1SBDA

Soybean agglutinin complexed with 2,4-pentasaccharide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
234
structure length
232
Chain Sequence
AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENEDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOYBEAN AGGLUTININ
publication title X-ray crystallographic studies of unique cross-linked lattices between four isomeric biantennary oligosaccharides and soybean agglutinin.
pubmed doi rcsb
molecule tags Lectin
total genus 45
structure length 232
sequence length 234
ec nomenclature
pdb deposition date 1995-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sbdA00
5E8AA 3JUUA 5GLZA 4BMEA 1VAMA 4UW6A 3I8TA 2A6XA 3QLQA 5DXDA 4ZXKA 1DFQA 4GWMA 2EXKA 2DYCA 2VH9A 5DG2A 4WZFA 1VLNA 2CY6A 3LSDA 5DUXA 1TEIA 1GICA 4YG0A 2ZMKA 4M3CE 2CYFA 2JKBA 4ZKTB 4GKXA 5JVVA 4BOWA 1LHVA 2ZZJA 5CA6A 1LOGA 3ILFA 1KDMA 5DUWA 1N1VA 1S0FA 1A3KA 1LENA 1FNZA 3H0OA 1SLTA 3IM0A 1HQWA 1DZQA 2E7TA 1DBNA 4Y1XA 4YGCA 1BYHA 2P37A 5JOYA 1JHNA 3RMYA 2JECA 2ZKNA 2JE9A 1DYPA 4R9BA 5EYYA 2NM1A 2VUAA 2ZGLA 1UKGA 4UW4A 5JOWA 5IK7A 3LCPA 4AVVA 1W6PA 3HN1A 4AVTA 4XXAA 1IS6A 2A6YA 4Z8BA 1G8WA 2A6WA 3MEPA 3WG1A 1JYCA 4XOGA 2VY0A 1IS3A 5JOZA 3LSEA 3SLIA 4U36A 3ZXJA 4BLIA 2C9AA 2D3SA 1N47A 3AZVA 3KM5A 3M3OA 4M00A 2B7YA 2A3YA 2NMOA 3MW4A 4K1ZA 3A4UA 3ZXLA 2DUPA 1F31A 4GKYA 4OZXA 1LJ7A 3A0KA 2VW0A 1ENQA 1GLHA 5F5QA 3FLTA 2R0FA 3N3HA 3PVNA 3WG4A 4AYUA 1N3OA 1UAIA 1LHOA 1B09A 1MS3A 4Y1VA 1NXD1 1I3HA 1QNWA 1ULCA 2ARBA 1W6NB 1LEDA 2PHRA 4LBLA 2CTVA 4HANA 5IT6A 4ISRA 4DPNA 1HLCA 4XHXA 3PJQA 1GANA 1SACA 1GZ9A 1YXWA 4Y20B 3V0AA 3ILNA 1LOEA 2CWMA 2WLQA 4WV8A 5EXOA 2ENRA 5T55A 1CONA 1LHWA 1MVEA 3HR9A 1BQPA 1BXHA 2AREA 1WW4A 2VW2A 4YZ3A 1N1TA 1DYKA 1Z0HA 4FVVA 1FV3A 1WW7A 1JW6A 1H9PA 4L8QA 4Y24A 5DZFA 2W68A 2ZA9A 4JRAA 4XIKA 4IQPA 1QDOA 3WDTA 3AXEA 5GZGA 3TB0A 4P9YA 3ASIA 4FPEA 4DFSA 3D5OA 4P9WA 1AF9A 5T5PA 5CBLA 4YW3A 1LOCA 3ZSMA 2D6MA 1JXNA 1LESA 2E51A 2AUYA 4BLJA 1YO8A 1KRIA 1V6IA 5GZFA 2ZACA 4PBOA 4FPCA 4RL7A 3WNXA 2ERFA 2ZGSA 3W59A 4XHBA 3N7LA 3L2YA 2ZGOA 1DQ1A 4XMIA 1QDCA 3OBRA 5H9RA 3AZWA 4XZPA 4FOWA 1LCLA 1LOAA 3N36A 1V6JA 4P9XA 2CNAA 3SH4A 1AZDA 3V65A 1WW5A 4LBOA 5L73A 5GZDA 4NOTA 1IOAA 2NMNA 3BTAA 1YRZA 3N7KA 1W6QA 1JOJA 1ULEA 4PF5A 3RS6A 3WCRA 2UWAA 3JU9A 1WLWA 2RHPA 2SBAA 4XJUA 4WVVA 3WDWA 1WBFA 3FFZA 4SLIA 2ZGMA 3KQRA 5T5LA 3RG0A 1ENSA 2DU1A 4YW2A 4DQAA 2ES3A 4FPKA 2VXRA 4FP2A 4I30A 5DG1A 3T2TA 3FBYA 5IK5A 2AGSA 1BJQA 1OFSA 4FPOB 4XYXA 1AX1A 1O4ZA 4YFZA 4GALA 4XJZA 1IS4A 3T1LA 1V6LA 3QCWA 2FHRA 2GMEA 3B69A 3FUOA 3O12A 3UL2A 3UK9A 5CNAA 1GV9A 1JYIA 3IKWA 5T54A 4LBKA 4AWDA 2V5YA 1GZWB 3RRDA 4XBQA 3VKLA 3OYWA 1Z78A 1WD4A 2WNEA 5AVAA 2PHUA 1S0BA 3AP9A 5DZGA 1MS9A 1VAVA 1N1YA 2ZAAA 1X50A 1W6MB 4R9CA 2DUOA 2DURA 2A75A 2ZHKA 5GJ6A 1LHUA 1FATA 2P3JA 2NZ9A 4BMBA 2A7AA 2WT0A 4PBPA 2EXJA 5T50A 3RQ0A 4YM3A 1LEMA 1AJOA 1IS5A 2D6PA 1QU0A 4HL0A 4MYEA 1WBLA 4JC1A 2D44A 3GNEA 4XIOA 3WDXA 2WT2A 1H30A 1NLSA 2A3XA 3ZXFA 1F5FA 4YZ1A 1LOFC 1R1ZA 4KBBA 1LGNA 1YI7A 4XTPA 3AZYA 4LBQA 5E89A 4LBMA 2AH2A 3CNAA 5CB7A 3AZXA 1GNZA 3M1HA 1XQNA 3RSJA 3WOGA 3O0WA 1EPWA 2ARXA 1V6NA 2TEPA 1DQ4A 3V0BA 1CN1A 1UMZA 1IKPA 1HQLA 4K20A 5T5JA 3USUA 3WVJA 4Y1YA 2ZGKA 1RINA 4C1XA 2VU9A 2EF6A 1LU1A 2W52A 3N35A 4Q8KA 1GZCA 1MS0A 4ISQA 1DQ5A 3R05A 2AYHA 2WSVA 3M2MA 3ZSLA 1RITA 2UWBA 5GLWA 4YGDA 4FPYA 4FPGA 1QOTA 2ZMLA 2DTYA 2V73A 1CJPA 2WQZC 2P3KA 2VW1A 2JDZA 4YM1A 3VKFC 1QOOA 4BPZA 1DHKB 3B00A 1CVNA 4FPJA 4R9AA 4UW5A 5GLUA 2PELA 2ZGUA 1S0EA 5H9QA 4JCKA 5JDBA 5DUVA 2AENA 3DGTA 1UPSA 4ITCA 1WW6A 5SV8A 4ASMB 2OW4A 2NYYA 1W6OA 5DUUA 4LBNA 4C1WA 5FREA 5LK5A 3PVEA 1FX5A 1V6KA 4YW4A 2EALA 4LBJA 4Y22A 2ZHLA 2GNMA 3IPVA 2EIGA 1W6PB 4XILA 1MVQA 2E53A 1CIWA 4AGGA 1SLLA 1LOFA 1C1FA 3POYA 4M3CA 2P3IA 1N3PA 3BODA 2E6VA 4U2AA 2ZGPA 4R9DA 4CTEA 1UN1A 2ZGQA 1SLIA 1A8DA 2GMPA 2GNBA 1RIRA 1W0OA 1FYUA 3NWKA 3R4UA 5E88A 5CAZA 2ZMNA 4YLZA 2A6ZA 3INAA 5KXDA 1CQ9A 4Y1UA 2JD4A 1A78A 2A6VA 3WV6A 2LTNA 3SISA 3AXDA 4ATEA 4GA9A 1ENRA 3ZYRA 4XBNA 4XJ9A 1UZZA 3WDUA 2D6OX 3DUIA 5GZEA 2D3PA 1QNYA 2GN7A 3ENRA 3FLPA 1S0GA 3N7JA 3V0AB 3WHTA 4K21A 1ZA4A 2E7QA 3AJZA 2WT1A 4XXPA 1LGCA 1V00A 2R1DA 2ZABA 4FPLA 2A70A 3ZSKA 3SITA 5GALA 3AP7A 1YIFA 5EWSA 1S1AA 5JLVA 1V6MA 3MPPG 3O0XA 2UU8A 1KJLA 3PMEA 3C2UA 3A0NA 4FOQA 1DQ6A 3D4KA 4W65A 4Q1PA 2DVAA 3PVOA 2WKKA 5KXCA 1S0CA 5GLVA 3AP5A 1N3QA 4GXLA 1LOBA 3R4SA 2A71A 1G9FA 3B9CA 1W0PA 2R16A 1ULFA 3OJBA 2UURA 2WSUA 4PCRA 1MS5A 4XJWA 2UWCA 4YG3A 5H9SA 5KXEA 2KM2A 3AJYA 4LBQD 1LHNA 2D6KA 1MS8A 3W58A 1QKQA 3U4XA 3AZZA 1D0HA 2DVGA 2DVFA 1GZWA 4D69A 2EAKA 4YW1A 1OKQA 2DUQA 3ATGA 3IMNA 1KDKA 4AGVA 1JBCA 2JE7A 4WVWA 1W6QB 2XG3A 3ZYPA 4ATFA 5HCAA 2DVDA 2FMDA 1W6MA 2YV8A 4XTMA 1LECA 2YZ4A 3M3CA 1GYKA 4DRRA 1AVBA 1G9CA 1QOSA 2Q5TA 3B01A 3ILRA 4Y26A 1N1SA 1AXKA 3AYDA 3NV3A 1QGLA 1V6OA 1Q56A 2R1BA 3M3QA 2P34A 1GBGA 1LGBA 3ZXEA 3ZPYA 5GZCA 1KQRA 1JUIA 1Q8QA 3OBTA 2PHWA 4YG6A 1BZWA 5H9PA 1F9KA 3N7MA 3OY8B 1G9DA 3OYWB 2D6LX 2GMMA 3B3QE 4M3CF 1VALA 3SH5A 4AGRA 2GN3A 2I2SA 2GDFA 3AP4A 1QF3A 4FPHA 1WUVA 4M01A 1S0JA 2D43A 3AFKA 4TZDA 1MACA 2ZBJA 1AXYA 1DQ0A 3POSA 5EYXA 2DV9A 3VUOA 3BOPA 3WUCA 1PZ8A 1SCRA 1PZ7A 3WZ1A 1MZ6A 1GKBA 4PQ9A 2R0HA 3WDVA 2YROA 1DQ2A 5IK4A 1Y7BA 2D3RA 1G86A 4Q2FA 2DVBA 2G4IA 4LBQB 2H0BA 2NP0A 1GNHA 3Q9OA 3FUQA 3VKMA 2ZGRA 2ZHNA 3ZXKA 1FV2A 1C1LA 2AR6A 4Q26A 3V0BB 3O0VA 1PZ9A 3USUB 3VV1A 4DS0A 4XJAA 1DLLA 3WG2A 3ZSJA 1W6NA 1AXZA 1IKQA 2NN8A 5JMCA 1URXA 1QMJA 1CPMA 3TAYA 1WCSA 1SLBA 1HKDA 3AX4A 4Y20A 3WLUA 2EXIA 1WLDA 3AYCA 1SBDA 1WD3A 1MZ5A 2Z42A 3V64A 1LODA 4XBLA 2JJ6A 1C4RA 1SLAA 1CR7A 3APBA 4F83A 4DRVA 2R49A 3UJOA 1LTEA 1Q8VA 4YZ2A 1SBEA 5DZEA 3MW2A 5JOXA 1CESA 1MR5A 4GWNA 3AYAA 3HMYA 1G9AA 2CWSA 2ZHMA 3FLRA 2GALA 4TYSA 5IUQA 5GLTA 3VKNA 1S0IA 4AVSA 1W6OB 1FAYA 1AX0A 1GSLA 1YYNA 3OGGA 4FOVA 3RMXA 2ZGTA 2CL2A 5BYNA 2OVUA 1SCSA 4Y22B 3IPVB 2PHTA 2LALA 3M3EA 1UX6A 4Q1RA 5FRAA 1LU2A 1VIWB 1O4YA 2HYKA 4NO4A 5HCBA 4FOYA 1Q8PA 5T52A 3WCSA 2A3WA 3NV1A 1UZYA 4FQ4A 3WG3A 4K1YA 4Q27A 1ULGA 4YZ4A 1Q8SA 2BQPA 3AYEA 3OPZA 2ZGNA 4M3CB 2PHXA 2D7FA 1LULA 1AJKA 2GNDA 2YXSA 2GNTA 2SLIA 3UJQA 4YFWA 3NV4A 4RA0A 4YGEA 1APNA 2XB6C 2DWRA 3GALA 4YW5A 4CRQA 2DTWA 3WDYA 1WLCA 1KJRA 2EXHA 2YY1A 1AX2A 1D2SA 3ZVXA 1ULDA 4BQ1A 1I1EA 2DU0A 2OUHA 4XE9A 1SLCA 1S0DA 4Y1ZA 1C57A 1DGLA 1J1TA 4Q8LA 4XJ8A 5HCFA 1SBFA 3SH3A 3VKOA 3IN9A 1H9WA 1ZM1A 3POWA 1SFYA 1OQ1A 5GM0A 1CPNA 3WHUA 4FP3A 1MS1A 3T1MA 4H55A 4YZ5A 3WUDA 3AP6A 3D6EA 2W08A 1ONAA 4XMAA 1UL9A 2C5DA 5F9TA 1JN2P 4FQZA 5KXBA 4FPFA 4CZSA 4P14A 1MS4A 3I4IA 3MW3A 4YGBA 3AK0A 1U0AA 4YM0A 5IK8A 3BIWE 3O5SA 3NV2A 1BKZA 3SNMA 2P2KA 1G7YA 1KITA 2A5ZA 2OUJA 2PHFA 2YMZA 2WJSA 2W39A 1G9BA 5T5OA 4UW3A 2D6NA 1DIWA 3OY8A 4YM2A 1Q8OA 4BM8A 4XDQA 1HDKA 1FNYA
chains in the Genus database with same CATH superfamily
1WWYA 5E8AA 2OS2A 5GLZA 5LEKA 4GWJA 1VAMA 4BMEA 4CXXA 3NJYA 5C6CA 1QXPA 1W0NA 3I8TA 3K75B 3TNQA 4BQ4A 2N7GA 2I74A 2VGDA 1R64A 2QQVA 2WZR2 1VB2A 1PIV3 4LO8A 4IEVA 3JBG3 5FYTA 2PQSA 4BA6A 1GICA 3TOJA 4QGLA 3WNKA 2CYFA 4CDXB 5J37A 2JKBA 5FYUA 5JVVA 4YNIA 4BOWA 4GB31 1DDLA 3ZMOA 4LIUA 1LOGA 2VOKA 4IGPA 5F39A 3THPA 3RZHA 1F4HA 1RTVA 2WFF2 1QJU1 3ZN6B 3IM0A 3RWNA 4W8JA 1DZQA 3MICA 2HYXA 2RE9A 1WCDJ 5JOYA 1JHNA 3RMYA 4KNCA 3PIGA 4N9IA 2JE9A 2VZRA 5FZ4A 4Q4V1 5EYYA 2VUAA 2ZGLA 2YFZA 2OT7A 2WR9A 3OGSA 4AVVA 2VC9A 3HN1A 4XFBA 4CU7A 1IS6A 1PM4A 3FMGA 1G8WA 5TSWA 5F5IA 2A6WA 2ZX4A 2IXCA 4H14A 4XOGA 3ZXJA 2C9AA 5FZ8A 2W5FA 1K3IA 4JHZA 4ZZ8A 2X5IA 2ZX3A 4OZXA 3HQUA 5A7SA 1RUH1 1AR93 2R0FA 2XLGA 3N3HA 3PVNA 1O3SA 1ZNPA 4PDWB 3UGFA 1UAIA 1LHOA 3ACGA 4XF1A 5FY7A 1JU4A 4Y1VA 2V4VA 2HWE1 3TBDA 1JMUB 1I3HA 3EMRA 4JKKA 5DDJ1 1QNWA 3USSA 1PO21 2ARBA 4CUBA 3T2PA 2CTVA 4RFRB 5IT6A 2RR13 1CAXA 4ISRA 1RUG2 4XHXA 1GANA 1YXWA 1GZ9A 4RQPC 4UBGA 3V0AA 3ILNA 3LEKA 3NNJA 3TN91 2B9VA 4WV8A 2CWMA 3UYJA 1DGRA 1UWWA 4NWVA 4PLNA 3HNYM 5EXOA 5A6QA 1BXHA 3R4DB 1WA6X 3WQ1A 2AREA 4CXWA 5CFDB 1JYXA 4XUNA 1WW4A 3PUIA 4QHOA 2JG9B 4Z2WA 2BGPA 2IVJA 4Y24A 1X8EA 1VBA2 4QX3A 3AXEA 3CJIB 1ND3B 3ASIA 4DFSA 4IEUA 2HWD1 5FYCA 3KV4A 3VBOB 5FY4A 2E51A 1UY2A 4RGAA 4BLJA 4ZU7A 3FFQA 3NNFA 4Q0UA 2ZACA 3THDA 4FPCA 1H2LA 3VZJA 5BY5A 1VRH1 4CE8A 4QM9A 1WKYA 3O1SA 4IGOA 3J9SA 1XPWA 3J8F3 1RHI2 3N7LA 1IQDC 2CGOA 4CP9A 5HPOA 3IBMA 4HN0A 3I59A 3VL8A 3OBRA 5JSRA 4FOWA 1RUNA 1V6JA 1AZDA 2OXBA 3S7EA 5L73A 2HWB1 4NIAA 4LKSA 3V65A 3VZMA 1RUJ3 1O5LA 3C8XA 1IOAA 4NOTA 5I8YA 1VBD2 1S2BA 5K9YA 1R082 2R043 4AAPA 4QXHA 5A32B 4MX3A 2UWAA 4AI1A 1WLWA 2RHPA 3DCQA 1RUF1 3HD8B 4WVVA 3WDWA 2HKXA 4SLIA 1NAEA 3JCIA 1AYM1 2DU1A 4RQPA 2B9UA 1FXZA 3T2TA 2VXRA 4X8PA 4NVPA 1MZEA 4NIHA 5C33A 1IS4A 3T1LA 2VNRA 5CKNA 5J48A 3B69A 3O12A 3FUOA 3RI8A 5CNAA 2JDMA 4DO0A 1WMFA 1NA1B 3WW1A 4B29A 1BCXA 3IKWA 4NIDA 3AVSA 4XFCA 4AWDA 2Q30A 2CDOA 3OYWA 5AFBA 5AVAA 2PHUA 1S0BA 5C8WA 5DZGA 4UF0A 4P08A 4XF0A 2BFUL 1MS9A 3UT0A 3H1WA 4CUAA 4P5HA 3ZYGA 1NZIA 1W6MB 1YLLA 3POBA 4WM7C 3ZR5A 1STMA 2ZHKA 3CU7A 5GJ6A 1LHUA 4IV3C 4H3WA 3OTFA 2NZ9A 4AVBA 1OA4A 3N9NA 5EHDA 3RQ0A 2WO1A 1AJOA 1IG0A 4Y5SA 5FO7B 1IG3A 1NE4A 5FBZA 5L9RA 1ZRFA 1H8TC 2WT2A 1F5FA 2VQUA 1LOFC 4L11A 4CP2A 4KBBA 1HN1A 1YI7A 4XTPA 3AZYA 4LBQA 5E89A 4PI2A 2H0VA 5KC6A 3BALA 3MI8A 3RSJA 2XQXA 1VJ2A 1OI6A 4CEYC 4G4FA 2TEPA 3B02A 3MIEA 1FMD2 3NNLA 3CBNA 1AR73 4LXLA 3WVJA 1POV3 5JXGA 3H42B 2WO7A 2ZTNA 3L2HA 1HRV2 1RINA 2G9FA 4Q0PA 3N35A 5F5AA 2WDBA 5FXZA 3Q8FA 1MS0A 3WX5A 2RS51 4ISQA 3UGHA 1DQ5A 4QQLA 1QQP3 3KT1A 1RITA 1ZRIA 3WF1A 2BPA2 4FPYA 4XEZA 1O4TA 1QOTA 1US2A 2DTYA 2ZMLA 3AL5A 3KZ4C 4LHKA 3BIEA 2VW1A 2JDZA 1PVC3 1QOOA 2BVVA 3B00A 5DAPA 2WS91 5BNPC 3NKGA 2JDYA 3FZ3A 1V0AA 1GP4A 2GC2A 4BJ0A 4OLLA 3I3DA 2AENA 3DGTA 1UPSA 5FOJB 1S2EA 1ZA7A 3HNMA 4PT6A 2OW4A 2VNGA 2XQRA 5DUUA 4AF9A 4WM7A 5E6HA 2HLEA 1FX5A 1V6KA 2EALA 3D0JA 4AI8A 3HBZA 2ZHLA 3IPVA 5FJHA 2XHNA 3ORJA 5LASA 1W6PB 4LLFA 4CP0A 3E97A 5EJ3A 5LY1A 4CDWB 3C7OA 4O61A 4KBZA 2V09A 2L9LA 3I2DA 4CDQB 1SLLA 1LOFA 1UXXX 4MZUA 3K46A 3BODA 1H2MA 3N9LA 1O3QA 4QDSA 4CTEA 3RPQA 1EAH2 1A8DA 4OHXA 1TMF1 3HBKA 5E88A 4ZU4A 4GMP1 3HQRA 4B4PA 1A78A 3U11A 2A6VA 3WV6A 4UWDA 3RZGA 5A1LA 3MIGA 2XHKA 4GA9A 1ENRA 3ZYRA 3JD72 4XBNA 4XJ9A 3WDUA 4COYA 4JKLA 3ENRA 1S0GA 1VBC2 3MYXA 4LK6A 2MEV3 5A33B 3AJZA 1HIXA 1E5HA 1R1A2 4LE3A 3ZSKA 4PLOA 2VO5A 5FR3A 5FDBA 2B45X 5L9VA 5BNPA 4YVWB 1QJX2 3MIBA 4LLOA 1O3RA 1UCXA 1EUUA 1TNRA 3NJZA 3VD4A 3C2UA 3ETQA 3OOXA 2VZUA 5B4NA 1PK6B 4FOQA 4JGZC 1BVVA 3D4KA 3P6BA 3BYWA 5J3UA 1H6XA 3J26N 3PVOA 5FZDA 5KXCA 3WNLA 3O14A 2IFRA 1TME1 4RR3B 5CG9A 3WQ0A 2DCYA 2IFWA 3ZYBA 1G9FA 1WCKA 5KBFA 5FLHA 2R16A 1PHMA 4AEDC 4O65A 5GKAC 1MEC3 2UWCA 1X82A 4NRPA 4PIYA 5A7WA 3AJYA 3W58A 4LBQD 4LEJA 3I7DA 5LA9A 1DYOA 2DVGA 4BIOA 3MLJA 1VMJA 4D69A 1OKQA 4GH4C 4R4ZA 1JS9A 3RI9A 1DF0A 4PDWC 4AR2A 2IVIB 4PIXA 1Q43A 4ATFA 1QXRA 1RVF2 5A3OA 2DVDA 5A3MA 5LK7B 4XTMA 2CHHA 3OD0A 3BI3A 2YUEA 1AVBA 2YFUA 3HN3A 4MADA 5LBEA 2QZ2A 1XOYA 3MIFA 4NRQA 3ILRA 1XNCA 4BXSV 2P5BA 4IEOA 4Q4W2 4A7YA 4YSFA 1AXKA 3AYDA 1HX6A 2FBEA 4UOJA 1V6OA 1Q56A 5K7PA 3KT4A 3M3QA 4V2VA 5CFDC 5LA0A 3ZPYA 5F3CA 3POGA 1ZBA1 2JG9C 5ANQA 4QU2A 2RM23 1Q8QA 3OBTA 2PHWA 2Y6JA 1PNFA 3B7MA 3P1IA 1BZWA 3WNOA 3GZTB 1BVP1 1RUC2 3OY8B 2RJKA 3ZN6A 4AVCA 2WO2A 3J7MA 4AGRA 5FZCA 3HT2A 3AP4A 5AC92 2QQLA 4AFCA 3LFIA 4FPHA 3LQCA 4ARXA 4M01A 1O8PA 3ROUA 4XFAA 2Q1FA 2VVFA 4TZDA 4P5YA 3O1UA 4AQ6A 1BEV3 1AXYA 5DAWA 2HJIA 1RUI3 3PTYA 4DY3A 1PZ8A 1SCRA 2CGPA 1PZ7A 3ZLIA 1AL23 3WZ1A 1MZ6A 4PQ9A 1PIV2 2YROA 4CCKA 2ZKLA 3GYDA 3JBG2 4IETA 4QGMA 5CU1A 1G86A 4ES8A 2CAUA 2G4IA 1XRUA 3SEPA 1RUE1 1GP5A 1GQHA 1GNHA 4Q4X1 3VKMA 4PDWA 4IW3A 3NAPC 3ZXKA 3VD5A 2AR6A 4Q26A 4C0BA 3USUB 1PZ9A 1ULOA 4OI1A 3RJ2X 2GP5A 4XJAA 3K48A 5FYVA 3ZSJA 2ADEA 4INDA 3POEA 3WNNA 1SLBA 1OF3A 1BBT1 1QH6A 1WCQA 2V5DA 4ONUA 2EXIA 4XUTA 1SBDA 1WD3A 3AMMA 2EAAA 2VTXA 2E63A 3O1VA 4L2NA 4XBLA 1C4RA 4F83A 5CFDA 3ZYHA 5DAVA 4DRVA 2JG9A 3KCYA 4KG8A 1ZRDA 5JR2A 1Q8VA 4SBVA 4P9LA 1NA1C 3MW2A 1UKRA 2AACA 2XJSA 4RHV3 5DQ0A 1W2AX 1MR5A 2C9KA 4GWNA 2IXIA 3CJIA 2JX9A 3HMYA 5FFOC 1G9AA 4FAHA 3BKZA 4O9EA 3VBOA 3VKNA 1AR92 4AVSA 2WN2A 3LWCA 4K9SA 4CUCA 5FCCA 3OGGA 2O0OA 2ZGTA 2VOXA 4Y22B 3THCA 3S7IA 2LALA 3ES4A 1VBE1 2LUWA 3TNPB 1OPMA 4EWAA 1LU2A 1D2QA 1UYXA 2E32A 4RGGA 4XETA 3T2QA 2RR12 2UY9A 4OUMA 5HCBA 4FOYA 4TWTA 4EN7B 3WG3A 3WCSA 3RNSA 4K1YA 1ULGA 2WNOA 2BDRA 4M3CB 3AKRA 2RDQA 4COWA 2R061 1JZ4A 2GNDA 1AJKA 4GULA 2VOVA 2PLV1 4XF9A 1JI6A 1QJU3 4I0WB 4YW5A 3H8RA 2DWRA 3OSDA 4DUVA 2PMWB 1SFPA 4GIQA 2PHDA 3C3VA 3FBMA 4EE2A 2JDKA 3MFAA 4JVAA 4Q4V3 4COZA 3EBRA 3LA7A 4BE3A 5DMYA 3N9OA 3BPSA 3IDAA 2OUHA 3HWJA 3S5QA 1S0DA 1OUSA 2R32A 1UD1A 2BYVE 4Y4YA 1J1TA 2D97A 5FMOL 3RYKA 1SBFA 4E4HA 2BWAA 2ATFA 3N9PA 4QX1A 1NA1A 3NNMA 2Z69A 5GM0A 2LW8A 2FDIA 1CX1A 4FP3A 4D7SA 1MS1A 3WUDA 1UY0A 3S0MA 5C8CC 2GSYA 2VCAA 4NIIA 1UL9A 4E27A 4MO3M 2R042 3VBRB 4QMAA 4H7LA 1O59A 4OHWA 5EP9A 5FMDA 2ZS6B 1MS4A 4BU2A 3NVCA 4HSJA 2QE3A 4LE4A 5JSOA 1U0AA 1HB1A 3OEBA 2KXLA 5J96B 2FD8A 3NNGA 4PHZA 3O5SA 2VMDA 3NV2A 2GC1A 4CDQC 3SNMA 4E8CA 1GQGA 2VZQA 3GHMA 2XONA 4CU6A 1G9BA 4PJYA 1I9RA 1W04A 1DIWA 1DZRA 1HDKA 3VZNA 3WF2A 3IDEA 5F1RA 2HWD3 1HRV3 5D8AB 1L3JA 4UW6A 1W9YA 2OQ7A 3K77A 2J42A 3KV9A 2C26A 2G9GA 3QLQA 3SCHA 5IATA 1DFQA 4GWMA 5FYIA 4MSVA 5CKMA 5DG2A 2CY6A 3LSDA 5IAVA 4F3JA 1W99A 5DUXA 1TEIA 1W8UA 3BPZA 5HXMA 3ST7A 1H4GA 4OI4A 4M3CE 5A6YA 3PUAA 4RSUA 4GKXA 3ZIWA 5IVCA 2FDFA 4Z92B 2W91A 5LY2A 2HWB3 3SHRA 1OPOA 1KDMA 1Y43B 2QJVA 4FFGA 3D82A 4HXCA 1A3KA 5K0UB 2F6BA 1UMHA 4AG4A 1ZZBA 3BU0A 4V1PA 5C8CA 1HQWA 1ZZ8A 2E7TA 1DBNA 1PK6C 3FHAA 4Y1XA 1QY4A 5IWFA 1BYHA 4IESA 1GZTA 4AK3A 5I93A 1RUF3 4OMDA 1LNSA 5L19A 2ZKNA 2DCZA 4R9BA 3WP6A 2NM1A 1AR72 2ETEA 3WQBA 3MV11 1GMMA 1QXJA 3LCPA 3L9JT 4IXLA 4RR3C 1W6PA 3O7OA 1NY71 2W1SA 1HN0A 1W2NA 4S2FA 5LA2A 2VMIA 3MEPA 4LNVA 3WG1A 5FYHA 1IS3A 1YIPA 1W8NA 4LORA 4U36A 4CDQA 4CUGA 3PUSA 2J22A 3S6PA 1KS5A 1QQP2 4M00A 3JB8A 3ZXLA 3MW4A 2NMOA 2GAUA 5FO8B 1LJ7A 3AMHA 2RMU1 4IE4A 2VW0A 2Z5WA 3FLTA 3CZJA 3RJRA 4IEZA 3ZXGA 1PVC2 4E4SA 2Y33A 3VHPA 1MS3A 1L7LA 4QXCA 2BGCA 1NXD1 4NUBA 1ULCA 1W6NB 3K3OA 4JTOA 4LBLA 4ZS2A 3H7JA 1VBC3 4HANA 4Q29A 2HWF3 2WINB 2X53S 4NRMA 4IV3B 1PX3A 1JOBA 2WAOA 1SACA 1XB9A 3PJQA 5A33A 3S30A 3ZMNA 5M0TA 4IV1C 2KR2A 5CZKA 1QJX3 4OI2A 2VMHA 3ALQA 1H8TB 2ZX1A 4D6RA 1YCIA 2VW2A 1HQNA 2XWBB 3ECQA 1K5MB 1DYKA 2J1TA 3LD8A 4FVVA 1FV3A 1JW6A 4XQWA 4XF4A 1F35A 5DZFA 1CWPA 3WDTA 4CEYB 1LRHA 4CVUA 3LEGA 2VMCA 5GZGA 4P9YA 1PK6A 4FPEA 4A6OA 3D5OA 4P9WA 5T5PA 3DKWA 5CBLA 4YW3A 5A6ZA 2D6MA 1LESA 3NW4A 5FAXA 1OQEA 1YO8A 3THTA 1UIJA 4NMIA 4RR3A 5GZFA 2RS53 1FI2A 5BNQA 4GWIA 2ZGSA 3W59A 1V9U1 4F7ZA 3SQOA 1PM7A 4WM8C 3FN9A 1DQ1A 2VZ1A 5AVPA 3CLPA 5H9RA 5EQUA 2Y60A 2MEV2 2H6BA 2VXJA 3T30A 2WS93 4EN8B 4YW7A 1NG0A 2DFBA 4I0BA 4Y5Z0 5BNPB 1UU6A 2JDHA 3LEMA 2NMNA 3O1OA 2VZTA 2PAKA 3IZOA 3OBZA 1OD5A 3T3YA 2GC3A 1ULEA 5CIRA 4PF5A 3RS6A 3VZKA 3WW3A 4TTGA 3JU9A 5C3PA 3ZFGC 3BCWA 4QPIB 2SBAA 3H1YA 1WBFA 4FXKB 2ZGMA 3KQRA 1ENSA 5HCHA 2JE8A 4DQAA 4FPKA 3W20A 1YNAA 5DG1A 1K45A 2EIEA 3FBYA 2AGSA 3WSOA 4LO7A 1BJQA 1J84A 2F4PA 1NOVA 4QX8A 4YFZA 2P6HA 3U10A 3DYOA 2J1VA 4P9IA 1OLRA 2GMEA 5ACA2 1QJY1 4N7IA 1U12A 2DF7A 1GV9A 3C7FA 4W4ZA 1MEC2 2OA2A 5T54A 3MO4A 1TMF3 1GNYA 2V5YA 5JAXA 4GMP3 1Z78A 5JPNB 1C8M1 5IVJA 4CCLA 5A3LA 5F3GA 2D5FA 5FBJA 4FTEA 2ZAAA 2WZEA 4R9CA 3S57A 4HLTA 2DURA 2A75A 4L92A 1K42A 1PMHX 5FPBA 4ZY9A 2A7AA 5T50A 2W3JA 5FMCA 2XJVA 3GBFA 3HIFA 3OB8A 4QPGC 2D6PA 4HL0A 4YM3A 5JI9A 4MYEA 1WBLA 4JC1A 3GNEA 4QX5A 4N90A 5A3PA 4R4XA 2EICA 2Y8KA 2A3XA 1NLSA 2VBPA 3ZXFA 3IAPA 4EV0A 2XDVA 4Q4Y1 5KXEA 2X10A 3PDQA 1OVPA 1IPKA 2AH2A 3KVAA 5CB7A 4B1LA 3WOGA 4CCEA 1V6NA 2RM22 4AHYA 1DQ4A 1JHJA 3SKVA 3USUA 1HQLA 2W1WA 4HZFA 1SZBA 4TXWA 4JGZB 3I49A 1PX4A 4ZS3A 4GJZA 1ZZ7A 1TME3 3ZDVA 1UX7A 2YC4A 3R05A 2ZX0A 3KD4A 4XC9A 4MOAA 4CCMA 3RYPA 3ZSLA 1BEV2 4AEDB 1RUI2 2QCSB 2JD9A 2V73A 2YGMA 1X7NA 3KF5A 4AHZA 1AL22 2RS11 4YM1A 2HBTA 2MPFA 1DHKB 3OPTA 4CU9A 2WWUA 1CVNA 1E5RA 4FPJA 5B4XA 4GH4B 4HPKB 1X33A 2VMGA 2JB8A 1COV1 3ZPOA 3T4VA 2NYYA 1AR61 1U5ZA 3N9QA 3VBRC 3K3NA 1JU3A 3WXPA 2Q1ZB 2VBDA 1REEA 4LBJA 4Y3OA 1TG7A 4Y22A 1DGWA 4QPGA 5FYBA 2X8KA 4QHBA 4URAA 2W94A 4AI3A 4QDQA 1C1FA 1I5PA 3PUHA 3POYA 4KU7A 1GWKA 4M3CA 4OUEA 3U37A 2P3IA 2WFPA 2FQPA 3BTXA 5I0RA 2VCBA 5LBCA 5HV0A 3PTRB 4R8HA 5FUNA 1SLIA 2WL1A 5FYYA 2GNBA 2MNGA 1RIRA 1W0OA 5FZFA 1XU1A 3NWKA 4M4RA 1PVXA 4NAOA 5A1AA 5FUIA 2BZDA 2Q8OA 5D8AC 5KXDA 4EN0A 4RHV2 2X05A 1H0BA 4QPWA 5CKQA 4N7UA 3T09A 1EV11 1UZZA 3DUIA 1E5SA 1QNYA 1KFUL 1Y9MA 3FLPA 3N7JA 5C3SA 2VJXA 4K21A 2E7QA 1HV0A 4K6BA 2TUNA 2PN5A 4KWLA 4IEXA 4QB1A 1RUOA 2A70A 3R0RA 3VBFB 2FDJA 3JZVA 4AFDA 5F2WA 3NMBA 4PIZA 5F2SA 1HV1A 1WGPA 2ZXQA 4MHUA 1H2KA 2BUKA 5GALA 3SITA 2VL4A 5J09A 4BQ5A 2QQPA 1YIFA 1OD3A 3MPPG 4GB32 5K0UC 2ZEXA 3PU8A 5T3NA 4XQDA 5KHJA 3NAPB 2VTFA 3BOWA 4B8EA 1QJU2 4HONA 1H6YA 5I8SA 3VBRA 1POV0 1W9FA 1O8SA 1RUD1 2JG8C 1BBT3 5CADA 3ZR6A 3N9MA 3CZUA 2VZSA 5FY0A 4Q4V2 4MGIE 1LOBA 1XNDA 5IYYA 1IGOA 1MZFA 1W0PA 3OJBA 4PCRA 3CJXA 4RFT0 1MS5A 4I3PA 3GJAA 5LCWL 4QKDA 5JSPA 2KM2A 3AVRA 2D6KA 1MS8A 1KEXA 1JZ6A 1BLZA 2DVFA 5FJKA 2C6SA 2EAKA 1REFA 2DUQA 1QJZA 4DMIA 4A45A 2QQNA 5D8AA 2OKXA 4WVWA 3ZYPA 1RUH2 4CCDA 3P3NA 1NCRB 5FWJA 4URTA 2QNKA 2YZ4A 4DRRA 1ZREA 1FOD1 1IPSA 2Q5TA 2WAAA 4KWKA 5FPXA 1PO22 3B01A 1CZSA 1JZ8A 2PFWA 3IIIA 4ZXEA 2R071 3DL3A 2K2SA 5F32A 3BTYA 3NV3A 4YW6A 2VZVA 4PF1A 3UV9A 1W03A 3PIJA 4IE0A 2P34A 3MUY1 1LGBA 1KGYA 1JOPA 5GZCA 1JUIA 2NPIA 1K5MC 2R063 4M0HA 4DXZA 1S55A 2BOIA 1PO11 2PLV3 4YG6A 3ACIA 5K0UA 1G9DA 4CXYA 4JKMA 3B3QE 4M3CF 4COVA 5A3WA 5A3UA 1K5JA 2PAMA 2W1UA 1TNFA 1QF3A 3MF9A 1ZVFA 2YBSA 2JG8A 2HWD2 1NXMA 1S0JA 1YEWA 2D43A 1FPN1 4OZOA 3JQWA 1QJEA 1XE0A 4HETA 3VUOA 4JDNA 5JMOA 4DOUA 2J1SA 1XNBA 4NHYA 1Y9GA 1GKBA 1VRH2 5FK7A 2BEOA 1DQ2A 3AKPA 1GFF2 2ORXA 5KC5A 4Q2FA 5F3EA 3T0AA 1ODNA 4AI9A 1AR81 4BQXA 1W39A 2XL9A 1XBFA 2IXLA 4EQVA 4JTNA 1AUYA 1RL3A 2HWB2 1FV2A 1C1LA 4QX0A 3BTZA 3V0BB 4IEPA 5C8CB 4DS0A 3WG2A 1W6NA 4QPIC 1AXZA 1IKQA 2NN8A 5JMCA 1UZWA 3E6BA 4L97A 3TAYA 1CPMA 1HKDA 4IV3A 5C7GA 1RUF2 2Y38A 1D4M1 4LUKA 4LMFA 3T2OA 3WF4A 4AOCA 4EYUA 4I2OA 1O5UA 1ASJ1 2ET1A 3V64A 2ZZQA 5EJZB 5A7OA 1AYM2 5EZWA 2RDNA 3APBA 3AL6A 2QZ3A 1H8TA 4QKBA 4AE2A 4FAGA 4Q0SA 5J98B 2FDHA 1K5MA 3UJOA 4IERA 1DG6A 5FV3A 4KWJA 4NAMA 4E2GA 4NPMA 4CEYA 1CESA 1H1MA 2YBPA 2V4AA 3PHMA 2BP6A 4QWNA 1HRI1 4BHPA 3EYPA 4DXRA 2CWSA 2WIIB 2ZHMA 4TYSA 5BV6A 3KV6A 2FDGA 4CSWA 3NKTA 1PGW1 1Z7S1 2J1RA 2JEMA 3ME2A 1AX0A 1YYNA 3I2IA 4AZZA 3ABZA 2VVEA 2CL2A 5BYNA 2OVUA 1IHMA 5L7OB 2IZWA 1A6CA 4Q1RA 1VIWB 5KHIA 3O1TA 2HWF2 1VMHA 2HYKA 4AQ2A 2OZJA 4JV4A 1CAWB 4QX7A 4FQ4A 5JCTA 4P9JA 1S4CA 3MLKA 5IVVA 4Q27A 4QHZA 1RUC1 4KGQA 3AYEA 4I01A 3C7EA 3OPWA 1OBNA 2PHXA 2Q8EA 2Y6FA 3J7NA 5KR7A 1QHDA 1W05A 2VPVA 3H7YA 2GNTA 2SLIA 3UJQA 3HPNA 3NV4A 4RA0A 4YGEA 1APNA 2JDPA 2O8QA 2XB6C 4CRQA 1UO9A 4CYDA 1RJ8A 2DTWA 1C28A 1RYYA 2XGXA 4QPIA 3VDDC 4BDVB 2EXHA 2VG9A 5FQ0B 4JDMA 5BNOC 1MQTC 5EJ1B 1D2SA 3ZVXA 1SDWA 4QPYA 1I1EA 2CV6A 4QT6A 1DLCA 4N43C 3JBG1 2VCCA 4R52A 4XE9A 4K8RB 2RS52 5FZBA 5ACA3 2OQ6A 4IUGA 2HEVF 3ZFFC 1DGLA 1QEXA 2H6CA 4Q8LA 3SH3A 5HCFA 2ADDA 1H9WA 2IWGB 2RMU3 3IN9A 4PQQA 3VD9A 4HVOA 2Y0OA 3E5XA 3A23A 4BCUA 1ULPA 2WS92 4YZ5A 4H55A 2XPJA 4F8AA 1GUIA 1YHFA 2BRTA 5ABJC 3MFCA 1YWKA 2IUWA 2W08A 1ONAA 2XBO1 4YVSB 3U75A 1YC61 2C5DA 5D2AA 1BMV1 2O8OA 4MGTA 1E5IA 3E6CC 3PU3A 4CZSA 1ZBE1 2XOMA 1HB3A 2JENA 2Q1MA 3I4IA 3MW3A 1JZ7A 1NYWA 1Y3TA 3H3UA 2HWC1 1OA3A 1OC1A 1SQ4A 4YARA 1XNAA 4IV1B 1UYYA 3QACA 4CCNA 1HXS3 1BKZA 5LW9A 3O1PA 2P2KA 1KITA 2A5ZA 2OUJA 2A73B 2QUOA 2WBKA 2W39A 3VL9A 1VB4A 1PGL1 2YB7A 4BH9A 2LROA 4Q0QA 3HNBM 1NQJA 3Q8AA 1J1LA 4BM8A 3CMGA 3SCFA 2BNNA 1FNYA 5FUPA 1GP6A 3TEZA 3JUUA 1OH3A 3UKVA 3A21A 1W8ZA 5HBAA 4JGZA 1TMF2 1RMU1 2K9ZA 4XCAA 5FXWA 5CISA 3GJBA 3ZKYA 2A6XA 1MQTA 1VMFA 1WCUA 4HFSA 4UAPA 3LF7A 5DXDA 5DAQA 4TN7A 4B4QA 2F4LA 4XFGA 4N43A 2XKOA 1SDDB 5C71A 2VH9A 4H2AA 4BYYA 1YQ5A 2BBAA 1WA4A 1NLQA 3W9AA 4AEDA 1HB4A 4WM8B 3VBFC 3PVBB 2ZMKA 1XE7A 5D21A 3LPFA 4J1WA 4ZKTB 3J7HA 3POFA 3SKJE 4D7TA 1LHVA 5CA6A 5DAXA 3ILFA 2AEYA 3GM8A 1NUKA 5DUWA 4GH4A 1UYZA 4HPKA 4HKWA 1G6NA 1LENA 1FNZA 2VBBA 3H0OA 1UQXA 2CGNA 1SLTA 4LOSA 2BWCA 2GC0A 3CEWA 5FYZA 3T0BA 2GH2A 3CIHA 1ND2B 4D6QA 4RYDA 2YU2A 2JWPA 3PURA 3ZFGB 3VDCA 2YYOA 1DYPA 3P5BA 3ACFA 4FBFA 1YJKA 3ZN4A 3EQEA 2VQAA 2J7MA 4XW3A 1SMVA 4HVQA 3Q8EA 2A6YA 4XXAA 4Z8BA 2ORZA 3J8F1 1TME2 4A4AA 2XVLA 2E33A 2LRPA 2XJPA 2D3SA 5FXVA 3AZVA 3KM5A 3QD6A 1CJDA 3HT1A 4HMZA 4K1ZA 5FZ3A 5L9BA 2XLAA 3NSTA 2DUPA 3A7QA 1F31A 4GKYA 3IMMA 5FZOB 3RDIA 2WWSA 1ENQA 1GLHA 1RUJ1 1UNBA 3LDRA 2FCUA 1CX4A 1YI9A 1C8M3 1N3OA 3KB5A 1B09A 3M70A 1NCRC 3JB4C 4QGNA 1AYN1 4UI9L 3VBUC 1OHFA 4EWEA 1JODA 5LEJA 5FZEA 1OOPC 4Y20B 4BWOA 2WC2A 4C8DA 5C4WB 3VHNA 5FYSA 1XNTA 4P00B 4QPGB 1JYTA 3KVBA 1ENXA 4LO6B 5T55A 3VBFA 1LHWA 2Y6HA 3HR9A 1UYPA 4I02A 5FZIA 4ZPIA 5FZMA 5IW0A 3U78A 2RS31 2Y6GA 4Q4Y3 1N1TA 1UOBA 3FHIB 1Z0HA 3K51A 4GB33 4XACA 4EN9B 5LZ6A 1OVSA 2W68A 2ZA9A 4JRAA 4XIKA 4IQPA 1QDOA 1ZBA2 1W06A 2JDNA 4AHXA 3NAPA 4XF3A 3TB0A 2W2IA 1AF9A 2BGOA 3FE5A 2X09A 1LOCA 3OUHA 2VUJA 2IXJA 1YQ8A 1JXNA 2AUYA 1KRIA 3OUIA 5F5CA 3UNPA 1V6IA 4ZONA 4PBOA 2ZEYA 3WNXA 4BQYA 1GR3A 1UY4A 4A3ZA 2MHFA 4QQ2A 2HEYF 3KSCA 2IXHA 3L2YA 3KMHA 4XMIA 4HG6B 4LIVA 1R091 2FMYA 3BGAA 3DXTA 4AL9A 4MHRA 4XZPA 4H7MA 2LM3A 4I0AA 4LHSA 3VBHB 3POIA 1LCLA 3WF3A 3N36A 1XU2A 3DEMA 4LTAA 2CNAA 4A3XA 2Y6KA 3OBAA 4EN6B 3LZZA 4XVHA 5GZDA 3MZHA 1RUH3 4MV2A 1W8WA 1YFXA 3BTAA 1COV3 1RUE2 1JOJA 3QH6A 1KD7A 4Q4X2 2HWE3 3WCRA 3D0SA 1NCRA 5DDJ3 1AR63 3EHKA 1PO23 5FY1A 2BOJA 1XC6A 3TRSB 5T5LA 4XUOA 2YC0A 3LIGA 3RG0A 5ISLA 1OOPA 3HQXA 4YW2A 2ES3A 3BN6A 1ZYBA 4I30A 3TYJA 4A42A 2WLPA 4LOTA 3TN93 4JGYB 1BBT2 1OFSA 2QDNA 3MGUA 1O4ZA 5FZHA 4XCBA 4GALA 4XJZA 2K46A 3W5NA 1V6LA 1VBB1 2FHRA 2JIJA 3I2JA 3UL2A 2ZJCA 2ID4A 4HVRA 1ODMA 2XUMA 2YPDA 3AMNA 3RRDA 4XBQA 4UFIA 4C1XA 1WD4A 3AKQA 2IC1A 4DXTA 1C5IA 1JYWA 1XXNA 2WNUB 5F6LB 1NQDA 4JAAA 5FZGA 4AQSA 2Y26A 1X50A 4XUPA 4LR4A 1EV13 4MH0E 2DUOA 5A7QA 5IVEA 2E31A 5FMBA 1FATA 1WZXA 2P3JA 3J7LA 4BMBA 1VRH3 5L7OC 1ZZCA 3T0DA 1LEMA 1IS5A 1QU0A 3H50A 5FP3A 4LULA 1H30A 4QQOA 4YZ1A 3OEAA 1Y9QA 2Y64A 4IGQA 5KHHA 4MUVA 5K8SA 4LBMA 1UPIA 2Z4FA 1GNZA 1XQNA 2YPJA 1EY2A 1EPWA 1UW8A 3OCPA 1YQ2A 2R062 4BQ2A 3V0BA 1CN1A 1IKPA 4K7JA 2PLV2 4Y1YA 2ZX2A 4JX0A 3AMPA 3FL7A 2KA3A 4Q8KA 5FPZA 2JG8B 2PXJA 4C90A 1M06G 4K8FA 3TEXA 1AYM3 5A6XA 5B2GB 2AYHA 2WSVA 3GF6A 3V56A 1DU3D 4Q5OA 4QM8A 2FCVA 3R6SA 4YYOA 4AI0A 2YGLA 4YGDA 5GLWA 2RDRA 1GOFA 2DCKA 4NHKA 1ZRRA 2WQZC 4QKFA 4MGKE 4AEMA 2UY8A 4XDOA 4BPZA 1ZRCA 1NCQB 2RJLA 4DINB 1F5JA 4IEQA 2C24A 1I6XA 4R9AA 4UW5A 4XFHA 5GLUA 2ZGUA 5BUVA 3TEWA 2WA4A 3EB7A 3BU7A 1GWLA 3P3PA 2XWJB 4JCKA 5H9QA 5DUVA 1WMEA 4B7KA 2BTVC 4ITCA 4YVSC 5SV8A 1W2TA 2VNVA 5A3NA 5L36A 4C1WA 4LBNA 1PNGA 5FREA 5LK5A 1FOD3 3MPBA 2VULA 2WYFA 4YW4A 3DN7A 4AVAA 2FCTA 4LO4B 4QX2A 5C3QA 2EIGA 2R073 5L7OA 5FTTC 4XILA 4FFIA 3I54A 2BERA 1MVQA 1CAWA 4QD2A 3U07A 3WINE 2GU9A 1W8HA 5E1RA 2PHLA 1N3PA 5C9AB 3M8LA 1ST8A 2E6VA 1PO13 2QDRA 1KXGA 2ZGPA 4U2AA 4E4ZA 2ZGQA 4KMQA 4FTBA 5FPLA 1D4VB 4PLMA 1FYUA 1F15A 5JPMB 2ZMNA 4LK7A 1T2XA 1YFWA 3LGRA 4YLZA 2QQKA 3INAA 4RS5B 4Y1UA 4GMP0 4FFHA 4W6WA 1XYNA 2RV9A 2WZR1 5FQ0A 5JZGB 1M4WA 2LTNA 3AXDA 1TQ5A 3I3BA 2VM9A 4QKNA 1FPN3 2J1UA 4KI5M 4O7XA 3U4SA 2D6OX 3KV5A 3WP5A 1WMXA 2D3PA 2D98A 2GN7A 2QBXA 4K40A 4X6RB 2VNOA 2JIGA 5LWBA 1ZA4A 4XXPA 2WT1A 5J7MA 1V00A 3T08A 4FPLA 2Z2SB 5G04L 4EZHA 4TLFA 5JXHA 2VUDA 3VDBA 3AP7A 5CFCB 1NX9A 2WFF1 1S1AA 2TBVA 2XL7A 5EWSA 4HKOA 5JLVA 2D93A 2VR4A 3WP4A 5A70A 3O0XA 2UU8A 3PMEA 3DF0A 2JB4A 2G9ZA 4YVSA 5ERLA 5A7PA 1A34A 1ND2C 4W65A 5FPAA 1C5HA 1J3RA 1S2KA 1S0CA 4KGGA 2XMLA 3I2OA 1D4M3 1RUI1 2XKPA 2W46A 1E57A 1UOGA 1IPJA 2XJQA 3R4SA 4GXLA 5KHKA 1AL21 3CO2A 4IE7A 3B9CA 4IV1A 5FOBB 1LAJA 1ULFA 2UURA 4NHLA 4YG3A 5H9SA 2DCTA 5E16A 1HJFA 5IJRA 1LHNA 3U4XA 1QKQA 3AZZA 1D0HA 1QH7A 4JQTA 1GZWA 3B5LB 2B46X 4BK5A 4FO9A 4MGYE 3IMNA 1KDKA 3KCXA 2YG0A 2RMU2 1NE6A 3LEIA 4LUMA 2JE7A 5D1IA 4AGVA 1W6QB 3HVDA 2XG3A 4AI2A 3HOBA 4J1XA 5HCAA 3ITQA 1Z7S3 1RUG1 2ZEZA 5LB6A 1LECA 2GH8A 1GYKA 2RVAA 1W8OA 3F95A 1QOSA 4MLOA 3JXSA 2JDAA 4Y26A 5FZAA 1N1SA 3AFGA 3MV01 5FP4A 3WNPA 5C4WC 3TEYA 4G9SB 2XXZA 4WM8A 4RD7A 4OULA 2VECA 1GBGA 2VE1A 2AZ5A 2UYBA 1VBA1 1KQRA 3FC0A 4JZRA 5JIAA 4BQ3A 1X9PA 2DBIA 1C3HA 1HXS2 2D40A 1NT0A 4C91A 4AFMA 2VQTA 1F9KA 1DP0A 1CGPA 2D6LX 3SH5A 1ND2A 2GN3A 2GDFA 1J58A 3VDDB 3I2GA 3ZFGA 1WUVA 4A2UA 4E4DX 5BNOB 2YC2A 5LATA 2WYSA 1MACA 1MQTB 1RHI1 2ZBJA 3POSA 4N53B 4NROA 3RZLA 1D7PM 3NQHA 2BU9A 3BOPA 5FZKA 3WUCA 3LIHA 4N43B 4HSLA 1XNKA 5DPNA 1RXFA 2PA7A 1V9U2 2QVSB 3B9IA 4HBNA 5EFUA 3W21A 3ZFFB 2QTWB 2PYTA 3VBHC 2Z79A 4BQWA 2D3RA 2QKDA 4XDPA 2DVBA 1EYBA 1VBD1 3ON7A 1SPPB 5FZOA 5FZ0A 1R081 2B39A 2WN3A 3C7GA 1UU4A 2CDPA 3FUQA 2VMEA 4CPBA 2ZGRA 1WLTA 2ZHNA 1DGRN 3M3IA 2ZPXA 3DYPA 4MXWB 5ABJB 2XBO3 3VV1A 4B1MA 1NLRA 3URFA 4QXKA 4LKDA 3UKTA 1X8MA 4P9GA 4AHWA 1IZ3A 1WCSA 1ZBE3 3LOIA 2E26A 3IDCB 3OG2A 5C4WA 4Y20A 2HWC3 1EPZA 3LB9A 4JDOA 4L99A 3AYCA 3K4AA 4XAEA 2Z42A 3WP3A 4JGYC 1L7QA 1H1AA 1SG3A 2BNOA 3ZFEC 1CR7A 3MIDA 1JH5A 3MLLA 5IVYA 3ZN5A 3SCGA 1ZBA3 4ORFA 4YZ2A 1SBEA 3ZM8A 5DZEA 1RXGA 1O7FA 5HXVA 4OCTA 3PUQA 4WZCA 2WNVB 1QJY2 5BPXA 5JOXA 3U0ZA 2ZEWA 3O1RA 1ZZ9A 4A7ZA 4OQ8A 1AL0G 1RMU3 2WNUC 4W50A 5GLTA 1S0IA 3CKHA 4Y33A 5FPUA 1C8M2 1W6OB 1FAYA 4FOVA 3WD5A 4CDUB 5I8TA 3I3MA 2B5HA 1ZZ6A 2XLFA 4P02B 1SCSA 5KWRA 1BK0A 3MBWA 5C3RA 3M3EA 1KFXL 4IEYA 1UX6A 5FRAA 1J83A 3KF3A 4LJHA 3DKQA 1O4YA 5C5UA 4LITA 4AFAA 5T52A 2YU1A 2A3WA 1H1IA 1UZYA 4HT1T 3WW2A 3VBHA 4AEJA 1VR3A 5DABA 2ZGNA 2R6QA 1DCSA 1EP0A 4JRLA 1VE0A 1FMD1 1RUE3 3VLBB 2YXSA 4Q4Y2 3QH7A 1XYOA 4Q4X3 5FO9B 3FWEA 2G19A 1HRV1 3WDYA 1WLCA 1KJRA 2DCJA 4DEQA 2OYZA 4QAWA 1OF4A 1QIQA 4LT5A 3HEIA 1HJGA 2YY1A 1AX2A 4LQRA 5CYYA 4D94A 5DN2A 3ZIXA 1FT9A 1XE8A 4KU8A 2DU0A 4LA3A 3VB9A 3VHRA 2XJUA 2NQYA 5IFTA 5C3OA 3ZX7A 4JGYA 3IB3A 5FP9A 1RGSA 2Q8CA 1RJ7A 4B3NA 3ZFEA 1EUTA 3H8OA 4ARYA 1C57A 1K12A 4A44A 4CEWC 2IXKA 2FZ1A 3PL0A 4S2DA 4RGKA 1NCQC 3KCCA 1TE1B 2XJRA 3KHBA 1OH4A 3POWA 1OQ1A 4OMCA 1CPNA 5CVRA 2RS12 3CQOA 3MIHA 1BK1A 2RG4A 5BXXA 1VAKA 1XJAA 3ELNA 2WNUA 1JZ3A 4XMAA 1AYN3 3U1XA 1UIKA 5F9TA 1COV2 1RC6A 1CAVB 3D3AA 4FQZA 4A41A 2VMFA 3LA3A 4S2HA 3VBUB 2HWE2 1MPXA 4P14A 2Y0IA 3AC0A 2E7AA 2ET7A 1SFNA 3HJRA 2QQOA 5DDJ2 1VBE3 1AR62 1OOPB 3RYRA 1OLQA 4GD4A 1H4HA 3ZOIA 5IK8A 3BIWE 4UFMA 3BUCA 4NIGA 4FXGB 2RS33 4KL1A 3AMQA 3CHXA 5J36A 1VPHA 1EAH1 3TN92 2WJSA 1DZTA 1I5ZA 5T5OA 5C9AC 2D6NA 1UOJA 4KG0A 3K2OA 2PAEA 5G05L 4CPBD 3LAGA 1Q8OA 4YM2A 4XDQA 5I0DA 4ZZ5A 4S2GA 5FY5A 2VD7A 1GQPA 4RS5C 3JD71 1T6GC 5LA1A 5JZGC 3E6DA 1VBC1 5ANNA 4BB3A 4ZXKA 3MDPA 2HWF1 2VUCA 5F37A 1R1A1 3E5UA 3KLSA 1ALYA 2EXKA 2J1EA 2QQWA 2Q4SA 2DYCA 4OHYA 2W1QA 1EV12 5CAZA 1F4AA 1VLNA 4WZFA 4DXSA 2RJ2A 3PNAA 4X6QB 4CEWA 1R093 1QJX1 4YG0A 5LRRA 3E5QA 1XSRA 1L7RA 1NCQA 4MGQA 5LRSA 2O1QA 3VN4A 5CEHA 5CFCC 2ZZJA 3VD7A 2R30A 1Y4WA 3I2HA 1N1VA 5FMOS 1S0FA 2BW8A 3AB0A 1X36A 3H3LA 4L0PA 2WZPP 3LOBA 4YGCA 3TWIA 1CAUB 2P37A 4IEWA 4LO5B 2JECA 2OIIA 1W90A 3AM2A 2JDUA 5FKBA 5IVFA 4UW4A 1US3A 1UKGA 5JOWA 3GBWA 2YHJA 5IK7A 2VZ3A 3NL1A 4AVTA 3KGLA 4MXVA 1RUD2 1W9SA 4XAAA 5FY9A 1OT5A 1JYCA 4UT5A 2VY0A 5JOZA 3LSEA 3SLIA 4CP9B 4OI0A 4BLIA 1VBB3 5EPAA 1N47A 4UFLA 3M3OA 5IVBA 1X9TA 5J1XA 2B7YA 2A3YA 5C9AA 3A4UA 4CA9A 3GBGA 4XFFA 4NJ4A 3FX3A 3JQXA 3A0KA 5F5QA 4XURA 3ES1A 3GHNA 3I97A 1RVF1 3WG4A 4AYUA 4X8NA 4Y5TA 5FP7A 4RS5A 4EJRA 3AKSA 3K4ZA 4ZHNA 5JZGA 2VOTA 3LFMA 4NHXA 1LEDA 1CIYA 2PHRA 4Q4W1 4B7EA 2ARCA 5AFEA 4DPNA 3SXWA 3WR0A 1HLCA 3K4DA 2EVXA 2Q8DA 5FYMA 1FOD2 4IL7A 4O9GA 1LOEA 2WLQA 2ENRA 3OGJA 1CONA 1MVEA 2ZAHA 2R072 1BQPA 2JXAA 3ZYFA 4DIQA 3E1F1 4YZ3A 4QQPA 5CFCA 4CCJA 1WW7A 4L8QA 1H9PA 3KS7A 4BXFA 5SV5A 3PMSA 1OQDA 4BISA 5FK8A 5AC91 1O6UA 1PO12 3GZEA 5EV7A 3KHCA 2FZ2A 3ZSMA 4KWUA 5FP8A 1RB8G 1F2NA 2W87A 4Y4RA 2X29A 4N53C 4RL7A 5A3TA 4W6YA 2ERFA 1PIV1 1FPN2 4XHBA 3WY6A 4YWAA 4D6SA 4XUQA 1O3TA 2ZGOA 3VD3A 1QDCA 2B42B 2B8MA 4CDXC 4Z2AA 3AZWA 3LPGA 4AXOA 1BHGA 4BK4A 1LOAA 3M7AA 4P9XA 3SH4A 4OUSA 4BZ4A 3CDZB 1WW5A 4LBOA 1T6BX 4EROA 3MHZA 1CZVA 1UXZA 5JIUA 2W0XA 3RFRA 3WEZA 1LR5A 1YRZA 2OX0A 3LKJA 1W6QA 3N7KA 1AR82 2EIDA 3RGBA 4QU1A 4XJUA 4J6GA 1IQAA 2HBUA 3FFZA 3MF6A 3ZSEA 1OSGA 1J59A 1REDA 2WABA 2QQUA 4ES9A 4FP2A 5IK5A 2LS6A 4AAXA 4OFGA 2P3YA 4FPOB 4XYXA 1AX1A 1D4M2 3B94A 1ASJ2 4LHNA 3QCWA 4WVMB 3UK9A 2BBVA 1UZ0A 3VBSB 1JYIA 4TSVA 4LBKA 4B4RA 1B35B 1GZWB 2VZPA 2WNVC 3C7HA 2DDUA 3KQ4B 1AR91 3LDBA 3VKLA 5JR7B 2P4EA 2WNEA 2WZ8A 3H8XA 3I3EA 2D5HA 3AP9A 3NJXA 2WZR3 3QOPA 4Z07A 3VDDA 1VAVA 1HRI2 1N1YA 1OURA 4DUXA 5BNOA 4J25A 4QQHA 4DZGA 3WT3A 4OVEA 3DPRB 3G6JB 4CDUC 1PGW2 2TNFA 4N53A 2RR11 4QXBA 1Z7S2 5IAXA 2WT0A 4PBPA 2EXJA 1V9U3 4DUWA 1YFYA 3IT8A 4QB2A 4XIOA 2GZWA 2D44A 3WDXA 4IE5A 4CDXA 3ZFFA 5BNNB 1R1ZA 2YBKA 3EXUA 1LGNA 3T4HB 5FKCA 1PMIA 3IDBB 2WFF3 2RDSA 1SPPA 1W8FA 2I45A 2W92A 4NPLA 5FLIA 3CNAA 2PQQA 3AZXA 3M1HA 3M4FA 5JXIA 3O0WA 4HOOA 3CJIC 1ND3C 4MVTA 4ASLA 2ARXA 4XZUG 4MXWA 5ABJA 5F3IA 1UMZA 4K20A 5LBFA 5T5JA 3VBOC 4OHZA 4CCOA 1UZVA 2ZGKA 1AHSA 3OUJA 3OF1A 2VU9A 2EF6A 1HW5A 1LU1A 2W52A 1QWRA 2Q0AA 2R7EB 3NO8A 4ZU5A 1GZCA 3RWKX 4AW7A 4EWDA 1J3QA 1O91A 1U5XA 2EA7A 4M4PA 3VGIA 3N4MA 3M2MA 1W9WA 3Q8BA 4XABA 2I07B 2UWBA 5F6KA 4CCCA 2KD7A 4ET7A 4FPGA 1GOHA 4XQ4A 5HV4A 1PGSA 1CJPA 5A7NA 3WNMA 2P3KA 4DNYA 3VKFC 3LDKA 1QJY3 2K0GA 5FIXA 4UYBA 3WQ7A 2PELA 2C0ZA 2WNVA 2ZOEB 1S0EA 2VCMA 5JDBA 5F8PA 1Q5OA 3SEEA 2R041 4HK8A 4WVZA 3UETA 1WW6A 1RUG3 1GOGA 5FZLA 4ASMB 4NWWA 1W6OA 1W3VA 3GZUC 3PVEA 4CDUA 3GCWA 4XFIA 2XBO2 3J4UH 2QFEA 2GNMA 3NRUA 4DY5A 1BMV2 4V2WA 4G3YC 3IAQA 3QBQA 5FZ9A 1ZBE2 4AEKA 2E53A 3VZLA 3ACHA 1CIWA 2HWC2 4AGGA 2XUEA 3Q8CA 5FZ7A 4D0QA 3S5AA 1VBA3 5FZ6A 4TLGA 2X5IB 4CP1A 4R9DA 1A8MA 4FI9A 1UN1A 4ASKA 1ND3A 2BJSA 2GMPA 3R4UA 1PGL2 3I2FA 3B93A 1YFUA 3CL1A 2A6ZA 4QB6A 1CQ9A 4KH9A 1SHWB 2JD4A 1DGWX 1OKOA 1OLME 5F7UA 3SISA 4ATEA 4FTSA 4YRDA 1LB2A 4FFFA 1RHI3 4I09A 1RMU2 2HH9A 1CAXB 4D8MA 1YJLA 5GZEA 3ZXDA 5C5TA 3CF6E 2A1XA 3V0AB 3WHTA 4NN0A 1LGCA 2R1DA 4K3UA 2ZABA 4FCAA 4META 1ZX5A 4OHVA 2RS13 1VBD3 1R083 4UXAA 1CD3G 1V6MA 2WA3A 3H9AA 5I91A 1KJLA 1W9TA 4NE9A 5A32A 1U5YA 3MUZ1 3A0NA 2VAUA 3AKTA 1DQ6A 3BB6A 1AR71 3VDAA 1POV1 2AEZA 4Q1PA 2DVAA 1YQ6A 4GZ9A 5FLJA 2WKKA 1CAVA 3VZOA 4C0HA 3W5MA 3UGGA 5GLVA 4YPJA 3VBUA 1YQCA 2BV4A 2C4XA 2E9QA 4RN5A 3AP5A 1N3QA 2Y34A 5APAA 2A71A 1W2OA 4I3GA 3X29B 1QQP1 2VQ0A 2QQIA 3ZYJB 2HEWF 2VVDA 2WSUA 2YDEA 3I3QA 4W6XA 4XJWA 3ZFEB 1UY3A 2P17A 3I59B 4KQ7A 3J8F2 3ZYIB 2Y6LA 4JHTA 1F8VA 1GU3A 1PVC1 3LA2A 2WRAA 3DXUA 4YW1A 1OFNA 2QQJA 2OPKA 3ATGA 4HK9A 4FSJA 1QJFA 1JBCA 1RUJ2 2O14A 4IDZA 3ZKUA 2DBNA 2XVKA 2FMDA 1W6MA 3HAGA 2YV8A 3RVHA 4DEVA 1NKGA 3M3CA 3PLQA 3ZO0B 1G9CA 3A22A 2ZCWA 1LKNA 4RQPB 1AYN2 4CDWC 4M0NA 3WW4A 3U14A 3DECA 4LHLA 1JZ2A 1QGLA 2R1BA 2WUHA 1D0GA 3IWZA 4A6SA 1VBE2 4L9BA 5IFPA 3H1MA 4HKLA 4LPLA 3ZXEA 5EIYB 1PMJX 1JYNA 1FMD3 2RS32 1UMIA 5H9PA 3N7MA 4COUA 1C8NA 1OMIA 1VRBA 2ARAA 2QQMA 3OYWB 2GMMA 1JUHA 1VALA 1TZOA 3RZJA 2I2SA 1CAUA 4UF0B 2WQ8A 2NLRA 2UYAA 4JQRA 1RUD3 4E8DA 3AFKA 4Z82A 1DQ0A 2OZ6A 4GJYA 5EYXA 2DV9A 3ZXAC 4NPRA 4HN1A 2MEV1 1KS4A 3POJA 4BIFA 3O1MA 4MG2A 1OUXA 4LA2A 2PTMA 2R0HA 3GDBA 3WDVA 3VHOA 5A80A 4CEWB 1Y7BA 5IK4A 2P1BA 4YVWC 5FXXA 2CSGA 3ACLA 3OGRA 1UY1A 1R092 4LBQB 2FDKA 2CAVA 2H0BA 3H3ZA 2NP0A 5CG8A 3Q9OA 2DFCA 1WMDA 4GQ7A 3GGLA 3ZDSA 4E2SA 3O0VA 3GCXA 4MGSA 4PI0A 1DLLA 4IE6A 1HB2A 3G7DA 3SC7X 4MGZE 1URXA 1UF2C 1QMJA 5FWEA 2CU5A 3AX4A 1W3XA 4CDWA 2BFUS 2XR4A 3EO6A 3OGVA 3WLUA 1WLDA 3WF0A 3PJYA 1MZ5A 1XSQA 2JKXA 4Z1VA 1LODA 4XPVA 5ACA1 2JJ6A 1SLAA 2ILMA 1EAH3 2WO3A 2C1FA 5C70A 1MEC1 1SEFA 2R49A 1LTEA 3VBSC 1VBB2 3SMHA 4NR1A 1JTZX 1OA2A 1B35C 2WWJA 4UFKA 3AYAA 3FLRA 5IUQA 1UOFA 2GALA 3JD73 4N9HA 3EJKA 1GWMA 3D8CA 5I0TA 4WM7B 1CZTA 3H8UA 3KT7A 3RZMA 1GSLA 3RMXA 3DPRC 1R1A3 3RZKA 4AQTA 3IPVB 1OXCA 2P6CA 2PHTA 2VTXJ 1JYVA 1H2NA 2OPWA 2W47A 4D7YA 1UU5A 4E2QA 4NO4A 1Q8PA 1HXS1 2XH6A 3BVCA 3NV1A 5BNNC 4YVWA 4YZ4A 1Q8SA 2BQPA 3OPZA 5I0SA 3GXUA 4FT8A 1ACCA 2D7FA 1LULA 2RM21 2WQ4A 2AC1A 5JI7A 1AR83 1W28A 1V70A 4YFWA 3I2KA 5IHRA 3GALA 3GZAA 5FY8A 4GAZA 3IIAA 4CU8A 2JICA 5JWPA 5KHGA 1XYPA 4DB5A 4EZ4A 1YUDA 1JZ5A 5I0UA 1ULDA 3KWVA 4BQ1A 1J3PA 1BEV1 5FPVA 2VZOA 3UESA 1ASJ3 4Y1ZA 1SLCA 2W9XA 3KGZA 4NHMA 5LBBA 1H8VA 3UKNA 4E9KA 1Q3EA 2BVBA 3ETPA 2GP3A 1NY72 1U5IA 2EIBA 2XJTA 2XVGA 3OD4A 4XJ8A 3VKOA 4WVMA 3RZZA 1W2UA 4D3WA 2V72A 3VBSA 2F17A 1ZM1A 1SFYA 4LKFA 4N8MA 4AFBA 1B35A 1RVF3 3F2ZA 3WHUA 4QDRA 5FZ1A 1W8TA 4WBBA 3T1MA 1HRI3 5HI0A 3AP6A 3D6EA 1VP6A 4Q4W3 1OLMA 4OQ9A 5A1FA 5JXJA 1JN2P 4A7KA 3DPRA 2G1MA 4Q0VA 5KXBA 4FPFA 4YGBA 3DYMA 3AK0A 5K4LA 1POQA 1P8JA 4LKEA 4YM0A 3FHQA 1TVGA 4OYUA 3DV8A 3LE0A 5BNNA 1G7YA 2PHFA 5A7WB 4UFJA 1RUC3 2B4KA 2J1AA 2YMZA 5JUVA 3NJVA 4UW3A 2W95A 2X5IC 3FJSA 1NZCA 4UFHA 3OY8A 2VOWA 4UBHA 2BNMA 5AC93 4RHV1
chains in the Genus database with same CATH topology
5E8AA 5GLZA 5LEKA 4BMEA 1VAMA 5C6CA 1QXPA 3I8TA 3TNQA 2N7GA 2I74A 2VGDA 2WZR2 1VB2A 1PIV3 4LO8A 4IEVA 3JBG3 4BA6A 1GICA 3TOJA 4QGLA 2CYFA 4CDXB 5J37A 2JKBA 5JVVA 4YNIA 4BOWA 4GB31 1DDLA 3ZMOA 1LOGA 2VOKA 3THPA 1RTVA 2WFF2 1QJU1 3ZN6B 3IM0A 3RWNA 1DZQA 3MICA 2RE9A 1WCDJ 5JOYA 1JHNA 3RMYA 4KNCA 4N9IA 2JE9A 4Q4V1 5EYYA 2VUAA 2ZGLA 4AVVA 3HN1A 4XFBA 1IS6A 3FMGA 5TSWA 1G8WA 2A6WA 2ZX4A 2IXCA 4H14A 4XOGA 3ZXJA 2C9AA 2X5IA 2ZX3A 4OZXA 1RUH1 1AR93 2R0FA 2XLGA 3N3HA 3PVNA 1O3SA 1ZNPA 4PDWB 1UAIA 1LHOA 4XF1A 4Y1VA 2HWE1 3TBDA 1I3HA 5DDJ1 1QNWA 3USSA 1PO21 2ARBA 2CTVA 5IT6A 2RR13 1CAXA 4ISRA 1RUG2 4XHXA 1GANA 1YXWA 1GZ9A 4RQPC 4UBGA 3V0AA 3ILNA 3TN91 4WV8A 2CWMA 1DGRA 4PLNA 4NWVA 5EXOA 1BXHA 3R4DB 3WQ1A 5CFDB 2AREA 1WW4A 4Z2WA 2JG9B 4Y24A 1X8EA 1VBA2 3AXEA 3CJIB 1ND3B 3ASIA 4DFSA 4IEUA 2HWD1 3VBOB 2E51A 4RGAA 4BLJA 4ZU7A 3FFQA 4Q0UA 2ZACA 4FPCA 1H2LA 3VZJA 5BY5A 1VRH1 4QM9A 3J9SA 3J8F3 1RHI2 3N7LA 2CGOA 3IBMA 4HN0A 3I59A 3VL8A 3OBRA 5JSRA 4FOWA 1RUNA 1V6JA 1AZDA 3S7EA 3V65A 5L73A 2HWB1 3VZMA 1RUJ3 1O5LA 4NOTA 1IOAA 5I8YA 1VBD2 1S2BA 5K9YA 1R082 2R043 5A32B 4MX3A 2UWAA 4AI1A 1WLWA 2RHPA 1RUF1 3HD8B 4WVVA 3WDWA 2HKXA 4SLIA 3JCIA 1AYM1 2DU1A 4RQPA 2B9UA 1FXZA 3T2TA 2VXRA 4X8PA 4NVPA 1MZEA 5C33A 1IS4A 3T1LA 2VNRA 5J48A 3B69A 3O12A 3FUOA 3RI8A 5CNAA 1WMFA 1NA1B 3WW1A 4B29A 1BCXA 3IKWA 4XFCA 4AWDA 2Q30A 3OYWA 5AFBA 5AVAA 2PHUA 1S0BA 5C8WA 5DZGA 4XF0A 2BFUL 1MS9A 3H1WA 4P5HA 3ZYGA 1W6MB 1YLLA 4WM7C 2ZHKA 3CU7A 5GJ6A 1LHUA 4IV3C 4H3WA 3OTFA 2NZ9A 4AVBA 1OA4A 3RQ0A 1AJOA 5FO7B 1NE4A 5FBZA 1ZRFA 1H8TC 2WT2A 1F5FA 4CP2A 1LOFC 4L11A 4KBBA 1YI7A 4XTPA 3AZYA 4LBQA 5E89A 2H0VA 5KC6A 3BALA 3MI8A 3RSJA 4CEYC 1VJ2A 1OI6A 4G4FA 2TEPA 3B02A 3MIEA 1FMD2 1AR73 3WVJA 1POV3 2ZTNA 3L2HA 1HRV2 1RINA 2G9FA 4Q0PA 3N35A 1MS0A 3WX5A 2RS51 4ISQA 1DQ5A 4QQLA 1QQP3 3KT1A 1RITA 2BPA2 4FPYA 4XEZA 1O4TA 1QOTA 2ZMLA 2DTYA 3KZ4C 4LHKA 2VW1A 2JDZA 1PVC3 1QOOA 2BVVA 3B00A 5BNPC 2WS91 3NKGA 3FZ3A 2GC2A 4OLLA 2AENA 3DGTA 1UPSA 5FOJB 4AF9A 2OW4A 2VNGA 5DUUA 4WM7A 1FX5A 1V6KA 2EALA 3D0JA 4AI8A 3HBZA 2ZHLA 3IPVA 4CP0A 1W6PB 4LLFA 3E97A 5EJ3A 4CDWB 2V09A 3I2DA 4CDQB 1SLLA 1LOFA 4MZUA 3BODA 1H2MA 1O3QA 4CTEA 3RPQA 1EAH2 1A8DA 4OHXA 1TMF1 5E88A 4ZU4A 4GMP1 4B4PA 1A78A 3U11A 2A6VA 3WV6A 3MIGA 2XHKA 4GA9A 1ENRA 3ZYRA 3JD72 4XBNA 4XJ9A 3WDUA 4COYA 3ENRA 1S0GA 1VBC2 3MYXA 5A33B 2MEV3 3AJZA 1HIXA 1R1A2 4LE3A 3ZSKA 4PLOA 5FDBA 2B45X 5BNPA 4YVWB 1QJX2 3MIBA 4LLOA 1O3RA 1UCXA 1TNRA 3NJZA 3C2UA 3ETQA 1PK6B 4FOQA 4JGZC 1BVVA 3D4KA 5J3UA 3J26N 3PVOA 5KXCA 3O14A 2IFRA 1TME1 4RR3B 5CG9A 3WQ0A 2DCYA 2IFWA 1G9FA 1WCKA 5KBFA 5FLHA 2R16A 1PHMA 4AEDC 5GKAC 1MEC3 2UWCA 1X82A 4PIYA 3AJYA 3W58A 4LBQD 4LEJA 3I7DA 2DVGA 4BIOA 3MLJA 4D69A 1OKQA 4GH4C 4R4ZA 3RI9A 1DF0A 4PDWC 4PIXA 1Q43A 4ATFA 1QXRA 1RVF2 2DVDA 5A3MA 5LK7B 4XTMA 3OD0A 2YUEA 1AVBA 2QZ2A 3MIFA 3ILRA 1XNCA 4IEOA 4Q4W2 4A7YA 4YSFA 1AXKA 3AYDA 1HX6A 2FBEA 1V6OA 1Q56A 5K7PA 3KT4A 3M3QA 5CFDC 3ZPYA 1ZBA1 2JG9C 4QU2A 2RM23 1Q8QA 3OBTA 2PHWA 3B7MA 1PNFA 1BZWA 3GZTB 1BVP1 1RUC2 3OY8B 2RJKA 3ZN6A 4AVCA 4AGRA 3HT2A 3AP4A 5AC92 4AFCA 4FPHA 4M01A 3ROUA 4XFAA 2VVFA 4TZDA 4AQ6A 1BEV3 1AXYA 2HJIA 1RUI3 3PTYA 4DY3A 1PZ8A 1SCRA 2CGPA 1PZ7A 1AL23 3WZ1A 1MZ6A 4PQ9A 1PIV2 2YROA 2ZKLA 3GYDA 3JBG2 4IETA 4QGMA 5CU1A 1G86A 4ES8A 1XRUA 2CAUA 2G4IA 1RUE1 1GQHA 1GNHA 4Q4X1 3VKMA 4PDWA 3NAPC 3ZXKA 2AR6A 4Q26A 4C0BA 3USUB 1PZ9A 4OI1A 3RJ2X 4XJAA 3K48A 3ZSJA 4INDA 1SLBA 1QH6A 1BBT1 4ONUA 2EXIA 1SBDA 1WD3A 3AMMA 2EAAA 2E63A 4L2NA 4XBLA 1C4RA 4F83A 5CFDA 4DRVA 2JG9A 3KCYA 4KG8A 1ZRDA 1Q8VA 4SBVA 4P9LA 1NA1C 3MW2A 1UKRA 2XJSA 4RHV3 1MR5A 4GWNA 2IXIA 3CJIA 2JX9A 3HMYA 5FFOC 1G9AA 4FAHA 4O9EA 3VBOA 3VKNA 1AR92 4AVSA 3LWCA 4K9SA 5FCCA 3OGGA 2O0OA 2ZGTA 2VOXA 4Y22B 3S7IA 2LALA 3ES4A 1VBE1 2LUWA 3TNPB 1OPMA 4EWAA 1LU2A 1D2QA 4RGGA 4XETA 2RR12 2UY9A 4OUMA 5HCBA 4FOYA 4TWTA 4EN7B 3WG3A 3WCSA 3RNSA 4K1YA 1ULGA 4M3CB 3AKRA 4COWA 2R061 2GNDA 1AJKA 4GULA 2VOVA 2PLV1 4XF9A 1QJU3 4I0WB 4YW5A 2DWRA 4GIQA 2PHDA 3C3VA 3FBMA 4Q4V3 3MFAA 4JVAA 4COZA 3EBRA 3LA7A 4BE3A 2OUHA 3HWJA 1S0DA 2R32A 1UD1A 2BYVE 4Y4YA 1J1TA 2D97A 5FMOL 3RYKA 1SBFA 2BWAA 2ATFA 1NA1A 2Z69A 5GM0A 4FP3A 4D7SA 1MS1A 3WUDA 3S0MA 5C8CC 2GSYA 1UL9A 4E27A 2R042 3VBRB 4QMAA 4H7LA 4OHWA 2ZS6B 1MS4A 3NVCA 4HSJA 2QE3A 4LE4A 5JSOA 1U0AA 5J96B 2KXLA 3O5SA 3NV2A 2GC1A 4CDQC 3SNMA 1GQGA 3GHMA 1G9BA 4PJYA 1I9RA 1DIWA 1DZRA 1HDKA 3VZNA 3IDEA 5F1RA 2HWD3 1HRV3 5D8AB 1L3JA 4UW6A 2G9GA 3QLQA 3SCHA 1DFQA 4GWMA 4MSVA 5DG2A 2CY6A 3LSDA 4F3JA 5DUXA 1TEIA 3BPZA 3ST7A 1H4GA 4OI4A 4M3CE 4RSUA 3ZIWA 4GKXA 4Z92B 2HWB3 3SHRA 1OPOA 1KDMA 1Y43B 2QJVA 3D82A 1A3KA 5K0UB 2F6BA 4AG4A 1ZZBA 4V1PA 5C8CA 1HQWA 1ZZ8A 2E7TA 1DBNA 1PK6C 4Y1XA 1QY4A 1BYHA 4IESA 5I93A 4AK3A 1RUF3 5L19A 2ZKNA 2DCZA 4R9BA 3WP6A 2NM1A 1AR72 2ETEA 1QXJA 3LCPA 3L9JT 4IXLA 4RR3C 1W6PA 3O7OA 1NY71 4S2FA 2VMIA 3MEPA 4LNVA 3WG1A 1IS3A 1YIPA 4U36A 4CDQA 3S6PA 1KS5A 1QQP2 4M00A 3JB8A 3ZXLA 3MW4A 2NMOA 2GAUA 5FO8B 1LJ7A 3AMHA 2RMU1 2VW0A 2Z5WA 3FLTA 3RJRA 4IEZA 3ZXGA 1PVC2 4E4SA 3VHPA 1MS3A 2BGCA 1NXD1 1ULCA 1W6NB 4JTOA 4LBLA 3H7JA 1VBC3 4HANA 4Q29A 2HWF3 2WINB 2X53S 4IV3B 3ZMNA 3PJQA 3S30A 1SACA 5A33A 4IV1C 1QJX3 4OI2A 2VMHA 3ALQA 1H8TB 2ZX1A 1YCIA 2VW2A 1HQNA 2XWBB 3ECQA 1K5MB 1DYKA 4FVVA 1FV3A 1JW6A 4XQWA 4XF4A 5DZFA 3WDTA 4CEYB 1LRHA 5GZGA 4P9YA 1PK6A 4FPEA 3D5OA 4P9WA 5T5PA 3DKWA 5CBLA 4YW3A 2D6MA 1LESA 3NW4A 5FAXA 1OQEA 1YO8A 3THTA 1UIJA 4RR3A 5GZFA 2RS53 1FI2A 5BNQA 2ZGSA 3W59A 1V9U1 4F7ZA 1PM7A 4WM8C 1DQ1A 5AVPA 3CLPA 5H9RA 2MEV2 2H6BA 2WS93 4EN8B 1NG0A 2DFBA 4I0BA 4Y5Z0 5BNPB 1UU6A 2NMNA 2PAKA 1OD5A 2GC3A 1ULEA 5CIRA 4PF5A 3RS6A 3VZKA 3WW3A 3JU9A 3ZFGC 3BCWA 4QPIB 2SBAA 3H1YA 1WBFA 4FXKB 2ZGMA 3KQRA 1ENSA 4DQAA 4FPKA 1YNAA 5DG1A 3FBYA 2AGSA 4LO7A 1BJQA 2F4PA 1NOVA 4YFZA 3U10A 4P9IA 1OLRA 2GMEA 5ACA2 1QJY1 4N7IA 1U12A 2DF7A 1GV9A 1MEC2 2OA2A 5T54A 1TMF3 2V5YA 5JAXA 4GMP3 1Z78A 5JPNB 1C8M1 5A3LA 2D5FA 4FTEA 2ZAAA 4R9CA 4HLTA 2DURA 2A75A 4L92A 2A7AA 5T50A 2XJVA 3GBFA 3HIFA 4QPGC 4YM3A 2D6PA 4HL0A 5JI9A 1ZREA 4MYEA 1WBLA 4JC1A 3GNEA 4QX5A 4N90A 4R4XA 2A3XA 1NLSA 3ZXFA 4EV0A 4Q4Y1 1IPKA 2AH2A 5CB7A 3WOGA 1V6NA 2RM22 4AHYA 1DQ4A 3USUA 1HQLA 4HZFA 4JGZB 1ZZ7A 1TME3 3R05A 2ZX0A 3KD4A 3RYPA 3ZSLA 1BEV2 4AEDB 1RUI2 2QCSB 2V73A 2YGMA 1X7NA 4AHZA 1AL22 2RS11 4YM1A 2MPFA 1DHKB 1CVNA 4FPJA 4GH4B 4HPKB 1X33A 2VMGA 1COV1 2NYYA 1AR61 1U5ZA 3VBRC 3WXPA 2Q1ZB 1REEA 4LBJA 4Y22A 1DGWA 4QPGA 2X8KA 4QHBA 4AI3A 1C1FA 3POYA 4KU7A 4M3CA 2P3IA 2WFPA 2FQPA 5I0RA 4R8HA 1SLIA 2WL1A 2GNBA 2MNGA 1RIRA 1W0OA 5CAZA 1XU1A 3NWKA 1PVXA 2Q8OA 5D8AC 5KXDA 4EN0A 4RHV2 1H0BA 4N7UA 1EV11 1UZZA 3DUIA 1QNYA 3FLPA 1KFUL 3N7JA 4K21A 4K6BA 2E7QA 1HV0A 2TUNA 2PN5A 4KWLA 4IEXA 1RUOA 2A70A 3R0RA 3VBFB 3JZVA 4AFDA 4PIZA 3SITA 1HV1A 1WGPA 5GALA 1H2KA 2BUKA 5J09A 2QQPA 1YIFA 3MPPG 4GB32 5K0UC 5KHJA 5T3NA 4XQDA 3NAPB 3BOWA 4B8EA 1QJU2 5I8SA 3VBRA 1POV0 1RUD1 2JG8C 1BBT3 5CADA 4Q4V2 4MGIE 1LOBA 1XNDA 1IGOA 1MZFA 1W0PA 3OJBA 4PCRA 3CJXA 4RFT0 1MS5A 4I3PA 5JSPA 2KM2A 2D6KA 1MS8A 2DVFA 2EAKA 1REFA 2DUQA 1QJZA 4DMIA 5D8AA 4WVWA 3ZYPA 1RUH2 3P3NA 1NCRB 4URTA 2QNKA 2YZ4A 4DRRA 1FOD1 2Q5TA 4KWKA 5FPXA 1PO22 3B01A 2PFWA 2R071 3DL3A 2K2SA 3NV3A 3UV9A 2P34A 1LGBA 5GZCA 1JUIA 2NPIA 1K5MC 2R063 4M0HA 4DXZA 1S55A 1PO11 2PLV3 4YG6A 5K0UA 1G9DA 3B3QE 4M3CF 4COVA 2PAMA 1TNFA 1QF3A 3MF9A 1ZVFA 2JG8A 2HWD2 1NXMA 1S0JA 2D43A 1FPN1 3JQWA 3VUOA 4HETA 4JDNA 4DOUA 1XNBA 1GKBA 1VRH2 2BEOA 1DQ2A 3AKPA 1GFF2 5KC5A 4Q2FA 1AR81 1W39A 2XL9A 2IXLA 4JTNA 1AUYA 1RL3A 2HWB2 1FV2A 1C1LA 3V0BB 4IEPA 5C8CB 4DS0A 3WG2A 1W6NA 4QPIC 1AXZA 1IKQA 2NN8A 5JMCA 3E6BA 4L97A 3TAYA 1CPMA 1HKDA 4IV3A 1RUF2 2Y38A 1D4M1 4LUKA 4I2OA 1O5UA 1ASJ1 2ET1A 3V64A