1SBDA

Soybean agglutinin complexed with 2,4-pentasaccharide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
234
structure length
232
Chain Sequence
AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENEDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic studies of unique cross-linked lattices between four isomeric biantennary oligosaccharides and soybean agglutinin.
pubmed doi rcsb
molecule tags Lectin
molecule keywords SOYBEAN AGGLUTININ
total genus 45
structure length 232
sequence length 234
ec nomenclature
pdb deposition date 1995-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sbdA00
1ENRA 2E51A 5DG2A 3WCRA 4F83A 1QOSA 3NV1A 1WLWA 3PVEA 4XE9A 4AVVA 3V64A 1JW6A 3C2UA 3QCWA 2ZAAA 4FPCA 5GZFA 3ZXFA 1LGNA 3A0KA 4FOQA 1LOEA 3B3QE 4XJAA 2AYHA 3VKLA 2VXRA 1UKGA 4Q1PA 3VUOA 2ZA9A 1AJOA 1LOFC 2A3XA 5DZGA 5IUQA 2A7AA 1DHKB 3O12A 1Z78A 4PBOA 3AP7A 1O4YA 1GANA 4PCRA 2D6NA 4AGRA 4AWDA 3V65A 4BMBA 5GZDA 1BKZA 2OW4A 5CA6A 2CYFA 4YW1A 1QMJA 4GKXA 3SH3A 3WG3A 4YW2A 1HQWA 4H55A 3TAYA 1SBFA 4Q1RA 3SH4A 5H9QA 4FPGA 4YW4A 2FMDA 1CPMA 1QDOA 5T52A 3VV1A 3LSDA 5IT6A 2W68A 4FPJA 3WNXA 2FHRA 1LESA 4XIKA 4YLZA 2WT1A 2E53A 3LSEA 4Y22A 2NZ9A 3R05A 4P9WA 4WV8A 4YGCA 3PVNA 2AR6A 1GYKA 1KRIA 4LBOA 5DG1A 4PBPA 3T1LA 2ZHMA 4M00A 3GALA 1V6NA 2ZGSA 2WKKA 5IK7A 5E89A 3A0NA 5HCAA 5DXDA 1PZ9A 2JD4A 4GA9A 5SV8A 1OQ1A 3USUA 1BJQA 1UZYA 3UJQA 2A71A 3ZXJA 1G8WA 3ZSLA 4NO4A 3USUB 2ZBJA 2A3WA 1RITA 2ZZJA 2XG3A 1C4RA 3ZXEA 1AZDA 4YGEA 2RHPA 5JOXA 1JUIA 2GMPA 1TEIA 1LEDA 2A75A 1DQ4A 4NOTA 4BQ1A 1HKDA 4FVVA 4SLIA 3UL2A 5KXCA 3N7MA 4Y24A 4DFSA 1HLCA 1URXA 3D6EA 1LTEA 1IS4A 5E88A 3T1MA 1B09A 1LOBA 4XTPA 1W6NB 2ZMLA 4Q8KA 1FX5A 5T5LA 2LTNA 5EWSA 3AZYA 2ARBA 2AUYA 1FAYA 1QOTA 4YG3A 3L2YA 4Q26A 3MW2A 2E7QA 2DTYA 1SBDA 3RG0A 4YW3A 1AXZA 1WW6A 1DZQA 3ASIA 4UW4A 1W0PA 3ZXLA 1J1TA 4LBKA 1DIWA 2ZMKA 1AX1A 2JDZA 1DYPA 2YMZA 4XBLA 1GICA 4YM2A 3O5SA 2EALA 1V6IA 3AXDA 2AGSA 3UJOA 4Y1VA 3WV6A 3B9CA 4MYEA 3WOGA 1W6MB 2CWMA 2DWRA 1LGCA 5GLVA 4K20A 5T50A 2W08A 3QLQA 1GNHA 4ISQA 2WNEA 1AX0A 2JKBA 2VY0A 4FOVA 3HN1A 1IOAA 1G9FA 1NLSA 3M3QA 3NV2A 2W39A 1WLDA 4DPNA 2WSUA 2DVAA 2YV8A 5JLVA 4LBLA 1R1ZA 1W6OA 2GNBA 1JN2P 4ASMB 1VIWB 2DURA 3N3HA 5GJ6A 2PHXA 4XXPA 3AYDA 4UW6A 5EXOA 1DQ6A 5JOYA 3AZXA 1GV9A 1MZ6A 3OBTA 2CTVA 3N7JA 2EXKA 3WDYA 5CAZA 4P14A 2GN7A 3B01A 5JMCA 2D3RA 3M1HA 1F5FA 4JRAA 2EAKA 3ZYPA 3WG1A 1GZWB 4TZDA 1W6QA 2DUPA 4XMAA 1WW4A 4CZSA 1V00A 2ZGKA 2ZHLA 4YZ1A 3M2MA 3WDXA 1CR7A 4L8QA 1LU1A 1MR5A 1MS0A 2E6VA 4AGVA 4Y26A 2D6LX 4XDQA 2W52A 4HL0A 1SCRA 4Q2FA 3INAA 1U0AA 1V6OA 2D43A 3WDWA 2WSVA 2Z42A 5LK5A 4XJ8A 3AP4A 2I2SA 1V6KA 1H30A 4CTEA 2H0BA 3VKFC 1UMZA 1UN1A 2DVGA 1S0EA 2ZACA 2ZGQA 3OY8B 1W6PA 4CRQA 1S0JA 3R4SA 4R9CA 1QU0A 3WHTA 4FQ4A 5GM0A 1LHUA 2JE7A 3VKNA 5GZEA 4XJUA 3KQRA 1FYUA 3HMYA 4LBQA 4ZKTB 1DFQA 1LJ7A 2DVBA 2GMMA 1Y7BA 1LGBA 1UX6A 2UWAA 3ENRA 5T5OA 4D69A 5GZGA 1G7YA 1S0BA 2A6XA 2CY6A 4XOGA 5GLZA 3NWKA 4W65A 1WW7A 2JE9A 3BODA 4GKYA 1N3OA 1JHNA 4Q27A 3FUOA 4ZXKA 1H9PA 1GZCA 1OFSA 1Q56A 1N1YA 2ARXA 4Y22B 2PHUA 3AZVA 4LBQD 4PQ9A 3ILNA 1QNWA 1MS3A 4YZ4A 4YM1A 5GLUA 2R1DA 1BQPA 1UPSA 2R49A 3WUDA 1C1LA 2D6PA 2WQZC 4Y20B 3FLRA 4GALA 1LHVA 5DUVA 1XQNA 1DGLA 2Q5TA 3M3CA 4XJWA 1WD4A 4RA0A 1FNYA 2YXSA 2WT2A 2ZHNA 4K1ZA 3VKMA 3ZSKA 4Z8BA 2AENA 1N3PA 1GLHA 1KJRA 4AGGA 3O0XA 1SLAA 2R0HA 1G9DA 2EXIA 1Q8OA 4YZ2A 2R0FA 3RMYA 5CNAA 1MVQA 1W6NA 1V6MA 4WZFA 4R9BA 1YO8A 2ZABA 2D7FA 5IK8A 3WG2A 3R4UA 4U36A 5DUXA 1LULA 1SACA 3N7KA 1MS9A 2ZGOA 5F5QA 4XHBA 3RQ0A 3D5OA 3PJQA 1Q8VA 2ZGUA 3WHUA 2DVFA 1IS5A 2DVDA 3OYWB 3POSA 3AK0A 1MZ5A 4FP2A 4XMIA 2GDFA 1W6MA 1UAIA 3AJYA 1VAMA 4YW5A 3SISA 2DUQA 1N1SA 1ENQA 1QNYA 2DU1A 1YI7A 4DRVA 1SBEA 3RS6A 3Q9OA 2GALA 3WDTA 1QOOA 2EXHA 1QGLA 3I4IA 3ZSMA 3U4XA 3H0OA 4R9DA 2D6KA 3ZXKA 4Y20A 2P2KA 4Y1XA 3FUQA 4C1WA 2UURA 4YFZA 4FOYA 1BXHA 5DUWA 3B00A 3GNEA 2OVUA 4FOWA 4OZXA 3O0VA 1KJLA 1WBFA 2ZGMA 2D3SA 1IS3A 3POWA 1GKBA 2UWCA 1SLTA 1AX2A 2ZGNA 3BOPA 1FV3A 4XXAA 3T2TA 2DV9A 2EIGA 4ISRA 2SBAA 4BOWA 1YXWA 3AP5A 3JUUA 3IMNA 3AZWA 4BLJA 3ILRA 5JVVA 5JDBA 4AYUA 1YIFA 3POYA 4JCKA 5EYXA 1DQ1A 1BZWA 4YZ3A 4YM3A 4WVWA 5H9SA 1LCLA 1CONA 3I8TA 5GZCA 5HCFA 1QKQA 4LBJA 2PELA 4TYSA 1WCSA 4YGBA 2A6YA 5H9RA 1MS4A 1AXKA 1YRZA 1JYIA 3LCPA 5E8AA 2ZGTA 1I1EA 1LECA 1F31A 4P9YA 4HANA 3W59A 1WW5A 4XJZA 1CJPA 3WLUA 2ENRA 1Q8QA 1N3QA 2DTWA 5FRAA 1S1AA 3RSJA 3MEPA 3OBRA 2GMEA 3OGGA 1IS6A 3WCSA 1KDKA 1SLBA 2VW2A 1UL9A 4FP3A 1MACA 3CNAA 1ULFA 2R1BA 4GWMA 3RRDA 2VU9A 4LBNA 4UW5A 1JBCA 1ONAA 5T5JA 3ZVXA 2GNDA 2P37A 1D0HA 4YG0A 2AREA 3AZZA 3N36A 4XZPA 5T54A 1WBLA 5CB7A 4FQZA 4XBQA 1N1TA 4FPFA 1A3KA 1SFYA 2D3PA 2GNMA 1CQ9A 2YY1A 3AYAA 4FPLA 3UK9A 4BPZA 2VUAA 3PVOA 1G9CA 2GN3A 3TB0A 1SLLA 4ATFA 1LEMA 1YYNA 1C57A 1MVEA 2DYCA 1FV2A 5JOZA 2P3JA 1O4ZA 2EXJA 4RL7A 4BLIA 3FLPA 1LOAA 3OPZA 3V0BB 3DUIA 3HR9A 1ZA4A 1RIRA 1LHOA 3FLTA 3OJBA 1DLLA 2JJ6A 1DQ0A 1AXYA 1N1VA 2KM2A 2V73A 2EF6A 3ZYRA 4FPKA 3D4KA 1IKPA 2B7YA 2A6ZA 4XHXA 2C5DA 3M3EA 2CNAA 3DGTA 1LOFA 4YFWA 5JOWA 1ULCA 2WT0A 1KQRA 2XB6C 3ZSJA 3AP6A 4JC1A 4YM0A 2OUHA 3AXEA 1QF3A 1WD3A 1VLNA 1W0OA 2P34A 4XYXA 5DZFA 3IM0A 2YROA 5T55A 1N47A 2WLQA 1AVBA 4KBBA 2DU0A 2VW1A 1A78A 4U2AA 2PHRA 5F9TA 2VW0A 1X50A 1S0IA 1V6JA 1FNZA 2NM1A 3ZPYA 5IK4A 4XBNA 1FATA 1S0DA 4ITCA 5DUUA 3V0AA 5FREA 1PZ8A 1H9WA 2ES3A 2UWBA 2ZGLA 4WVVA 4XIOA 4UW3A 4BM8A 1DQ2A 2LALA 4DS0A 1UZZA 2AH2A 1VAVA 4ATEA 5T5PA 1LODA 3B69A 3ILFA 1BYHA 1ZM1A 3PMEA 2D44A 5DZEA 1AJKA 5KXBA 1LHNA 2ZGRA 2D6MA 4M01A 3FFZA 1PZ7A 3WZ1A 4LBQB 4M3CE 5GLTA 5CBLA 2P3KA 2P3IA 4K1YA 2NMOA 3N35A 4XJ9A 3AYCA 1W6PB 2CL2A 4M3CF 4GWNA 3FBYA 2JECA 4R9AA 1ENSA 5GALA 4K21A 2UU8A 4BMEA 4I30A 4FPYA 1LHWA 1IKQA 1GBGA 3ATGA 2C9AA 2PHTA 3M3OA 3IPVA 4Y1UA 3WUCA 2HYKA 1HQLA 2V5YA 1OKQA 1KDMA 2SLIA 4DRRA 1CN1A 3RMXA 2NYYA 3AFKA 2E7TA 3V0AB 3SNMA 4XILA 3W58A 1GZWA 3WDVA 3SITA 5EYYA 3JU9A 1VALA 2PHFA 4YZ5A 1MS8A 1WLCA 3SH5A 1GZ9A 1F9KA 2A3YA 1LOCA 2A6WA 3V0BA 1LOGA 1QDCA 4LBMA 4FPOB 1EPWA 1DYKA 2D6OX 1ULDA 1SLIA 1W6OB 3WVJA 1DQ5A 1NXD1 1WUVA 2ZHKA 5KXDA 3IKWA 1D2SA 3BIWE 2CWSA 2VH9A 4GXLA 1S0CA 1S0FA 2A5ZA 4Q8LA 2WJSA 4M3CB 2ZMNA 3O0WA 4DQAA 4FPEA 1RINA 3SLIA 5AVAA 3OY8A 5H9PA 2A6VA 2BQPA 3AJZA 2R16A 1CPNA 1JOJA 4Y1ZA 1G86A 1HDKA 5HCBA 5BYNA 1Q8PA 3MW3A 3NV3A 2PHWA 2NMNA 3APBA 1LENA 3WDUA 4YGDA 1S0GA 1MS1A 2NP0A 1ULGA 4C1XA 1V6LA 4YG6A 1JXNA 1GSLA 3IPVB 3AYEA 4Y1YA 1G9BA 4FPHA 2NN8A 1Z0HA 2GNTA 1JYCA 1MS5A 1W6QB 2G4IA 2ZGPA 1SCSA 1Q8SA 2TEPA 1CESA 1APNA 1GNZA 3IN9A 4AVTA 2ERFA 3N7LA 4P9XA 4IQPA 4AVSA 2ZKNA 4PF5A 1C1FA 3A4UA 1A8DA 1DBNA 1ULEA 3MPPG 5KXEA 3AX4A 3KM5A 2A70A 2DUOA 1CVNA 3NV4A 5GLWA 1I3HA 5L73A 1SLCA 3MW4A 1KITA 3BTAA 5IK5A 3OYWA 4XTMA 1AF9A 3VKOA 3WG4A 1G9AA 2OUJA 3AP9A 4M3CA 1CIWA 1LU2A 2YZ4A
chains in the Genus database with same CATH superfamily
1ENRA 2E51A 3RVHA 1WLWA 3VHNA 4AG4A 3W5MA 3P1IA 1JW6A 3ACGA 3ZXFA 4CDXA 3RI8A 2RS13 5KHIA 1K5MC 4Q1PA 3VKLA 4Q4Y3 4BQYA 1AJOA 1NZIA 2ARAA 3KVAA 4E9KA 1LAJA 2B42B 2WR9A 2A7AA 1DHKB 2WFF2 4Q4W1 1Z78A 4K40A 4Q4X1 1GP6A 3RNSA 5F3CA 1GANA 4PCRA 5F39A 2WINB 3V65A 4YWAA 4XAEA 5GZDA 1BKZA 2C9KA 2VQAA 4GMP3 4HXCA 4GKXA 2O1QA 5JI7A 4AFDA 4A7ZA 5CA6A 5I8TA 1YQCA 4D7YA 1HQWA 1SBFA 1Z7S3 5A80A 2JG8B 3MIDA 4XUOA 1QDOA 2VR4A 3LSDA 1AR91 3H42B 4FPJA 2FHRA 4XIKA 5BNOA 5FY7A 3O1RA 4C0BA 3EHKA 1ZZ9A 4O9GA 3LSEA 1OURA 4Y22A 4AHYA 5A3UA 3PVNA 4XF4A 1R1A3 1U5ZA 2AR6A 3OGJA 4YVSA 1IPJA 4PBPA 4QKDA 4AHWA 4X6RB 4RQPB 2XJRA 3CJIB 5IK7A 4JQTA 2IVJA 1YUDA 2O8QA 1NAEA 2PHDA 3AMQA 3PU3A 5HCAA 3T30A 4CEWB 1R64A 3KV5A 5SV8A 3I3MA 4M0HA 4FAHA 4O65A 3I2IA 1BJQA 1CZSA 2DCYA 2ZS6B 3ZXJA 1H6YA 2JEMA 1MEC1 2ZBJA 2BTVC 1VBD1 1RITA 4B7EA 4YGEA 1VBA1 4YARA 3MPBA 5M0TA 4NOTA 1DQ4A 4P00B 2RVAA 4SLIA 4IEZA 3UKNA 3RYKA 5KXCA 3N7MA 2XJUA 4QX1A 1AYN2 4NAMA 1H2NA 2R061 4WZCA 1JOPA 3B5LB 4XTPA 5AVPA 2J1UA 2Q30A 4BIOA 4D3WA 2EIEA 3H50A 2LW8A 1JZ8A 4MV2A 5A6QA 2ARBA 2AUYA 3AVSA 1WGPA 3RZJA 2JDKA 3NKGA 1RYYA 2NQYA 1VBD3 2DTYA 1O3QA 5LK7B 1OA4A 1AXZA 1WW6A 2QTWB 1YCIA 3OUIA 2RDRA 5K0UB 2YMZA 3ZXAC 3TN93 4A4AA 4A6SA 1XNKA 4QPGB 4GB31 2FDIA 4XURA 3LFIA 1IZ3A 4AQ6A 2A1XA 4OI0A 2QZ3A 4KGQA 2WZPP 1AR72 2W08A 1IPKA 1GNHA 1E5SA 2RJ2A 4ISQA 3FE5A 4KU7A 4ONUA 5J48A 2ZEWA 5FP8A 1XNAA 1OLQA 1NLSA 4IXLA 1CD3G 1WLDA 1W28A 1OUSA 1RJ7A 2GSYA 3WNMA 4CEYB 1R1ZA 1QJEA 4CU8A 2Q1ZB 2DURA 3N3HA 2PHXA 4XXPA 2WN2A 1NCRB 4UW6A 3TN91 1DQ6A 3OCPA 3BTXA 5FZ7A 2HEYF 4LQRA 4M4RA 1LR5A 4J6GA 2EXKA 3LEGA 4P14A 1EAH2 2RS32 2GH2A 5C71A 2X29A 5FYVA 1PNFA 1GFF2 3KF3A 5A6XA 2EAKA 4MGIE 2C4XA 3ZYPA 4XMAA 1WW4A 4CZSA 1V00A 4YZ1A 1PM4A 2Y6GA 3M2MA 1CR7A 4QXBA 4DXZA 2ZKLA 1AHSA 2HWE1 5IVEA 2JG8A 2Y0IA 1QQP3 2KD7A 4H2AA 1PIV1 4GWJA 2GC2A 2MEV2 1UU6A 3WSOA 1OC1A 2WSVA 2X8KA 3AP4A 2I2SA 1OQDA 2JB4A 1UOBA 4XFCA 2OYZA 3UGHA 3LOIA 1UN1A 2VCAA 1S0EA 1O91A 2ZACA 5I0TA 1W6PA 4EZ4A 1S0JA 3WHTA 1LHUA 1C28A 4JDNA 1P8JA 1ZZ6A 2JE7A 4W6YA 4OUMA 2VZVA 3KV4A 2QQOA 4MGSA 1FYUA 4NHLA 3DEMA 3BGAA 3J7LA 5FLJA 1Y7BA 2HWF3 3RWKX 3WNLA 5FFOC 1S0BA 3WY6A 2CGOA 2Z5WA 4QM9A 1KD7A 2CHHA 5FZMA 5G04L 1N3OA 1KS4A 3ETQA 3HQRA 4NE9A 5A3PA 1XXNA 3FUOA 3THPA 1GZCA 4TLGA 3VL9A 1IGOA 1N1YA 3RZGA 4CDQA 1XE8A 2W0XA 3WP4A 1JYXA 1BLZA 2XR4A 4XF3A 5F1RA 1ODMA 3ILNA 3ZMNA 5GLUA 1NCQA 2IFRA 2WZR2 1BQPA 3WD5A 3POEA 1J84A 1PX3A 3IB3A 4MXVA 5CFDB 4Y20B 4UFLA 2WQZC 4BWOA 5BNNB 4ZXEA 5KHJA 5KBFA 3VDBA 3PVBB 1VBB2 1X8EA 4WBBA 3D0JA 4V2WA 2G9GA 4BE3A 1WD4A 4RA0A 4B4RA 1POV1 5CADA 2ZHNA 5LEKA 5IJRA 1UY0A 4KQ7A 4XF9A 1UOFA 3OSDA 1KJRA 4AGGA 2VNRA 2BVBA 1RUF2 1G9DA 5LRSA 4R52A 4YZ2A 1VE0A 1BMV1 1OXCA 1NQDA 2JG9C 3I3DA 1W6NA 3SCHA 3JD73 3T09A 5A3MA 1TME2 3SEPA 4QX5A 4KG8A 5B4NA 5KR7A 4LKEA 1V0AA 3LEKA 1LULA 3GF6A 4COWA 3JCIA 1SPPB 3MFCA 4X6QB 3ZFFA 4OHWA 4BISA 3PJQA 2ZGUA 3AKRA 3HT2A 4LOTA 5A7PA 2DVFA 3VBSC 2F6BA 3WHUA 5C8CA 5D8AA 5I8SA 5L7OC 2VTXJ 2K9ZA 1VAMA 2R6QA 1X8MA 4QGLA 1N1SA 1ENQA 1R083 2LM3A 1CAXB 2VO5A 4Q4W3 2E9QA 3Q8EA 4UXAA 3O1PA 2JDUA 1SBEA 1IQAA 1WMXA 3WQ0A 3PJYA 2GALA 1JZ4A 2YPDA 5EV7A 2HBTA 2Y6LA 2JE8A 3I4IA 4WVZA 1TMF3 3H0OA 3TRSB 4IE6A 3ZXKA 3TEWA 2P2KA 5BNPA 4QT6A 4Y3OA 1PO22 2UURA 4C1WA 1X33A 4RN5A 4FOYA 1BXHA 1VB4A 3POIA 5DUWA 3GZEA 3MGUA 4LKFA 3SCFA 5CFCB 4FOWA 4I3GA 4OZXA 5EZWA 1IHMA 1PHMA 4NIGA 3POWA 5JR7B 3SHRA 2UWCA 1AR83 4LHKA 4IGPA 3AKQA 4BOWA 5JZGA 3RZMA 4QX8A 3C7OA 1HV0A 1K45A 1PVXA 4I02A 4LLOA 1UYZA 5JVVA 1CZVA 3ZN6A 2IVIB 3MLKA 1X9PA 5JIAA 1YIFA 4JCKA 4KWUA 3VBUB 2AZ5A 3NNMA 3H1MA 5EQUA 4RQPC 3VBHA 2D98A 4HOOA 4QKFA 4IV1A 3GCXA 4PLMA 1US2A 5JSPA 1WCSA 4YGBA 2A6YA 3VBHB 4MADA 2JG9A 5E8AA 3ME2A 1I1EA 2Q0AA 1GP5A 3VDCA 3W59A 2Z2SB 1CJPA 4IE5A 2ENRA 1UOJA 4S2FA 1MZFA 1N3QA 3CMGA 1OH4A 3O1MA 1S1AA 1RHI1 2BYVE 3MEPA 1CZTA 3FBMA 3HJRA 2WFF3 1DYOA 1RUI3 1AYM1 1IS6A 2JDAA 2XUMA 2QQUA 3WCSA 1IPSA 4COVA 1SLBA 2RR12 1YEWA 1RMU2 4ZS2A 2BUKA 4W8JA 5FO8B 4OVEA 1VPHA 1ONAA 5T5JA 3ZXGA 5J3UA 1QJFA 2PMWB 5LBCA 3N4MA 3N36A 2VM9A 4QB2A 1WBLA 3AKTA 1NA1B 1ND3A 5A7QA 4EN9B 4LJHA 4FPLA 2OKXA 3BYWA 4ZONA 3K3OA 3U10A 3H9AA 4ASKA 1LEMA 1L7LA 5DAVA 2QCSB 4CCCA 1AYM3 2B9UA 2P3JA 4BLIA 5LA2A 5C6CA 1CAWB 2PLV2 1G6NA 1C8M1 4HKLA 3OJBA 4JGZC 1OOPB 2KM2A 1WCDJ 1SPPA 2WO2A 4E8CA 2EF6A 3AB0A 2R042 4FPKA 3D4KA 5DABA 4L0PA 1ENXA 3IDBB 5DAQA 3LOBA 4B1LA 4P02B 1JZ5A 3DGTA 2B5HA 1LOFA 3MLJA 1PO23 3VL8A 2PTMA 1SHWB 3JD72 1KQRA 4OQ8A 3ZSJA 1REDA 1CAUB 5FP4A 2XBO2 3H3LA 3WP3A 4XYXA 5CYYA 4I01A 4XC9A 4WM8A 4GH4A 1XNDA 1NKGA 5T55A 1N47A 4E2QA 1BK0A 1H2LA 2QFEA 4D8MA 1RUH2 1M4WA 1ZVFA 1S0DA 3KGZA 5CZKA 3V0AA 1RUG1 4RHV1 1H9WA 2ZGLA 4XIOA 1SDDB 3NNJA 3SKJE 2LALA 4DS0A 1B35C 1UZZA 2BP6A 3IMMA 4ATEA 2VBBA 1CAWA 1Y9MA 3B69A 3OF1A 2QBXA 1ZM1A 2Q4SA 1AJKA 1LHNA 3DF0A 2J1EA 1UZVA 2X53S 2D6MA 4LHLA 2QJVA 2WWJA 5GLTA 3Q8AA 4K1YA 4QB1A 3N35A 2RDSA 3J9SA 3VN4A 3SC7X 1UMIA 1JOBA 1RUD1 1W6PB 2F17A 4GAZA 4GWNA 4M3CF 5BPXA 2UYBA 1NA1A 2JECA 1ENSA 4K21A 3N9OA 3L9JT 4JHZA 4BMEA 2W9XA 1J3RA 3RYRA 4TSVA 2VE1A 3FMGA 5J98B 1OA3A 2CGNA 4XZUG 3QACA 5F3IA 3M3OA 4JGZA 2JWPA 2JIGA 3K77A 4NVPA 4IDZA 1E5HA 1H2KA 2HWD1 2SLIA 1CN1A 3VZNA 2WIIB 5FY5A 3B02A 3SNMA 3RZKA 1RUE2 3W58A 2P4EA 1D4M3 3WF1A 2WZR1 1J1LA 4J25A 1F35A 4TN7A 2XMLA 3U1XA 1JZ2A 4MXWB 2PHFA 2XH6A 2EVXA 2DF7A 3OUJA 3ZDVA 4Z82A 5CKQA 2A3YA 4M0NA 3KCYA 3VBOA 1LOGA 2NPIA 1UIKA 3KVBA 4FPOB 4H7MA 4AHZA 1DYKA 1RUF3 4Q4V2 1VRH1 1W8WA 2D5HA 3I7DA 4CP2A 5AC92 5FYUA 2OPWA 5EIYB 3WVJA 1WUVA 4HSJA 2ZHKA 2XOMA 3KMHA 3MFAA 4AVAA 2CWSA 4H3WA 1S0FA 1W90A 3VZJA 2Q1MA 3NVCA 5ACA1 3D3AA 4EWAA 1YFYA 2HWB3 1D4M1 2VVEA 4WM7A 1OH3A 4LKSA 5DDJ2 1JZ7A 3KLSA 5H9PA 2A6VA 2BQPA 2R16A 5J09A 1NX9A 1OUXA 3OD0A 4H7LA 5FZ1A 5HCBA 2WABA 3D0SA 5FZIA 4AEJA 5DMYA 1Q43A 4RD7A 1JZ3A 3H8XA 2BV4A 2NMNA 5J37A 5EJ1B 4YYOA 1WCQA 1S55A 2P1BA 3HN3A 4LE4A 2BU9A 3WDUA 1MS1A 2DCJA 5K8SA 1K5MB 3MIBA 4YG6A 1JXNA 1GSLA 4JGYC 5CKMA 3OGSA 1Y9GA 4E2SA 4AQSA 1GOFA 4FPHA 1L3JA 4PLNA 3B9IA 2VECA 1UW8A 1NA1C 2BDRA 1MS5A 4QX7A 1BHGA 1BEV3 2G4IA 2VXJA 1CAVA 2XHNA 5A1FA 4MVTA 2TNFA 3HAGA 1CESA 5FZLA 3ZFEC 1GOHA 5FPXA 2VZ1A 3LE0A 3TEXA 3ZSEA 4IEQA 3U14A 1A8DA 1ULEA 2OPKA 2DBIA 4GQ7A 4IESA 5A6ZA 4UBGA 2DFBA 2PAKA 4META 1C5IA 5L73A 5C4WC 1I3HA 4HLTA 1SLCA 4CCJA 3MW4A 3NNLA 3VDAA 2BJSA 3VKOA 3AP9A 4LHSA 5J36A 4MGKE 1W8FA 3U75A 3WCRA 2RJKA 1QJU2 3CL1A 4AVVA 2GC1A 4B4QA 3I59A 1RUC1 1HN1A 3QCWA 3C2UA 5GZFA 2ZAAA 4C90A 5B4XA 1LGNA 4OI4A 2ZTNA 1COV1 4FOQA 3RYPA 3HBZA 2VCMA 2X10A 3VBUA 4A6OA 2A3XA 4DINB 4JVAA 3ZMOA 4CP9A 2E32A 4AI8A 3UGFA 1DGRN 2QKDA 3BTZA 1ZBE1 2QQVA 1ZRDA 4N7UA 1HRV1 3LA2A 1OLME 1YFXA 1VBC3 2CYFA 1NLQA 5FYCA 1W9TA 4CVUA 1NCQB 4IETA 4EWEA 4YW2A 4QGNA 2RR13 1EAH3 2RS33 3N9PA 4H55A 4I09A 4Q1RA 5H9QA 3SH4A 4E2GA 2FMDA 1UF2C 1CPMA 1CX1A 3JB8A 5IT6A 4XPVA 2W68A 5FPBA 2QUOA 1YFUA 2WT1A 1YI9A 2QVSB 1TME3 2E53A 3ELNA 1XYOA 2NZ9A 4P9WA 4YGCA 5A3OA 3WNPA 1RUD2 4ZU4A 2MHFA 4A42A 4JHTA 1OHFA 5LA9A 2VMFA 1HXS1 2G9FA 5E89A 1TG7A 3A0NA 1C8NA 4B3NA 1PZ9A 3CEWA 1YHFA 1AL22 2J1AA 1OQ1A 3NNFA 4GA9A 3USUA 3ZFEA 2XJSA 3EJKA 3PIGA 4KI5M 4JDOA 2YUEA 3USUB 3ZFEB 3ORJA 2RDQA 2BOJA 1C4RA 2XG3A 5C4WA 1AZDA 4YW6A 1BBT3 1GMMA 1AUYA 4OUEA 4AZZA 2BW8A 5LRRA 1UD1A 4ZS3A 4FVVA 3UL2A 3GHNA 4YVWC 1ND2B 2XPJA 4DIQA 5F5CA 1URXA 1LTEA 1IS4A 4AW7A 1EP0A 5LZ6A 4Q8KA 1AR92 3ZR6A 1FX5A 1OKOA 1O8PA 3ZN4A 3AZYA 2EIBA 2MEV1 5F3EA 3L2HA 5LATA 3H8OA 1FAYA 1JHJA 1QOTA 1RC6A 2HWD2 1SFPA 3AMNA 4Q26A 4UFKA 3ZN6B 3MW2A 2GC0A 2E7QA 4KWKA 1L7QA 1S4CA 3RG0A 2JXAA 1DZQA 3ZX7A 2VMDA 3ZXLA 4LBKA 3GBFA 4YW7A 4XBLA 1GICA 1DF0A 5ANNA 2J1RA 3LB9A 1GQHA 3FJSA 1XPWA 1UYXA 3AXDA 4AEDB 3ACHA 5FLHA 3B9CA 2JDYA 1UU5A 1C3HA 3NW4A 4AQ2A 2CWMA 5IVVA 1XU1A 1LGCA 1XYPA 1QH6A 3ZFFC 1SDWA 5SV5A 2YYOA 2QDNA 2WZEA 4QDQA 4AAPA 4FOVA 2ETEA 5JUVA 1C8M3 2HWC2 1G9FA 1IOAA 3M3QA 1DCSA 2VPVA 4OUSA 2W39A 3BIEA 2DVAA 2GZWA 2W91A 1FPN2 2R32A 1QQP1 2DCKA 3LKJA 1W6OA 3ZIXA 2ZOEB 4RGAA 3AZXA 1MZ6A 3OBTA 2WDBA 5E6HA 3N7JA 1AR61 3WDYA 1X7NA 1GZTA 2GN7A 1HX6A 1QJY3 4QX0A 4GZ9A 3B01A 4V1PA 1VMFA 3A23A 5DAPA 5B2GB 5CEHA 5JMCA 3RZHA 2HWC1 3V56A 4I3PA 1RXFA 4E4HA 4TZDA 1M06G 3VZOA 3WQBA 1W6QA 1O8SA 2HWD3 4UOJA 2ZGKA 5K9YA 3WDXA 5JCTA 2C26A 4L8QA 3WQ1A 4NIDA 2E6VA 1DZTA 2D6LX 3EBRA 1SCRA 4Q2FA 1U0AA 1PVC3 1V6OA 2D43A 5A32A 1JZ6A 3WNNA 5C3SA 3KQ4B 5FYHA 3WW3A 1WZXA 4PJYA 3BB6A 3S57A 5LK5A 4URTA 4QPIB 3M3IA 4P5HA 1H30A 4CTEA 2QQJA 1QJY1 1DP0A 1UMZA 2ZGQA 5TSWA 3OY8B 4CEWC 4LO5B 4IV1B 4UFJA 1I9RA 1YC61 3VKNA 5AC93 5GZEA 2QQMA 4QX3A 4LBQA 1QXPA 3ZDSA 1LJ7A 3P3NA 3J4UH 4AI2A 3JZVA 4HKOA 2FDJA 2YDEA 2CY6A 5J96B 2BEOA 1QJU3 1PVC1 1WW7A 1ZNPA 4C0HA 4KNCA 2VC9A 1JHNA 2RM22 4Q27A 2WA3A 4RR3C 3MYXA 3HPNA 2UY9A 1PX4A 2J22A 1OFSA 1Q56A 2QE3A 4XUQA 2ARXA 3K46A 4Y22B 5JPNB 4ARXA 1AL23 1UQXA 5A1LA 3KGLA 4HK8A 5BNOB 1OVSA 2LRPA 3OEAA 3O1UA 3M7AA 4MHRA 1UPSA 5AC91 2BRTA 2D6PA 4GALA 5JAXA 1XQNA 3HQXA 4LA3A 1W8HA 2BVVA 5IVBA 3C8XA 4CCKA 5APAA 4LUMA 4X8PA 1SZBA 2H6BA 3MICA 1JUHA 4K1ZA 3VKMA 4HVRA 2CGPA 2AENA 3GZAA 5JSOA 2ORXA 1GWKA 4BK4A 2R0HA 4OHZA 1CGPA 2O14A 1UWWA 2XWJB 2LROA 1V6MA 4WZFA 5E1RA 4IEXA 2J1SA 1HRI1 1HB4A 4R9BA 3GZTB 2IXCA 2VJXA 5K7PA 2IZWA 4A3XA 2VZ3A 4UT5A 5IK8A 3TNPB 3WG2A 4MUVA 4U36A 4XETA 5FUPA 1MS9A 1WWYA 4DY3A 3P3PA 3WEZA 4BXFA 1FOD2 1RUC3 2HH9A 4WM7B 4XHBA 5FYYA 3RQ0A 2WQ4A 1UNBA 2HWB2 4CPBD 1RUH3 4PDWA 2UY8A 2ZCWA 3ZKYA 1W6MA 5F5IA 3AJYA 2Y64A 3E5XA 2DUQA 3VBRA 3BTYA 3WT3A 4WM8C 2JKXA 3HQUA 4RS5C 2XONA 4JRLA 5C8WA 1DG6A 5LBEA 5BNQA 3MIEA 3R0RA 2EXHA 3WX5A 5IFPA 3U4XA 2HJIA 4N43C 4R9DA 4CU7A 2IWGB 1S2BA 3O1OA 4LNVA 4HN1A 5ABJA 1LRHA 3PIJA 4EV0A 5BUVA 3B00A 3CKHA 3GNEA 3MUZ1 4JV4A 1W9WA 5CVRA 3VD9A 3O0VA 1UXXX 4NUBA 1XE0A 1A8MA 3MIFA 1H8TB 1R1A1 5HCHA 4XUNA 1MEC2 1GUIA 1K42A 3SCGA 3BOPA 1JS9A 4ZU5A 3I3EA 4FXGB 3IIAA 4SBVA 3JUUA 3IMNA 1HXS3 1W8ZA 5FWEA 1Y9QA 4XCAA 5JDBA 2Y26A 3AKPA 4P9JA 1XNTA 1DQ1A 1BZWA 3M8LA 4YZ3A 1TMF1 2UYAA 3LAGA 5EYXA 3ZFGB 4DUXA 1LCLA 3AFGA 1CONA 1O7FA 2VL4A 3GBWA 1LB2A 3I8TA 2Y6HA 4ASLA 5KC5A 5HCFA 4LBJA 3ZFGA 3K3NA 2G19A 3MIGA 5JR2A 2C1FA 4F7ZA 1YRZA 2RJLA 4BQ3A 1JYIA 3LCPA 1KFUL 1LECA 1F31A 4MLOA 4NRPA 4PIZA 3THCA 3CHXA 4IEUA 5LA0A 1EV13 2DTWA 4YSFA 5FJKA 3CQOA 5A3LA 1AR62 4CP0A 4OHXA 1OBNA 5FZDA 2X5IC 2GMEA 3KB5A 3IBMA 3OGGA 4TLFA 1QJY2 4IEOA 2JDHA 2FQPA 4AEMA 1E5IA 4I2OA 4NWWA 4PDWC 1W8TA 4PI2A 3I2HA 4JKMA 2R1BA 4GWMA 1H8VA 2J1VA 4OLLA 4L92A 3VDDC 3NAPB 4NIIA 3VBRC 4Y4YA 2P37A 1D0HA 1OQEA 4ARYA 4PF1A 4XQWA 5G05L 4FQZA 4BXSV 2VAUA 3ECQA 5HXVA 1N1TA 1RUE3 1A3KA 1ULOA 3AYAA 3VLBB 3UK9A 4GB33 3GJBA 2XBO3 4CDWA 1G9CA 4MH0E 5C33A 4A7KA 2ADDA 2IXIA 1T6GC 3KT4A 5ABJC 4Q4X2 2WNUB 4AVCA 4AXOA 2VNGA 5JOZA 3CJIC 2W92A 1O4ZA 4QHBA 1ZZ8A 3FLPA 1GQGA 1ND2A 3V0BB 1JYNA 4N8MA 1ZA4A 4FTSA 3EB7A 2JJ6A 5HV0A 3C7GA 3LZZA 2V73A 4ZZ8A 3KT1A 3ZYRA 5ISLA 3VDDB 4A7YA 1IKPA 2J1TA 2B7YA 1ND3C 2C5DA 1RUG3 4YFWA 2ZX0A 5BY5A 5JOWA 2WT0A 1XE7A 3DPRC 1NE4A 1HJGA 3IDEA 5LY1A 2FD8A 3C7EA 4P9IA 5FZBA 1F8VA 2WLPA 3WINE 1VAKA 3ZFGC 2OUHA 1QF3A 5DZFA 1VLNA 1W0OA 2P34A 3WW2A 1JYWA 2XLGA 2XVKA 4I0BA 1HRI2 1QXRA 4TWTA 2WLQA 1OFNA 3KHBA 4KBBA 4QPYA 3DYPA 1O3RA 1A78A 2IC1A 2VW0A 2Q1FA 1H1IA 1X50A 1S0IA 5AFBA 1V6JA 2NM1A 3ZPYA 4Q4V1 1CX4A 3AL5A 2Y38A 3EO6A 4LOSA 4XBNA 3KV6A 3THTA 2YPJA 4ITCA 5DUUA 5FREA 1W9SA 5A33A 2PLV1 1GNYA 1YLLA 3NKTA 5A7NA 2ES3A 4WVVA 4BM8A 1XB9A 2FDHA 4IE0A 3MLLA 1OLMA 4IGOA 3E5QA 3MHZA 2D97A 5F32A 1YQ2A 3S5QA 1DGRA 1BYHA 2VZOA 1U5YA 3DV8A 5FV3A 4P9LA 2VG9A 2QNKA 1OVPA 4LBQB 3KF5A 1X36A 4P5YA 3ZXDA 2VCCA 5FMBA 2NMOA 3ZKUA 4EN8B 5IATA 4NIHA 2IFWA 3ETPA 5I91A 1RUI2 1PK6A 4GULA 4AOCA 3O1TA 1VMHA 3CJIA 4OCTA 2ZX1A 5F8PA 3JQXA 4MXWA 4FPYA 1LHWA 5JWPA 3IAPA 1IKQA 5A7SA 4N53A 5F5AA 4QD2A 1GQPA 5FZ3A 3B93A 1HIXA 1REEA 1ZRIA 2XHKA 2Q8EA 1W2OA 3RMXA 1MZEA 3AFKA 3I2OA 1F4AA 4LORA 4QDSA 2PXJA 5L36A 1D7PM 1GZWA 3DPRA 3PUAA 3SITA 4AR2A 5EYYA 1FMD2 1QH7A 4QQ2A 2H6CA 1ZRCA 2I74A 3KS7A 5FY0A 3SH5A 2A6WA 3JQWA 1O3TA 1QDCA 1EPWA 3C3VA 4MO3M 2D6OX 1JMUB 5L7OB 2XQRA 4K6BA 4J1XA 4AI3A 2O0OA 4R8HA 1REFA 3BIWE 1RUJ3 5I93A 3W9AA 2VH9A 4N9HA 3UV9A 3J8F2 4M3CB 5DDJ1 1R092 3K4ZA 3WNOA 1RINA 2CAUA 5FPVA 5IFTA 1CPNA 2CV6A 4Y1ZA 3BALA 1HDKA 4LLFA 4AI0A 5BYNA 3MW3A 4Q4W2 1HV1A 1OF4A 3APBA 1R093 3TEZA 5FYBA 3CDZB 4C1XA 1O3SA 3IPVB 4HETA 3IT8A 4XCBA 3KT7A 5DN2A 4EQVA 4MG2A 1UO9A 2KA3A 2W1WA 4WM8B 2VQUA 1WKYA 3I2KA 3RJRA 4CU6A 4OI2A 4IEWA 4GIQA 4KBZA 3POFA 2WBKA 4CDUA 3LD8A 4IQPA 4N43B 2ZKNA 4AVSA 5A3TA 4YNIA 4IEYA 5KXEA 3AX4A 4AI9A 2A70A 3NV4A 2XDVA 2D93A 1R091 4ZHNA 2VMIA 2ZXQA 4GB32 2YBSA 4MGZE 5FP9A 5KWRA 1W2TA 2OUJA 1G9AA 1YFWA 5KHHA 1ASJ3 5L9RA 4Y33A 4EN6B 2RG4A 4M3CA 1VBC1 4K7JA 4A41A 1UU4A 1ULPA 5DG2A 4F83A 1QOSA 1WMDA 1TNRA 1DU3D 2HKXA 4KWJA 5FQ0A 1AYM2 5LEJA 1UMHA 3FFQA 1GWMA 3A0KA 2W1QA 1LOEA 3B3QE 1ASJ2 2AYHA 1UKGA 4CSWA 4LO6B 2ZA9A 1EV11 1UOGA 3AM2A 3WF3A 3CF6E 3O12A 2D40A 3LIHA 4LPLA 3AP7A 1O4YA 2XJPA 4AGRA 5FPUA 1B35B 4IUGA 1OLRA 5FPLA 4BMBA 2E33A 1CAXA 1UXZA 2OW4A 3I2FA 4YW1A 3DN7A 3SH3A 4Y5TA 1JYVA 1COV2 3JXSA 4AI1A 3WW1A 4FPGA 4YW4A 5D8AB 2B9VA 5D1IA 1BBT1 2E26A 3WNXA 3U78A 1LESA 1XSQA 4YLZA 4IW3A 2I07B 3DCQA 3R05A 2TBVA 1UY1A 2CDPA 2ZEXA 4NN0A 5IAVA 4B8EA 1GYKA 1KRIA 4LBOA 2DCTA 5DG1A 5EFUA 3W21A 4LKDA 3GALA 4KGGA 5DPNA 3EQEA 3X29B 4AL9A 1RUC2 2WNVB 5DQ0A 4HK9A 5DXDA 2JD4A 3I97A 1QQP2 5C5UA 4BQ2A 2P17A 2ID4A 3PMSA 3UJQA 4ZZ5A 4NMIA 2WNVA 4CDUC 3ZSLA 4QHOA 1RB8G 2RR11 1JYTA 2BWCA 4HVOA 2Q8DA 5AFEA 5FK7A 2ZZJA 3ZXEA 5JOXA 2GMPA 2MNGA 2A73B 4NPRA 1TEIA 1SFNA 2XLAA 5D8AC 1VBA2 2A75A 5LWBA 1H4GA 3FN9A 5JZGB 3PHMA 2J42A 4DFSA 2G9ZA 4W6XA 2CU5A 1FXZA 2WFF1 4QXCA 1B09A 1LOBA 3ZYGA 2ZMLA 1UIJA 4B1MA 5T5LA 1NE6A 2WAAA 2LTNA 3GJAA 2W2IA 3LA3A 5EWSA 4BH9A 5CFCA 1ZX5A 4YG3A 3VHRA 5FOJB 3L2YA 2W1UA 4XFFA 1PMHX 3HOBA 5FO9B 3O1VA 1MEC3 2XVGA 4HBNA 2OQ7A 1SMVA 2HYXA 2RMU1 3LPFA 4FFHA 3EXUA 4ZPIA 2Y6JA 5C3QA 4YW3A 4UW4A 3ASIA 5IVJA 3QD6A 1DIWA 2ZMKA 1AX1A 1O4TA 2BBAA 1DYPA 2JDZA 2MPFA 3DECA 4S2DA 5F2SA 2ILMA 2VOXA 3C7HA 3O5SA 4YM2A 1WMEA 1V6IA 3WP6A 4QMAA 2AGSA 5JZGC 5KHGA 3WV6A 1AR71 4BYYA 1XNCA 2JIJA 4FI9A 2R063 4UFMA 1HB1A 4PT6A 5GLVA 3ZYFA 2IXHA 3MUY1 3USSA 2WNEA 1BK1A 3RI9A 4CCOA 3QH7A 3NV2A 2HWE3 5D21A 2YV8A 3CIHA 4E4DX 4LBLA 2F4LA 4RS5A 3WNKA 3KCCA 2Y6KA 3AYDA 4NJ4A 5JOYA 3CJXA 2CTVA 3MO4A 5CAZA 4RGGA 2BNOA 4PQQA 5CKNA 5ANQA 5FDBA 3S0MA 3NJYA 2OX0A 2D3RA 3M1HA 1I5ZA 1F5FA 2QQPA 4DY5A 1AYN1 1GU3A 2AACA 3NMBA 3WG1A 5LW9A 2DBNA 3TNQA 2QQIA 3VHOA 5BNNA 2IXLA 4RSUA 4CXWA 1CWPA 1GWLA 4UYBA 1MR5A 1MS0A 3PNAA 3MBWA 4Y26A 4HN0A 4YRDA 4COUA 4KH9A 1PM7A 2YB7A 2YGLA 4OHYA 5FPAA 2WWSA 3IDCB 4ZU7A 2ZZQA 2OZJA 3S30A 3CO2A 1KGYA 4Z2WA 1V6KA 2WO7A 2BFUS 4D6RA 2VBDA 3VKFC 1K3IA 3J8F3 2W47A 2WAOA 4XEZA 5FP7A 3WF2A 4CUBA 4CRQA 2VGDA 2HWC3 1QU0A 1X82A 1NYWA 2EICA 3NJVA 3R4SA 4FQ4A 2F4PA 3HT1A 4AFAA 5I0RA 5EJZB 4FXKB 5FPZA 4ZKTB 1RL3A 1D4VB 2DVBA 4AVBA 5ACA3 1LGBA 3E1F1 4XQ4A 4D7TA 2UWAA 3ENRA 4JGYB 2P3YA 5F3GA 1I5PA 2XL7A 2JDMA 5T5OA 2A6XA 5GZGA 1ND3B 5GLZA 3ZYIB 2OA2A 5C8CB 4W65A 1POV3 2B45X 4TXWA 2CSGA 1PIV3 4LIUA 5LB6A 1KS5A 3BODA 3AKSA 4ZXKA 1H9PA 2OIIA 2OZ6A 3OD4A 3O7OA 2PHUA 3QH6A 4Q4Y2 3AZVA 4Q0QA 3NO8A 4JKLA 1QNWA 2R1DA 1YQ6A 3HEIA 2GP5A 4QKBA 2W94A 3LA7A 4Y5Z0 1C1LA 2XKPA 2ZEYA 5FO7B 3UESA 3WQ7A 3FX3A 1LHVA 3GHMA 5DUVA 5IHRA 2VVFA 2Q5TA 4GH4B 5A70A 1F5JA 2LS6A 4LTAA 4N53B 5FMDA 4CDWC 1FI2A 1FNYA 2YXSA 2WT2A 4EYUA 1ZA7A 3LGRA 4NHKA 1RXGA 4K8RB 3O0XA 5CIRA 3LEMA 1CAUA 3N9NA 5A7WA 5BNNC 2PQQA 2R0FA 3RMYA 5CNAA 1ND2C 1RUF1 3R6SA 3NNGA 5JIUA 2ZABA 2D7FA 2VZQA 2WS92 1IQDC 5DUXA 1PGW1 4IE4A 3N7KA 1SACA 4UAPA 1POQA 3ABZA 1QXJA 3H3UA 3KSCA 5DDJ3 5F5QA 4CEYC 5CISA 1QWRA 4EN7B 1IS5A 5FXZA 3M4FA 3POSA 3AK0A 4H14A 1OSGA 4D6SA 2GDFA 1Y3TA 4WVMB 3LEIA 4Q0UA 2JB8A 4YW5A 1ZBA3 4GJYA 2RS53 1XC6A 3T3YA 3W20A 3GCWA 4Q4X3 1YI7A 1CIYA 3O14A 3OTFA 4DRVA 2XJVA 3RS6A 1Z7S2 1QOOA 1QGLA 4UBHA 2WA4A 1CAVB 3ZSMA 5C9AA 3BPZA 3A21A 3BPSA 1VBB3 5K0UC 1ZBA2 4LXLA 3FUQA 4IV3A 4YFZA 1QY4A 1VP6A 3E97A 5JXHA 5CU1A 2VULA 1AR93 2R072 4AFCA 4W50A 1JTZX 1J58A 4F3JA 4MGTA 2HEWF 4NROA 1KJLA 1WBFA 2HWF2 2ZGMA 1IS3A 3OGRA 5FY1A 5K4LA 4BHPA 3VBOC 1AX2A 3K4AA 1NY71 1RHI3 2DV9A 2EIGA 3H1YA 2SBAA 4ISRA 5FYZA 4NRMA 1QJX1 3T4VA 3TOJA 2WUHA 3ILRA 4K3UA 4C91A 2L9LA 2ZEZA 4AYUA 3POYA 1U5IA 4QX2A 5H9SA 4QQOA 5KHKA 4LUKA 1PK6C 5GZCA 1TNFA 1QKQA 3GZUC 4BU2A 3CU7A 2K0GA 2PELA 4TYSA 5C5TA 1MS4A 2B39A 4Y4RA 2ZGTA 3POBA 3ACIA 1VR3A 4P9YA 4HANA 4QPIA 1WW5A 2XL9A 1Q8QA 1HB3A 2ZAHA 5C3RA 3F95A 2WYSA 2W87A 3OBRA 1KXGA 4HMZA 3JBG1 3LWCA 4RFRB 4RYDA 3ZOIA 3N9QA 5EHDA 1ODNA 4NAOA 3GBGA 5ERLA 3T2QA 5A33B 5E16A 2VW2A 1UL9A 5HV4A 1OF3A 3I3QA 1V9U2 4XFHA 1JODA 5FY4A 3RRDA 3N9LA 2VOVA 4XFIA 4W6WA 1Z7S1 4LBNA 3OB8A 3ZVXA 5JXIA 2BFUL 2GNDA 2JENA 2JG8C 1W9FA 3FL7A 4OQ9A 2AREA 4NWVA 5T54A 5C4WB 1YIPA 4L9BA 4FSJA 4FPFA 1SFYA 1W2UA 2GNMA 2YY1A 4BPZA 4CUAA 1W03A 5C9AC 2VUAA 4DUVA 1S2KA 1SQ4A 5IWFA 1PMJX 4A3ZA 1SLLA 4CDXB 2X5IA 4JKKA 1V9U1 4S2HA 4UWDA 1C57A 3GGLA 1BCXA 2V72A 2Z69A 2BWAA 2ORZA 2V5DA 3RGBA 4RL7A 3T4HB 5I0UA 3OPZA 5L9BA 1NOVA 3J26N 3TEYA 3HR9A 4GD4A 3FZ3A 1RIRA 3LFMA 5BV6A 2QQLA 3VDDA 1A34A 4CCMA 5F6LB 3MZHA 2ATFA 1CJDA 2VZPA 3ACFA 2BZDA 3P5BA 4LE3A 4P08A 4RFT0 2XJQA 4NPMA 1VJ2A 4XHXA 1UY4A 5BXXA 3RPQA 2CNAA 5HPOA 1RUNA 5IVYA 3OGVA 2OQ6A 3D8CA 2FBEA 4NR1A 2XBO1 1YWKA 5FXWA 4Y5SA 1TE1B 2YGMA 3AP6A 4IE7A 4CDQC 3ZPOA 5C3OA 1VBE1 3PTRB 1W39A 3AXEA 1NCQC 1PGSA 3WR0A 2BOIA 3IM0A 2MEV3 1W8UA 1WLTA 2YROA 4YVSB 2EIDA 1AVBA 2EA7A 2IXJA 4NHYA 2VW1A 1DGWX 2PHRA 3CLPA 5F9TA 1BVVA 1U12A 1FNZA 1RUD3 4R4ZA 3HVDA 1AL0G 1J59A 3U07A 2W95A 3VHPA 3E6DA 2K46A 2PN5A 1PMIA 2UWBA 5FMOS 1DQ2A 2AH2A 1W2AX 2WRAA 3E5UA 2R30A 2P6HA 4XUPA 1EUUA 3PMEA 5DZEA 4G3YC 2ET1A 2WO1A 2ZGRA 4NPLA 4M01A 4CUGA 1OD5A 4M3CE 5DAWA 3POGA 4A45A 1FMD3 2P3KA 2X5IB 5FUIA 2P3IA 3U0ZA 1Q3EA 4XJ9A 3AYCA 4L2NA 3C7FA 1KFXL 5L7OA 3PTYA 4YVWA 4I30A 1Y4WA 4HVQA 2JDNA 4F8AA 3UNPA 3ATGA 2C9AA 2VVDA 3EMRA 3HBKA 3WUCA 4HONA 2HYKA 3B7MA 5FZOB 4MOAA 1H8TA 4CCNA 2ARCA 2XKOA 5F37A 4CCDA 3V0AB 3PUIA 2YFUA 1GOGA 1WCUA 3PUHA 2E7TA 4P9GA 2VMGA 4XILA 4BQ5A 5BNPC 5LCWL 4EJRA 2RS12 1LNSA 3SKVA 2Y8KA 3IZOA 1W2NA 3OEBA 5DAXA 5D2AA 2VZTA 3D82A 4FT8A 4YZ5A 2WQ8A 1WLCA 1DZRA 2ZPXA 5FK8A 3V0BA 4HG6B 5FZ4A 3ZN5A 2ET7A 2VD7A 2VNVA 1K12A 2XXZA 4KU8A 3JB4C 2HEVF 2WNUC 4N53C 1QJX2 1W06A 3VBFB 4AFMA 4UF0B 3AMMA 4B29A 2XUEA 1DQ5A 1NXD1 3KWVA 4JAAA 4E4ZA 2DDUA 5KXDA 1NCRA 2EAAA 3VBFA 2XWBB 1SG3A 1S0CA 2A5ZA 2R041 4Q8LA 2WJSA 4RQPA 2ZMNA 3FHAA 2V4AA 2XLFA 4DQAA 2WS91 3SLIA 4EZHA 5AVAA 3OY8A 1RUH1 3NJZA 4LK7A 3NAPA 4XFAA 1JOJA 4DO0A 1Q8PA 4PIYA 3T2PA 3NV3A 2PHWA 4E8DA 1D0GA 2RE9A 1XYNA 1W04A 4YGDA 2XJTA 2FDKA 3I2GA 5BNPB 3WF4A 3MF6A 3AYEA 3QBQA 1XBFA 3T2OA 1XU2A 5FAXA 3TYJA 4BK5A 4ES9A 5JPMB 2FZ2A 3OG2A 3BI3A 2YG0A 4KL1A 1JYCA 2R043 3G7DA 1W6QB 3PUQA 4QB6A 4XFGA 2Z79A 2PFWA 3P6BA 4B7KA 1Q8SA 2ADEA 2QZ2A 2TEPA 2VBPA 1ZZBA 1F2NA 1UYPA 3ON7A 3IN9A 4MZUA 4CDXC 2FDFA 1BMV2 3N7LA 4P9XA 4PF5A 1C1FA 2GAUA 3H1WA 1DBNA 3MPPG 1K5MA 1T2XA 3WW4A 3KM5A 5F2WA 1CVNA 2WL1A 3AMHA 5FYTA 1A6CA 4WVMA 1QJX3 5CG8A 5IVFA 2H0VA 1AF9A 1XSRA 4MGQA 3WG4A 1QIQA 4FAGA 4IEPA 1W3XA 4KG0A 4I0AA 1YJKA 1LU2A 5FRAA 1QJZA 4GWIA 4AE2A 4BIFA 3NV1A 1E5RA 1EAH1 2RS31 1H4HA 3LDKA 3PVEA 4XE9A 3SXWA 3S6PA 3V64A 4NHXA 3BCWA 3CZJA 4JZRA 4ES8A 2FDGA 2AEZA 2BGOA 4FPCA 4UF0A 2XQXA 4G4FA 3ZYHA 5LA1A 5C7GA 3DKWA 2WNUA 4BDVB 2XGXA 1TME1 4LULA 4XJAA 4JTNA 1O5LA 2VXRA 5LY2A 3VUOA 2Y0OA 4RR3A 1LOFC 1FOD3 1NCRC 3NRUA 1TVGA 1ZBE2 5DZGA 2JD9A 4YVSC 5IUQA 5L9VA 4FO9A 4N90A 5LBBA 4PBOA 4AHXA 1UZWA 1NY72 3IIIA 4O9EA 2WYFA 2D6NA 4AWDA 3W5NA 2VTFA 5FY8A 5CFDA 4FTBA 1UZ0A 4GH4C 1QMJA 1U5XA 1EUTA 3WG3A 5ACA2 5FR3A 3VD4A 4XUTA 3I2JA 3TAYA 3KZ4C 1HW5A 3DKQA 5FZOA 5T52A 3VV1A 1VBA3 1FPN1 2JDPA 5F7UA 4IL7A 4QAWA 1W9YA 5EP9A 1W8NA 1Q5OA 3BN6A 4YVWB 1VBC2 1WA4A 4WV8A 4DEVA 1FOD1 1AR81 1H2MA 3K48A 1HXS2 3ALQA 2ZHMA 4M00A 3T1LA 1V6NA 3CBNA 1OA2A 4QM8A 2FCTA 2ZGSA 2IUWA 2WKKA 2YC2A 4Z07A 5FMCA 5FZHA 5FZEA 4OULA 2Y33A 3H3ZA 4XFBA 1RVF2 5FZCA 1ZYBA 2JX9A 3WP5A 1UZYA 4UI9L 2A71A 5FTTC 3ITQA 1G8WA 2R062 2RDNA 4NO4A 3F2ZA 2A3WA 5IK4A 2RHPA 1JUIA 1FPN3 3I49A 2LUWA 2YC4A 2QQWA 1WMFA 1H1AA 1LEDA 2WN3A 5J1XA 2B4KA 3DPRB 4BQ1A 4FCAA 5A6YA 1HKDA 5IW0A 1PO21 3EYPA 4Y24A 2V4VA 4DUWA 1HLCA 3D6EA 1UY3A 4AAXA 3T1MA 5E88A 3RZLA 2GC3A 3GDBA 3JBG3 1GR3A 1W6NB 1MQTC 4QXKA 2R073 5FYMA 5FJHA 2W1SA 2WNVC 4N43A 3LF7A 3DXTA 4D0QA 1C5HA 1VBE2 1AR82 4QDRA 4QQHA 4YPJA 3Q8CA 1SBDA 1UPIA 3LQCA 4CCLA 5FBZA 1IG0A 1O5UA 1POV0 1W0PA 1J1TA 3VBRB 4EROA 1PVC2 4IERA 2YFZA 1BVP1 5FYIA 2RS52 3TWIA 3E6BA 5CFDC 4TTGA 2EALA 2D5FA 4PDWB 1OMIA 2YU2A 4Q29A 3UJOA 4BZ4A 4LITA 4Q0SA 4XW3A 4Y1VA 5HBAA 3KD4A 4LA2A 4MYEA 1W6MB 3ACLA 3U37A 4PLOA 3WOGA 3H7YA 4DMIA 2DWRA 4LR4A 1GP4A 1OT5A 4JDMA 4CEYA 4K20A 5T50A 2P6CA 4D94A 3QLQA 1BEV2 3LIGA 1STMA 4O7XA 3OPTA 4QU2A 3SEEA 3ZYJB 4AFBA 1AX0A 2JKBA 2VY0A 1YQ5A 3HN1A 3AC0A 1I6XA 3I2DA 4BJ0A 4DPNA 2WSUA 5JLVA 4LT5A 3KV9A 1W8OA 4WM7C 4QPGA 4XDOA 3VD7A 1VRH2 1JN2P 1XNBA 2GNBA 1VIWB 4S2GA 4ASMB 5GJ6A 1PO12 4RHV2 5EXOA 4LO8A 1NLRA 1GV9A 1O6UA 1C8M2 1ST8A 1J3PA 3G6JB 3UGGA 1HRV2 3NJXA 5FCCA 1DLCA 3J8F1 2VQTA 3VD5A 5K0UA 5FKBA 1TQ5A 4I0WB 4MX3A 4JRAA 1GZWB 5LBFA 5FXVA 2DUPA 1OPOA 4Q0PA 4L97A 1ZZ7A 2ZHLA 5GKAC 3MIHA 5JSRA 4DXSA 3I3BA 1LU1A 4BQ4A 4AGVA 2WZR3 3BU7A 4QPWA 1OPMA 1W99A 4XDQA 2W52A 2HBUA 1NG0A 4HL0A 3INAA 5FIXA 3VB9A 4DXTA 4Q4V3 4QHZA 3WDWA 4EE2A 4J1WA 3MV01 5FYSA 2Z42A 3UKVA 4XJ8A 3SMHA 3GM8A 1UKRA 2PLV3 2TUNA 3PLQA 1F15A 2H0BA 4HT1T 3OPWA 5BNOC 1AL21 1JH5A 2DVGA 2C6SA 1QEXA 3A7QA 4R9CA 4CP9B 4AK3A 5GM0A 1AYN3 4DB5A 3MDPA 4RR3B 4FTEA 4XJUA 3KQRA 3HMYA 1YNAA 4QGMA 1DFQA 5A7WB 5CG9A 2GMMA 5T3NA 3BU0A 1UX6A 4K8FA 2HWB1 4QPIC 4D69A 4CCEA 3K4DA 1G7YA 4JTOA 4PI0A 4XOGA 3NWKA 4G9SB 3WF0A 3IAQA 4MHUA 2JE9A 2WZ8A 4GKYA 3FHIB 3B94A 4LMFA 3VGIA 3VBUC 3GXUA 2R7EB 3ZYBA 2RM21 4E27A 2BBVA 5IYYA 5FZAA 5FZ8A 4AF9A 5FWJA 1HN0A 2VNOA 4LBQD 4PQ9A 4DNYA 1MS3A 4YZ4A 4YM1A 5A32B 4ZY9A 3RDIA 3UYJA 4QPGC 1OI6A 2R49A 3WUDA 2IXKA 3FLRA 1OOPC 1RVF1 3J7HA 1DGLA 4N7IA 4Z1VA 3M3CA 4QQPA 1UCXA 4QU1A 3ZO0B 4D6QA 1RUJ2 4XJWA 5C70A 1US3A 2HWE2 3TBDA 4Z2AA 4OMDA 5C8CC 5KC6A 2WC2A 2VZSA 3ZSKA 4Z8BA 1N3PA 1GLHA 1RGSA 3AL6A 2FZ1A 2FCUA 1SLAA 4LHNA 2EXIA 1NQJA 1Q8OA 2BGCA 3VZLA 2DFCA 1MVQA 3LDBA 3VBSB 5IVCA 1JU4A 1VRH3 1UYYA 1YO8A 5JMOA 4IGQA 4KWLA 1VB2A 1ASJ1 1UX7A 5F6KA 5FQ0B 3BKZA 3VZMA 3E6CC 2PA7A 3R4UA 1NZCA 1RUJ1 3ES4A 4A2UA 1RVF3 3HNMA 4EN0A 2G1MA 2ZGOA 1VBD2 3D5OA 4CA9A 4Z92B 1Q8VA 5A7OA 2RS11 4AEDA 2DVDA 4DEQA 3OYWB 1MZ5A 4FP2A 4XMIA 1ALYA 4QWNA 3PUSA 1UAIA 4RGKA 4CDWB 3SISA 1QNYA 3N9MA 2DU1A 4HFSA 3J7NA 1O59A 1PGW2 1ZBE3 5FZGA 3K2OA 1H0BA 3Q9OA 2X05A 4A44A 4C8DA 2O8OA 3JD71 3WDTA 2PYTA 4ET7A 1L7RA 1PGL2 2CAVA 2YBPA 2PHLA 4COZA 5IAXA 3RFRA 2D6KA 3Q8BA 3K51A 4Y20A 4Y1XA 5J7MA 5EJ3A 4O61A 4QQLA 3VBHC 1BEV1 2I45A 1RUG2 4DZGA 4FFIA 4XDPA 2ZX2A 4IV1C 3ZM8A 1WCKA 2AEYA 2OVUA 4JQRA 3KCXA 3DXUA 4CDQB 5FZFA 4NHMA 2D3SA 3DL3A 1JU3A 4PIXA 1GKBA 1SLTA 2B46X 1LKNA 2ZJCA 2ZGNA 2RS51 1UY2A 2VUCA 3PL0A 2ZX3A 1FV3A 1R081 4XXAA 3RJ2X 3T2TA 5JXGA 1OOPA 1YXWA 3AP5A 5FMOL 3AZWA 1RUI1 2VQ0A 1TZOA 3PDQA 5FZKA 4BLJA 5I0DA 1F4HA 2BPA2 2QDRA 3U11A 4CUCA 4EWDA 4YM3A 1SEFA 4WVWA 1VBB1 2W46A 2FCVA 4IV3C 5FLIA 2VUJA 4K9SA 4NIAA 4MGYE 4OMCA 4CE8A 4XQDA 2GP3A 3M70A 2QQNA 2YC0A 3H8RA 5H9RA 1R082 1AXKA 1COV3 1BBT2 1RUOA 1RTVA 1W3VA 1RUE1 4XJZA 4Q4Y1 3WLUA 1S2EA 2K2SA 5FBJA 1H8TC 3FWEA 2RMU2 1EY2A 3RSJA 4N9IA 3DYOA 4OYUA 4BQWA 1RHI2 2R071 1HRV3 1KDKA 1QHDA 3ZLIA 4AEDC 4FP3A 4GMP1 3ZR5A 4AQTA 1MACA 4OI1A 3CNAA 1ULFA 1KEXA 4BQXA 1EV12 2VU9A 4KMQA 2RMU3 4HPKA 1RMU1 2VUDA 1JBCA 3PU8A 4UW5A 5ABJB 1PGL1 2OT7A 1EPZA 4MSVA 2QQKA 4YG0A 4CXXA 4XZPA 3AZZA 5L19A 1PIV2 3TN92 1WA6X 2GU9A 3O1SA 5CB7A 2BGPA 5FXXA 4XBQA 3JBG2 2PAEA 3AMPA 3PURA 1T6BX 2D3PA 1CQ9A 1D4M2 1NXMA 4Q0VA 4XABA 4XF1A 4XVHA 5FP3A 5FZ9A 3PVOA 3HNYM 4LK6A 2GN3A 2ZX4A 2GH8A 4XF0A 3TB0A 4ATFA 3BUCA 5FKCA 1VBE3 1YYNA 4CEWA 1ZRFA 2VZUA 1MVEA 3ROUA 4E4SA 5JXJA 2DYCA 1FV2A 1MPXA 2W5FA 2EXJA 3I54A 2RV9A 1LOAA 4RS5B 2KXLA 5A3WA 3DUIA 4ORFA 2BNNA 3BVCA 2VCBA 1X9TA 4QKNA 1LHOA 1TMF2 3FLTA 1DLLA 1DQ0A 2DCZA 3HWJA 1AXYA 1N1VA 1RMU3 1J3QA 2VOWA 2YU1A 2YHJA 3QOPA 2A6ZA 1D2QA 3M3EA 2YBKA 3H8UA 4L11A 4RHV3 1ULCA 1AR63 4XACA 3MI8A 3VBSA 2XB6C 2PAMA 5C3PA 1K5JA 4JC1A 4YM0A 2E31A 3UT0A 3DYMA 2JICA 1V9U3 1B35A 5I0SA 1WD3A 2VMEA 3NL1A 2N7GA 5HXMA 4IV3B 3POJA 1OD3A 1DDLA 4M4PA 2DU0A 2KR2A 2VMCA 1DGWA 3S5AA 1W0NA 4U2AA 3A22A 2V09A 3ES1A 2WFPA 1R1A2 2VZRA 2P5BA 2X09A 4W4ZA 1FATA 2VTXA 3URFA 2PQSA 3Q8FA 4HKWA 4PHZA 4BCUA 1PZ8A 2Y60A 4LO7A 3FHQA 1FT9A 4IEVA 4UW3A 3CZUA 1AR73 3OBAA 5I8YA 1VAVA 3H7JA 5T5PA 1LODA 3ILFA 4HZFA 4X8NA 2CDOA 2D44A 2B8MA 5KXBA 3LPGA 4FBFA 3T0BA 1PK6B 3FFZA 1HB2A 1PZ7A 2HWF1 3VD3A 3WZ1A 5CBLA 4V2VA 2C24A 3UKTA 1ZZCA 1QJU1 1Y43B 2CL2A 4NRQA 3ST7A 3FBYA 3I59B 4R9AA 5LASA 4CP1A 5GALA 4D7SA 3T0AA 2UU8A 1ACCA 2RM23 4QXHA 3VBOB 1GBGA 2J7MA 2OXBA 2PHTA 1NUKA 2WO3A 1HJFA 4OFGA 3IPVA 4Y1UA 1HQLA 2V5YA 1ZRRA 5CFCC 4HPKB 3GYDA 1RJ8A 1OKQA 1KDMA 1VMJA 4DRRA 1NT0A 1VRBA 2NYYA 4LEJA 3U4SA 1ZREA 2C0ZA 1MQTB 4UFIA 1FMD1 3HIFA 3IWZA 4INDA 3HD8B 2Q8OA 3WDVA 5EPAA 1YJLA 4FFFA 2WWUA 3WXPA 3JU9A 1VALA 1MS8A 1IG3A 4JGZB 1GZ9A 5C9AB 3K75B 3S7IA 1F9KA 2VOTA 1LOCA 3BOWA 3R4DB 4XAAA 4LBMA 3NSTA 1EYBA 4UFHA 1ULDA 1H6XA 1SLIA 1W6OB 2VOKA 4JX0A 4JGYA 2E63A 3IKWA 4COYA 1D2SA 4OHVA 5FOBB 5FUNA 4GXLA 3MV11 5FZ0A 3O0WA 2W3JA 5A3NA 4BB3A 3T0DA 1H1MA 4FPEA 2VMHA 3ZFFB 4LIVA 1XJAA 3S7EA 4B4PA 5JI9A 3AJZA 1JI6A 1PO11 4FFGA 4CXYA 1G86A 4L99A 5FZ6A 1XRUA 1MQTA 4AEKA 1ZBA1 3J7MA 2XVLA 4Q5OA 2OS2A 2Q8CA 1LENA 4CDUB 3KHCA 2Y6FA 4BA6A 1S0GA 2NP0A 1ULGA 1V6LA 3RZZA 3FC0A 5FY9A 3THDA 3UETA 3VBFC 3VZKA 1XOYA 5A1AA 4Y1YA 1G9BA 4URAA 2BNMA 2NN8A 1Z0HA 2GNTA 2AC1A 3OBZA 4CYDA 2ZGPA 3MF9A 4LO4B 1SCSA 2WS93 4CPBA 2JG9B 1E57A 1J83A 2FMYA 1GNZA 1APNA 2WNOA 2Z4FA 3IDAA 3NAPC 1PNGA 3AVRA 2ERFA 1PO13 3OUHA 4OZOA 3T08A 1W05A 4AVTA 2NLRA 4GJZA 1YQ8A 3A4UA 3SQOA 3OOXA 4DXRA 2DUOA 5GLWA 5HI0A 4GMP0 4R4XA 2E7AA 1KITA 3BTAA 3NQHA 1V70A 3OYWA 4HSLA 4XTMA 3ZIWA 1HRI3 2BERA 5IK5A 3HNBM 3RWNA 4DOUA 1HQNA 2Y34A 4CU9A 3LDRA 1CIWA 2HLEA 2YZ4A
chains in the Genus database with same CATH topology
1ENRA 2E51A 1WLWA 3VHNA 4AG4A 1JW6A 4CDXA 3ZXFA 3RI8A 2RS13 5KHIA 1K5MC 4Q1PA 3VKLA 4Q4Y3 1AJOA 4E9KA 2B42B 2A7AA 1DHKB 2WFF2 4Q4W1 1Z78A 4K40A 4Q4X1 3RNSA 1GANA 4PCRA 2WINB 3V65A 5GZDA 1BKZA 2VQAA 4GMP3 5JI7A 4A7ZA 4GKXA 2O1QA 5CA6A 4AFDA 5I8TA 4D7YA 1HQWA 1SBFA 1Z7S3 2JG8B 3MIDA 1QDOA 3LSDA 1AR91 4FPJA 2FHRA 4XIKA 5BNOA 4C0BA 3EHKA 1ZZ9A 4O9GA 3LSEA 4Y22A 4AHYA 3PVNA 4XF4A 1R1A3 1U5ZA 2AR6A 3OGJA 4YVSA 1IPJA 4PBPA 4AHWA 4X6RB 4RQPB 2XJRA 3CJIB 5IK7A 1YUDA 2O8QA 2PHDA 3AMQA 5HCAA 4CEWB 5SV8A 4M0HA 4FAHA 1BJQA 2DCYA 2ZS6B 3ZXJA 2JEMA 1MEC1 2ZBJA 2BTVC 1VBD1 1RITA 4B7EA 4YGEA 1VBA1 4YARA 3MPBA 4NOTA 1DQ4A 4SLIA 4IEZA 3UKNA 3RYKA 5KXCA 3N7MA 2XJUA 1AYN2 4WZCA 1H2NA 2R061 4XTPA 3B5LB 5AVPA 4BIOA 4D3WA 2Q30A 3H50A 4MV2A 2ARBA 2AUYA 1WGPA 3NKGA 2NQYA 1VBD3 2DTYA 1O3QA 5LK7B 1OA4A 1AXZA 1WW6A 1YCIA 5K0UB 2YMZA 3ZXAC 3TN93 1XNKA 4QPGB 4GB31 1IZ3A 4AQ6A 4OI0A 2QZ3A 4KGQA 2WZPP 1AR72 2W08A 1IPKA 1GNHA 4ONUA 4ISQA 5J48A 3FE5A 4KU7A 1OLQA 1NLSA 4IXLA 1CD3G 1WLDA 1RJ7A 2GSYA 4CEYB 1R1ZA 2Q1ZB 2DURA 3N3HA 2PHXA 4XXPA 1NCRB 4UW6A 3TN91 1DQ6A 3OCPA 2HEYF 1LR5A 4J6GA 2EXKA 4P14A 1EAH2 2RS32 2GH2A 2X29A 1PNFA 1GFF2 2EAKA 4MGIE 3ZYPA 4XMAA 1WW4A 4CZSA 1V00A 4YZ1A 3M2MA 1CR7A 4DXZA 2ZKLA 1AHSA 2HWE1 2JG8A 2Y0IA 1QQP3 1PIV1 2GC2A 2MEV2 1UU6A 2WSVA 2X8KA 3AP4A 2I2SA 1OQDA 4XFCA 2OYZA 3LOIA 1UN1A 1S0EA 1O91A 2ZACA 5I0TA 1W6PA 1S0JA 3WHTA 1LHUA 1C28A 4JDNA 4W6YA 1ZZ6A 2JE7A 4OUMA 4NHLA 1FYUA 5FLJA 1Y7BA 2HWF3 5FFOC 1S0BA 3WY6A 2CGOA 2Z5WA 4QM9A 1KD7A 1N3OA 1KS4A 3ETQA 1XXNA 3FUOA 3THPA 1GZCA 3VL9A 1IGOA 1N1YA 4CDQA 1XE8A 2W0XA 3WP4A 4XF3A 5F1RA 3ILNA 3ZMNA 5GLUA 1NCQA 2IFRA 2WZR2 1BQPA 3WD5A 4MXVA 5CFDB 4Y20B 5BNNB 2WQZC 4BWOA 5KHJA 5KBFA 3PVBB 1VBB2 1X8EA 4WBBA 3D0JA 2G9GA 4BE3A 1WD4A 4RA0A 4B4RA 1POV1 5CADA 2ZHNA 5LEKA 4KQ7A 4XF9A 1KJRA 4AGGA 2VNRA 2BVBA 1RUF2 1G9DA 5LRSA 4R52A 4YZ2A 1BMV1 1NQDA 2JG9C 1W6NA 3SCHA 3JD73 5A3MA 1TME2 4QX5A 4KG8A 1LULA 3GF6A 4COWA 3JCIA 3MFCA 4X6QB 3ZFFA 4OHWA 3PJQA 2ZGUA 3AKRA 3HT2A 3WHUA 3VBSC 2DVFA 5C8CA 2F6BA 5D8AA 5I8SA 5L7OC 2K9ZA 1VAMA 2R6QA 1X8MA 4QGLA 1N1SA 1ENQA 1R083 2LM3A 1CAXB 4Q4W3 2E9QA 4UXAA 1SBEA 1IQAA 3WQ0A 3PJYA 2GALA 5EV7A 3I4IA 4WVZA 1TMF3 3H0OA 3TRSB 3ZXKA 2P2KA 5BNPA 1PO22 2UURA 4C1WA 1X33A 4FOYA 1BXHA 1VB4A 5DUWA 3MGUA 3SCFA 5CFCB 4FOWA 4I3GA 4OZXA 5EZWA 1IHMA 1PHMA 3POWA 5JR7B 3SHRA 2UWCA 1AR83 4LHKA 3AKQA 4BOWA 5JZGA 1HV0A 1PVXA 4I02A 4LLOA 5JVVA 3MLKA 5JIAA 1YIFA 4JCKA 3VBUB 2AZ5A 3H1MA 4RQPC 3VBHA 2D98A 4IV1A 4PLMA 5JSPA 1WCSA 4YGBA 2A6YA 3VBHB 2JG9A 5E8AA 3ME2A 1I1EA 2Q0AA 3W59A 2Z2SB 1CJPA 2ENRA 4S2FA 1MZFA 1N3QA 1S1AA 1RHI1 2BYVE 3MEPA 3FBMA 2WFF3 1RUI3 1AYM1 1IS6A 2XUMA 3WCSA 4COVA 1SLBA 2RR12 1RMU2 2BUKA 5FO8B 4OVEA 1ONAA 5T5JA 3ZXGA 5J3UA 3N4MA 3N36A 1WBLA 3AKTA 1NA1B 1ND3A 4EN9B 4FPLA 3U10A 3H9AA 1LEMA 2QCSB 1AYM3 2B9UA 2P3JA 4BLIA 5C6CA 1CAWB 2PLV2 1G6NA 1C8M1 4HKLA 3OJBA 4JGZC 1OOPB 2KM2A 1WCDJ 2EF6A 3AB0A 2R042 4FPKA 3D4KA 1ENXA 3IDBB 3LOBA 3DGTA 2B5HA 1LOFA 3MLJA 1PO23 3VL8A 2PTMA 3JD72 1KQRA 3ZSJA 1REDA 1CAUB 3WP3A 2XBO2 4XYXA 4I01A 4WM8A 4GH4A 1XNDA 5T55A 4E2QA 1N47A 1H2LA 2QFEA 1RUH2 1M4WA 1ZVFA 1S0DA 3KGZA 3V0AA 1RUG1 4RHV1 1H9WA 2ZGLA 4XIOA 4DS0A 2LALA 1B35C 1UZZA 4ATEA 1CAWA 3B69A 3OF1A 1ZM1A 2Q4SA 1AJKA 1LHNA 3DF0A 2X53S 2D6MA 4LHLA 2QJVA 5GLTA 4K1YA 3N35A 3J9SA 3VN4A 1RUD1 5BPXA 1W6PB 4M3CF 4GWNA 2UYBA 1NA1A 2JECA 1ENSA 4K21A 3L9JT 4BMEA 1J3RA 3RYRA 4TSVA 3FMGA 5J98B 1OA3A 2CGNA 3QACA 3M3OA 4JGZA 4NVPA 1H2KA 2HWD1 2SLIA 1CN1A 3VZNA 2WIIB 3B02A 3SNMA 1RUE2 3W58A 1D4M3 2WZR1 1J1LA 4MXWB 2PHFA 2XH6A 2EVXA 2DF7A 4Z82A 2A3YA 4M0NA 3KCYA 3VBOA 1LOGA 2NPIA 1UIKA 4FPOB 4H7MA 4AHZA 1DYKA 1RUF3 4Q4V2 1VRH1 2D5HA 4CP2A 3I7DA 5AC92 3WVJA 1WUVA 4HSJA 2ZHKA 3KMHA 3MFAA 4AVAA 2CWSA 4H3WA 1S0FA 3VZJA 2Q1MA 3NVCA 5ACA1 4EWAA 1YFYA 2HWB3 1D4M1 2VVEA 4WM7A 5DDJ2 3KLSA 5H9PA 2A6VA 2BQPA 2R16A 5J09A 3OD0A 4AEJA 4H7LA 5HCBA 3D0SA 1Q43A 4RD7A 2NMNA 5J37A 4YYOA 1S55A 4LE4A 3WDUA 1MS1A 2DCJA 5K8SA 1K5MB 3MIBA 4YG6A 1JXNA 1GSLA 4JGYC 4E2SA 4AQSA 4FPHA 1L3JA 4PLNA 3B9IA 2VECA 1UW8A 1NA1C 1MS5A 1BEV3 2G4IA 1CAVA 4MVTA 2TNFA 3HAGA 1CESA 3ZFEC 5FPXA 3ZSEA 4IEQA 1A8DA 1ULEA 2OPKA 4GQ7A 4IESA 4UBGA 2DFBA 2PAKA 4META 1C5IA 5L73A 5C4WC 1I3HA 4HLTA 1SLCA 3MW4A 3VKOA 3AP9A 5J36A 4MGKE 3WCRA 2RJKA 1QJU2 3CL1A 4AVVA 2GC1A 4B4QA 3I59A 1RUC1 3QCWA 3C2UA 5GZFA 2ZAAA 4C90A 1LGNA 4OI4A 2ZTNA 1COV1 4FOQA 3RYPA 3HBZA 3VBUA 2A3XA 4DINB 4JVAA 3ZMOA 4AI8A 1DGRN 2QKDA 1ZBE1 1ZRDA 4N7UA 1HRV1 3LA2A 1YFXA 1VBC3 2CYFA 1NCQB 4IETA 4EWEA 4YW2A 4QGNA 2RR13 1EAH3 2RS33 4H55A 4I09A 4Q1RA 5H9QA 3SH4A 4E2GA 2FMDA 1UF2C 1CPMA 3JB8A 5IT6A 4XPVA 2W68A 2QUOA 1YFUA 2WT1A 1YI9A 2QVSB 1TME3 2E53A 3ELNA 1XYOA 2NZ9A 4P9WA 4YGCA 1RUD2 4ZU4A 2MHFA 1OHFA 1HXS1 2G9FA 5E89A 3A0NA 1C8NA 4B3NA 1PZ9A 3CEWA 1YHFA 1AL22 4GA9A 1OQ1A 3USUA 3ZFEA 2XJSA 3EJKA 4JDOA 2YUEA 3USUB 3ZFEB 2XG3A 1C4RA 5C4WA 1AZDA 1BBT3 1AUYA 2BW8A 5LRRA 1UD1A 3UL2A 4FVVA 3GHNA 4YVWC 1ND2B 2XPJA 1URXA 1LTEA 1IS4A 4AW7A 1EP0A 4Q8KA 1AR92 1FX5A 3ZN4A 3AZYA 2MEV1 3L2HA 1FAYA 1QOTA 3AMNA 1RC6A 2HWD2 4Q26A 3ZN6B 3MW2A 2GC0A 2E7QA 4KWKA 3RG0A 2JXAA 1DZQA 3ZX7A 3ZXLA 4LBKA 3GBFA 4XBLA 1GICA 1DF0A 3LB9A 1GQHA 3FJSA 3AXDA 4AEDB 5FLHA 3B9CA 1UU5A 1C3HA 3NW4A 4AQ2A 2CWMA 1XU1A 1LGCA 1XYPA 1QH6A 3ZFFC 1SDWA 5SV5A 2YYOA 2QDNA 4FOVA 2ETEA 1C8M3 2HWC2 1IOAA 1G9FA 3M3QA 2VPVA 4OUSA 2W39A 2DVAA 2GZWA 1FPN2 1QQP1 2DCKA 3LKJA 1W6OA 3ZIXA 2ZOEB 4RGAA 3AZXA 1MZ6A 3OBTA 3N7JA 1AR61 3WDYA 1X7NA 2GN7A 1HX6A 1QJY3 3B01A 4V1PA 5JMCA 5B2GB 2HWC1 3V56A 4I3PA 4TZDA 1M06G 3VZOA 1W6QA 2HWD3 2ZGKA 5K9YA 3WDXA 5JCTA 4L8QA 3WQ1A 2E6VA 1DZTA 2D6LX 3EBRA 1SCRA 4Q2FA 1U0AA 1PVC3 1V6OA 2D43A 5A32A 3WW3A 4PJYA 3BB6A 5LK5A 4URTA 4QPIB 3M3IA 4P5HA 1H30A 4CTEA 1QJY1 1UMZA 2ZGQA 5TSWA 3OY8B 4CEWC 4LO5B 4IV1B 1I9RA 5AC93 3VKNA 5GZEA 4LBQA 1QXPA 3ZDSA 1LJ7A 3P3NA 3J4UH 4AI2A 3JZVA 4HKOA 2YDEA 2CY6A 2BEOA 1QJU3 1PVC1 1WW7A 1ZNPA 4C0HA 4KNCA 1JHNA 2RM22 4Q27A 2WA3A 4RR3C 3MYXA 2UY9A 2QE3A 1OFSA 1Q56A 5JPNB 2ARXA 4Y22B 1AL23 3KGLA 4HK8A 5BNOB 3M7AA 1UPSA 5AC91 2D6PA 4GALA 5JAXA 1XQNA 3HQXA 4LA3A 2BVVA 4LUMA 4X8PA 2H6BA 3MICA 1JUHA 4K1ZA 3VKMA 4HVRA 2CGPA 2AENA 3GZAA 5JSOA 2R0HA 4OHZA 1CGPA 2XWJB 1V6MA 4WZFA 5E1RA 1HRI1 4R9BA 3GZTB 2IXCA 5K7PA 2IZWA 4A3XA 5IK8A 3TNPB 3WG2A 4MUVA 4U36A 4XETA 1MS9A 4DY3A 3P3PA 2BPA2 1FOD2 1RUC3 4WM7B 4XHBA 3RQ0A 2WQ4A 2HWB2 1RUH3 4PDWA 2UY8A 2ZCWA 1W6MA 3AJYA 3E5XA 2DUQA 3VBRA 3WT3A 4WM8C 4RS5C 4JRLA 5C8WA 1DG6A 5BNQA 3MIEA 3R0RA 2EXHA 3WX5A 3U4XA 2HJIA 4N43C 4R9DA 2IWGB 1S2BA 4LNVA 4HN1A 5ABJA 1LRHA 4EV0A 5BUVA 3B00A 3GNEA 4JV4A 5CVRA 3O0VA 1A8MA 3MIFA 1H8TB 1R1A1 1MEC2 3SCGA 3BOPA 4ZU5A 4FXGB 3IIAA 4SBVA 3JUUA 3IMNA 1HXS3 1Y9QA 5JDBA 2Y26A 3AKPA 4P9JA 5EYXA 1DQ1A 1BZWA 3M8LA 4YZ3A 1TMF1 2UYAA 3LAGA 3ZFGB 1LCLA 3AFGA 1CONA 1O7FA 3GBWA 1LB2A 3I8TA 4ASLA 5HCFA 4LBJA 3ZFGA 3MIGA 2C1FA 4F7ZA 1YRZA 2RJLA 1JYIA 3LCPA 1KFUL 1LECA 1F31A 4MLOA 4PIZA 4IEUA 1EV13 2DTWA 4YSFA 1AR62 5A3LA 4CP0A 4OHXA 2X5IC 2GMEA 3KB5A 3IBMA 3OGGA 4TLFA 1QJY2 4IEOA 4AEMA 2FQPA 4I2OA 4NWWA 4PDWC 2R1BA 4GWMA 1H8VA 4OLLA 4L92A 3VDDC 3NAPB 3VBRC 4Y4YA 2P37A 1D0HA 1OQEA 4XQWA 4FQZA 3ECQA 5HXVA 1N1TA 1RUE3 1A3KA 3VLBB 3AYAA 3UK9A 4GB33 2XBO3 4CDWA 1G9CA 4MH0E 5C33A 4A7KA 2IXIA 1T6GC 3KT4A 5ABJC 4Q4X2 2WNUB 4AVCA 4AXOA 2VNGA 5JOZA 3CJIC 1O4ZA 4QHBA 1ZZ8A 3FLPA 1GQGA 1ND2A 3V0BB 1ZA4A 4FTSA 2JJ6A 3LZZA 2V73A 3KT1A 3ZYRA 3VDDB 4A7YA 1IKPA 2B7YA 1ND3C 2C5DA 1RUG3 4YFWA 2ZX0A 5BY5A 5JOWA 2WT0A 1XE7A 3DPRC 1NE4A 3IDEA 4P9IA 1F8VA 2WLPA 3WINE 1VAKA 3ZFGC 2OUHA 1QF3A 5DZFA 1VLNA 1W0OA 2P34A 3WW2A 2XLGA 2XVKA 4I0BA 1HRI2 1QXRA 4TWTA 2WLQA 1OFNA 4KBBA 4QPYA 1O3RA 1A78A 2IC1A 2VW0A 1H1IA 1X50A 1S0IA 5AFBA 1V6JA</