBKA 2I30A 1VFIA 2XVVA 1GNJA 1KXPD 2YDFA 1GNIA 2DG5A 4BY9C 1HK5A 4W4UB 2EFCA 4F5TA 2BXBA 4IW1A 5D7GA 3LU8A 4HGKA 4WA6B 1HA2A 1HK2A 2EFDA 3BPJA 5IIUA 5GIOA 3WHRA 1KDXA 3GA9L 4OTUA 4F5UA 4FIPB 2OZBB 4MBEC 5IFOA 1HK3A 2BXPA 2BXDA 2LXSA 4TQ1A 4ZBQA 3SQJA 4ZBRA 3PLAA 2BXOA 1E7AA 4Z9OA 2XW0A 1HK1A 2XMOA 1MIYA 4ZC6A 5GHKA 1H5WA 2BXHA 5B5TA 4ZUXV 3NVIA 2AJEA 1O9XA 2VDBA 4LB9A 2NQOA 2Z8JA 4FJCB 4FK5B 5IIHA 5GINA 3KIKA 4C31B 4G04A 2LOQA 2QHBA 4GDKB 2NNWA 2LXTA 3MHHB 4HGMB 4JK4A 2VUFA 4DHXB 4PO0A 2I2ZA 2CKXA 2ROHA 1NT2B 1UORA 1MIVA 2XVWA 1HK4A 3MHSB 3SIVB 2AGHB 2KBZA 4GDLB 2BXIA 4N0FD 3NMUA 4E99A 1E78A 2KWFA 2Z8KA 3UIVA 1MA9A 1E7GA 3GQXA 1MUSA 4N0UD 3NVKA 2DBUA 1BKEA 5BPKA 5DBYA 1J78A 3FWCC 2LQIA 2DYOA 4N3ZA 2XW1A 2E0XA 1MUHA 1KW2A 1IJGA 4Z69A 2Z8IA 1E7FA 1H9ZA 2DBXA 5IJFA 3ICXA 2E0YA 4G03A 4OTTA 2V36A 3GQUA 3JQZA 2BX8A 4TQ0A 3B9LA 3A75A 2GUTA 3CX9A 3JRYA 4LUFA 3VQIA 4L9QA 2K0NA 1VZSA 4K2CA 2EFEA 2BXFA 5DQFA 4F5VA 1E7HA 1BJ5A 2BXNA 4K71A 3SIUB 2XSIA 1FOUA 2BXCA 3H3AA 4BKEA 1E7CA 2LQHA 4OR0A 5IIXA 4GDXA 3LU6A 2BXMA 3W1SA 5FUOA 3FNMA 3A73A 3WHSA 3V03A 4D7XA 1E7EA 2QMCA
chains in the Genus database with same CATH topology
2KWFA 4I9OA 1SB0A 2K0NA 2LQIA 2LQHA 2LXSA 2LXTA 1KDXA 4D7XA 2AGHB 2GUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWF A;  4I9O A;  1SB0 A;  2K0N A;  2LQI A;  2LQH A;  2LXS A;  2LXT A;  1KDX A;  4D7X A;  2AGH B;  2GUT A; 
#chains in the Genus database with same CATH topology
 2DBW A;  3M99 C;  1N5U A;  3G9K D;  2BXG A;  3H37 A;  3FWB C;  4IW2 A;  2BXA A;  4LUH A;  4I9O A;  1TF0 A;  4GG2 A;  1BM0 A;  1AO6 A;  1LOT A;  3ECP A;  2BXQ A;  4S1Y A;  2JUH A;  5ID9 A;  4F5S A;  3V09 A;  1E7I A;  1LNS A;  2BXE A;  4L8U A;  2XVQ A;  1JNB A;  2BXK A;  4ZCG A;  5GIP A;  2BXL A;  3LU7 A;  4J2V A;  4DM0 A;  3V08 A;  1J7E A;  4G01 A;  5HOZ A;  5IJE A;  4LB2 A;  4NAW B;  3TDL A;  4OT2 A;  3B9M A;  3WHQ A;  2EFH A;  1TXU A;  2VUE A;  3NVM A;  1MIW A;  3KJL A;  4EMX A;  1SB0 A;  5IJ5 A;  1E7B A;  4LA0 A;  5ID7 A;  2OT3 A;  2QM6 A;  4L9K A;  1MM8 A;  2XVU A;  4M70 B;  2DYM A;  4ZBK A;  2I30 A;  1VFI A;  2XVV A;  1GNJ A;  1KXP D;  2YDF A;  1GNI A;  2DG5 A;  4BY9 C;  1HK5 A;  4W4U B;  2EFC A;  4F5T A;  2BXB A;  4IW1 A;  5D7G A;  3LU8 A;  4HGK A;  4WA6 B;  1HA2 A;  1HK2 A;  2EFD A;  3BPJ A;  5IIU A;  5GIO A;  3WHR A;  1KDX A;  3GA9 L;  4OTU A;  4F5U A;  4FIP B;  2OZB B;  4MBE C;  5IFO A;  1HK3 A;  2BXP A;  2BXD A;  2LXS A;  4TQ1 A;  4ZBQ A;  3SQJ A;  4ZBR A;  3PLA A;  2BXO A;  1E7A A;  4Z9O A;  2XW0 A;  1HK1 A;  2XMO A;  1MIY A;  4ZC6 A;  5GHK A;  1H5W A;  2BXH A;  5B5T A;  4ZUX V;  3NVI A;  2AJE A;  1O9X A;  2VDB A;  4LB9 A;  2NQO A;  2Z8J A;  4FJC B;  4FK5 B;  5IIH A;  5GIN A;  3KIK A;  4C31 B;  4G04 A;  2LOQ A;  2QHB A;  4GDK B;  2NNW A;  2LXT A;  3MHH B;  4HGM B;  4JK4 A;  2VUF A;  4DHX B;  4PO0 A;  2I2Z A;  2CKX A;  2ROH A;  1NT2 B;  1UOR A;  1MIV A;  2XVW A;  1HK4 A;  3MHS B;  3SIV B;  2AGH B;  2KBZ A;  4GDL B;  2BXI A;  4N0F D;  3NMU A;  4E99 A;  1E78 A;  2KWF A;  2Z8K A;  3UIV A;  1MA9 A;  1E7G A;  3GQX A;  1MUS A;  4N0U D;  3NVK A;  2DBU A;  1BKE A;  5BPK A;  5DBY A;  1J78 A;  3FWC C;  2LQI A;  2DYO A;  4N3Z A;  2XW1 A;  2E0X A;  1MUH A;  1KW2 A;  1IJG A;  4Z69 A;  2Z8I A;  1E7F A;  1H9Z A;  2DBX A;  5IJF A;  3ICX A;  2E0Y A;  4G03 A;  4OTT A;  2V36 A;  3GQU A;  3JQZ A;  2BX8 A;  4TQ0 A;  3B9L A;  3A75 A;  2GUT A;  3CX9 A;  3JRY A;  4LUF A;  3VQI A;  4L9Q A;  2K0N A;  1VZS A;  4K2C A;  2EFE A;  2BXF A;  5DQF A;  4F5V A;  1E7H A;  1BJ5 A;  2BXN A;  4K71 A;  3SIU B;  2XSI A;  1FOU A;  2BXC A;  3H3A A;  4BKE A;  1E7C A;  2LQH A;  4OR0 A;  5IIX A;  4GDX A;  3LU6 A;  2BXM A;  3W1S A;  5FUO A;  3FNM A;  3A73 A;  3WHS A;  3V03 A;  4D7X A;  1E7E A;  2QMC A; 
#chains in the Genus database with same CATH homology
 2KWF A;  4I9O A;  1SB0 A;  2K0N A;  2LQI A;  2LQH A;  2LXS A;  2LXT A;  1KDX A;  4D7X A;  2AGH B;  2GUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...