1SBDA

Soybean agglutinin complexed with 2,4-pentasaccharide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
234
structure length
232
Chain Sequence
AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENEDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic studies of unique cross-linked lattices between four isomeric biantennary oligosaccharides and soybean agglutinin.
pubmed doi rcsb
molecule tags Lectin
molecule keywords SOYBEAN AGGLUTININ
total genus 45
structure length 232
sequence length 234
ec nomenclature
pdb deposition date 1995-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sbdA00
3WHTA 1HKDA 1APNA 2PHTA 3HMYA 2P3JA 5DG2A 1WLDA 4YW3A 2V73A 3APBA 1KQRA 1N47A 2R16A 3AP5A 1GANA 4L8QA 3FFZA 1QGLA 2AUYA 5CB7A 3N7MA 4Q26A 3MW4A 1LOFC 4UW5A 1CQ9A 2YY1A 4U36A 1JW6A 4XTPA 4BMEA 3O0VA 3SH4A 2A71A 4Y1UA 3MPPG 1VIWB 2DUPA 4XHBA 4XBNA 3ILFA 2NMNA 3O12A 2D6KA 1TEIA 2ZACA 3MW2A 3HN1A 2EXJA 4BPZA 1UKGA 4FPOB 5HCBA 2GN3A 5L73A 2BQPA 3N35A 1O4YA 4WV8A 3T2TA 1G9BA 5KXBA 5H9PA 4YZ3A 3WDUA 1LU2A 3C2UA 3AXDA 3N3HA 1SLAA 2VH9A 4GXLA 3PVEA 2Z42A 3PJQA 1WBLA 3ZXEA 2E7QA 2P34A 1YO8A 2E51A 2P3KA 2YV8A 4LBQA 4XXAA 3BIWE 1QF3A 5JLVA 3T1MA 4ATFA 4TZDA 1JBCA 2D6NA 3D5OA 1LULA 1G7YA 5BYNA 2ZGPA 4XDQA 1S0FA 4Q1RA 1LHWA 4AGVA 4M3CB 4YZ2A 1QNYA 2ARXA 2ZGKA 3NV3A 2GNBA 4FOQA 1FYUA 1AXYA 3WCSA 4YG0A 1S0EA 3A0KA 5EYYA 1DQ1A 4FPJA 4NOTA 1G9AA 1SBFA 1OFSA 2ZGQA 3AJZA 4JRAA 1LCLA 3PVOA 5T55A 1V6LA 2DUOA 1UN1A 3KQRA 3OJBA 4R9CA 2EXIA 1FNYA 1H9WA 4XBLA 2E6VA 1SLCA 1GNZA 3R4UA 3ZSLA 2WKKA 4AGGA 3AX4A 5DZEA 5GLUA 3RSJA 1J1TA 5FREA 1BKZA 3D4KA 1C4RA 1Z78A 4AGRA 2DU1A 4FQ4A 1V00A 2ZGUA 1AXKA 1DYKA 2D44A 4M00A 5T50A 5GALA 4YGDA 5F9TA 1OKQA 2ZZJA 3AYAA 3FBYA 1LOGA 5DZGA 1UMZA 1MS5A 4R9BA 4RA0A 3V65A 2FMDA 3PMEA 2RHPA 2DTWA 4DQAA 3WUCA 5JOWA 1UX6A 4Y1VA 2ZGMA 5JMCA 4YM1A 3AK0A 4BMBA 5GLZA 2XB6C 1JN2P 4CZSA 3VKNA 1SLBA 1QMJA 3LCPA 3W59A 3WDTA 1W6NB 5DZFA 4XILA 1S0JA 1N3PA 1LOCA 1LEDA 2ZGSA 4PQ9A 1MZ6A 4JC1A 3BODA 1A3KA 1LU1A 5IK7A 2ZGNA 3ATGA 1H30A 4MYEA 4XZPA 4XYXA 3ZXKA 3FUQA 1LOEA 2DTYA 1LGNA 3ZXLA 4I30A 3OYWB 2A75A 1IS4A 4Y1XA 2JD4A 5JOZA 1GZWB 2UU8A 1IS6A 4P14A 4DFSA 3A4UA 1DQ4A 2PHXA 2A3XA 1V6MA 3M3QA 4GA9A 1AX1A 1DHKB 2R1DA 3AFKA 2ZGRA 4P9YA 1CVNA 1Q8SA 1RINA 2DWRA 1IKPA 3ASIA 4GALA 3VV1A 1VAVA 1ONAA 4K1ZA 2VW0A 4TYSA 2AREA 5GM0A 3INAA 5T5OA 2WSUA 4FP2A 2VU9A 3AYEA 2E7TA 1LHVA 1LHOA 4YW1A 1URXA 5KXEA 3ZYRA 3B00A 4Y22A 2WT2A 3FLTA 1RIRA 2AH2A 1DGLA 4WVWA 2LTNA 1JHNA 2UURA 2VY0A 3SISA 2WNEA 3ILNA 5GZFA 1GZWA 3NWKA 3WG4A 1LTEA 1W6OB 4YZ5A 2D6LX 2JDZA 1MVEA 4FOWA 1W0PA 1GV9A 2A6WA 3AP4A 1N1TA 1WLCA 1H9PA 3Q9OA 2PHFA 4ITCA 2DYCA 2G4IA 2H0BA 4GKXA 2A5ZA 1Q8QA 3OYWA 3UJQA 3WG3A 2E53A 3DGTA 4U2AA 4C1WA 1F9KA 1DBNA 1AX0A 3AZVA 3GALA 3O0WA 4Y24A 4GKYA 1DQ5A 1GSLA 3WOGA 3ENRA 2ZMLA 1QOTA 5SV8A 1G9FA 3UL2A 4FP3A 2ZABA 1W6OA 1W6NA 1WCSA 2D6OX 2D6MA 2NZ9A 2DURA 2D3RA 5CBLA 1WD4A 3M2MA 5GZCA 1JOJA 2D3SA 2ZHLA 5GZEA 3QCWA 1YXWA 1C1LA 1MACA 4HANA 4Y22B 3B69A 2OW4A 2ZMNA 4W65A 4M3CF 3AZYA 2R49A 1HQWA 3TB0A 2ENRA 1LESA 2DVDA 2EAKA 4WZFA 1W6PB 1AX2A 1KJLA 2Q5TA 4AWDA 1N3QA 4FPCA 1PZ8A 5H9QA 4Q27A 2XG3A 4F83A 2PHRA 2EALA 4ASMB 1YIFA 4ZXKA 1LENA 2DVAA 3SITA 1Y7BA 1R1ZA 1G9CA 2NN8A 4FPGA 4FPEA 2CYFA 4XTMA 5E8AA 4UW6A 3AYDA 4P9WA 1KJRA 3WNXA 4BLJA 1LHUA 1JUIA 1AJOA 1X50A 1BJQA 4XMIA 1DIWA 1GKBA 3RS6A 4BM8A 1F31A 2YROA 3AP9A 2JE9A 1WW4A 1VAMA 4XMAA 4FQZA 1SCSA 2ZA9A 1IKQA 4FVVA 5GLTA 2D6PA 1LOBA 2GMMA 4BOWA 2GN7A 1QKQA 2GNMA 3WDYA 1D0HA 1IS5A 5IK5A 3WCRA 1ENSA 1Z0HA 4AYUA 3NV1A 1OQ1A 2PELA 1JXNA 2A6ZA 1MS9A 1AJKA 1PZ7A 1QU0A 2A3YA 4HL0A 5E88A 3RRDA 2LALA 3WG1A 3WVJA 3ZPYA 4Y20B 3L2YA 1AF9A 1KITA 4YZ4A 3WDXA 3ZXJA 3WLUA 1LGCA 4XE9A 1W6MA 1I3HA 5H9SA 1DYPA 3AP7A 3OGGA 1CESA 2AR6A 3USUB 4AVSA 1HQLA 2DUQA 1V6IA 3H0OA 3IKWA 5DUWA 2NYYA 5T54A 3SH3A 2GMEA 3O5SA 4LBLA 5JOXA 1Q8VA 3LSDA 1UPSA 4ZKTB 2EXKA 2PHUA 3U4XA 1Q56A 3IM0A 3B01A 4YGCA 3TAYA 4XBQA 2VXRA 3VKLA 1AVBA 3BOPA 4C1XA 1DQ0A 5FRAA 3V0AB 2AGSA 2ZKNA 4FPFA 1FV2A 1QNWA 2C9AA 2ZMKA 4M3CA 3VKMA 3USUA 4GWNA 2UWBA 1MR5A 1UZYA 4XJ8A 2KM2A 5T52A 4YG6A 4XHXA 2ZGTA 4Q8KA 1W6PA 2ZGOA 4LBQB 2GNDA 3POWA 5IUQA 1Q8PA 1S0GA 1DQ2A 1MS1A 4XOGA 4BQ1A 2GNTA 1LJ7A 3GNEA 3M1HA 1CPNA 1VLNA 2W68A 2WT0A 1CR7A 4YM2A 5EXOA 2CWMA 1G9DA 1C1FA 3N36A 1QOSA 3NV2A 2ZHMA 3MW3A 1YI7A 2VW1A 1WLWA 3SLIA 4YM0A 2VUAA 2YXSA 4JCKA 4FOVA 1JYIA 1GZCA 3JU9A 4M01A 5GLWA 4DRVA 4Z8BA 5HCAA 3O0XA 3A0NA 2EIGA 1SACA 4UW4A 1ULDA 3N7LA 3ZVXA 1WBFA 1EPWA 1FAYA 1KDKA 2R0HA 5F5QA 4UW3A 4XIOA 4LBMA 3IPVA 4OZXA 3D6EA 5CA6A 3AZZA 2A6YA 5EYXA 4XJUA 5EWSA 4WVVA 1DQ6A 4YFZA 1CJPA 3OBRA 4XJAA 2W52A 2ERFA 2NMOA 2B7YA 4LBKA 3OY8A 1CONA 1MS4A 2W08A 3ILRA 4H55A 2ZHNA 1SLLA 2ZAAA 1LOAA 2D7FA 3WHUA 4LBNA 2P3IA 1LHNA 3NV4A 3R4SA 4ISRA 2NM1A 1GNHA 1SCRA 4SLIA 3RG0A 1QOOA 2DVBA 2EXHA 3IN9A 4Q8LA 3V0AA 3WDWA 4FPHA 2JJ6A 2JKBA 3LSEA 1A8DA 4KBBA 4DRRA 4BLIA 1FNZA 5DUUA 1VALA 3WZ1A 1LGBA 4PF5A 4XIKA 2YZ4A 3RQ0A 3M3CA 1ZM1A 1S0BA 1WUVA 1GLHA 4K20A 4AVVA 3M3EA 2C5DA 2A6VA 2ZBJA 4YM3A 1DFQA 4Y1YA 3MEPA 2SLIA 1HDKA 1V6JA 3VKOA 4YLZA 2GDFA 4LBOA 3V0BB 2WLQA 4R9AA 4Y20A 2CNAA 1F5FA 2CL2A 2P2KA 4LBQD 5KXCA 4GWMA 2CWSA 1O4ZA 1SBEA 1BXHA 1WW7A 3AZWA 4YW4A 1D2SA 1LODA 2I2SA 3V64A 1A78A 1UZZA 3VKFC 2OVUA 1SLIA 1AZDA 1SLTA 1Q8OA 2YMZA 1ULFA 1YYNA 1GZ9A 4FPYA 3HR9A 1MS8A 5HCFA 2A7AA 1ENQA 3AP6A 2A70A 1N1YA 5CAZA 4D69A 1RITA 1KDMA 3OPZA 3T1LA 3RMYA 3SH5A 2AYHA 1QDOA 3B3QE 1WD3A 1GBGA 5DUXA 1SFYA 2ZGLA 2WSVA 3IMNA 3ZSMA 1MZ5A 2UWAA 3ZYPA 2EF6A 3KM5A 2DU0A 4PBPA 5T5PA 1XQNA 1SBDA 3WUDA 1QDCA 3B9CA 3CNAA 4ATEA 4FPLA 3JUUA 2ZHKA 5IT6A 1CN1A 2DVGA 2ES3A 1WW6A 5LK5A 4PBOA 3QLQA 3POSA 4YGBA 1YRZA 1IOAA 2P37A 1DZQA 1W6MB 2SBAA 1C57A 1W6QA 2TEPA 5CNAA 3RMXA 1ENRA 1FV3A 1BYHA 4YGEA 2OUJA 1ULGA 1W0OA 3W58A 1GICA 3POYA 4YG3A 3R05A 4LBJA 1U0AA 3N7JA 3M3OA 5T5LA 1S0CA 4Y1ZA 3UK9A 3WV6A 5JDBA 2DVFA 4CRQA 2JE7A 4FPKA 4DS0A 5GZGA 3VUOA 2A6XA 1FATA 1LOFA 5DG1A 4RL7A 4YW5A 3PVNA 5JVVA 4Q1PA 2R1BA 2W39A 2VW2A 2DV9A 4IQPA 2NP0A 3AYCA 1UL9A 1N3OA 1HLCA 1S1AA 3AXEA 3FLPA 4XJZA 5GLVA 1S0DA 2HYKA 2UWCA 1CPMA 2GALA 2PHWA 4YFWA 4CTEA 5GZDA 2R0FA 3N7KA 1BZWA 4PCRA 2WQZC 4R9DA 1W6QB 4ISQA 4FOYA 1N1SA 1LEMA 2WJSA 2A3WA 2D3PA 1FX5A 3AJYA 1LECA 1NXD1 4Q2FA 1V6KA 1PZ9A 2FHRA 5KXDA 1MS0A 3FLRA 3BTAA 2V5YA 3OBTA 3WDVA 2GMPA 1CIWA 3DUIA 1JYCA 3SNMA 4XJWA 4P9XA 2CY6A 4M3CE 1N1VA 3UJOA 1MS3A 5DUVA 2JECA 5DXDA 1ULEA 2ARBA 5IK8A 5IK4A 2D43A 5T5JA 4YW2A 5E89A 5H9RA 4YZ1A 2OUHA 1WW5A 1AXZA 2CTVA 5JOYA 3FUOA 3I8TA 3OY8B 4NO4A 1KRIA 4XXPA 4AVTA 3AZXA 1ULCA 5GJ6A 3IPVB 1I1EA 4XJ9A 3ZSKA 1ZA4A 1V6OA 1NLSA 1GYKA 2AENA 1S0IA 2WT1A 3I4IA 5AVAA 1BQPA 4DPNA 1DLLA 1V6NA 1G86A 1IS3A 1G8WA 4K21A 4Y26A 1MVQA 3WG2A 1UAIA 3V0BA 4K1YA 3ZXFA 1B09A 3ZSJA
chains in the Genus database with same CATH superfamily
2JDKA 3MIHA 4D94A 2LRPA 5I8TA 1HKDA 5K4LA 3FE5A 5FYBA 1Y9QA 4HT1T 1QJZA 5JI7A 4YYOA 1WZXA 4OHZA 4CXWA 2ZX4A 4CA9A 3I2KA 3S5AA 1HRI2 4Q0SA 5JSOA 3FFZA 5JR7B 1K5JA 1HB1A 4AI3A 4XFAA 3N7MA 3VBHB 4LKEA 4CU7A 3KD4A 4C90A 2VBPA 2YC0A 4BMEA 3O0VA 5BNPB 1W9TA 3SH4A 4Y1UA 2XL7A 1TME1 1FPN2 4NUBA 4PT6A 1O6UA 1HRI3 3O12A 3QACA 3SCFA 4OHYA 1TEIA 1NCRC 5C8CC 1R64A 3HN1A 3U0ZA 3K4ZA 1DDLA 2EXJA 2XLGA 2Q30A 3DYPA 2BBAA 2QTWB 2XJQA 3BOWA 4Q4X2 4Q5OA 5FP8A 4CDQA 1UOJA 1K5MA 2Z69A 4WV8A 3T2TA 2E31A 5AC92 3O1MA 3KHCA 1TG7A 2UY9A 5C9AC 2IXKA 3VZMA 2B42B 3AXDA 2CDPA 3SQOA 3VBOA 3PVEA 5FZHA 1CIYA 4OUEA 1NYWA 2RDQA 1WCKA 1BK1A 1CD3G 2BVBA 4LO8A 4OI4A 3EQEA 1GFF2 3WSOA 1PGW2 4GB32 1W8WA 3U75A 1RUE2 2W1SA 1MQTC 5FYCA 3RWNA 4JHTA 4QU2A 5FYYA 1X33A 2MEV1 4SBVA 5EP9A 5FZ1A 1G7YA 1XNBA 1DF0A 1LHWA 2AEZA 4M3CB 4ONUA 4YVSA 5GKAC 4DXTA 4YZ2A 1FYUA 2VOWA 5JPMB 1W8OA 3H3ZA 3A0KA 4MGZE 4Q4V3 4CU9A 1JZ6A 1G9AA 1SBFA 1MPXA 1OFSA 2Q1MA 3AJZA 3LD8A 1ND2C 3PVOA 5T55A 2B45X 4FFGA 2DUOA 1UN1A 1D4M2 1FNYA 3VD4A 3PIGA 1OOPB 2IFRA 3R4UA 1PK6A 3KGZA 3AX4A 3LA7A 3NJZA 3HT2A 1RUI2 2R6QA 5GLUA 3RSJA 2YU2A 2W1QA 4MHUA 5FREA 3TYJA 3D4KA 1QJX2 2RDRA 4XEZA 4CDWA 3FZ3A 4IV1C 4RYDA 1BVP1 2D44A 3EXUA 4M00A 1C28A 5GALA 1PMJX 1Y9GA 2QQNA 1VMJA 1W8TA 3VDDC 1OQDA 2HYXA 1KD7A 1O5UA 1PNGA 2VZUA 4OI0A 5F3CA 1LOGA 4XF4A 2OKXA 4NMIA 3V65A 4YRDA 1ALYA 3PMEA 4GMP3 1LRHA 4MADA 2JG8C 2WNOA 5A3LA 5FFOC 4AVBA 4X6QB 3AK0A 4NPRA 2EA7A 3O1TA 4WM7B 4A7KA 3FBMA 1W2TA 1JN2P 3VBUA 3KF5A 4TWTA 2VTFA 4W6WA 4JHZA 3W59A 3WDTA 1W6NB 3ZFGC 1HN1A 1S0JA 1R1A3 1LOCA 4IEWA 4ASLA 2VPVA 2WQ4A 5FZ0A 5C3SA 5HXMA 3H7YA 2W87A 2GC1A 3ATGA 3HQXA 3PTYA 3VBRC 4XZPA 5L7OA 2DTYA 5F2WA 1A8MA 3CQOA 1YC61 1YJLA 3ZIWA 1IS4A 5L7OC 3NO8A 2P5BA 1ASJ1 2UU8A 3ZFEB 1OF3A 1RUG2 4Z82A 5B4NA 1DQ4A 2PHXA 4O9EA 4BIOA 4ZPIA 1H1AA 4XACA 3H3UA 4JGZC 2R1DA 1VBD2 1RUNA 1YIPA 1CGPA 1CVNA 2VOTA 4BDVB 3GZAA 4LQRA 4GALA 3ASIA 4OI1A 3WP4A 2RMU1 1RUI3 3BYWA 2D5FA 1ONAA 4TYSA 2VW0A 5FP7A 2FD8A 2AREA 3ZMNA 4F7ZA 5FKCA 1RUJ1 5DAVA 2WSUA 2L9LA 3AYEA 2E7TA 3K2OA 4B4PA 1URXA 5FQ0A 3O1SA 4Y22A 5JOXA 1JOBA 1GOHA 2RS32 2WT2A 1RIRA 3FLTA 3KT1A 1DGLA 5FJHA 2LTNA 2VY0A 2GH8A 5IHRA 2ET1A 2YBSA 3WG4A 3ZFGA 2P4EA 2XBO2 1W6OB 2G9ZA 2MPFA 4LTAA 1W0PA 2WYFA 5J96B 4PHZA 4XUNA 1ZRFA 3W5MA 1N1TA 3VBSB 4ITCA 3EB7A 1H8TC 3OYWA 3VBFC 3DGTA 3W9AA 3AZVA 4C1WA 2VMIA 4HVOA 1QY4A 2BWAA 1ND2A 1QOTA 1W2AX 3UL2A 3DKQA 2VVEA 4NIHA 4XDOA 2DURA 3LZZA 2B46X 3SHRA 5B4XA 4EYUA 4Q4W1 2JDAA 1COV3 1JOJA 4M0HA 2ZPXA 1C1LA 4Y22B 1EV11 1GWLA 3B69A 1F8VA 2OW4A 4M4PA 4JDNA 3I49A 1R083 2ZMNA 1RVF3 3CLPA 3OB8A 5CKMA 3ON7A 1J1LA 2HWB1 4LLOA 2WIIB 2J1AA 3RVHA 2J1RA 4A45A 3LPGA 4CCJA 4DEQA 2R071 5IVCA 1LESA 2Q5TA 1PZ8A 4AG4A 1C3HA 5H9QA 4AEDA 4IGPA 5KHJA 2PHRA 5ACA2 3ME2A 2C0ZA 5B2GB 1ULOA 3WNKA 1VRH3 4LNVA 3VBOC 1PK6B 3H8XA 4FPGA 5C7GA 5C71A 1HRV1 2X10A 1W3VA 4XTMA 5E8AA 4BLJA 5DDJ3 4TZDA 2G1MA 3OOXA 3AVRA 2QJVA 1BJQA 2R042 4XMIA 4OZOA 1GKBA 1RYYA 2ARAA 3RS6A 1PGL2 3NJVA 5FUIA 1H6XA 4XMAA 4FQZA 2B4KA 2WNVB 1SCSA 1ZX5A 5A1AA 2ARCA 4PI0A 4MGIE 5GLTA 2QZ3A 1GWMA 3RYPA 2XJSA 2VCMA 1UY4A 2XWJB 2GMMA 1RHI2 2XGXA 4Y5SA 5JSPA 4N9IA 2QE3A 1WMFA 4QB2A 3AMQA 4Y5Z0 1UZWA 3CJIB 1ENSA 3USSA 1OA2A 2PELA 2D97A 2VM9A 2A6ZA 1GMMA 4P9GA 4EWEA 2Y6HA 4CE8A 4Y20B 1RUD1 2QNKA 1AF9A 1W8FA 1LGCA 5D21A 1FMD3 2WO1A 2VGDA 3OCPA 1IHMA 4AAXA 1W6MA 1I3HA 5H9SA 1DYPA 3CL1A 4BQYA 4CEWB 2AR6A 4CDWB 2QVSB 1QJX1 3FX3A 2DCYA 2RJLA 1OD3A 2NYYA 2DBIA 1ZA7A 1AL22 2GMEA 5DUWA 1PVC1 2BNNA 5T54A 2OYZA 2D40A 4CDQB 4COUA 4PIXA 1EP0A 3PUAA 1UPSA 3VL9A 2PHUA 3U4XA 4AI9A 1QJEA 4DY5A 2VMDA 4FFHA 3I7DA 2IVJA 1DG6A 2WS91 4WM8A 5FXVA 1DQ0A 2XXZA 4MGQA 4PI2A 4QKNA 4GMP0 5FRAA 4FPFA 2WRAA 5BNOA 1F2NA 3TWIA 4ZXEA 4J6GA 3VKMA 3NKGA 1NY71 4OHWA 3PL0A 5DDJ1 2KM2A 2MEV2 3C8XA 4XDPA 5FPXA 3P5BA 4YG6A 4XHXA 4DOUA 1V70A 2B39A 4LBQB 2N7GA 3NW4A 4IEQA 3S0MA 4DIQA 3LIGA 3NL1A 4ARXA 1WMEA 3ELNA 1XYOA 3WQ0A 4XOGA 2JIJA 4LO7A 5JUVA 3LA3A 1F4HA 1VLNA 1JZ7A 4LJHA 3AKRA 3MUY1 3HBKA 1RHI1 5A33B 4OCTA 1C1FA 4IV1A 1G9DA 2WINB 3H3LA 4E2GA 2RS33 2ADEA 4LUMA 4YVWA 5FZMA 2GC3A 2ILMA 3RFRA 5DAXA 4NIDA 4LEJA 2XBO3 5HCAA 5JSRA 4W6XA 3A0NA 3IDBB 2EIGA 4X8NA 3ZYGA 3Q8CA 1B35A 2R0HA 3ZVXA 4FAHA 2BPA2 2A1XA 5LBFA 5A32A 2YPDA 5FXZA 4BWOA 4MOAA 4LBMA 1NXMA 1HRV2 3PVBB 1JZ5A 1PX4A 1OKOA 4CYDA 2KR2A 1IQDC 4XJAA 1GZTA 3BIEA 1S2KA 2B7YA 2ETEA 4UAPA 4AK3A 4CUCA 4LBKA 4QDQA 3CZUA 1SLLA 4IE5A 1LOAA 3MLJA 2RR12 4LBNA 1LHNA 3NV4A 4CXXA 4QPIC 4ZONA 2HBUA 4CCNA 2AC1A 4CEYA 4B7EA 2P1BA 2JJ6A 3KGLA 4RD7A 3AM2A 3LSEA 1A8DA 2BJSA 4DRRA 4IUGA 2WZ8A 2ADDA 1LGBA 4O61A 2WWJA 2YZ4A 4QXKA 5FZOA 5KHHA 5FYVA 1NAEA 1ZM1A 4HN1A 3RZMA 2HWB3 2FBEA 4QQLA 3M3EA 2C5DA 4XF9A 3Q8AA 1E57A 1S4CA 2ZBJA 1RVF1 1W90A 3E97A 2RMU3 3EO6A 4META 4Y1YA 4BQWA 4D7TA 5JCTA 3BTYA 2BDRA 1HDKA 3VKOA 4QXCA 1AR72 4BCUA 4YSFA 4DO0A 4B8EA 3VBFB 4B1LA 4LXLA 2CNAA 2P2KA 5KXCA 1VB4A 3T4VA 1WA6X 4IEVA 1QXRA 2BZDA 2YDEA 1PO12 3J4UH 1SLIA 1AZDA 2VNGA 5A6XA 2VZQA 3DPRC 4H2AA 4JV4A 4FPYA 3HR9A 1MS8A 5BY5A 2OX0A 4CP2A 5J3UA 4AEJA 1VBC1 3VDDB 3AP6A 1LKNA 4D69A 5LW9A 2V09A 3CIHA 2HEWF 5A7SA 4HPKB 2XJUA 1RGSA 4JDMA 2HEYF 5CFDA 2Q8DA 4BXFA 5DUXA 3ZSMA 2ZGLA 2Y6FA 1C8NA 1PIV1 3ZR5A 1NQDA 1H1MA 2NPIA 2B8MA 2QQMA 2UWAA 1GR3A 3PHMA 2C9KA 3PLQA 4GJZA 3ST7A 3WUDA 5I0UA 4GAZA 5FYUA 2DVGA 5K0UA 4YGBA 1Q43A 1YRZA 2P37A 1C5HA 1R081 1VJ2A 2F17A 3ZX7A 3OPTA 3BN6A 2O8OA 2OXBA 1COV1 2WFF1 5FK7A 2ORZA 1D0GA 3DYMA 5E1RA 1YNAA 5FV3A 1C8M3 4NHKA 5KBFA 5F5CA 1EUUA 4GD4A 4LBJA 2FCTA 1WMDA 3T09A 4LHLA 1XNCA 4BISA 4LKSA 1S0CA 4P9JA 3UK9A 2DVFA 2JE7A 4FPKA 1WKYA 3HQUA 3NAPC 4EZHA 3TEWA 1LOFA 5ANQA 1QH7A 1SHWB 2Q4SA 4RL7A 4HSJA 4QPGA 3ZPOA 5JVVA 5C5UA 3E5XA 2JG8B 2R1BA 5EQUA 4IE4A 2JB8A 4QHBA 1R1A1 4IQPA 2W9XA 1I5ZA 2BYVE 2NP0A 1O3TA 1PO13 1UL9A 1QJU1 1HLCA 4XJZA 1W9YA 5BNOC 5FOJB 3MFAA 2JG9A 2IXLA 3FJSA 1CPMA 2GALA 4CTEA 5JXJA 3WQ7A 1UOFA 2VC9A 5C4WB 1T2XA 3M3IA 4MV2A 3GBGA 3U4SA 3VBRB 4BQ4A 4ISQA 1YLLA 1PGSA 1RUH2 2WFPA 4FOYA 3RJRA 5A3TA 2IZWA 2C4XA 1RUI1 1XSQA 1OQEA 3AJYA 1HV0A 4X6RB 1TNRA 1XPWA 5CFCB 5CISA 2PHLA 2JXAA 2VZSA 4DUWA 2GMPA 1CIWA 3DUIA 4FO9A 4FSJA 5F3EA 5JIAA 1DGWA 1SQ4A 3VZOA 1SFNA 2CY6A 4HPKA 1MS3A 4Q4Y2 3M7AA 5DXDA 4R4ZA 5IK8A 2PA7A 4BQXA 5E89A 3POFA 1FPN3 2P3YA 5HV4A 4NO4A 1CZTA 5FBJA 4A6OA 1LR5A 4B4RA 4XXPA 3I3DA 1ULCA 2EIBA 3TN93 4DINB 4AOCA 1NE4A 2LM3A 1TME3 2WT1A 5AVAA 1GYKA 1S0IA 2WFF3 1T6BX 3RI8A 1G86A 4GH4A 2CDOA 2XUMA 4NHYA 3V0BA 2VMGA 3C7HA 1B09A 1H2LA 3ZSJA 3WHTA 1GOGA 2XUEA 2WO7A 1APNA 2PHTA 3HMYA 4QPWA 5A1LA 3CO2A 2EIEA 5A7QA 1WLDA 4YVWB 2P17A 2QQWA 3C7GA 2V73A 1KQRA 1N47A 2YPJA 1GANA 1ODNA 4L8QA 2VECA 2IWGB 1QGLA 5FYTA 2ZTNA 3ZYHA 3E6CC 4Q26A 4XAEA 2J1SA 4I01A 2XHKA 1XJAA 4UW5A 5T3NA 3OD4A 5A3MA 1JW6A 1GP4A 2A71A 1AR71 1VIWB 2HJIA 2VZOA 4HK8A 3RNSA 3EJKA 2HWE2 3FHIB 4FI9A 2FZ1A 4Q0PA 4A7ZA 2WA3A 1RVF2 3LEIA 5DPNA 2ZACA 3MW2A 4P9LA 1AL23 4QHZA 2XOMA 1UCXA 4TLFA 1UKGA 4FPOB 3J8F2 5HCBA 1DP0A 2RR11 2Q1FA 3AMMA 5KXBA 3GZUC 1QJY1 2ORXA 1H8TA 2ZZQA 3MBWA 4K8FA 3NKTA 5FYIA 3GDBA 3ZN4A 5C3RA 3M4FA 4MGYE 4H7MA 2PLV2 4I3GA 1OVSA 4S2HA 3N3HA 4HKWA 5FMOS 4B1MA 2Z42A 1KFXL 1HXS2 5KHIA 3ZXEA 5BV6A 1ZVFA 4DXSA 4LPLA 1YQCA 4O65A 3ZM8A 2WN3A 4H3WA 4QDSA 5FPAA 5FKBA 4AVCA 2P3KA 3HOBA 3I54A 3VZNA 2YV8A 4CCOA 5G05L 5BNQA 3G7DA 1QF3A 5JLVA 3T1MA 2FMYA 4KWUA 4UFJA 3OEBA 4CP9A 3D5OA 4Y5TA 2OPWA 5FZDA 3T2OA 4HZFA 5BYNA 4QPGB 4XDQA 1S0FA 1W9SA 4AGVA 1QNYA 2ARXA 3QBQA 1UWWA 3TEZA 2GNBA 5AFBA 3WCSA 1DZTA 4WM8B 2YBPA 4FPJA 4NOTA 3IDCB 4L97A 1OHFA 1AR61 4JRAA 2WO2A 2JDPA 4QX3A 3OJBA 1OOPA 2CU5A 4R9CA 3BCWA 1VBD3 1H9WA 2E6VA 1JZ2A 1SLCA 1QJFA 1GNZA 4D7SA 4XF1A 3LDKA 2WKKA 2AEYA 3K75B 3P6BA 1VRH1 5DZEA 4YNIA 1J1TA 2DCJA 4D0QA 1RUG3 3DN7A 1HB2A 4CP1A 1I5PA 4AGRA 5FPBA 1R1A2 3MIFA 2ZXQA 3I3MA 2ZGUA 1DYKA 3K3NA 5LRRA 4OHVA 3FL7A 4AHZA 4HVQA 1J59A 2R073 2WZPP 1OKQA 1UU4A 2ZEXA 2ZZJA 3C3VA 4V2VA 5FLHA 5KHKA 1V9U2 2IXJA 5DZGA 4FXKB 3A23A 5J37A 1YHFA 3D8CA 2JD9A 4RA0A 5FZ8A 3T0DA 5EIYB 1M4WA 1AR82 1UY3A 2GP5A 2PAEA 4AE2A 5JOWA 5FPZA 1YUDA 4ZU5A 1UX6A 4Q4W3 1ZBE2 2CGOA 1ZNPA 3ZFGB 1TNFA 4YM1A 5JMCA 4LE4A 4BMBA 1JHJA 5GLZA 3PU3A 4CCDA 1Y3TA 3UGGA 3U07A 4P00B 4CZSA 2RE9A 3VKNA 5F5AA 3VDDA 3ZLIA 2J1EA 4ZHNA 5LATA 4QPYA 2ZGSA 4LA2A 4PQ9A 3NVCA 4XQDA 4Y3OA 2YFUA 1LU1A 2DCTA 3N9NA 1H30A 4MYEA 4XYXA 2ID4A 3FUQA 5C4WC 2I45A 3O1PA 2PAKA 4LE3A 3R4DB 1PK6C 3MUZ1 3OYWB 4HK9A 3UKNA 5C6CA 1PVC3 2FCVA 2XH6A 1GZWB 1NA1B 2TUNA 4K7JA 1DGWX 4KWLA 4R4XA 3S5QA 5BXXA 1YFUA 2JDUA 4M4RA 5IVBA 5LA2A 1FOD2 5FY4A 2W0XA 1UOGA 4FFFA 5FBZA 4AVAA 1AR93 4YVSC 1JYXA 3AFKA 2ZGRA 1RUD3 3VBHA 4OFGA 4RHV1 1GNYA 1UU6A 1MQTB 3AC0A 1VAVA 2FDJA 3U78A 2E32A 4EN8B 1ZZ6A 1MQTA 4K1ZA 1VB2A 5ANNA 1AHSA 3CZJA 4EE2A 4QX7A 3ZIXA 4FP2A 5CFCA 2VR4A 5KXEA 3ECQA 1OMIA 2VOVA 4CCEA 3I2DA 5FZFA 2UURA 1XNAA 2WNEA 3ILNA 4AXOA 3NWKA 1OSGA 3LPFA 4IEOA 2KD7A 2R063 1DCSA 5J48A 2K9ZA 4FOWA 4D3WA 1GV9A 2A6WA 3AP4A 1VMFA 1OH4A 2OT7A 3Q9OA 1FXZA 4NR1A 2JG9B 2LW8A 2DYCA 2G4IA 1ODMA 2H0BA 2A5ZA 1Q8QA 4GKXA 2E53A 1RUC3 3RGBA 3ACHA 3SCGA 4CDQC 1F9KA 1DBNA 1AX0A 5C3OA 2HWB2 4NPMA 1JYNA 1O3QA 4FTSA 4GKYA 3WOGA 3DL3A 1TMF1 3VZJA 4CSWA 1G9FA 5C70A 5FPLA 4BH9A 3THPA 2ZABA 5KC6A 2LUWA 2NZ9A 5FY5A 3WF3A 1OVPA 3J7MA 4QDRA 1HXS3 4N43C 1WD4A 2VMCA 3WXPA 4DB5A 5HV0A 3X29B 2D3SA 5GZEA 5CG8A 1YXWA 2MNGA 3MF9A 4LHKA 1V0AA 4OLLA 5FZEA 4W65A 4ASKA 1RTVA 1RXGA 4M3CF 2R49A 1HQWA 1KXGA 2ENRA 3GZTB 2UYBA 5ERLA 3IBMA 3ZOIA 2EAKA 1AX2A 1N3QA 2JE8A 4FPCA 4A41A 2JWPA 1XU2A 3OUIA 1YIFA 5A80A 3KLSA 4UI9L 5DAQA 2QZ2A 2Y6JA 4I3PA 1OC1A 5BPXA 5F7UA 2CYFA 3HIFA 1QWRA 3KHBA 4J1XA 4MXWB 2JDNA 4LKFA 1F31A 3AP9A 5C5TA 2P6HA 3S57A 1CWPA 2XLFA 2F4LA 4QPIB 4QAWA 3HQRA 4NAMA 2D6PA 4CEWA 5EV7A 1RMU3 3CU7A 3T2PA 1VBE2 4YVSB 5BNPC 2GNMA 4I0WB 1L7LA 3WDYA 4FT8A 1RL3A 2V4VA 4UFHA 4AI8A 4QQOA 1H6YA 3S7EA 3DF0A 3IAPA 4KU8A 4P5YA 4E4ZA 1Z0HA 5JZGA 3BUCA 1PZ7A 1QU0A 3RRDA 4IETA 3EBRA 3CHXA 2LALA 3WG1A 4N7IA 4NE9A 4CEWC 1SMVA 3L2YA 1KITA 4O7XA 3LEKA 3WLUA 1BMV1 3N9LA 4IW3A 3AP7A 1W05A 2ZEZA 3M70A 4WM8C 3USUB 4N8MA 4AVSA 5FO8B 1HQLA 2DUQA 1RUH1 1NZIA 4LK6A 4XQWA 5IFPA 3O5SA 4AW7A 1Q8VA 2EXKA 3I2FA 3IM0A 3WNMA 3MFCA 4JX0A 3TAYA 1RUD2 4XBQA 4MHRA 4MGKE 5AFEA 1QEXA 1UXXX 2YHJA 4JQTA 2AGSA 1MZEA 2ZKNA 4K6BA 1Q3EA 1J83A 3MO4A 4M3CA 3RYRA 4Q4Y3 4IEUA 3E6DA 2WS92 3MLKA 2GC0A 4GWNA 2UWBA 1YFYA 1OBNA 2ZX0A 2WABA 3JD73 3ACGA 1AYN1 4AEDB 5T52A 2W92A 2PAMA 3M8LA 1W6PA 2ZGOA 3O1UA 1Q8PA 1DQ2A 2YGMA 3FHAA 1MS1A 2BOIA 2FDGA 2GNTA 1LJ7A 3GNEA 3M1HA 1U5ZA 2WT0A 3I3QA 3K48A 5JR2A 2WZR1 2CWMA 3N4MA 1TZOA 3AMPA 3WW2A 2ZHMA 4AFBA 4RR3A 2PFWA 3SCHA 2VUAA 2YXSA 4JCKA 1JUHA 3MIBA 3FN9A 1GUIA 1GZCA 1JYIA 4M01A 5GLWA 4DRVA 1AR83 4GB31 1J58A 5FO7B 5HBAA 1K5MB 1SACA 2VZPA 3TEXA 3N7LA 1WBFA 3JB4C 3LGRA 5F5QA 1PO22 3S7IA 3WQ1A 1VBA1 4MXWA 2WNVC 2VG9A 5CA6A 2HWD2 1RUE1 2A6YA 2P6CA 3I97A 4UFMA 4XJUA 1IZ3A 1JOPA 4CDUA 3VZLA 4YFZA 4CCLA 1PNFA 2ERFA 1W3XA 3PNAA 4ORFA 1EV12 4OUMA 3VN4A 1CONA 1MS4A 2W08A 4H55A 4UYBA 1AR73 2XMLA 2ZHNA 3KT7A 3MI8A 4FFIA 4RQPC 5FMDA 4ES8A 2LROA 1DZRA 4INDA 5FQ0B 1W2OA 4SLIA 1HJGA 1JTZX 4H14A 4XF0A 3A21A 2DVBA 3IN9A 4AQSA 5J1XA 1V9U1 3KVAA 3LF7A 4KBBA 4XFGA 1PX3A 4MUVA 3WW3A 1VALA 4XUPA 4XUQA 4DNYA 3PUQA 2XQXA 3RQ0A 3M3CA 1D7PM 2WAOA 1S0BA 2HH9A 4AVVA 3I59B 5CKNA 2A6VA 1WMXA 4GULA 3O1OA 1DFQA 1W8ZA 4KMQA 4Q4V2 4BYYA 5JOYA 5BUVA 2J22A 3QH6A 1V6JA 5C4WA 2GDFA 4R9AA 2ZKLA 1QJY3 4QGNA 4Y20A 5FZ7A 3ZXDA 2V4AA 4PIZA 4Q4W2 1F5FA 5JAXA 5HI0A 1SBEA 2IVIB 4YW4A 2PQSA 2Q8EA 1OLMA 2I2SA 3J9SA 5A7WB 1IG0A 2KA3A 4YW7A 3CF6E 3EYPA 1YYNA 1GZ9A 4XCBA 4A3XA 2R062 1HRI1 3GF6A 2R30A 2PXJA 1UD1A 1N1YA 2YB7A 1RITA 1VBC3 1HQNA 2VXJA 1GQHA 4BK5A 5IATA 1DLCA 2OZJA 4QX2A 2Y33A 4NHMA 1XNTA 3ZDSA 3RPQA 4IDZA 5FCCA 4EN7B 4PIYA 5J7MA 4DEVA 2EVXA 2QKDA 3KM5A 2DU0A 5T5PA 1QDCA 4YPJA 5K8SA 1UNBA 4HONA 3BALA 1J84A 2VUJA 3HT1A 4TSVA 4Z2AA 4G4FA 1LAJA 3POSA 4JKLA 1Y4WA 2XVKA 1H8VA 3J26N 3KB5A 5LRSA 2BBVA 2CHHA 4GIQA 2Y38A 1UU5A 4RGKA 2W94A 2WYSA 1AR92 3CKHA 2ZEYA 2CSGA 1L7RA 4YGEA 2OUJA 3W58A 1PIV3 4Z92B 3T0AA 3LKJA 3R05A 3WP6A 4UXAA 3SKJE 5KHGA 5T5LA 4DS0A 1OXCA 3P1IA 1QHDA 3WNNA 4MGTA 2EAAA 1UOBA 3LWCA 2WZEA 1ZRRA 1NY72 4NRQA 1K12A 4Q1PA 2W39A 1U5YA 5FZIA 2VW2A 4XUOA 4NWWA 3I2IA 2QBXA 2VCAA 3LAGA 3TN92 1ZRCA 3FLPA 5GLVA 3LDRA 3ZYFA 1R093 1OD5A 5D1IA 2QQLA 3GBFA 2PHDA 4JGYB 3SXWA 2WQZC 2VAUA 4H7LA 3TRSB 1W6QB 3WT3A 4FAGA 1JYWA 4UBHA 2UYAA 2CGPA 1N1SA 1VAKA 2J42A 3WF4A 2D3PA 5I8SA 1FX5A 3ZN5A 5HPOA 4FXGB 3UKVA 5FZOB 4DUVA 3R0RA 3OGSA 3I59A 2HWC2 2XVLA 4BU2A 3LEMA 3AVSA 1FOD1 4IEXA 4OQ9A 4J1WA 3BTAA 2HWD3 3BU7A 3MPBA 3T08A 5CEHA 4XJWA 4P9XA 5FYZA 1O4TA 5A6ZA 1O3RA 1N1VA 4RS5C 5DUVA 5JIUA 1NX9A 4UOJA 1SPPA 1QXPA 2YC2A 2ARBA 4OUSA 4V2WA 5IK4A 4KH9A 5H9RA 1EUTA 1POQA 2VVDA 4LHSA 1AXZA 1XBFA 2HWE3 4Q4Y1 3FUOA 2BV4A 3GXUA 3I8TA 3ACLA 3OY8B 3BKZA 5FP4A 4MXVA 4XZUG 1KRIA 4QGMA 1JZ8A 4AVTA 2RVAA 3AZXA 3IPVB 3KF3A 4S2DA 1I1EA 2BW8A 3ZXGA 2AENA 3I4IA 1VBE3 4I09A 5A32B 4CCCA 1DGRA 3OGJA 4YARA 1BQPA 3S30A 3ZKYA 4EWDA 3KMHA 4B7KA 1J3PA 1O8PA 3WG2A 3WX5A 4PDWB 2E63A 1UAIA 1WCUA 4EJRA 4WBBA 3I3BA 5ACA1 4I02A 5LEJA 3ZDVA 3SEEA 1TME2 1KGYA 4RR3B 1AYN2 1I6XA 2IXHA 2W46A 5FY7A 3WQBA 1H2KA 5C8CA 3GHMA 4NIAA 2AUYA 4OYUA 5CB7A 4OMDA 3MW4A 3WW4A 4CEYB 2D98A 1E5IA 1CQ9A 3NNFA 1X7NA 3RZZA 4XTPA 2VQ0A 3MF6A 1W8HA 3IT8A 4WZCA 1I9RA 5DAPA 4A2UA 4D7YA 2DUPA 4AR2A 3KZ4C 4LT5A 3OBAA 3PUHA 3RYKA 4J25A 3DECA 4KNCA 4BJ0A 4QQ2A 3BPSA 2GC2A 4KGQA 2CAUA 5L73A 1SDDB 1O4YA 2WWUA 1G9BA 2DDUA 3VDBA 3ZO0B 4A44A 1R082 4PLOA 3WDUA 1LU2A 2VJXA 1IGOA 5BNNA 4EN0A 3RI9A 1KEXA 1NE6A 1SLAA 2RS11 2VH9A 4GXLA 2VZTA 3ZN6B 1HJFA 1NA1C 1NCQC 1ND3B 1UO9A 2JG9C 3AL5A 2E7QA 2P34A 4KG0A 2JDYA 1OI6A 4JGZB 1JI6A 4L99A 4XFFA 5FZ3A 1YO8A 2RM22 2E51A 4CP0A 4D6SA 1UZVA 1XOYA 2Y6LA 4KWKA 4OI2A 5DN2A 3BIWE 5IAXA 3OPWA 1P8JA 1BEV2 1GP6A 1CAWA 2IUWA 3MZHA 4ATFA 1S2BA 1JBCA 4LUKA 4NRPA 1JZ3A 3H42B 3WEZA 4PJYA 4HLTA 5FP9A 4IL7A 3UGHA 4IEPA 2VVFA 1Q5OA 4YG0A 4CDWC 2ET7A 1ASJ2 2KXLA 2HWE1 2ZX3A 1MEC1 2ATFA 3CJXA 1V6LA 4YW3A 1REFA 1X8MA 2H6CA 3HEIA 3Q8BA 1RJ7A 4AGGA 5A3UA 4IERA 1W06A 1SDWA 2R061 4ZY9A 1D4VB 4ARYA 3O7OA 1C4RA 1TMF2 3OBZA 3RZHA 4K40A 2UY8A 4XETA 5A3WA 4DMIA 1DYOA 2XLAA 3LE0A 4FQ4A 1V00A 5F6KA 3S6PA 1AXKA 4Z1VA 4Z2WA 1RJ8A 5FYSA 5T50A 1NLRA 1UY2A 4YGDA 3AL6A 5EHDA 3RZGA 3RDIA 2XHNA 3HJRA 3FBYA 1SFPA 1HB3A 1UMZA 1OLRA 4NPLA 1MS5A 4R9BA 2FDKA 2FMDA 3VB9A 1XRUA 4G9SB 2RHPA 2DTWA 4UF0A 4DQAA 3WUCA 5FY8A 2OA2A 4JDOA 5D8AB 4AL9A 2ZGMA 1XNKA 3E5QA 1UIKA 2VMHA 1QH6A 2XB6C 4L9BA 4Q29A 4V1PA 4JAAA 2Y0OA 4IGOA 4N53C 4E4SA 3WR0A 5DZFA 3UT0A 3N9PA 1LEDA 4PF1A 1MZ6A 3BODA 1A3KA 5IK7A 1RMU2 2ZGNA 3D0SA 3ZXKA 5K9YA 4E2QA 5SV5A 1W28A 2O14A 2ZX2A 3VBSA 4LHNA 3GYDA 1ACCA 3PU8A 4GH4C 1K5MC 2A75A 2OZ6A 4YWAA 3ACFA 1D2QA 4Y1XA 1POV0 3PUIA 4OULA 5JOZA 4P14A 3A4UA 4WVMA 2QQKA 2VZ3A 2W91A 2Q0AA 2D93A 1NCRA 2HWD1 1O91A 4XW3A 3TEYA 2VQUA 1ZZ9A 4GA9A 2I74A 1FMD1 1VBA2 1XE0A 3NAPB 1RUF3 2W1WA 3ZYIB 5LA1A 3UNPA 1S55A 5EFUA 4P9YA 4COWA 4ET7A 1RINA 2DWRA 5L9RA 1RUOA 1X82A 2IXIA 3H50A 3OGVA 3AB0A 4DY3A 5T5OA 2HWC3 3MV01 2VZVA 4LK7A 1LHVA 1LHOA 3KCCA 4YW1A 3B00A 2W3JA 4Q0QA 2AH2A 1GWKA 4WVMB 1JHNA 1QXJA 4NWVA 2IXCA 5GZFA 1LTEA 2BGPA 3OG2A 4YZ5A 2JDZA 4PLMA 1MVEA 3U14A 2BERA 3U37A 1JMUB 2X5IA 1XXNA 5FWEA 4UFIA 4G3YC 2W2IA 2PHFA 3WG3A 3UJQA 2VL4A 2Z79A 2J7MA 3RZLA 4CPBD 2DCKA 1CZVA 3O0WA 4Y24A 4NRMA 5FOBB 1DQ5A 1GSLA 1X9TA 2QFEA 3ENRA 4QX8A 3R6SA 4AI2A 2PN5A 2ZMLA 4K3UA 1ZYBA 2BFUS 3BGAA 2Y6GA 5A1FA 4FP3A 5LY2A 4FBFA 1OT5A 1CAVB 1W6OA 1WCSA 2D6MA 3POBA 4Y33A 5CBLA 2MEV3 2Z2SB 4AHWA 4E9KA 4BQ3A 1XNDA 5GZCA 2ZHLA 1XC6A 4QPGC 4HANA 1WLTA 1RUC2 5FWJA 5JZGC 5LA9A 3BU0A 5LBCA 3POJA 4BA6A 3AZYA 1JS9A 4LOSA 2RG4A 4XC9A 3TB0A 4ZU7A 4AHYA 4Q4X3 4E2SA 5LY1A 2DVDA 1W6PB 1YWKA 1BMV2 4IXLA 5DABA 1K42A 2Y64A 4Q27A 1PHMA 3NMBA 1NZCA 1R091 4F83A 1AR62 2Y6KA 2EALA 4ASMB 2QQJA 1NCRB 4RFT0 2PQQA 2DVAA 4ZXKA 1Y7BA 1EPZA 5IVYA 2NN8A 2VOKA 2JDMA 2K0GA 5FZKA 4FPEA 2BWCA 1CZSA 2B9UA 3AYDA 2RR13 4P9WA 5FMOL 1X50A 4EZ4A 4DXZA 4BIFA 5LZ6A 1M06G 3ZSEA 4BM8A 2YROA 4CCKA 1GU3A 2JE9A 4JZRA 1VAMA 3ZYJB 5KWRA 4XABA 1STMA 2C6SA 2JEMA 2WNUB 2GH2A 4RSUA 1LOBA 3T30A 4D6QA 4BOWA 2GN7A 2JX9A 3CEWA 2QQOA 2OQ6A 4LULA 1SZBA 3KS7A 1IS5A 2DF7A 3MIDA 1PIV2 3WCRA 5IK5A 1LB2A 4JTNA 3NV1A 1OQ1A 2D5HA 1MS9A 1AJKA 4HL0A 1VMHA 1QJY2 3ZPYA 3WVJA 4EN9B 4COYA 1JYTA 2O8QA 1ND3A 2BOJA 2RM21 4BXSV 3K3OA 3PMSA 1US3A 3OGGA 1CESA 4QB6A 4UBGA 2HLEA 1V9U3 3NRUA 3NJXA 3ZYBA 4E8CA 3AKPA 3H0OA 1DU3D 4D8MA 3J7NA 3LSDA 4JKMA 4ZKTB 5LCWL 3HWJA 1EAH2 1Q56A 1H8TB 3JD71 3B01A 3JBG1 2OPKA 2VXRA 4QU1A 4I0BA 2BEOA 3VKLA 5A70A 4XPVA 4C1XA 5LBBA 1AR63 3ETQA 4QKDA 4AFCA 3VGIA 2WA4A 1FV2A 1WCDJ 4Q0VA 3HN3A 1ZBA3 1MR5A 4NAOA 3NJYA 3L2HA 4QT6A 3VD3A 2ZGTA 1W2NA 2YYOA 1RUJ2 2GNDA 3POWA 4HVRA 4AFMA 2WDBA 2BTVC 3VBHC 3PURA 4BQ1A 4YM2A 1CR7A 3CJIA 2MHFA 3KCYA 5EXOA 5FJKA 2VD7A 3N36A 1QOSA 1FT9A 3NV2A 3B5LB 4OMCA 3ITQA 3SLIA 5IVEA 4YM0A 5JXIA 1OH3A 4KGGA 3ZN6A 1B35C 2YGLA 2PLV3 4QD2A 2WNUA 2Y26A 3JU9A 4XAAA 4F3JA 4PDWA 4F8AA 2WUHA 1ZREA 1W04A 1U5IA 1ULDA 1QIQA 4CDXC 5BNNB 1EPWA 3NQHA 3UKTA 1GQGA 4UW3A 3K4DA 4YVWC 3IPVA 4OZXA 5FZAA 1LNSA 4C91A 3MHZA 3THTA 5EYXA 5FYMA 4MVTA 3BI3A 4XQ4A 2W52A 4KU7A 2NMOA 4GWJA 1ZBE3 4R52A 1HV1A 3WNLA 2ZAAA 4ES9A 1YJKA 3MLLA 2XPJA 4NIGA 3OGRA 2VNRA 5A7OA 1GNHA 2X09A 1SCRA 4CUBA 4Q8LA 3V0AA 5IAVA 4FPHA 3UGFA 4LMFA 4B4QA 5I93A 2JKBA 5CADA 2WQ8A 2C24A 1Z7S1 5F8PA 1UY0A 4BLIA 1FNZA 4BZ4A 1VPHA 4PF5A 2OQ7A 1UXZA 2HWC1 5CVRA 1WUVA 2Y8KA 3IDAA 3HNMA 5A7PA 4XF3A 2XKPA 1G6NA 1CAVA 2Y60A 4GJYA 4YM3A 4QM9A 5F2SA 4JVAA 2SLIA 1X9PA 5A3PA 2OIIA 4YLZA 3P3NA 2WLQA 4JQRA 1OOPC 3VBRA 5CYYA 1COV2 4JKKA 2CL2A 4QGLA 2OS2A 2X29A 3THCA 4GWMA 1O4ZA 2E7AA 5J98B 3UESA 1KFUL 1ZRDA 1CX4A 1H4GA 5CZKA 4WVZA 3LFIA 3HVDA 3TN91 1A78A 2X5IB 3VKFC 5IVVA 5LEKA 1Q8OA 2YMZA 2PTMA 1PGL1 3HPNA 1OPMA 2WWSA 2A7AA 5HCFA 2WS93 3ZFFC 1OFNA 5FIXA 2TBVA 3EHKA 1H2MA 1XE8A 2JG8A 4QKFA 5CAZA 3PJYA 3DEMA 4RS5B 3AMNA 2JIGA 4AI0A 1Y43B 4XURA 2YU1A 1K3IA 3B3QE 1W8UA 2V72A 2WSVA 3IMNA 3WF0A 4LLFA 5JPNB 1HB4A 4W50A 3ZYPA 4PBPA 1BBT3 2RJKA 1Y9MA 1XQNA 3KCXA 5CIRA 2ZAHA 3B9CA 1AYM3 3CNAA 4EN6B 1UPIA 4FPLA 2G19A 5IT6A 1WGPA 3P3PA 3QLQA 4XFHA 1F15A 3UYJA 1W6MB 3NNJA 4RHV3 4COZA 4PDWC 1E5RA 2W95A 1C57A 4L92A 3BB6A 1W6QA 5F6LB 4N43B 5A6QA 3LIHA 1OPOA 1ENRA 1RUF2 4A3ZA 4AEDC 1AYM2 1J3QA 1BYHA 1RMU1 1HXS1 1PM4A 4LIVA 1UX7A 3POYA 4RS5A 1WWYA 4YG3A 4C0HA 4QWNA 2Z4FA 3OTFA 1PO11 3N7JA 3TNQA 4E8DA 5FDBA 3M3OA 3N9MA 4S2FA 4Y1ZA 3WF1A 5JDBA 4CRQA 1H1IA 2FZ2A 1BK0A 1NUKA 1REDA 4B29A 5GZGA 3VUOA 5JXHA 1XYPA 4WM7A 3MDPA 2CGNA 3H8UA 4YW5A 1IPJA 4RQPA 5C3PA 3VD5A 3B02A 4W4ZA 1H2NA 2DV9A 3LA2A 3JZVA 5AVPA 4AFDA 4L0PA 1ZRIA 2AACA 2Y34A 1C8M1 1BEV3 2G9FA 2YC4A 1S0DA 1W39A 2HYKA 4JGYC 2UWCA 4N53B 3SC7X 4RFRB 4YFWA 2QQVA 4UT5A 5FXWA 4HSLA 2J1TA 2G9GA 5GZDA 3I2HA 3I3EA 2R0FA 3VBFA 1F4AA 3N7KA 1W8NA 2PYTA 2XVGA 5C9AA 1VBB3 2RMU2 4P08A 2WJSA 2HBTA 5JMOA 4QKBA 2A3WA 1ZZ8A 3F95A 1PMIA 2JDHA 1LECA 1NG0A 1NXD1 2RS52 1V6KA 1PZ9A 1EAH3 5KXDA 1RUF1 4LO4B 3FLRA 3OBTA 3WDVA 3C7FA 4A6SA 5EPAA 1ND3C 3FHQA 5L9VA 3ZR6A 4TTGA 1YQ6A 5DMYA 1RUG1 5FY9A 1XB9A 4CXYA 1TMF3 4XFBA 1SG3A 2Y0IA 2ZEWA 4P02B 3UJOA 2PMWB 3N9QA 1IQAA 4RHV2 3RZJA 1OUSA 2XL9A 3ACIA 1CX1A 4YZ1A 5FZCA 1WW5A 5JXGA 5LA0A 2H0VA 4JTOA 1UY1A 1CAWB 4C0BA 3GBWA 5GJ6A 2QQIA 4LO5B 3ZMOA 4IV3B 4XJ9A 1ZA4A 3ZSKA 5F37A 1V6OA 1JYVA 3DYOA 1H4HA 4CUGA 2HWF3 5G04L 2VMEA 1PO21 1V6NA 1IS3A 1G8WA 4K21A 3D82A 4CU6A 1MVQA 4BHPA 2BNMA 1B35B 4HBNA 4K1YA 4MO3M 4QM8A 5C8WA 1UF2C 4ZS2A 3U11A 2P3JA 2JENA 5DG2A 3SKVA 5DDJ2 3MICA 4GH4B 3APBA 1POV3 2R16A 3AP5A 3I2OA 2RS13 4AFAA 2XWBB 4IV3A 2I07B 4QMAA 2QDNA 4IEZA 4UFLA 2W47A 3O1RA 1LOFC 3NAPA 2XKOA 2YY1A 2DCZA 2NQYA 4TXWA 2HWF1 4U36A 4QQHA 3MPPG 5IVJA 5A3NA 1OA3A 5BNPA 4XHBA 1AL21 3VD9A 4XBNA 2W1UA 3ILFA 2NMNA 1E5SA 2D6KA 2V5DA 4UWDA 3Q8EA 2BP6A 1PVXA 4BPZA 4A42A 3JBG3 2GN3A 3HD8B 4N9HA 1IPKA 2GAUA 3DXUA 2BQPA 3FMGA 4TLGA 3N35A 5H9PA 2NLRA 2VQTA 4YZ3A 5ABJA 3HAGA 5L36A 4EQVA 3C2UA 5FXXA 2BUKA 1PGW1 3A22A 5FYHA 3VBUB 5IYYA 3Q8FA 3WINE 4HMZA 3PJQA 3BPZA 5C9AB 1WBLA 3RWKX 5IVFA 1UMIA 1FOD3 5D8AA 2R041 1FMD2 3J7LA 1TQ5A 1ZZBA 3OSDA 4UF0B 3KWVA 3O1VA 5APAA 3FWEA 3RJ2X 1CAUB 4COVA 3WW1A 2XONA 2RDNA 4LBQA 1JH5A 4XXAA 2HKXA 5FZ9A 2BRTA 3VD7A 2DBNA 4URAA 5AC91 2D6NA 1OUXA 4UFKA 1LULA 4K8RB 1VBE1 2VBBA 2FQPA 2ZGPA 3DPRA 4Q1RA 2VTXJ 3KSCA 3T2QA 1F35A 2R072 2WO3A 2ZGKA 3NV3A 4GZ9A 4FOQA 4NROA 4ZU4A 4BE3A 1SPPB 1AXYA 4CDUC 1S0EA 5EYYA 2FDHA 1DQ1A 2WNVA 3IWZA 4KBZA 2ZGQA 4LIUA 1FPN1 1ST8A 1LCLA 5I0SA 3KQRA 5LBEA 3J8F3 2EXIA 4XBLA 5HXVA 2XJVA 3ZSLA 1L3JA 2XR4A 1NKGA 1GP5A 1VBC2 2B5HA 2X8KA 1HIXA 1JZ4A 2VO5A 2A73B 1PMHX 2RDSA 5FZ6A 1RC6A 3VBSC 1BKZA 1NOVA 2CV6A 2WAAA 4QB1A 2H6BA 3G6JB 3E6BA 5FP3A 1Z78A 1KS5A 4R8HA 1ZBA2 2DU1A 5A7NA 4JGYA 3B9IA 2F6BA 4Q4X1 5F9TA 3K51A 2RS51 5IW0A 3AYAA 5FPVA 4CEYC 2O0OA 5FLJA 1YCIA 2ZS6B 3TBDA 5EJ3A 4C8DA 4IEYA 4QQPA 3LDBA 5FUNA 1UYZA 3IIAA 2C26A 4N7UA 3U1XA 1AYM1 4NVPA 4P5HA 1XU1A 4S2GA 1HX6A 4Y1VA 3IAQA 2XDVA 4E27A 3TNPB 4MG2A 2WLPA 1US2A 2XQRA 3OUJA 1QJU3 2VZ1A 1SLBA 1QMJA 1ZBA1 1ZZ7A 3LCPA 5D8AC 3WF2A 4XILA 5ISLA 1N3PA 3OUHA 5A3OA 2EIDA 4IE0A 4JC1A 1JU3A 3E1F1 1RXFA 2VCCA 4A4AA 3DV8A 1VR3A 4BK4A 1LOEA 3QOPA 5ABJC 1LGNA 2YFZA 3DCQA 3I2GA 3N9OA 4KG8A 3ZXLA 4I30A 4BQ5A 1U5XA 5CG9A 1ENXA 3ORJA 1YQ2A 2JD4A 4CCMA 1IS6A 2DFCA 3FFQA 2Q8CA 4DFSA 2EICA 4BQ2A 2A3XA 4ZZ8A 3EMRA 5IFTA 2ZJCA 1V6MA 3C7OA 3M3QA 2K2SA 3QD6A 3VHNA 1AX1A 5F32A 1DHKB 3OF1A 1D4M3 2VOXA 1OA4A 4FTEA 5TSWA 4QX0A 3T3YA 2AZ5A 1Q8SA 3URFA 3IB3A 1IKPA 4I0AA 3VV1A 1VBB2 1OLQA 3JCIA 3GHNA 3VDAA 5GM0A 4AEMA 5C8CB 3INAA 1MZFA 1H0BA 3T4HB 4L11A 3RZKA 2VU9A 1EV13 4MH0E 4E4HA 4HG6B 3OEAA 1QQP3 3ZYRA 3KV4A 3ZFFA 3H8OA 5FR3A 2GSYA 4WVWA 3SISA 1ND2B 4NN0A 1NLQA 2ZOEB 1GZWA 1NA1A 2VE1A 4CU8A 2D6LX 2VUCA 1W99A 3D3AA 1O59A 3MGUA 1WLCA 1H9PA 1NCQB 4NIIA 3LB9A 3NNMA 4W6YA 3D0JA 4U2AA 3KV6A 2X53S 4M0NA 5KR7A 3GALA 4Q4V1 1W9WA 3DXTA 1U12A 4EV0A 5SV8A 4AQTA 4X8PA 4CPBA 1XE7A 1VP6A 1W6NA 3WP3A 2D6OX 4EWAA 2D3RA 1JU4A 3M2MA 1IG3A 4OQ8A 1W2UA 3GJBA 3NSTA 2HWF2 1QQP1 3QCWA 4A7YA 3VHPA 1MACA 2VNOA 4IV1B 3ZFFB 4JRLA 5FLIA 5A33A 1AR81 5CKQA 4KL1A 5FUPA 3VL8A 2RS53 3JQXA 1K45A 4RGAA 4NJ4A 1E5HA 2WFF2 3POEA 4N43A 2FDIA 4WZFA 2R043 1KJLA 3GM8A 3JB8A 2VCBA 3OD0A 1D4M1 2HEVF 4AWDA 4QXBA 1W03A 2XG3A 1Z7S2 4AHXA 1NQJA 4P9IA 5FMCA 3KV9A 3KV5A 3WNPA 3SITA 1LENA 1FI2A 1HN0A 5FZGA 1R1ZA 1G9CA 4Q0UA 1ASJ3 4KWJA 1OF4A 3WNXA 4UW6A 1AYN3 4CDXA 1KJRA 5L7OB 1LHUA 1JUIA 1AJOA 5J09A 1DIWA 4XUTA 3W21A 1L7QA 2WNUC 1WW4A 2DFBA 4HKOA 4QX1A 1RB8G 1GOFA 1RUE3 1YQ5A 2ZA9A 1IKQA 4FVVA 1BHGA 4Y4RA 2XJRA 1UMHA 3T0BA 4QHOA 3CBNA 2VZRA 3CJIC 5FY0A 3HNBM 3ZKUA 1QKQA 2WZR2 4HOOA 5C3QA 1D0HA 4WM7C 4K9SA 5FZBA 2Z5WA 1RUH3 1DGRN 3VDCA 3AMHA 2XJTA 2J1UA 2BNOA 4AYUA 3CDZB 1JXNA 4RGGA 2A3YA 5E88A 3ES4A 5L9BA 5FAXA 1POV1 3FC0A 4AF9A 1YI9A 3WDXA 2RM23 2R7EB 4FCAA 4YZ4A 3ZXJA 1OLME 3IMMA 4XE9A 2BFUL 1NT0A 4HXCA 3ZFEC 1O8SA 3IKWA 1V6IA 3SH3A 2QUOA 2VTXA 4LBLA 1BBT2 3CMGA 1ZZCA 5EJZB 4YGCA 3K77A 3AKQA 2LS6A 1AVBA 3J8F1 2RJ2A 3W5NA 3BOPA 4I2OA 1O7FA 1C8M2 1X36A 3V0AB 5FMBA 2VUDA 5EJ1B 3QH7A 5F39A 3UV9A 1QNWA 2C9AA 2ZMKA 2JICA 3LQCA 2TNFA 3USUA 4AEKA 5LWBA 3VLBB 1VE0A 5FZ4A 5FZLA 1UZYA 4IGQA 3JBG2 4XJ8A 5C33A 1VBA3 2XJPA 2IFWA 3ABZA 4Q8KA 3ALQA 3TOJA 5IUQA 3IIIA 4CP9B 1S0GA 3GGLA 3J7HA 4MZUA 4GB33 2XBO1 3GJAA 5JZGB 2WC2A 1CPNA 2W68A 4GWIA 4JGZA 4FTBA 4GQ7A 1VRBA 1UYYA 2RS31 2W5FA 3I2JA 5IJRA 2BVVA 3MW3A 4DZGA 1YI7A 2VW1A 1EY2A 1WLWA 3VBOB 2WZR3 4HKLA 1AL0G 4FOVA 5F1RA 1UIJA 1T6GC 3BVCA 4Z8BA 3O0XA 1A6CA 5M0TA 4UW4A 1FAYA 1KDKA 5ABJB 3V56A 3LFMA 4XIOA 3D6EA 3AZZA 4CDXB 4PLNA 4MSVA 5I91A 5EWSA 3WNOA 4WVVA 4AQ2A 4B3NA 1DQ6A 5E16A 1CJPA 3OBRA 5D2AA 2FCUA 5EZWA 3VBUC 4CUAA 4EROA 1RUC1 4E4DX 3LOBA 3LEGA 3OY8A 3ILRA 3LOIA 4HETA 5DUUA 5FTTC 3H1YA 3WHUA 5FO9B 2D7FA 3ETPA 4TN7A 2P3IA 3AKSA 4ISRA 3R4SA 2NM1A 1S2EA 1WA4A 5BNOB 3RG0A 3K4AA 4XFCA 3VHOA 5AC93 1QOOA 2EXHA 4DUXA 4ZZ5A 3WDWA 5FPUA 1GQPA 2X05A 1QJX3 3NNGA 5DQ0A 4BB3A 1C5IA 1R092 3PIJA 4L2NA 1EYBA 1BVVA 3WZ1A 4QXHA 4OVEA 4XFIA 4XIKA 3VHRA 4KI5M 1A34A 1RHI3 4K20A 1GLHA 3MV11 2VBDA 1PVC2 2YBKA 4D6RA 5I0RA 1YQ8A 3THDA 1W0NA 3MEPA 1YFXA 3ZFEA 2YUEA 4LBOA 4LO6B 5IWFA 3V0BB 2J1VA 3B7MA 5JWPA 5K0UC 4LOTA 3BTXA 1XYNA 3H1MA 4LBQD 1BBT1 2CWSA 3L9JT 5FK8A 1BXHA 1WW7A 3AZWA 2JKXA 1D2SA 1LODA 3ES1A 3KVBA 4AAPA 1QJU2 3V64A 1UZZA 2VQAA 3O14A 2OVUA 1ULPA 1SLTA 4LA3A 1ULFA 3SMHA 1W9FA 2K46A 2Q8OA 3MYXA 1ENQA 4W8JA 5CFDC 4DXRA 2A70A 2WL1A 1UQXA 1KDMA 3C7EA 3OPZA 3T1LA 2GU9A 3RMYA 3SH5A 1PM7A 2AYHA 2GZWA 1QDOA 3BTZA 5K7PA 5JI9A 1WD3A 3H8RA 1GBGA 1SFYA 2RV9A 4HFSA 3F2ZA 2CAVA 3WD5A 1MZ5A 3PDQA 2EF6A 1CAXA 5I0DA 5F3IA 2WR9A 1SBDA 1O5LA 4OHXA 4ATEA 3JUUA 3ROUA 1J3RA 2ZHKA 4MGSA 3GZEA 1CN1A 2WBKA 2GP3A 2ES3A 4IESA 1WW6A 1O3SA 5LK5A 3KQ4B 4PBOA 4RN5A 5LK7B 3POGA 1SEFA 1IOAA 1DZQA 2SBAA 2QQPA 2E26A 5F5IA 2B9VA 1QQP2 2TEPA 5CNAA 4O9GA 4YW6A 1UYXA 1PO23 3RMXA 4RR3C 1FV3A 3W20A 3WP5A 1BLZA 1CJDA 3H7JA 1Z7S3 4KQ7A 4AQ6A 1ULGA 1W0OA 3DKWA 2VNVA 1GICA 5FY1A 4N53A 2E9QA 1CAXB 2YG0A 1UYPA 1U0AA 3H1WA 4LR4A 4MX3A 1TE1B 3WV6A 1HW5A 3PUSA 1X8EA 2VULA 1F5JA 3B94A 2QCSB 4LITA 4NHXA 2A6XA 1FATA 2QQUA 1ZBE1 4RQPB 5DG1A 4QPIA 4AZZA 2JB4A 3JQWA 5I0TA 1MEC3 3JXSA 3PVNA 2FDFA 3KT4A 1HRV3 3A7QA 3H9AA 5HCHA 1OURA 1UW8A 3HBZA 3HNYM 1TVGA 3AYCA 1N3OA 1S1AA 4XVHA 2ZX1A 3AXEA 4HN0A 3MIEA 3NNLA 4N90A 2Q1ZB 2PHWA 4XCAA 2ZCWA 1YFWA 4PQQA 1UZ0A 4Z07A 3JD72 1EAH1 3GCWA 5LB6A 4PCRA 1BZWA 1MEC2 4R9DA 5E6HA 5CFCC 1RUJ3 3U10A 1LEMA 1VBB1 4MLOA 5KC5A 1VRH2 2QDRA 2E33A 4Q2FA 3AFGA 2FHRA 5K0UB 1MS0A 1AR91 1KS4A 5F3GA 2V5YA 4IE6A 2BU9A 1XSRA 1BEV1 2C1FA 3UETA 1JYCA 3IDEA 3SNMA 3PTRB 2R32A 4IE7A 2WN2A 4M3CE 3SEPA 3VZKA 3AKTA 3E5UA 5L19A 2JECA 4QX5A 5CFDB 1ULEA 1YEWA 2D43A 5T5JA 1VBD1 4YW2A 4CVUA 3DPRB 2BGOA 2OUHA 4NHLA 2BGCA 2CTVA 5A7WA 4URTA 4IV3C 3ZXAC 1AUYA 2RS12 3B93A 3K46A 1REEA 4ZS3A 4LKDA 1BCXA 2O1QA 5LASA 5ACA3 5CU1A 5J36A 3IZOA 2IC1A 4Y4YA 5A6YA 1JODA 4LORA 1NLSA 2F4PA 5DAWA 3GCXA 1NCQA 1CAUA 4CDUB 3MIGA 1WCQA 2VMFA 5I8YA 3POIA 1UKRA 4DPNA 1DLLA 1IPSA 4Y26A 3WY6A 4AI1A 5BNNC 4GMP1 2PLV1 3ZXFA 2X5IC
chains in the Genus database with same CATH topology
3MIHA 4D94A 5I8TA 1HKDA 3FE5A 1Y9QA 4HT1T 1QJZA 5JI7A 4YYOA 4OHZA 2ZX4A 1HRI2 4Q0SA 5JSOA 3FFZA 5JR7B 4AI3A 4XFAA 3N7MA 3VBHB 3KD4A 4C90A 2YC0A 4BMEA 3O0VA 5BNPB 3SH4A 4Y1UA 2XL7A 1TME1 1FPN2 1HRI3 3O12A 3QACA 3SCFA 4OHYA 1TEIA 1NCRC 5C8CC 3HN1A 3U0ZA 1DDLA 2EXJA 2XLGA 2Q30A 3BOWA 2XJQA 4Q4X2 4CDQA 1K5MA 2Z69A 4WV8A 3T2TA 5AC92 2UY9A 5C9AC 2IXKA 3VZMA 2B42B 3AXDA 3VBOA 3PVEA 1NYWA 1WCKA 1BK1A 1CD3G 2BVBA 4LO8A 4OI4A 3EQEA 1GFF2 1PGW2 4GB32 1RUE2 1MQTC 3RWNA 4QU2A 1X33A 2MEV1 4SBVA 1G7YA 1XNBA 1DF0A 1LHWA 4M3CB 4ONUA 4YVSA 5GKAC 4YZ2A 1FYUA 2VOWA 5JPMB 3H3ZA 3A0KA 4MGZE 4Q4V3 1G9AA 1SBFA 1OFSA 2Q1MA 3AJZA 1ND2C 3PVOA 5T55A 2B45X 2DUOA 1UN1A 1D4M2 1FNYA 1OOPB 2IFRA 3R4UA 1PK6A 3KGZA 3AX4A 3LA7A 3NJZA 3HT2A 1RUI2 2R6QA 5GLUA 3RSJA 3TYJA 5FREA 3D4KA 1QJX2 4XEZA 4CDWA 3FZ3A 4IV1C 1BVP1 2D44A 3EXUA 4M00A 1C28A 5GALA 3VDDC 1OQDA 1KD7A 1O5UA 1PNGA 4OI0A 1LOGA 4XF4A 3V65A 4YRDA 1ALYA 3PMEA 4GMP3 1LRHA 2JG8C 5A3LA 5FFOC 4AVBA 4X6QB 3AK0A 4NPRA 2EA7A 4WM7B 4A7KA 3FBMA 1JN2P 3VBUA 4TWTA 4W6WA 3W59A 3ZFGC 3WDTA 1W6NB 1S0JA 1R1A3 1LOCA 4IEWA 4ASLA 2VPVA 2WQ4A 3H7YA 3VBRC 2GC1A 3ATGA 3HQXA 3PTYA 4XZPA 5L7OA 2DTYA 1A8MA 1YJLA 3ZIWA 1IS4A 5L7OC 3NO8A 1ASJ1 2UU8A 3ZFEB 1RUG2 4Z82A 1DQ4A 2PHXA 4O9EA 4BIOA 1H1AA 3H3UA 4JGZC 2R1DA 1VBD2 1RUNA 1YIPA 1CGPA 1CVNA 3GZAA 4GALA 3ASIA 4OI1A 3WP4A 2RMU1 1RUI3 2D5FA 1ONAA 4TYSA 2VW0A 2AREA 3ZMNA 4F7ZA 1RUJ1 2WSUA 3AYEA 2E7TA 4B4PA 1URXA 5FQ0A 4Y22A 2RS32 2WT2A 3KT1A 3FLTA 1RIRA 1DGLA 2LTNA 2VY0A 2GH8A 2ET1A 3WG4A 2XBO2 1W6OB 2MPFA 4LTAA 1W0PA 5J96B 1ZRFA 1N1TA 3VBSB 4ITCA 3VBFC 1H8TC 3OYWA 3DGTA 3W9AA 3AZVA 4C1WA 2VMIA 4HVOA 1QY4A 2BWAA 1ND2A 1QOTA 3UL2A 2VVEA 2DURA 3LZZA 2B46X 3SHRA 4Q4W1 1COV3 1JOJA 4M0HA 2ZPXA 1C1LA 4Y22B 1EV11 1F8VA 3B69A 2OW4A 4JDNA 1R083 2ZMNA 1RVF3 3CLPA 4LLOA 1J1LA 2HWB1 2WIIB 2R071 1LESA 2Q5TA 1PZ8A 4AG4A 1C3HA 5H9QA 4AEDA 5KHJA 2PHRA 5ACA2 3ME2A 2C0ZA 5B2GB 1VRH3 4LNVA 3VBOC 1PK6B 4FPGA 1HRV1 4XTMA 5E8AA 4BLJA 5DDJ3 4TZDA 2QJVA 1BJQA 2R042 4XMIA 1GKBA 3RS6A 1PGL2 4XMAA 4FQZA 2WNVB 1SCSA 1ZX5A 4MGIE 5GLTA 2QZ3A 3RYPA 2XJSA 2XWJB 2GMMA 1RHI2 2XGXA 5JSPA 4N9IA 2QE3A 1WMFA 3AMQA 4Y5Z0 3CJIB 1ENSA 3USSA 1OA2A 2PELA 2D97A 2A6ZA 4P9GA 4EWEA 4Y20B 1RUD1 2QNKA 1AF9A 1LGCA 1FMD3 3OCPA 2VGDA 1IHMA 1W6MA 1I3HA 5H9SA 1DYPA 3CL1A 4CEWB 2AR6A 4CDWB 2QVSB 1QJX1 3FX3A 2DCYA 2RJLA 5DUWA 2NYYA 5T54A 2OYZA 1AL22 2GMEA 1PVC1 2BNNA 4COUA 5JOXA 2D40A 4CDQB 4PIXA 1EP0A 1UPSA 3VL9A 2PHUA 3U4XA 4DY5A 3I7DA 1DG6A 2WS91 4WM8A 1DQ0A 5FRAA 4GMP0 4FPFA 5BNOA 1F2NA 3TWIA 4J6GA 3VKMA 3NKGA 1NY71 4OHWA 5DDJ1 2KM2A 2MEV2 5FPXA 4YG6A 4DOUA 4XHXA 1V70A 2B39A 4LBQB 2N7GA 3NW4A 4IEQA 3S0MA 3NL1A 1WMEA 3ELNA 1XYOA 3WQ0A 4XOGA 4LO7A 3LA3A 1VLNA 1G9DA 3AKRA 5A33B 1RHI1 1C1FA 4IV1A 2WINB 4E2GA 2RS33 4LUMA 4YVWA 2GC3A 2ILMA 4LEJA 2XBO3 5HCAA 5JSRA 4W6XA 3A0NA 3IDBB 2EIGA 4X8NA 3ZYGA 3ZVXA 1B35A 2R0HA 4FAHA 2BPA2 5A32A 4BWOA 4LBMA 1NXMA 1HRV2 3PVBB 4CYDA 4XJAA 1S2KA 2B7YA 2ETEA 4AK3A 4LBKA 1SLLA 1LOAA 3MLJA 2RR12 4LBNA 1LHNA 3NV4A 4QPIC 4CEYA 4B7EA 2JJ6A 3KGLA 4RD7A 3AM2A 3LSEA 1A8DA 4DRRA 1LGBA 4QXKA 2YZ4A 5KHHA 1ZM1A 4HN1A 2HWB3 2FBEA 4QQLA 3M3EA 2C5DA 4XF9A 1E57A 2ZBJA 4META 1RVF1 3EO6A 3E97A 2RMU3 4Y1YA 4D7TA 5ACA3 5JCTA 1HDKA 3VKOA 4BCUA 1AR72 4YSFA 4B8EA 3VBFB 2CNAA 2P2KA 5KXCA 1VB4A 4IEVA 1QXRA 2YDEA 1PO12 3J4UH 1SLIA 1AZDA 2VNGA 3DPRC 4JV4A 4FPYA 3HR9A 1MS8A 5BY5A 5J3UA 4CP2A 4AEJA 1VBC1 3VDDB 3AP6A 1LKNA 4D69A 2V09A 2HEWF 4HPKB 2XJUA 1RGSA 4JDMA 2HEYF 5CFDA 5DUXA 3ZSMA 2ZGLA 1C8NA 1PIV1 1NQDA 2UWAA 2NPIA 1H1MA 2B8MA 3PHMA 1GR3A 3PLQA 3ST7A 3WUDA 5I0UA 2DVGA 5K0UA 4YGBA 1Q43A 1YRZA 2P37A 1C5HA 1R081 1VJ2A 3ZX7A 2O8OA 1COV1 2WFF1 1D0GA 5E1RA 1YNAA 1C8M3 4NHKA 5KBFA 4LBJA 1WMDA 4LHLA 1XNCA 1S0CA 4P9JA 3UK9A 2DVFA 2JE7A 4FPKA 3NAPC 1LOFA 1QH7A 2Q4SA 4RL7A 4HSJA 4QPGA 5JVVA 3E5XA 2JG8B 2R1BA 4QHBA 1R1A1 4IQPA 1I5ZA 2BYVE 2NP0A 1O3TA 1PO13 1UL9A 1QJU1 1HLCA 4XJZA 5BNOC 5FOJB 3MFAA 2JG9A 2IXLA 3FJSA 1CPMA 2GALA 3WQ7A 5C4WB 3M3IA 4MV2A 3GBGA 3VBRB 4ISQA 1YLLA 1PGSA 1RUH2 2WFPA 4FOYA 3RJRA 2IZWA 1RUI1 1OQEA 3AJYA 1HV0A 4X6RB 1TNRA 5CFCB 2PHLA 2JXAA 2GMPA 1CIWA 3DUIA 4FO9A 4FSJA 5JIAA 1DGWA 1SQ4A 3VZOA 1SFNA 2CY6A 4HPKA 1MS3A 4Q4Y2 3M7AA 5DXDA 4R4ZA 5IK8A 2PA7A 5E89A 1FPN3 4NO4A 4B4RA 1LR5A 4XXPA 1ULCA 3TN93 4DINB 1NE4A 2LM3A 1TME3 2WT1A 5AVAA 1GYKA 1S0IA 2WFF3 3RI8A 1G86A 4GH4A 2XUMA 3V0BA 2VMGA 1B09A 1H2LA 3ZSJA 3WHTA 1APNA 2PHTA 3HMYA 3CO2A 1WLDA 4YVWB 2P17A 2V73A 1KQRA 1N47A 2YPJA 1GANA 4L8QA 2VECA 2IWGB 1QGLA 2ZTNA 3E6CC 4Q26A 4I01A 2XHKA 4UW5A 5T3NA 3OD4A 1JW6A 2A71A 1AR71 1VIWB 2HJIA 4HK8A 3RNSA 3EJKA 2HWE2 3FHIB 2FZ1A 4Q0PA 4A7ZA 2WA3A 1RVF2 2ZACA 3MW2A 4P9LA 1AL23 1UCXA 4TLFA 1UKGA 4FPOB 3J8F2 5HCBA 2RR11 3AMMA 5KXBA 3GZUC 1QJY1 2ZZQA 1H8TA 3ZN4A 4K8FA 3NKTA 3M4FA 4MGYE 4H7MA 2PLV2 4I3GA 4S2HA 3N3HA 4HKWA 5FMOS 2Z42A 1KFXL 1HXS2 5KHIA 3ZXEA 5BV6A 1ZVFA 4H3WA 4AVCA 2P3KA 3I54A 3VZNA 2YV8A 5BNQA 3G7DA 1QF3A 5JLVA 3T1MA 2FMYA 3D5OA 4HZFA 5BYNA 4QPGB 4XDQA 1S0FA 4AGVA 1QNYA 2ARXA 3QBQA 2GNBA 5AFBA 3WCSA 1DZTA 4WM8B 4FPJA 4NOTA 3IDCB 4L97A 1OHFA 1AR61 4JRAA 3OJBA 1OOPA 4R9CA 3BCWA 1VBD3 1H9WA 2E6VA 1SLCA 4D7SA 1GNZA 4XF1A 2WKKA 5DZEA 1VRH1 4YNIA 1J1TA 2DCJA 1RUG3 3DN7A 4CP1A 4AGRA 1R1A2 3MIFA 2ZGUA 1DYKA 5LRRA 4OHVA 4AHZA 4HVQA 1J59A 2R073 2WZPP 1OKQA 1UU4A 3C3VA 2ZZJA 5FLHA 5KHKA 1V9U2 2IXJA 5DZGA 4FXKB 5J37A 1YHFA 3D8CA 4RA0A 1M4WA 1AR82 2PAEA 4AE2A 5JOWA 5FPZA 1YUDA 4ZU5A 1UX6A 4Q4W3 1ZBE2 2CGOA 1ZNPA 3ZFGB 1TNFA 4YM1A 5JMCA 4LE4A 4BMBA 5GLZA 1Y3TA 3U07A 4CZSA 2RE9A 3VKNA 3VDDA 4QPYA 2ZGSA 4LA2A 4PQ9A 3NVCA 4XQDA 1LU1A 2DCTA 1H30A 4MYEA 4XYXA 3FUQA 5C4WC 2I45A 2PAKA 4LE3A 3R4DB 1PK6C 3OYWB 4HK9A 3UKNA 5C6CA 1PVC3 4R4XA 2XH6A 1GZWB 1NA1B 2TUNA 4K7JA 1DGWX 4KWLA 5A3MA 5BXXA 1YFUA 1FOD2 2W0XA 4AVAA 5FBZA 1AR93 4YVSC 3AFKA 2ZGRA 1RUD3 3VBHA 4OFGA 4RHV1 1UU6A 1MQTB 1VAVA 4EN8B 1ZZ6A 1MQTA 4K1ZA 1VB2A 1AHSA 3ZIXA 4FP2A 5CFCA 5KXEA 3ECQA 1OMIA 2VOVA 3I2DA 2UURA 2WNEA 3ILNA 4AXOA 3NWKA 1OSGA 4IEOA 2R063 2K9ZA 4FOWA 4D3WA 1GV9A 2A6WA 3AP4A 3Q9OA 1FXZA 4NR1A 2JG9B 2DYCA 2G4IA 2H0BA 4GKXA 2A5ZA 1Q8QA 2E53A 1RUC3 3SCGA 4CDQC 1F9KA 1DBNA 1AX0A 2HWB2 1O3QA 4FTSA 4GKYA 3WOGA 3DL3A 1TMF1 3VZJA 1G9FA 4BH9A 3THPA 2ZABA 5KC6A 2LUWA 2NZ9A 5L36A 1HXS3 4N43C 1WD4A 4DB5A 3WXPA 3X29B 2D3SA 5GZEA 5CG8A 1YXWA 2MNGA 3MF9A 4LHKA 4OLLA 4W65A 1RTVA 4M3CF 2R49A 1HQWA 1KXGA 2ENRA 3GZTB 2UYBA 3IBMA 2EAKA 1AX2A 1N3QA 4FPCA 1XU2A 1YIFA 3KLSA 2QZ2A 4I3PA 5BPXA 2CYFA 3HIFA 1QWRA 4J1XA 4MXWB 1F31A 3AP9A 2XLFA 4QPIB 2D6PA 4CEWA 5EV7A 1RMU3 3CU7A 1VBE2 4YVSB 5BNPC 2GNMA 4I0WB 3WDYA 4FT8A 1RL3A 4AI8A 4QQOA 3S7EA 3DF0A 4KU8A 4E4ZA 1Z0HA 5JZGA 1PZ7A 1QU0A 3RRDA 4IETA 3EBRA 2LALA 3WG1A 4N7IA 4CEWC 1SMVA 3L2YA 1KITA 3WLUA 1BMV1 3AP7A 3M70A 4WM8C 3USUB 4AVSA 5FO8B 1HQLA 2DUQA 1RUH1 4XQWA 3O5SA 4AW7A 1Q8VA 2EXKA 3IM0A 3MFCA 3TAYA 1RUD2 4XBQA 4MGKE 5AFEA 2YHJA 2AGSA 1MZEA 2ZKNA 4K6BA 1Q3EA 4M3CA 3RYRA 4Q4Y3 4IEUA 3E6DA 2WS92 3MLKA 2GC0A 4GWNA 2UWBA 1YFYA 2ZX0A 3JD73 1AYN1 4AEDB 5T52A 2PAMA 3M8LA 1W6PA 2ZGOA 1Q8PA 1DQ2A 2YGMA 1MS1A 2GNTA 1LJ7A 3GNEA 3M1HA 1U5ZA 2WT0A 3K48A 3N4MA 2WZR1 2CWMA 3AMPA 3WW2A 2ZHMA 4AFBA 4RR3A 2PFWA 3SCHA 2VUAA 2YXSA 4JCKA 1JUHA 3MIBA 1JYIA 1GZCA 4M01A 5GLWA 4DRVA 1AR83 4GB31 1J58A 5FO7B 5HBAA 1K5MB 1SACA 3N7LA 1WBFA 3JB4C 3LGRA 5F5QA 1PO22 3S7IA 3WQ1A 1VBA1 4MXWA 2WNVC 2VG9A 5CA6A 2HWD2 1RUE1 2A6YA 4CDUA 4XJUA 1IZ3A 3VZLA 4YFZA 1PNFA 2ERFA 3PNAA 4ORFA 1EV12 4OUMA 3VN4A 1MS4A 1CONA 2W08A 4H55A 4CTEA 1AR73 2ZHNA 3KT7A 3MI8A 4ES8A 5CFCC 4RQPC 1DZRA 4INDA 5FQ0B 4SLIA 4H14A 1JTZX 4XF0A 3IN9A 2DVBA 4AQSA 1V9U1 4KBBA 4XFGA 4MUVA 3WW3A 1VALA 4DNYA 3RQ0A 3M3CA 1S0BA 4AVVA 3I59B 2A6VA 4GULA 1DFQA 4Q4V2 4BYYA 5BUVA 3QH6A</