1SBDA

Soybean agglutinin complexed with 2,4-pentasaccharide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
234
structure length
232
Chain Sequence
b'AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENEDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOYBEAN AGGLUTININ
molecule tags Lectin
publication title X-ray crystallographic studies of unique cross-linked lattices between four isomeric biantennary oligosaccharides and soybean agglutinin.
pubmed doi rcsb
total genus 45
structure length 232
sequence length 234
ec nomenclature
pdb deposition date 1995-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sbdA00
3N7KA 4AGRA 4YGCA 5BYNA 3N35A 4UW4A 3DUIA 1PZ8A 1MZ5A 4LBMA 4Q8LA 2D6KA 1VAVA 2A3WA 1V6LA 1UAIA 4LBQB 1LESA 2WSVA 4WVWA 1GYKA 3SISA 4BLJA 4DRRA 1LHVA 1QNWA 3HN1A 4LBOA 3WHTA 1BZWA 1PZ9A 1KRIA 1VIWB 3AX4A 1W6OA 4K20A 3O5SA 3WHUA 1CONA 4PBPA 3MW3A 4GWMA 1ZA4A 1LODA 2R1DA 3WVJA 3POSA 1YRZA 2A6VA 4LBJA 3D6EA 4IQPA 1F5FA 1GNHA 4YZ4A 1W6PB 3NV1A 3ZYRA 2VXRA 4Q1RA 2WSUA 1G8WA 1QNYA 4YW5A 2VH9A 1GSLA 2DUPA 2B7YA 1N3QA 4ASMB 1B09A 2GDFA 2Q5TA 2LTNA 4FQZA 2CTVA 2ZGOA 4HL0A 2NZ9A 4M3CA 3IKWA 1FNZA 4UW6A 1SBEA 2I2SA 5GLTA 1RIRA 2A6XA 3WDYA 1N1TA 1Z0HA 5JOXA 5JOZA 5IK8A 3UK9A 1JOJA 1LHNA 3WG1A 2A3XA 3O0WA 4FPHA 1WD4A 4TZDA 1V6NA 2D6NA 3SH3A 3T2TA 3VV1A 2NMOA 2EXHA 1F9KA 2FHRA 2EIGA 1LOFC 1UZZA 3V0AB 4W65A 1KQRA 2A3YA 1QDOA 3VKLA 1SCSA 3V0BA 2CY6A 4LBQD 2P3KA 3WG4A 3N36A 1R1ZA 1G86A 1SLLA 3O12A 3OYWB 3OPZA 2CWMA 2DUQA 1BKZA 3ASIA 4DQAA 2E53A 3AP6A 4DRVA 2EF6A 1S1AA 1CVNA 1LJ7A 1SLAA 4JCKA 1O4YA 1UL9A 2YY1A 3B01A 5JOYA 4L8QA 4XJ9A 2KM2A 2WLQA 3FBYA 4Y1ZA 5IK5A 2DVFA 3FLRA 3W59A 3BIWE 5H9RA 3TAYA 2JECA 4FPLA 3R4SA 1JHNA 2GN7A 1WW5A 2E51A 4XMAA 1H9WA 5EXOA 1HLCA 3UJOA 1GZCA 1YIFA 2VW0A 3C2UA 3D5OA 4FOWA 4MYEA 5DG2A 3FUQA 2D6MA 2SBAA 3SH4A 3SITA 1AVBA 3WV6A 2JE7A 4HANA 4K21A 5F5QA 4D69A 1UKGA 2D3PA 2UWBA 3O0VA 5E8AA 5JDBA 5KXEA 3RMYA 1CJPA 1SCRA 4YW4A 2RHPA 1UX6A 1W6MB 3AJZA 4CTEA 4YM3A 2NN8A 3AXDA 1ENQA 1LU1A 1GZWB 1QGLA 2R49A 4FOVA 1JUIA 5KXDA 4GKYA 3A0NA 4ZXKA 4XJAA 3M3EA 1MACA 2D3RA 1VAMA 2R16A 1N1VA 3AP5A 4I30A 1LU2A 2R1BA 5AVAA 4XTMA 1S0DA 1WLWA 5CBLA 1S0IA 4YW2A 5JMCA 5GM0A 1LOEA 1G9BA 2C9AA 2D3SA 1IS3A 2ZAAA 2ZGLA 4NO4A 1C1LA 5LK5A 1Q8VA 4YGBA 3WG3A 3N7JA 1S0FA 3PVNA 1LTEA 1YI7A 5GZCA 4AYUA 3RSJA 4M00A 2EXKA 4Y1XA 1MR5A 4K1ZA 3ZVXA 1LOGA 2ZGNA 5T5PA 3WNXA 3BTAA 2WT2A 1SFYA 3WG2A 1H30A 1CPMA 1SACA 3T1MA 1LGBA 4ATFA 2ARBA 2GNMA 2YROA 4UW3A 1A8DA 3AZXA 5GLUA 4BQ1A 5KXCA 3ZSKA 2VW2A 1VALA 3N3HA 1O4ZA 1IKQA 5GALA 4GKXA 2GNTA 3ILFA 3OY8B 2UWCA 3NV2A 2WT1A 4H55A 5GZDA 2Z42A 2P2KA 2TEPA 1LECA 1FX5A 5E89A 4XHXA 4U36A 1DQ4A 3AYEA 3AYAA 3NWKA 1GZWA 4YG6A 5GZEA 4FOQA 4Z8BA 1W6MA 1Q8PA 3ZSLA 2CWSA 3T1LA 1UZYA 2XG3A 3ATGA 3AZVA 4PCRA 3B3QE 4BM8A 3DGTA 1QKQA 3APBA 1Z78A 3D4KA 1N3OA 4GWNA 4WZFA 2V73A 4XJWA 2ZA9A 2LALA 1CN1A 2DVDA 2EXIA 1GICA 2OW4A 2ZZJA 2E6VA 2CYFA 1IOAA 1SLTA 2ZHLA 5HCAA 2G4IA 2JE9A 4Q8KA 3IPVB 1KITA 5H9QA 4BLIA 4Y1UA 4XIOA 2ENRA 2AENA 2ZGTA 3I4IA 4YG3A 2ZMKA 3ENRA 3AK0A 1SBDA 2P3JA 3AP9A 1IS6A 4YM1A 1JN2P 3WZ1A 2DV9A 1S0CA 3AYDA 1AJKA 5HCFA 3OYWA 1A3KA 2AH2A 1TEIA 4KBBA 4YM0A 3POYA 3IPVA 5CB7A 3HR9A 1CR7A 2ES3A 2OVUA 3TB0A 4XBQA 5JVVA 3W58A 4XDQA 3AYCA 2JJ6A 4M3CF 2W39A 4F83A 1LHWA 3V0BB 1CESA 1SLIA 1ULGA 5CA6A 3ZSMA 4XMIA 1DLLA 1BXHA 4GALA 1QOOA 4ITCA 4NOTA 5DZGA 4YW3A 5DZFA 5GLWA 5DZEA 1G9AA 2SLIA 3V0AA 1S0EA 1DGLA 1W0OA 1C57A 4FP2A 3LCPA 4CZSA 2DTWA 5L73A 3B00A 2ZBJA 2YXSA 1V6IA 2A7AA 1S0GA 2P34A 5T5OA 2D6LX 3AZZA 1HKDA 1HDKA 1LHUA 1ULFA 1LCLA 4R9DA 3OY8A 1DFQA 2ZGRA 3HMYA 1MVEA 2BQPA 1CQ9A 4XJUA 5T54A 3VKFC 3IM0A 4AVVA 1QOSA 4AVSA 1JBCA 1QOTA 1CIWA 1W6PA 4FPGA 3BODA 5DUUA 2VW1A 4Y24A 2DU0A 1H9PA 1Q8QA 4XXPA 1WBLA 5IT6A 4LBNA 1I1EA 3KQRA 1WW7A 2UU8A 1W6OB 1HQLA 2PHTA 3WUDA 3NV3A 4K1YA 5DXDA 4AGVA 1BYHA 3VUOA 2UWAA 2NMNA 4M3CE 2A70A 4XJ8A 1MS9A 1Q8OA 1GKBA 2PHRA 4YW1A 3ILRA 2YMZA 5EYYA 1MZ6A 3LSEA 1DHKB 2EXJA 1YO8A 4GXLA 2R0HA 1VLNA 1MVQA 2WKKA 1U0AA 3VKOA 2JDZA 2WNEA 4XE9A 1QMJA 3MPPG 1GNZA 4Y20B 1ULDA 3GALA 1WD3A 5JOWA 2GN3A 2A6YA 5E88A 1SLBA 5GLZA 3SH5A 4AGGA 2PELA 4YM2A 2R0FA 4FVVA 5GZGA 1V00A 1WUVA 4JRAA 2PHWA 3SNMA 4XYXA 1Y7BA 1NLSA 5CNAA 1DQ5A 1W6NB 2PHXA 1IKPA 3M1HA 4RL7A 4YFWA 2PHFA 2ZGMA 5HCBA 1FNYA 1GV9A 1Q56A 4LBKA 4M01A 1FV3A 2A6ZA 4JC1A 1DQ0A 2ZACA 3SLIA 3WUCA 2WQZC 4R9CA 3V65A 2W68A 2ZABA 1JYIA 3RS6A 3N7LA 3CNAA 3PMEA 4LBLA 1AX1A 4XBNA 3PVEA 5EWSA 3A4UA 4BMEA 1AF9A 5H9SA 3RG0A 3WCSA 3QCWA 1XQNA 3U4XA 4ISQA 4R9AA 4XOGA 2P3IA 1A78A 3M3OA 3R05A 1UMZA 4YZ1A 1DQ6A 2WJSA 1MS4A 2E7TA 3ZYPA 1APNA 2A71A 5DUVA 3USUA 3WDTA 4Y1YA 4FP3A 1DYPA 4U2AA 2ZHNA 3N7MA 3ZXFA 3RRDA 4P9XA 5T5LA 4FPJA 1ZM1A 3FLTA 2DURA 1ENSA 3IMNA 3OBTA 2ZGKA 4YZ3A 4AWDA 3MW4A 4TYSA 3OJBA 4FPFA 3I8TA 1CPNA 4FPYA 3WLUA 4ISRA 4FPEA 3RQ0A 2A75A 1DQ1A 1DZQA 2FMDA 1V6JA 3FUOA 4FOYA 4M3CB 4R9BA 4XXAA 4WVVA 4YFZA 5T52A 3WDWA 2GMMA 1AX2A 1JYCA 1J1TA 1LGNA 1AZDA 1GBGA 3WCRA 3WDXA 4P9WA 2DVGA 3AJYA 4Y22A 1ONAA 2EALA 2W08A 2D7FA 3ZPYA 1W6QA 3V64A 2AR6A 2ZGUA 1W0PA 5T55A 2D44A 2YV8A 3FLPA 1LHOA 3H0OA 3WDVA 1URXA 4Q1PA 1FV2A 1N3PA 2JKBA 2NYYA 1ENRA 2V5YA 2ZKNA 4Q2FA 3RMXA 1GLHA 2DVAA 5JLVA 1G9CA 1X50A 2ZHKA 3ZXKA 2GALA 1D0HA 2WT0A 1ULEA 2D6OX 1MS8A 1GZ9A 3AP4A 1KJRA 3MEPA 4LBQA 4Q26A 5GZFA 1QF3A 2EAKA 1V6OA 1MS1A 1ULCA 2DUOA 1YXWA 4FPCA 1G9FA 4FQ4A 1N1YA 4GA9A 4DFSA 1LOCA 2JD4A 3IN9A 4BPZA 3FFZA 4AVTA 2ARXA 3QLQA 1MS0A 3B9CA 4OZXA 5KXBA 2DU1A 1RINA 3ZXJA 4BOWA 3PVOA 4YG0A 4P14A 4ATEA 5IK4A 3OBRA 4YZ5A 1C1FA 2PHUA 2DWRA 2GNBA 2ZMLA 5FREA 3ZSJA 1HQWA 1WW4A 2VY0A 1W6QB 3L2YA 1BQPA 1QDCA 4P9YA 1AJOA 1JW6A 1NXD1 1WLDA 3WOGA 1KJLA 4PQ9A 4Y22B 1EPWA 3AXEA 2VUAA 1G7YA 1N1SA 4FPKA 1KDMA 2P37A 2CL2A 1D2SA 5DG1A 3AFKA 1AXYA 5DUWA 2GMEA 4Q27A 4Y1VA 2XB6C 3BOPA 3UL2A 4C1XA 1JXNA 1V6MA 1AXKA 3GNEA 3NV4A 4YZ2A 5F9TA 3O0XA 1IS5A 1LGCA 2ZGQA 3INAA 5GLVA 3AZWA 4PBOA 3JUUA 2AGSA 1N47A 3M3QA 5FRAA 1OKQA 1LULA 1SBFA 2GMPA 1LENA 4RA0A 4UW5A 5SV8A 3UJQA 1S0BA 4WV8A 2HYKA 1MS3A 5DUXA 3USUB 3B69A 2AUYA 4XILA 4XIKA 1Q8SA 2ZHMA 2D6PA 2DTYA 1LOBA 1AXZA 1LOFA 1WLCA 2DYCA 2ZMNA 1GANA 4FPOB 2DVBA 3WDUA 2OUHA 2YZ4A 1G9DA 2AYHA 1C4RA 1PZ7A 3M2MA 4C1WA 2E7QA 4XHBA 4SLIA 4Y26A 1OFSA 2NM1A 2ZGPA 3ZXLA 2A6WA 2H0BA 1DYKA 4YLZA 1FAYA 3MW2A 1F31A 1WCSA 1FYUA 2AREA 5T5JA 4XJZA 1DBNA 3A0KA 3M3CA 1DQ2A 1OQ1A 3ZXEA 3POWA 4XZPA 3AP7A 2A5ZA 1QU0A 1WW6A 3Q9OA 3R4UA 2C5DA 2OUJA 4PF5A 2CNAA 1FATA 1MS5A 1UPSA 1BJQA 4ZKTB 3ILNA 4CRQA 3KM5A 1V6KA 3AZYA 1W6NA 2D43A 5T50A 1LEMA 1SLCA 4DPNA 4YGDA 5H9PA 1UN1A 4BMBA 4YGEA 5IK7A 1LEDA 1LOAA 4XBLA 1RITA 1AX0A 1IS4A 3JU9A 3PJQA 2ZGSA 2UURA 5IUQA 4DS0A 3VKNA 4XTPA 4Y20A 3OGGA 1S0JA 5EYXA 2VU9A 2GNDA 2NP0A 2W52A 1I3HA 1WBFA 1DIWA 3LSDA 3VKMA 5CAZA 1KDKA 1YYNA 5GJ6A 2ERFA
chains in the Genus database with same CATH superfamily
4NPMA 1AR83 5BYNA 3S6PA 2X09A 3N35A 4EN9B 4IE7A 2VAUA 4Q8LA 1W05A 2A3WA 1UAIA 1VMHA 2WSVA 1UIJA 1BEV3 3OUHA 1GYKA 1ZBA1 4LBQB 5FPAA 4BLJA 4ZHNA 3HOBA 2CAUA 4QPGA 3DXUA 2XPJA 3LE0A 1RJ8A 4UYBA 1KRIA 1RTVA 1H4HA 1ALYA 1VIWB 4N7UA 1ZBE2 1W6OA 2YGMA 1CONA 4PBPA 4GWMA 3U07A 3KF3A 1LODA 5K0UA 3VBFA 5D21A 1PGW1 3TRSB 3POSA 2A6VA 3I2KA 2CGPA 2QTWB 2R062 3OGVA 4YZ4A 1PX3A 3VL9A 3I2OA 1Q5OA 1W6PB 3NV1A 3ZYRA 2VXRA 4IV1B 3BI3A 1L7LA 2WSUA 3K51A 1GSLA 2B7YA 2BRTA 3C7FA 1AYN2 2GDFA 3JBG3 2LTNA 4HN1A 3FZ3A 4HL0A 2CGNA 2VUCA 1Y9GA 2YFZA 1Y4WA 4QAWA 4UW6A 2W0XA 2I2SA 4AEDB 4DUVA 3HT1A 4META 1HRV1 4PF1A 1COV1 2RR11 3VHNA 4ZS3A 4EWEA 4WBBA 5FPVA 3H8XA 4YPJA 1E5HA 4RQPA 2ZCWA 1OA3A 3W20A 4TZDA 1V6NA 5AFBA 2W94A 2F6BA 4FFHA 3RJRA 5CFCB 2NMOA 4AHXA 1F9KA 1W3VA 3VBUC 2WZR1 1UZZA 2RS52 1E5RA 4JGYB 2A3YA 4LK6A 3I3DA 3V0BA 2ADDA 3AKQA 3DPRA 4OHYA 4AAXA 2P3KA 5FLJA 5CU1A 3NAPC 3B9IA 1CAWA 2HWE2 3GJAA 4PIYA 4Q4W3 2MEV2 3CKHA 3VBUB 2IXKA 3GHNA 1IPSA 4CUBA 2FZ2A 3JXSA 4F7ZA 3WR0A 4BQ3A 2EF6A 2VC9A 1CVNA 1LJ7A 2QUOA 4W6YA 3OG2A 1MZFA 4E2GA 4Y5SA 3TOJA 3B01A 4LA3A 5LA9A 4XJ9A 4DXTA 3FBYA 3VBSC 5C3SA 4K40A 2DVFA 3H3UA 3W59A 5BPXA 5K7PA 2OQ7A 5H9RA 1I5ZA 1PHMA 4IEVA 1ODNA 1JHNA 2GN7A 4H3WA 5JSOA 2EIBA 2JG9B 3C2UA 2VW0A 3D5OA 4MYEA 4QQPA 4XFIA 4B8EA 3FUQA 3KT4A 4DY3A 1EYBA 4CEYA 1X9PA 4OYUA 3ROUA 1KFXL 2HWD3 4D69A 5ACA1 2D3PA 1Q43A 2UWBA 3O0VA 5F39A 5JDBA 5G04L 1PVC1 4CCEA 4YVWA 1SCRA 4Q4X1 4E2QA 4XDOA 1UX6A 2RJKA 4QPIA 4CU7A 1CAVA 1QGLA 2WINB 2GP3A 4FOVA 4INDA 2YBSA 2WYSA 5FP9A 1JUIA 5FXVA 4NRPA 5KXDA 4OUEA 2PAKA 5LEJA 1VPHA 2P4EA 1JS9A 4KMQA 2W1WA 2EICA 3AP5A 4FT8A 2R1BA 4LKEA 4XTMA 2OKXA 1S0IA 4YW2A 3OEBA 3PUSA 2HEVF 5JMCA 3LDRA 1ULPA 2QQVA 2C9AA 2QBXA 1EAH2 1C1LA 1RC6A 3H7YA 2ET7A 3PVNA 3MIEA 5EQUA 3SCHA 1LOGA 5A3PA 3HBKA 3BTAA 2VULA 1H30A 5IAXA 1DGWX 1LGBA 5IK5A 2GNMA 4CA9A 5KXCA 4UW3A 4FTBA 4MH0E 1BBT3 2RE9A 4NROA 3ZSKA 4Q29A 3N3HA 2JDMA 2RVAA 4MXWB 3VDAA 2ZJCA 1IKQA 2OPKA 1UOBA 2GNTA 4Q0PA 3JQXA 4Q5OA 4RGKA 2TEPA 1FX5A 3SCFA 3LA7A 3A7QA 5E89A 4B7EA 4BISA 4XHXA 4PDWC 3BTYA 4S2FA 4COVA 5A80A 5GKAC 3PLQA 4Q0VA 4LE3A 1B35B 2PXJA 4FOQA 3EJKA 1VE0A 3ZYBA 3I54A 1V9U3 3HIFA 3PUIA 4XFGA 4I3GA 3MV01 1K5MB 5F6KA 3OF1A 2VR4A 1AR91 4HG6B 5C5TA 3K3NA 1TMF3 3T4VA 2IFRA 4PCRA 4BM8A 2FDFA 1JZ6A 1K5MC 3DGTA 3VBHA 4BIOA 2HWB1 1MQTC 2WWSA 2W47A 2V73A 3GXUA 1X9TA 2JDHA 4J6GA 1VBA2 2LALA 5KHHA 1RUD3 2RS53 1BVVA 3HQUA 3LPFA 1OURA 1SLTA 2G4IA 3LZZA 4PDWB 1OD5A 5DAVA 4CYDA 4YG3A 1L7QA 3I4IA 3H1YA 1SBDA 3DPRC 3T2QA 4FXKB 3OBZA 4RR3C 3WZ1A 5C4WC 4UI9L 3KCXA 3ZFFC 3ZXDA 1PO23 2DV9A 1P8JA 1AJKA 3CHXA 3OYWA 2J1VA 2RMU2 5HCFA 3UV9A 3VBUA 3IPVA 4JRLA 3AC0A 4A44A 1CR7A 2XJRA 1CAWB 2XR4A 4EWDA 3Q8FA 1KXGA 3A21A 4MADA 5FZ7A 4FAGA 3CZJA 1YI9A 3R0RA 2BP6A 3DPRB 3HNBM 2RS11 4IE6A 3VBHB 4GJYA 3ZSMA 4JGYA 5KHKA 1DLLA 4ITCA 5DZGA 5GLWA 4AFMA 1M06G 3ITQA 4C0BA 5FJHA 2JICA 3I7DA 1DGLA 4BQXA 3Q8AA 4CDXC 1ZBE3 3CEWA 4FP2A 5BNPA 4RQPB 5J1XA 4QQ2A 1YWKA 2XL7A 2ZX3A 3B00A 1AR81 5J98B 3UESA 5ABJC 2E63A 1S0GA 2YFUA 3MLLA 5A6XA 1HKDA 4QKNA 2G9FA 1NA1C 1RUC3 1RMU1 3D8CA 1NAEA 1OBNA 2V4VA 1XYPA 2E32A 1RUD2 4MXWA 3VKFC 3IM0A 1XNBA 1QOTA 1KGYA 4O65A 4FSJA 1IG3A 2EIEA 2YPDA 5FZOB 1YHFA 3OOXA 5DUUA 3VLBB 5IWFA 3ACHA 4XZUG 2X8KA 2JB4A 1NCRC 1H2KA 1CZSA 2O14A 4Q4Y2 5K0UB 3AKTA 4PJYA 4AL9A 2UU8A 3AL6A 1HV1A 4UWDA 4A6OA 1Y43B 5I0TA 3VN4A 4M3CE 3THDA 1RUG1 4YRDA 3O7OA 1MS9A 1K12A 4YW1A 2YMZA 4AFBA 3D82A 4C8DA 2BTVC 5FZEA 2VPVA 2HJIA 4NIAA 5G05L 1PX4A 4BXFA 1VLNA 3LIHA 1CAVB 4DXSA 5IVJA 3M3IA 4IGPA 3W5NA 4AI3A 1ZX5A 2Y6KA 4M4PA 1U0AA 2C24A 4YVWB 3SEPA 2Z4FA 3JD73 3MLKA 5JOWA 1WD3A 5LRRA 3TEXA 3KSCA 4D6SA 1HB2A 5FZMA 3POBA 4CEYB 4IDZA 5LASA 2GSYA 4URTA 2PELA 5HXMA 2JG9A 2RDNA 1UMHA 3VZOA 4XFHA 1UWWA 1IHMA 2QQOA 5CNAA 4AI8A 1W6NB 2PHXA 2YHJA 1OH4A 1X7NA 4GQ7A 1NZIA 4TN7A 1FNYA 3PIGA 1HXS2 1GV9A 1RYYA 4IL7A 4M01A 3S7EA 1ZREA 1FV3A 3SLIA 1DQ0A 1PVC3 1QJY2 2N7GA 2ZACA 4O61A 3WUCA 2LROA 2ZABA 4K6BA 2HEYF 3PVEA 1W0NA 4A42A 5FUIA 2VD7A 1OOPC 5FZ6A 3VBOA 2Y33A 2JWPA 1TQ5A 3POJA 1FMD2 2P5BA 3QCWA 4L97A 4QX3A 4R9AA 2DCKA 4IEZA 3NNGA 4XOGA 3ZFGB 4PI2A 4N9HA 1KS4A 3KGLA 2Q8OA 4QX1A 5LB6A 4WVMA 4BQ4A 2Q8EA 1SPPA 3ETQA 1H0BA 1APNA 1YQCA 4MHRA 4EN8B 1AYM1 4HXCA 4TLFA 1W39A 5CYYA 4KL1A 4AVCA 5HCHA 4U2AA 3ZXFA 3IDBB 3RRDA 5JXJA 4P9XA 4UFKA 2WZEA 3B7MA 5M0TA 4XFAA 5I8TA 3ST7A 1NLQA 1ZZ6A 4YZ3A 5LA1A 3C3VA 3J7LA 1V0AA 3EHKA 3MW4A 3U14A 3I8TA 2R043 1PGL2 1W3XA 3WLUA 2HYXA 3NRUA 1DZQA 1QJX2 3POIA 4AEDA 3FUOA 3ZO0B 2MEV3 2P3YA 5T52A 4CUGA 1F2NA 4IEYA 3R6SA 2HWE3 3PUHA 3D3AA 5E1RA 4QPWA 1GBGA 1XYOA 1GMMA 3DF0A 3WDXA 3AJYA 2IXCA 1OLMA 1PO21 2VTXA 2EALA 3I97A 4BYYA 4KWJA 3MPBA 1OH3A 5FZDA 3O1VA 3ZPYA 1JMUB 3QACA 4UF0B 4XURA 3LOIA 1EPZA 1LHOA 1O91A 2CGOA 3BU0A 1N3PA 2J22A 3UKTA 4A2UA 1ENRA 1PMJX 2V5YA 4M0NA 4XF1A 4JDOA 1UZ0A 4AVAA 1CAUB 2ZHKA 2QQJA 2GALA 2ZPXA 1UZWA 4URAA 4E4SA 1GZ9A 1VB2A 5A33B 4RHV3 1KJRA 3MEPA 4LBQA 4LHKA 1X8MA 1ULCA 4A45A 2Z2SB 1JZ8A 3C7EA 4JQTA 4XPVA 3KV5A 5LY2A 1LRHA 4LIUA 5DMYA 4D8MA 2JD4A 5CADA 3IMMA 1QJU1 3MIDA 4HZFA 4XUPA 2XBO2 3KS7A 2FZ1A 4ZZ5A 4OZXA 2ETEA 4CEWB 5D2AA 2B39A 3OPWA 1UQXA 3WW3A 4N90A 1AL23 4LITA 4ATEA 1PNFA 2VOTA 5BNOB 5D8AC 5A3NA 1ACCA 3ZSJA 1VR3A 1F5JA 1UCXA 1WW4A 4QM9A 5FMDA 1W6QB 2WNOA 2WZPP 2JDNA 1QDCA 1UY4A 2VCCA 4KWUA 5A7WB 3WOGA 4N43C 4Y22B 3AM2A 2BGCA 1KDMA 2P37A 1NKGA 5KHGA 2XBO3 3H50A 4N43B 5L36A 1AXYA 1AR72 1RVF2 2GMEA 5FKBA 3RYRA 4Q27A 4C1XA 3BOPA 4IEWA 1S55A 2RM23 3C8XA 2VJXA 2Y64A 2IWGB 3O0XA 3OGRA 3WNNA 5JUVA 1JYVA 3AMNA 5EFUA 2DCZA 5A3WA 2VTXJ 3ZFFA 4HMZA 4EQVA 3SC7X 2QVSB 2UYAA 4LLFA 4QGNA 2G1MA 1UOGA 4ASLA 4D6RA 2DDUA 1R1A2 2VZ3A 5FOBB 1LULA 1SBFA 2DBNA 4OUMA 4UW5A 1L7RA 1HJFA 3ZLIA 3J7NA 4BK5A 3QH6A 2ZHMA 2DTYA 2D6PA 1WLCA 2RS33 2VNGA 2ZMNA 3GJBA 4FPOB 1GANA 2QQMA 4A7YA 1SQ4A 3ZFFB 2AYHA 4LJHA 4FTEA 2I07B 1HN0A 4ASKA 4HKOA 4SLIA 2XBO1 1OFSA 1RUH1 1UU6A 1W06A 2RR13 4LA2A 4Y26A 3ZXLA 4E9KA 5FZKA 4YLZA 4K7JA 5K4LA 1W03A 5I0DA 4XJZA 4QQLA 1O3SA 2DFCA 4N43A 5LBCA 2J7MA 1GOHA 3POWA 3ETPA 1HB3A 2B5HA 2C5DA 1QJX3 3EYPA 2VBDA 1BJQA 4BB3A 1R083 5A1FA 3W21A 3ILNA 4PLNA 1F8VA 5A7WA 1V6KA 4MZUA 1LEMA 3E5QA 3ES4A 2HH9A 4DPNA 5H9PA 4N9IA 4QT6A 4BMBA 5BNOA 5FYCA 1LEDA 4MUVA 5FTTC 1OA4A 4QGLA 3ZM8A 1QWRA 5FY7A 2R071 3WINE 5JAXA 4JQRA 4F3JA 1PO13 1RUG3 4Y20A 3THTA 3WW1A 3EBRA 2RMU3 1ZRIA 3ZMNA 1UYYA 1WBFA 1XE8A 1J3RA 3LSDA 4GH4B 1QH7A 1VRH1 5GJ6A 2ERFA 5FMBA 2QQLA 5FWJA 3CJXA 3N7KA 4AGRA 4YGCA 3TN91 4PT6A 3URFA 1AHSA 2P1BA 1D0GA 1U5IA 4P5YA 3QBQA 5A33A 4CDUA 1XXNA 4DRRA 5L7OA 3KV9A 1RUF1 4P5HA 4LBOA 4Q4X2 1BZWA 2OIIA 4KQ7A 1PZ9A 2XJQA 1V9U1 4FAHA 5A7QA 3R4DB 3AX4A 3VZJA 2E31A 5ACA2 2XHNA 5C9AC 1ZA4A 4LQRA 2R1DA 5AC92 3BOWA 4OVEA 5EHDA 1SG3A 1NLRA 3MV11 4UF0A 3D6EA 1GNHA 3AVSA 1JZ2A 1W99A 4AEMA 4UFIA 1FPN3 1UXXX 3BGAA 4YW5A 5FZCA 3JD72 1JYTA 1N3QA 1O8SA 5D1IA 2Q5TA 3ZN6A 3ZDVA 2XLGA 1CZVA 4FQZA 4ZXEA 3TN92 3WDYA 2K0GA 2CU5A 2OZ6A 2HLEA 1Z0HA 5DN2A 2IFWA 3BN6A 1DU3D 4OMCA 1YQ5A 1BBT2 2A3XA 2ZTNA 2BJSA 3S7IA 1VMFA 4YARA 1AYM3 1HV0A 4DOUA 1EV11 4KG8A 4XCAA 3IZOA 2EXHA 2FHRA 2EIGA 1LOFC 3V0AB 4W65A 4K9SA 5F2SA 3RWNA 4LHSA 2Y34A 2XUEA 1EAH3 1YQ2A 2WL1A 2ZX2A 5ERLA 1OOPA 4JHZA 4QB2A 4AI0A 3AVRA 2WS91 3VBRC 5D8AB 4AK3A 3NKGA 2DCTA 2CWMA 2DUQA 1BKZA 3AFGA 2JIJA 3NNJA 4UFHA 4DQAA 3UETA 2E53A 2O1QA 4DY5A 5KHJA 4DRVA 5JZGC 1WGPA 3LEKA 1J84A 1VBE1 2YY1A 1AR93 5FJKA 1POV1 2RJLA 2WLQA 2YPJA 1UW8A 3CJIA 3FJSA 1AL0G 2HWD2 4DB5A 3BIWE 3ACIA 2JECA 5FY1A 4FPLA 2H6CA 2QZ3A 3NL1A 2NLRA 3NNLA 3LGRA 3UJOA 2PYTA 2RS12 5EXOA 1HLCA 5FZLA 3RZZA 3WQ0A 4Y4RA 3WX5A 2X5IA 3LKJA 5DG2A 3SH4A 2SBAA 1AVBA 1QXRA 2XJUA 3I3BA 2OT7A 1JUHA 2YUEA 1UKGA 4HANA 4K21A 3WV6A 5BNNB 5K8SA 4ES9A 4LO8A 2FD8A 4YW4A 1NY71 5T3NA 1W6MB 4NMIA 1ASJ3 3U78A 4CTEA 3K46A 4YM3A 3AXDA 2XDVA 5FMOS 1GZWB 5FP7A 4CDXB 3VD9A 3LEGA 3VZLA 5FY5A 4GKYA 3MF9A 3O1SA 1BEV1 1MACA 2D3RA 1VAMA 2WYFA 3GYDA 1HRI2 4OHZA 5F5AA 3BTZA 4OI1A 1NA1B 4X6RB 1LOEA 4PQQA 3IIIA 4XETA 1IS3A 2ZGLA 3T3YA 5LA0A 3I49A 1PM4A 1ZRCA 2VXJA 1GWLA 1YI7A 5GZCA 3RSJA 3U0ZA 4JTNA 3ZVXA 5JI9A 2ZGNA 5T5PA 1DGRN 1H2LA 2WT2A 3WNXA 3WG2A 3VHOA 2XLAA 1EV12 1SACA 4H2AA 3N9MA 2ARBA 5EZWA 5GLUA 4P00B 1A8DA 1HB4A 1JU4A 5J09A 1KD7A 4JKLA 1JH5A 2IXLA 1O4ZA 4JDMA 2RS31 3MZHA 1ASJ1 1ZBA2 4M0HA 1RUC1 4WM8B 2B4KA 3HNYM 2VTFA 4PI0A 2P2KA 3FN9A 1LECA 2VL4A 1VBD2 2ZXQA 4GD4A 4U36A 5F6LB 3JB4C 1RGSA 2O8QA 3AYEA 3NWKA 3GM8A 1IQDC 5GZEA 1H4GA 1CX4A 5BNPB 1WMDA 1YQ8A 5IVCA 1Q8PA 3WQBA 3ZSLA 2VG9A 1BMV1 2CWSA 3T1LA 1UOFA 1PIV3 1UZYA 5I0RA 2XQRA 4EZ4A 1SZBA 2YU2A 3ZYFA 4B1LA 1J3QA 1HJGA 2BBAA 2PQSA 3HEIA 3LD8A 1Z78A 1N3OA 4GWNA 4HPKA 2ZA9A 3WEZA 2DVDA 2OW4A 3H7JA 1IOAA 1MQTB 1U12A 3MHZA 3VBHC 3UT0A 2XQXA 5BNQA 1ND2B 2C26A 2VECA 3IPVB 5H9QA 2DCYA 2H6BA 4QXKA 5FY0A 4OZOA 5DAQA 3J7HA 4BQ5A 4AE2A 1RHI2 2P3JA 1O5LA 2WFF1 4Q0SA 4LOTA 3RGBA 4W4ZA 4YM1A 3OEAA 3ZR5A 1TEIA 4OFGA 4YM0A 4RR3B 2XVKA 4PDWA 2VOXA 5CB7A 3F95A 4CP0A 2ES3A 4XBQA 1HXS1 1R091 1RUE2 1OQEA 3AYCA 3NVCA 1XU1A 4XQWA 2JJ6A 2UY9A 3PURA 4S2DA 1Y3TA 4X6QB 4IE5A 4F83A 1LHWA 3T0DA 3EQEA 1ST8A 4BA6A 2E9QA 4RGAA 4COYA 4C91A 2BVVA 4XMIA 4GALA 5HV4A 5KXEA 5J96B 3UYJA 4LOSA 1D4M2 5DZEA 4K8RB 5A3UA 3ZN5A 5JSRA 1O3RA 1RUNA 1W0OA 4DIQA 1PIV2 3LCPA 3PNAA 1X8EA 5L73A 2HWC3 3AB0A 4FFIA 2YXSA 1V6IA 1ZRFA 3TN93 4AHZA 2GAUA 2D6LX 1FOD2 5FCCA 2FCTA 2YC0A 1LHUA 1ULFA 1LCLA 1O7FA 3OY8A 2VMDA 4RD7A 5C9AA 3FHQA 3KGZA 3HMYA 1MVEA 3C7GA 4AI1A 2QKDA 2HEWF 4XJUA 4AVVA 4AVSA 4ZU4A 5JXIA 5C71A 1CIWA 3U1XA 4RFT0 3MGUA 3BODA 2BOJA 3KQ4B 1W8ZA 3BTXA 2DU0A 1AL21 4E27A 1ENXA 4XXPA 4RQPC 2VVEA 4CVUA 5IT6A 2BBVA 1HQLA 4E8CA 3ALQA 2R041 4UXAA 1ZVFA 4D7SA 3FL7A 3VUOA 2UWAA 2NMNA 3SKJE 1XSQA 5FZGA 1COV2 2VCMA 2DFBA 2JDPA 3NJZA 4XJ8A 4Z82A 3TNQA 2AC1A 4PHZA 2P17A 3ILRA 1GQPA 5EYYA 1HRI3 1S2BA 1SEFA 5JI7A 2XONA 1MZ6A 4V2VA 1JYWA 2LUWA 4ZU5A 3ZKYA 1H8TB 1RMU2 2R0HA 2H0VA 3KZ4C 3ZIWA 2ZS6B 1XSRA 4QX8A 4IE0A 4GJZA 1RUG2 4QPIB 1US3A 4YW6A 4P9JA 2JDZA 2WNEA 3L9JT 2R061 1ULDA 2YYOA 2GN3A 2A6YA 3MFAA 4B3NA 5E88A 2C6SA 1SLBA 2ZEYA 5GLZA 2OXBA 2QQPA 3CO2A 1TME3 1W8TA 4DUWA 5K9YA 2YB7A 3ZIXA 2R0FA 1UKRA 4HLTA 2VZSA 4LORA 4R52A 1U5ZA 4AEKA 5GZGA 4FTSA 5JPNB 2DCJA 3E97A 2TNFA 3FX3A 1R082 1IKPA 3M1HA 3OGJA 3PTRB 4RS5B 1QJU2 5HCBA 1NE4A 3SEEA 1IGOA 1F35A 3ACFA 5KHIA 4QKFA 5A6ZA 4I2OA 3K2OA 1MEC2 2D93A 3GBGA 4IEUA 2W68A 1OD3A 5FPZA 3CNAA 3PMEA 4LBLA 1AX1A 2VMGA 3RS6A 4NIHA 2RR12 5FO9B 1HRV2 1PK6C 4BMEA 3O1RA 2WN2A 4AAPA 3NKTA 3PJYA 3VB9A 1B35C 1XQNA 3M4FA 2WIIB 1UOJA 3M3OA 2RS32 5FYBA 1OA2A 1PK6A 1RXGA 1H6XA 4RFRB 4CU8A 5FZFA 2E7TA 4JHTA 4CE8A 1JODA 4W6XA 3PDQA 3USUA 2WNVC 3WDTA 3O14A 1UY2A 4FP3A 3HN3A 2WC2A 4H7MA 2HWB2 4IW3A 3VBRA 1TNRA 2P6CA 4JVAA 4C0HA 1XOYA 1JHJA 2WRAA 5CFCA 4OQ9A 5LATA 4B1MA 1M4WA 1WA4A 1ZBE1 3IDAA 4CDQC 3O1UA 2PLV2 2ZGKA 1KEXA 4FPFA 3DECA 1SDDB 4GMP3 4QX0A 4XF4A 3RQ0A 3FFQA 2A75A 1DQ1A 1V6JA 1VBB1 4R9BA 3ZFGC 5ISLA 1MPXA 4XXAA 3WD5A 4UFJA 5FZ0A 4GZ9A 4Z2WA 4V2WA 5DAXA 3PU3A 5HBAA 1JYCA 2GH2A 3WCRA 2B9VA 2LRPA 2YC4A 5J37A 4P9WA 2DVGA 4IV1A 2YG0A 3ZSEA 2W08A 2D7FA 2K2SA 2AR6A 2VO5A 3E5UA 5B4XA 5CEHA 2YV8A 5HI0A 2Y6LA 3VBFB 5BY5A 5IVBA 1R093 1URXA 1S2KA 5FPLA 1JZ7A 3BKZA 1FV2A 3ACLA 3U11A 1FT9A 2D5FA 2NYYA 4Q2FA 4FFGA 4XUQA 2OZJA 3NMBA 3HD8B 4I0AA 1ULEA 3PTYA 2BGOA 1FPN1 2GC0A 5BUVA 4LKFA 2B42B 3B02A 5FXWA 5FY8A 5GZFA 4Q26A 4I01A 1V6OA 4Z07A 1MS1A 3E5XA 3KMHA 2C4XA 5DDJ1 4DFSA 1QJY1 1WMXA 4YW7A 2WNUC 3RNSA 1EUTA 4BPZA 2ARXA 3QLQA 5IAVA 3WF1A 1PIV1 1GOGA 3B9CA 3L2HA 1RINA 2Q1MA 4ARXA 5J3UA 1PO12 4FXGB 1D4M1 3LF7A 4YG0A 4E4ZA 2OYZA 5J36A 4WM8C 2PHUA 2DWRA 2VE1A 1CD3G 2PMWB 3EMRA 4MHUA 4CU9A 1KFUL 1J58A 1UF2C 4KGGA 5BV6A 1BQPA 4KG0A 3N9QA 4P9YA 1VRH3 4I0BA 2VZVA 2Y60A 1WLDA 1NXD1 2JE8A 5A32B 5L9RA 3K3OA 1IQAA 3ES1A 3NNMA 3ZFEC 3D0JA 1BBT1 2VUAA 2WFPA 3B5LB 3MIHA 4HONA 5IVEA 2CL2A 3VBSA 3DCQA 2FMYA 3AFKA 3HWJA 3GZTB 5DUWA 3I2JA 3G7DA 4YNIA 4BJ0A 3RPQA 4X8PA 4D3WA 1JXNA 1V6MA 3NV4A 1RHI1 5F32A 3HQRA 5FZAA 5TSWA 5JCTA 1LGCA 4R4XA 2ZGQA 2MEV1 1OF4A 1WA6X 4PBOA 2AGSA 4A6SA 4BDVB 1UZVA 1UY0A 2PA7A 4N7IA 3KWVA 4E8DA 3M3QA 4Q4Y1 4TSVA 3CIHA 2O8OA 3I3QA 3ZFEA 2ZEZA 3CZUA 3I2HA 2HYKA 3B93A 4WV8A 3VDCA 1O3TA 3GGLA 3TEWA 5EP9A 4HKWA 2JIGA 4QD2A 2DYCA 3OUIA 3WDUA 4A41A 2OUHA 1JZ3A 3AKRA 1RUD1 1G9DA 1YJLA 2ATFA 1PK6B 1C4RA 3RZJA 2WWUA 3T09A 4CP2A 3KVBA 2E7QA 4XHBA 2Q4SA 3LPGA 2ZGPA 1O6UA 1REDA 2EVXA 4WM7B 3T08A 1ZNPA 3NAPA 2B45X 5FWEA 4BQ2A 1W04A 5T5JA 1F31A 1XNKA 1FYUA 3AMPA 3IBMA 4NHXA 1DBNA 4RYDA 3M3CA 2RM22 4CDQA 4RS5C 1OQ1A 5EPAA 1NG0A 4HKLA 2A5ZA 1WW6A 3Q9OA 3FBMA 3R4UA 5DXDA 4LO7A 5F5CA 2CNAA 2Z69A 1MS5A 1O59A 2VQTA 4ZKTB 5C7GA 2EAAA 4IEQA 1NCRB 4OMDA 3S57A 3KM5A 5CBLA 3AZYA 4IETA 1YJKA 1VBC3 2A1XA 1L3JA 2D43A 2K46A 3VL8A 2R072 1SLCA 1KS5A 1A8MA 1U5XA 3POGA 4YGDA 2Y0OA 1UN1A 4QWNA 4CXWA 4EJRA 4ZU7A 5ANNA 5I93A 4LKDA 1RITA 1AX0A 2AACA 2XWJB 5FR3A 1IS4A 3JU9A 2ZGSA 4BXSV 1I6XA 2UURA 3OUJA 1E5SA 2JG8C 2WO1A 2JENA 4L2NA 4DNYA 1US2A 1CAXB 1OMIA 4QU2A 1S0JA 2GNDA 3VHRA 2NP0A 1I3HA 1GZTA 2XVLA 3U37A 3ZYIB 4QKBA 5CAZA 1KDKA 1YYNA 4GKXA 3Q8EA 3HVDA 4P9LA 4W50A 3WW2A 5EIYB 3DUIA 1H8TA 1PZ8A 4UOJA 1GWKA 4LBMA 2D6KA 1VAVA 4NHKA 1LESA 2EA7A 2TUNA 4XW3A 4NPRA 4LO4B 3UKNA 4K8FA 3RI9A 1C8M2 1QNWA 3MUY1 4MVTA 4EWAA 4AW7A 2IVJA 3QH7A 4RHV2 5IW0A 1NY72 3WHTA 2HWB3 1D4VB 1VBA1 5A70A 4B7KA 4JKKA 3FC0A 4S2HA 3ZX7A 3ACGA 2VUJA 1ZZCA 3T0AA 3WVJA 1C28A 2QDRA 1XPWA 1AR63 4LBJA 3CBNA 2BERA 3PHMA 1GWMA 1R1A1 2I74A 3F2ZA 1F5FA 2HWF3 4B29A 5JXGA 1I5PA 1YNAA 4Q1RA 4TLGA 2Q0AA 5C4WB 3KHCA 2VH9A 4CDWC 3WCSA 4QMAA 5FBZA 5C9AB 2ET1A 2CTVA 2ZGOA 5FLIA 2NZ9A 4E4HA 4M3CA 1T6BX 3IKWA 1FNZA 3Q8BA 3WP5A 4IGOA 5GLTA 2A6XA 1N1TA 5JOXA 5JOZA 1QJU3 3UK9A 4QHOA 2FDKA 1JOJA 1LHNA 1WWYA 2JDKA 2ARCA 4R8HA 2R042 3WG1A 3O0WA 1OI6A 3DYMA 1W8OA 2D6NA 3BB6A 5FZIA 4B4QA 5KC5A 2FCUA 1XB9A 2EIDA 3T2TA 3VV1A 1BLZA 5CFDC 3LOBA 1CWPA 1R081 2VMCA 3IDCB 3IB3A 4NWWA 4JTOA 1KQRA 4RSUA 3H8RA 3GZUC 3S0MA 4W6WA 3M70A 2IC1A 2HKXA 1PGSA 3J7MA 2YU1A 2IUWA 4GMP1 5EJZB 1UIKA 2BNNA 2XKOA 2VVFA 4COWA 3CMGA 3N36A 1RMU3 1RUH3 4NWVA 1SLLA 5L9VA 5FYIA 1QQP3 3O12A 4LUMA 3OPZA 3ASIA 4HVRA 5FKCA 3AP6A 4GWJA 1COV3 2PAEA 3X29B 1SLAA 1UYPA 1QJEA 2JG8B 2XOMA 1O4YA 2AZ5A 5JOYA 5FP4A 4L8QA 2KM2A 1QJY3 1JYXA 5FO7B 4Y1ZA 1UYZA 2V5DA 2BZDA 1O8PA 3RZLA 1VP6A 3TAYA 1ODMA 3R4SA 1WW5A 5LZ6A 1H9WA 2FQPA 4PLOA 1BVP1 4Y33A 1GZCA 1YIFA 4FOWA 1H2MA 5AC91 2WNUB 2VCBA 5FXXA 3SITA 4AG4A 2JE7A 1SMVA 2WO3A 5HV0A 2P6HA 4YVSA 1CGPA 3RZMA 2VZRA 1T2XA 5A7OA 2RHPA 2WQ4A 3AJZA 2WQ8A 1GP5A 4GWIA 3VD3A 2NN8A 2VZ1A 1LU1A 2KR2A 5DDJ3 2R49A 4DINB 3P5BA 5FZHA 3WQ1A 1NYWA 4ZXKA 3JD71 3M3EA 3DXTA 4X8NA 5CFDA 4QU1A 3VD7A 1S0DA 1WLWA 2HWE1 4WM8A 4CPBD 5C8CA 4IESA 3ZMOA 4ZPIA 3LFIA 2E33A 1G9BA 2QFEA 3VDBA 2D3SA 1D4M3 2ZAAA 4NO4A 3T2OA 3U10A 2VOWA 1O5UA 1Q8VA 5E6HA 1JOBA 1G6NA 4MLOA 1LTEA 4MGZE 4ARYA 5L9BA 1TMF1 4K1ZA 3SQOA 4NHLA 3J8F3 3MF6A 4LUKA 1UU4A 1W2UA 2BPA2 1ZYBA 1ZRRA 2YROA 1GFF2 3AZXA 4KH9A 2J1TA 5I8SA 3AMHA 2VW2A 3ZXGA 1U5YA 2JXAA 3O1MA 2C9KA 4ZS2A 5GALA 1OXCA 2VZUA 1F4HA 3NJVA 4XQDA 4YSFA 1YFWA 2UWCA 3NV2A 3OCPA 4H55A 5GZDA 2NPIA 4P9GA 2YGLA 3CU7A 2QQNA 1BK0A 4O9GA 1DQ4A 1RUC2 1OLME 5K0UC 1OLQA 4UBHA 4YG6A 2WNVB 4XQ4A 5A7NA 4CCNA 4Z8BA 1W8HA 4LIVA 3THCA 4CCOA 3IT8A 4M4RA 4SBVA 5KBFA 4OLLA 3HAGA 1S2EA 2ZEXA 3EXUA 1QXJA 3U4SA 3OBAA 3OTFA 5DAPA 3ATGA 3B3QE 3LA2A 3CQOA 3APBA 4XABA 4WZFA 1WKYA 3WY6A 5CKMA 4AVBA 4CP9B 2RG4A 1GICA 1XNCA 1TME2 2ZZJA 2E6VA 2CYFA 4GAZA 2X5IC 4PIZA 4RHV1 5HCAA 5IYYA 5FZ4A 1NCQA 5FDBA 5ABJB 1KITA 2ZX0A 5FQ0B 4XIOA 2ZGTA 5FBJA 2JG8A 3AK0A 1W28A 3KD4A 3AP9A 4Y4YA 3MO4A 3MICA 1IS6A 5A3MA 4PLMA 1JN2P 5CFCC 1DCSA 1UY1A 4A3ZA 1S0CA 3T4HB 3WQ7A 1HB1A 2AH2A 1NE6A 5FQ0A 2Y6GA 3POYA 5ABJA 1OSGA 1NCQB 3P3NA 1YLLA 2RV9A 4GB31 3TB0A 5JVVA 3W58A 1WMEA 4XDQA 3VD4A 3E6CC 4AEDC 4EV0A 4AXOA 1V70A 2J1EA 3ZKUA 3MLJA 2W39A 4IXLA 2WAOA 1J3PA 1NT0A 1CESA 1GP4A 1SLIA 4IGQA 4L92A 5CA6A 4MG2A 3TEZA 4GULA 1BXHA 4NOTA 1QOOA 1PNGA 2VBPA 4QHZA 4YW3A 3V0AA 2XWBB 3I3EA 1G9AA 2SLIA 2W9XA 4OQ8A 1S0EA 4LKSA 4XVHA 3UGGA 3BCWA 3FMGA 4LEJA 3ZXAC 2Y6HA 1C57A 2VVDA 4HVOA 4KNCA 3WF4A 2OPWA 4QB6A 2MNGA 4CZSA 4NAOA 4O9EA 4E4DX 2ZBJA 2VQAA 2RM21 2P34A 5T5OA 1QY4A 1WLTA 3AZZA 3WNPA 5LWBA 3VD5A 4XF3A 1OVPA 2OA2A 4Q4W1 5F3CA 2WUHA 3IDEA 3O1TA 1QQP1 1BHGA 3LEMA 4KI5M 4R9DA 1FOD3 4N53C 5CG8A 3ZN6B 3LDBA 2QQIA 2R6QA 4CCKA 3H3LA 1CQ9A 4YWAA 4NR1A 1Z7S2 5DABA 1JBCA 1S4CA 1OF3A 4FPGA 4Q4V3 5A6QA 1WZXA 2VW1A 2RS13 3HT2A 2Y38A 4Y24A 5FO8B 1RL3A 2HWF1 4ZY9A 1H9PA 4XF0A 1VMJA 4QX7A 3EO6A 1BCXA 3LA3A 3KQRA 1WW7A 4JDNA 2QQWA 1RXFA 4QM8A 4D6QA 5F37A 4ES8A 3VZNA 2MHFA 3N9OA 1VBC2 3N9NA 4XAEA 5C8CB 5CFDB 2A70A 5FP8A 1GKBA 3JB8A 3H1MA 1ND2C 1RUI3 4QX5A 5FUNA 4AQ6A 1VBE2 2VNRA 1DHKB 3LSEA 1E57A 2ID4A 4GXLA 4NIGA 2LM3A 1OLRA 2WKKA 5BXXA 4AHYA 2VMEA 4XFFA 4EN0A 2VUDA 4P08A 2KA3A 3G6JB 4MGQA 2JX9A 4LT5A 4TXWA 4OI2A 4H7LA 2WS92 4Y20B 2ZX1A 1CAXA 2HBTA 3GALA 3NJYA 4I0WB 3OPTA 1JTZX 3RDIA 4CDWB 3B94A 2WNUA 3WP6A 4AGGA 3MIFA 1AYM2 3ME2A 1RUOA 5F3EA 1PO11 3GDBA 3SNMA 4JRAA 4XYXA 4QPIC 4AHWA 4MV2A 4CXXA 5IVFA 1DG6A 2PHLA 4KU7A 2MPFA 3J8F1 4YFWA 2ZGMA 1NCRA 1Q56A 4LBKA 4UFLA 4D0QA 3LWCA 4H14A 2A6ZA 4JC1A 4EROA 4EZHA 5I8YA 2R7EB 4R9CA 5IVYA 3HBZA 1W8FA 1LAJA 3C7HA 2VOKA 1QJX1 4XBNA 2OX0A 3WW4A 5JMOA 5FYVA 2XHKA 3A4UA 3MDPA 1AF9A 2YBKA 4G9SB 2CHHA 3BYWA 3RG0A 1FPN2 3U4XA 4L0PA 4ISQA 3TNPB 1W8NA 2VBBA 2YDEA 1A78A 3R05A 4XC9A 4YZ1A 2JD9A 3UGFA 2VMIA 2V72A 4CXYA 4IUGA 1MS4A 1BK1A 2QJVA 1XNTA 2W2IA 3H9AA 2FCVA 2PQQA 1DGWA 2A71A 3ABZA 5DUVA 3RZHA 5FP3A 1DYPA 3RFRA 1EP0A 4XUNA 5T5LA 3PVBB 3OB8A 1ZM1A 3WF3A 1XNAA 2WBKA 4AWDA 4B4PA 4C90A 1EAH1 2JG9C 2B8MA 2WDBA 5FY9A 4TYSA 1PMIA 2VOVA 2GZWA 1CPNA 2QE3A 2WFF3 4HN0A 5C5UA 3QOPA 4LHNA 5F1RA 4LXLA 4AFAA 4M3CB 2WFF2 3SKVA 3WNLA 1RUH2 3E6BA 3USSA 4YFZA 3WDWA 4JAAA 4S2GA 4XFBA 2ZKLA 5FYYA 5HXVA 4N8MA 3SMHA 3VDDA 2F4PA 5FK8A 4BWOA 5FYZA 2VQUA 5C4WA 2G19A 4Y22A 5E16A 1ASJ2 2X29A 1ONAA 2F4LA 1OVSA 3VZMA 2VZOA 2VZPA 3V64A 4JZRA 1W0PA 4FI9A 3POFA 4B4RA 1TNFA 2Q30A 4IERA 1OHFA 4EYUA 1I9RA 2JKBA 2ZKNA 5LEKA 3C7OA 3ZN4A 1W2AX 1GLHA 1ND3A 3KF5A 2D97A 2DBIA 4XDPA 4AI9A 4CEWA 4NJ4A 5KC6A 3ZXKA 1G9CA 1D0HA 2D6OX 1MS8A 2O0OA 4AEJA 5APAA 2CSGA 4LK7A 3AP4A 3T0BA 2PTMA 4EN6B 4J1XA 1QF3A 3K4AA 4A7ZA 4NVPA 1AR71 1EUUA 1RVF1 1W9WA 3GBFA 2FDGA 1DP0A 2DUOA 1BEV2 3DYOA 4XACA 2BGPA 2E26A 1G9FA 1POV3 1N1YA 4GA9A 2IVIB 4MXVA 1LOCA 2V4AA 2PAMA 1AR82 3IN9A 3FFZA 2BV4A 5L19A 2WO2A 1YFUA 1UXZA 3PL0A 4IE4A 1C3HA 2WA4A 3TYJA 5FZ8A 3ZDSA 2PLV3 2VQ0A 3GF6A 3MFCA 3KLSA 4XUOA 5B4NA 1REFA 4P14A 4Z92B 5FPBA 1WMFA 4JKMA 5B2GB 1ND3C 4HETA 2OQ6A 1CX1A 1SFPA 4Q4V1 1HQWA 5BNPC 4I09A 4GMP0 1H1IA 2VY0A 3L2YA 4QQHA 1OKOA 4I02A 4LO5B 1OPMA 1H6YA 2YBPA 1KJLA 3H3ZA 3HPNA 3IAPA 5CG9A 1CJDA 1EPWA 3AXEA 2QNKA 4N53A 2QCSB 5FXZA 1N1SA 1LNSA 4Q0UA 1D2SA 3Q8CA 3I3MA 5DG1A 1PVXA 4CDQB 3I59A 2BFUL 1RUI2 4AR2A 3UL2A 5C6CA 1QH6A 2W92A 3NAPB 4P02B 2J1UA 1AXKA 3GNEA 5F9TA 4YYOA 1HRV3 2FDHA 1RUI1 1IS5A 4TTGA 1XJAA 2JDYA 5LW9A 4AFCA 2LW8A 1GP6A 2X10A 5SV5A 1JU3A 1TME1 1N47A 1W2NA 4QPYA 3VBRB 5C3PA 1AL22 4LO6B 2GMPA 2WZR3 3LFMA 1GR3A 4Y5Z0 2BVBA 5DUXA 1MS3A 1O3QA 4Q4V2 3USUB 3B69A 2GC1A 4XIKA 4BCUA 1Q8SA 4NE9A 4CPBA 1LOFA 1Z7S3 2XGXA 1A34A 1DLCA 2DVBA 1DYOA 4HFSA 2YZ4A 4LHLA 4WVMB 2K9ZA 3WT3A 1VJ2A 2RMU1 1PZ7A 5FZ3A 2I45A 3M2MA 2BU9A 4Q4X3 1UY3A 4C1WA 2NM1A 3HNMA 2A6WA 2H0BA 4QDSA 1H1MA 3K48A 1VBB3 3MW2A 1WCSA 3P6BA 2W91A 3V56A 5IATA 3I59B 1JOPA 2ARAA 3ZXEA 3J26N 5FPXA 3VBSB 1QU0A 1NCQC 4CCLA 4N53B 1UPSA 4MO3M 3O1PA 1QXPA 4Q0QA 3WNKA 4CRQA 5A32A 5CZKA 1W6NA 5T50A 5A3LA 2BYVE 5IHRA 4IEXA 4BK4A 4AF9A 2GC3A 1A6CA 1ULOA 1NQJA 3KCCA 4BQWA 4OI0A 3GCXA 4YGEA 5JSPA 3SCGA 4XBLA 1C5HA 3GCWA 3VZKA 3H8UA 3CF6E 2W1QA 5F3IA 1DGRA 5IUQA 2ZEWA 4MSVA 4DS0A 1MZEA 3VKNA 4XTPA 3OGGA 5EYXA 2BNOA 5IFPA 4KGQA 2J42A 4AI2A 1NX9A 5J48A 1RUF2 1GU3A 3WNOA 2Q8DA 2ZOEB 4QXCA 4UW4A 5CKQA 1MZ5A 2UY8A 5IFTA 4TWTA 1V6LA 1OT5A 4WVWA 3SISA 1H8VA 3SHRA 2WAAA 1LHVA 1UYXA 1POQA 5FYTA 1VRH2 3HN1A 4GIQA 2HWC2 1ND3B 1O4TA 1J59A 3W5MA 4MGIE 1JZ4A 2R30A 4K20A 1XU2A 2DF7A 1RJ7A 3O5SA 4J1WA 3MW3A 3WHUA 4D94A 3UNPA 4OUSA 2W3JA 5FZ1A 2CV6A 4JGZC 1GOFA 1VB4A 3U75A 1YRZA 4R4ZA 5FOJB 4QDRA 3GHMA 4IQPA 2WWJA 5FZOA 2HWC1 3AL5A 2NQYA 2J1SA 1G8WA 1QNYA 5A7PA 4EN7B 3ZYJB 2DUPA 2WS93 3VDDB 5I91A 2XMLA 3KVAA 3BPZA 4NUBA 1B09A 4ASMB 2KXLA 4DEQA 2X53S 4XF9A 3BUCA 5DPNA 2UYBA 4QX2A 1VBD1 3BIEA 1E5IA 1SBEA 1YQ6A 1RIRA 1ZA7A 2IZWA 3O1OA 5A3TA 1HXS3 4HT1T 1VBE3 5IK8A 1AR73 1RVF3 3RVHA 4CU6A 5BNOC 2WABA 1H2NA 1T6GC 5I0UA 4FPHA 1WD4A 3UGHA 3KV4A 4OHXA 1PMHX 3OGSA 1Y9QA 2XL9A 3SH3A 3J8F2 3NJXA 1NQDA 4WVZA 2PFWA 3TBDA 4UAPA 5FYSA 1QDOA 3VKLA 3TEYA 1SCSA 5A7SA 1YFYA 4MX3A 2CY6A 3GZEA 4LBQD 3I2FA 3H42B 5LBBA 4CP1A 4UFMA 1HIXA 3WG4A 1HRI1 3NW4A 4G4FA 4CUAA 3RZGA 1R1ZA 1G86A 2VM9A 3NO8A 3OYWB 3S5AA 1DZTA 5DDJ2 1X36A 4Y3OA 3LAGA 1S1AA 3GZAA 4CCMA 4JCKA 1TZOA 5EJ3A 3N9PA 2W1UA 5F8PA 1UL9A 2OS2A 2ZX4A 3WP3A 1PM7A 4RS5A 5KWRA 3FLRA 1ND2A 4A3XA 1ZBA3 1YFXA 3J4UH 2G9ZA 4ZONA 4Q4Y3 5A1AA 4BU2A 4XMAA 2E51A 1D2QA 3MI8A 2L9LA 1POV0 1IPJA 2RS51 4IEOA 4BIFA 4K3UA 1JI6A 1K3IA 4BE3A 4CDWA 4WZCA 2D6MA 2XUMA 5F5QA 5F3GA 3MYXA 5E8AA 1F15A 2Q1FA 3T30A 1K5MA 3RMYA 3K4ZA 5FMOL 1CJPA 5C3RA 5LRSA 1C5IA 5F7UA 1Z7S1 5JR7B 1B35A 1ENQA 3JCIA 5DAWA 4A7KA 2QQUA 4QGMA 4XUTA 4F8AA 2QQKA 4BHPA 1MEC3 2WO7A 1K42A 1QQP2 2XJVA 3A0NA 4GB33 4NIIA 4XJAA 2KD7A 2XLFA 2R16A 5AVAA 1N1VA 4I30A 4MGSA 1LU2A 4QDQA 4DMIA 5FY4A 5GM0A 3WNMA 5JR2A 2PLV1 3J9SA 5LBEA 1H8TC 5LK5A 3WG3A 1UO9A 4YGBA 2TBVA 1S0FA 2RDRA 1YIPA 2QZ2A 2XVGA 3N7JA 4AYUA 2JDUA 4M00A 2EXKA 4Y1XA 1ZZ7A 3DEMA 1MR5A 4MOAA 1K5JA 1SFYA 3ECQA 4Z1VA 2ORZA 1CPMA 3T1MA 4ATFA 4Z2AA 4BQ1A 1YUDA 3RWKX 3NNFA 5IJRA 3AMQA 3D0SA 4MGYE 1VALA 2WN3A 5CVRA 1HQNA 1PO22 1NA1A 2PN5A 4XEZA 5JPMB 4NHMA 4HVQA 4GB32 3ILFA 3OY8B 2BUKA 4O7XA 2WT1A 1FMD3 2Z42A 2BWCA 1F4AA 4RN5A 5KR7A 4DUXA 1OUXA 4FO9A 4CDXA 2RDQA 2VCAA 1GZWA 3AYAA 3H8OA 4MGTA 3OD0A 4AZZA 1W6MA 1HW5A 1VBA3 1HN1A 1UX7A 4AQTA 1UPIA 1RUJ1 4ONUA 5BNNA 2XG3A 4QHBA 4NPLA 3AZVA 2VZQA 1TMF2 2W46A 4G3YC 3H1WA 4YVWC 1AR61 1QKQA 2Y6JA 3D4KA 2Q8CA 3BALA 2X5IB 2GU9A 5HPOA 4XJWA 1V9U2 2IXHA 1CN1A 2EXIA 3NSTA 3PUQA 5A6YA 1C8M3 2ZHLA 3IWZA 5C3OA 1YEWA 3GBWA 4DXRA 2JE9A 4Q8KA 1FI2A 4RR3A 4BLIA 5C3QA 2Y26A 4Y1UA 2ENRA 2AENA 3KB5A 4OCTA 5FYHA 4FBFA 1WCUA 2ZMKA 3ENRA 4HK8A 4L99A 3FE5A 4V1PA 4E2SA 5FMCA 4OHWA 2VGDA 4FFFA 3AYDA 3ZPOA 2Q1ZB 3EB7A 1A3KA 3I2GA 5FZ9A 4KBBA 5D8AA 3HR9A 4CEYC 1NXMA 1XE7A 2OVUA 1MQTA 3KHBA 1ZRDA 5JXHA 2XXZA 3CLPA 3DYPA 4CP9A 3CDZB 4HSLA 2RJ2A 4HPKB 4M3CF 3V0BB 3LQCA 1ULGA 4UBGA 3THPA 1J1LA 5C33A 5DZFA 2C1FA 1VAKA 4W8JA 4D7TA 1OC1A 2BEOA 3DN7A 4J25A 2B46X 3K75B 2DTWA 2WNVA 3ELNA 4FCAA 2A7AA 1SFNA 1RHI3 4DEVA 4NAMA 5FFOC 4CEWC 1HDKA 5LY1A 2JDAA 1UMIA 5CKNA 5EV7A 2QDNA 1DFQA 2ZGRA 4ORFA 2W95A 1TE1B 1QJFA 2BQPA 5T54A 4EE2A 5FYUA 4NIDA 4BQYA 3OD4A 1W6PA 4Y5TA 5A3OA 1WCQA 3ZR6A 1YCIA 4JV4A 4LMFA 4CCCA 4NHYA 1Q8QA 4ET7A 1WBLA 3KV6A 2GP5A 2JKXA 4LBNA 3TWIA 1I1EA 2ZZQA 4AGVA 1W6OB 2PHTA 3WUDA 3NV3A 3FWEA 4K1YA 4LTAA 3E1F1 1BYHA 1OUSA 4KU8A 1LR5A 3E6DA 1AUYA 3RI8A 3FHAA 4QPGB 4GH4C 2FDJA 1Q8OA 2J1AA 2PHRA 5FK7A 2WR9A 4CDUB 1VBD3 4LULA 5L7OB 4COZA 2Z5WA 5FUPA 2BOIA 3LEIA 1K45A 1UU5A 2EXJA 1YO8A 1WCDJ 2VMFA 4IV1C 2W5FA 4NRMA 1MVQA 4Q4W2 3K77A 2BWAA 3BU7A 1JYNA 1X82A 4AQSA 1IPKA 2ADEA 1VBC1 3VKOA 3A23A 2JEMA 1DZRA 4XE9A 1QMJA 3MPPG 1GNZA 4YVSB 1EV13 3VBFC 1TG7A 1X33A 1RB8G 1PGW2 1XRUA 3WSOA 2HWF2 3SH5A 4DXZA 4YM2A 4FVVA 4QPGC 1AR62 1V00A 1WUVA 5A1LA 2PHWA 2CDOA 1Y7BA 1NLSA 1XBFA 1SDWA 1R64A 2ZAHA 1DQ5A 5F2WA 2R32A 1R1A3 4RL7A 3CJIB 2PHFA 1XYNA 2Y6FA 3AKSA 4OI4A 2Y0IA 2WQZC 3V65A 1JYIA 1VBB2 2VNVA 3KT1A 3N7LA 1HX6A 1W2TA 5EWSA 3WP4A 4CSWA 3VHPA 2JB8A 5FYMA 3MUZ1 1MEC1 5H9SA 1XC6A 5FLHA 2WA3A 3DV8A 2BFUS 2P3IA 5JIUA 1OOPB 1J83A 1UMZA 3T2PA 3ZYGA 1DQ6A 1QIQA 3ZYHA 1SHWB 1VRBA 2J1RA 2WJSA 1EY2A 1FXZA 5JZGA 3MIGA 4P9IA 3ZYPA 3BPSA 4LLOA 2BW8A 4Y1YA 1H1AA 2LS6A 3LIGA 4D7YA 3N9LA 2ZHNA 3AKPA 3N7MA 5F5IA 1WCKA 2GH8A 3AMMA 2X05A 1AR92 1ZZ8A 2R073 3HJRA 4FPJA 3PMSA 5LA2A 3FLTA 2DURA 1ENSA 1CZTA 1W9FA 3IMNA 3OBTA 5ANQA 2GC2A 5LBFA 3A22A 4LPLA 3OJBA 2W87A 3MBWA 2VZTA 3I2IA 3KT7A 1LKNA 4FPYA 3DKWA 1C8M1 1UNBA 2Z79A 4FPEA 2FMDA 4ISRA 4JX0A 4MGKE 4FOYA 1QHDA 3OSDA 4WVVA 2GMMA 1PGL1 1REEA 4KWKA 2FDIA 1AX2A 2W1SA 4CCDA 1J1TA 1LGNA 1AZDA 1DF0A 4NN0A 3DL3A 4COUA 4DZGA 3RZKA 5FPUA 4UT5A 3POEA 4BH9A 1UD1A 1C8NA 5I0SA 2V09A 1W6QA 2ZGUA 5T55A 3VBOC 2D44A 3FLPA 3H0OA 2BNMA 3HQXA 4Q1PA 3WDVA 4IV3B 2D40A 4XCBA 1D7PM 2C0ZA 2XJTA 3IIAA 4HOOA 3PIJA 3JBG1 3RMXA 2DVAA 5IVVA 5JLVA 3LB9A 1X50A 3P3PA 2YC2A 3LDKA 2XJPA 3JZVA 2WT0A 4WM7C 2HWD1 4AFDA 1ZZ9A 1FMD1 4BZ4A 2WLPA 4JGZA 1NUKA 2EAKA 1W9SA 4QKDA 2IXJA 2CAVA 3RYKA 3VGIA 2ILMA 1YXWA 2HBUA 1FOD1 3BVCA 1IZ3A 4FPCA 4FQ4A 1XE0A 4OULA 4JGZB 4GH4A 3S30A 4JGYC 4AVTA 3PU8A 1OQDA 1MS0A 1QEXA 1RUJ3 1W8WA 1RUF3 3ORJA 2IXIA 3CL1A 4IV3C 5KXBA 2DU1A 3W9AA 1CAUA 3UKVA 4YVSC 5AC93 4AOCA 3ZXJA 3VDDC 4BOWA 3PVOA 5IK4A 3ON7A 4KBZA 3OBRA 4YZ5A 5ACA3 1C1FA 2GNBA 4IV3A 4DO0A 4I3PA 2ZMLA 5FREA 1Y9MA 5FV3A 2D5HA 5FZBA 1W9YA 1LB2A 1W8UA 2CDPA 4LR4A 2BDRA 4HBNA 1AJOA 1JW6A 5LCWL 3MIBA 4PQ9A 1GUIA 1YC61 2VNOA 1G7YA 1IG0A 5C70A 4FPKA 4HSJA 1ZZBA 3N4MA 3RYPA 5LK7B 1TVGA 4Y1VA 2XB6C 4PIXA 3M7AA 4HK9A 4WM7A 5EJ1B 4KWLA 4A4AA 4YZ2A 3FHIB 1GQHA 1GNYA 2FBEA 3INAA 1AYN3 1PVC2 2B9UA 3JBG2 3M8LA 5DQ0A 5GLVA 3AZWA 1GQGA 5CIRA 1OFNA 2WZ8A 3JUUA 4QXHA 4QXBA 3NQHA 1W2OA 5FRAA 1OKQA 5FAXA 5SV8A 1LENA 4OHVA 4RA0A 3UJQA 3WF0A 2R063 3QD6A 2Y8KA 1S0BA 2AEYA 4QB1A 3ZFEB 5C8WA 1DDLA 2AUYA 4XILA 1R092 1RUE1 4CCJA 1LOBA 1AXZA 2WZR2 5JZGB 1SPPB 1RUJ2 1JZ5A 2D98A 3IAQA 4NRQA 4AQ2A 3ZFGA 4XAAA 3S5QA 1W9TA 2RDSA 5CISA 3VBOB 1DYKA 5JWPA 4QQOA 1FAYA 5J7MA 2AREA 1OPOA 3A0KA 2XH6A 1DQ2A 3ZOIA 3CJIC 4L9BA 4RGGA 1XNDA 4XZPA 3AP7A 4PF5A 4LNVA 2OUJA 5FIXA 5AFEA 1FATA 3DKQA 1AYN1 3KCYA 3SXWA 3WF2A 3P1IA 2VMHA 4CDUC 1NZCA 3JQWA 4IEPA 5L7OC 1W90A 1QJZA 4CUCA 4LE4A 2F17A 2PHDA 5JIAA 5IK7A 1LOAA 2XKPA 5C8CC 5BNNC 3WXPA 3PUAA 5AVPA 4ZZ8A 1RUE3 3PJQA 4XFCA 1BMV2 2A73B 3I2DA 4L11A 1STMA 2ORXA 2VU9A 2G9GA 2AEZA 1CIYA 2E7AA 1NOVA 1DIWA 2W52A 3K4DA 3RJ2X 3VKMA 1QOSA 1Q3EA 2XJSA
chains in the Genus database with same CATH topology
1AR83 5BYNA 3S6PA 3N35A 4EN9B 4Q8LA 2A3WA 1UAIA 4LBQB 2WSVA 1UIJA 1BEV3 1GYKA 1ZBA1 4BLJA 2CAUA 4QPGA 2XPJA 1RJ8A 1KRIA 1RTVA 1H4HA 1ALYA 1VIWB 4N7UA 1ZBE2 1W6OA 2YGMA 1CONA 4PBPA 4GWMA 3U07A 1LODA 5K0UA 3VBFA 1PGW1 3TRSB 3POSA 2A6VA 2CGPA 2R062 4YZ4A 3VL9A 1Q5OA 1W6PB 3NV1A 3ZYRA 2VXRA 4IV1B 2WSUA 3K51A 1GSLA 2B7YA 1AYN2 2GDFA 3JBG3 2LTNA 4HN1A 3FZ3A 4HL0A 2CGNA 4AEDB 4UW6A 2W0XA 2I2SA 3HT1A 4META 1HRV1 1COV1 2RR11 3VHNA 4EWEA 4WBBA 4RQPA 2ZCWA 1OA3A 4TZDA 1V6NA 5AFBA 5CFCB 2F6BA 3RJRA 2NMOA 4AHXA 1F9KA 3VBUC 2WZR1 1UZZA 2RS52 4JGYB 2A3YA 3V0BA 3AKQA 3DPRA 4OHYA 2P3KA 5FLJA 5CU1A 3NAPC 3B9IA 1CAWA 2HWE2 4PIYA 4Q4W3 2MEV2 3VBUB 2IXKA 3GHNA 2FZ2A 4F7ZA 3WR0A 2EF6A 1CVNA 1LJ7A 2QUOA 4W6YA 1MZFA 4E2GA 3TOJA 3B01A 4LA3A 4XJ9A 3FBYA 3VBSC 4K40A 2DVFA 3H3UA 3W59A 5BPXA 5K7PA 5H9RA 1I5ZA 1PHMA 4IEVA 1JHNA 2GN7A 4H3WA 5JSOA 2JG9B 3C2UA 2VW0A 3D5OA 4MYEA 4QQPA 4XFIA 4B8EA 3FUQA 3KT4A 4DY3A 1EYBA 4CEYA 3ROUA 1KFXL 2HWD3 4D69A 5ACA1 2D3PA 1Q43A 2UWBA 3O0VA 5JDBA 1PVC1 4YVWA 1SCRA 4Q4X1 4E2QA 1UX6A 2RJKA 4QPIA 1CAVA 1QGLA 2WINB 4INDA 4FOVA 1JUIA 5KXDA 2PAKA 5LEJA 3AP5A 4FT8A 2R1BA 4XTMA 1S0IA 4YW2A 5JMCA 2HEVF 2C9AA 1EAH2 1C1LA 1RC6A 3H7YA 2ET7A 3PVNA 3MIEA 3SCHA 1LOGA 3BTAA 2VULA 1H30A 1DGWX 1LGBA 5IK5A 2GNMA 5KXCA 4FTBA 4UW3A 4MH0E 1BBT3 2RE9A 3ZSKA 4Q29A 3N3HA 4MXWB 2ZJCA 1IKQA 2OPKA 2GNTA 4Q0PA 3JQXA 2TEPA 1FX5A 3SCFA 3LA7A 4B7EA 5E89A 4XHXA 4PDWC 4S2FA 4COVA 5GKAC 3PLQA 4Q0VA 4LE3A 1B35B 4FOQA 3EJKA 3I54A 1V9U3 3HIFA 4XFGA 4I3GA 1K5MB 5F6KA 3OF1A 1AR91 1TMF3 4BM8A 2IFRA 4PCRA 1K5MC 3DGTA 3VBHA 4BIOA 2HWB1 1MQTC 2WWSA 2V73A 4J6GA 1VBA2 2LALA 5KHHA 1RUD3 2RS53 1BVVA 1SLTA 2G4IA 3LZZA 4PDWB 1OD5A 4CYDA 4YG3A 3I4IA 3H1YA 1SBDA 3DPRC 4FXKB 4RR3C 3WZ1A 5C4WC 3KCXA 3ZFFC 3ZXDA 1PO23 2DV9A 5HCFA 1AJKA 3OYWA 2RMU2 3UV9A 3VBUA 3IPVA 4JRLA 1CR7A 2XJRA 1CAWB 4EWDA 1KXGA 4FAGA 1YI9A 3R0RA 3DPRB 2RS11 3VBHB 3ZSMA 4JGYA 5KHKA 1DLLA 4ITCA 5DZGA 5GLWA 4AFMA 1M06G 4C0BA 2JICA 3I7DA 1DGLA 4CDXC 1ZBE3 3CEWA 4FP2A 5BNPA 4RQPB 4QQ2A 1YWKA 2XL7A 2ZX3A 3B00A 1AR81 5J98B 5ABJC 2E63A 1S0GA 3MLLA 1HKDA 2G9FA 1NA1C 1RUC3 1RMU1 3D8CA 1XYPA 1RUD2 4MXWA 3VKFC 3IM0A 1XNBA 1QOTA 4FSJA 1YHFA 5DUUA 3VLBB 2X8KA 1NCRC 1H2KA 4Q4Y2 5K0UB 3AKTA 4PJYA 2UU8A 1HV1A 1Y43B 5I0TA 3VN4A 4M3CE 1RUG1 4YRDA 3O7OA 1MS9A 4YW1A 2YMZA 4AFBA 3D82A 2BTVC 2VPVA 2HJIA 1VLNA 1CAVB 3M3IA 4AI3A 1ZX5A 1U0AA 4YVWB 3JD73 3MLKA 5JOWA 1WD3A 5LRRA 3KSCA 4CEYB 2GSYA 4URTA 2PELA 2JG9A 3VZOA 4XFHA 1IHMA 5CNAA 4AI8A 1W6NB 2PHXA 2YHJA 1X7NA 4GQ7A 1FNYA 4IL7A 1HXS2 1GV9A 4M01A 3S7EA 1ZREA 1FV3A 3SLIA 1DQ0A 2ZACA 1PVC3 1QJY2 2N7GA 3WUCA 2ZABA 4K6BA 2HEYF 3PVEA 1OOPC 3VBOA 1TQ5A 3WCSA 1FMD2 3QCWA 4L97A 4R9AA 2DCKA 4IEZA 4XOGA 3ZFGB 4N9HA 1KS4A 3KGLA 2Q8OA 4WVMA 3ETQA 1H0BA 1APNA 4EN8B 1AYM1 4TLFA 4AVCA 1W39A 4KL1A 4U2AA 3ZXFA 3IDBB 3RRDA 4P9XA 3B7MA 4XFAA 5I8TA 3ST7A 1ZZ6A 4YZ3A 3C3VA 3MW4A 3EHKA 3I8TA 2R043 1PGL2 3WLUA 1DZQA 1QJX2 4AEDA 3FUOA 3ZO0B 2MEV3 5T52A 1F2NA 4IEYA 3R6SA 2HWE3 5E1RA 1GBGA 1XYOA 3DF0A 3WDXA 3AJYA 2IXCA 4BYYA 1PO21 2EALA 4KWJA 3MPBA 3ZPYA 3QACA 3LOIA 1EPZA 1LHOA 1O91A 2CGOA 1N3PA 3UKTA 4A2UA 1ENRA 2V5YA 4M0NA 4XF1A 4JDOA 4AVAA 1CAUB 2ZHKA 2GALA 2ZPXA 4E4SA 1GZ9A 1VB2A 5A33B 4RHV3 1KJRA 3MEPA 4LBQA 4LHKA 1X8MA 1ULCA 2Z2SB 4XPVA 1LRHA 2JD4A 5CADA 1QJU1 3MIDA 4HZFA 2XBO2 3KS7A 2FZ1A 4OZXA 2ETEA 4CEWB 2B39A 3WW3A 4N90A 1AL23 4ATEA 1PNFA 5BNOB 5D8AC 3ZSJA 1VR3A 1F5JA 1UCXA 1WW4A 4QM9A 2WZPP 1W6QB 1QDCA 3WOGA 4N43C 4Y22B 3AM2A 2BGCA 1KDMA 2P37A 5KHGA 2XBO3 3H50A 4N43B 5L36A 1AXYA 1AR72 1RVF2 2GMEA 3RYRA 4Q27A 4C1XA 3BOPA 4IEWA 1S55A 2RM23 2IWGB 3O0XA 3AMNA 5EFUA 2DCZA 3ZFFA 4HMZA 2QVSB 2UYAA 4LLFA 4QGNA 4ASLA 1R1A2 5FOBB 1LULA 1SBFA 4UW5A 4OUMA 3QH6A 2ZHMA 2ZMNA 2D6PA 1WLCA 2DTYA 2RS33 2VNGA 4FPOB 1GANA 4A7YA 1SQ4A 3ZFFB 2AYHA 4FTEA 2I07B 4HKOA 4SLIA 2XBO1 1OFSA 1RUH1 1UU6A 4Y26A 2RR13 4LA2A 3ZXLA 4E9KA 4YLZA 4K7JA 4XJZA 4QQLA 1O3SA 2DFCA 4N43A 3POWA 2B5HA 2C5DA 1QJX3 1BJQA 1R083 3ILNA 4PLNA 1F8VA 1V6KA 4MZUA 1LEMA 3E5QA 3ES4A 4DPNA 5H9PA 4N9IA 4QT6A 4BMBA 5BNOA 1LEDA 4MUVA 5FTTC 1OA4A 4QGLA 1QWRA 3WINE 2R071 5JAXA 4JQRA 4F3JA 1PO13 1RUG3 4Y20A 3THTA 3WW1A 3EBRA 2RMU3 3ZMNA 1WBFA 1XE8A 1J3RA 3LSDA 4GH4B 1VRH1 1QH7A 5GJ6A 2ERFA 3CJXA 3N7KA 4AGRA 4YGCA 3TN91 3URFA 1AHSA 1D0GA 1U5IA 3QBQA 5A33A 4CDUA 1XXNA 4DRRA 5L7OA 1RUF1 4P5HA 4LBOA 4Q4X2 1BZWA 2OIIA 4KQ7A 1PZ9A 2XJQA 1V9U1 4FAHA 3R4DB 3AX4A 3VZJA 5ACA2 5C9AC 1ZA4A 2R1DA 5AC92 3BOWA 4OVEA 1NLRA 3D6EA 1GNHA 4AEMA 1FPN3 4YW5A 3JD72 1N3QA 5D1IA 2Q5TA 3ZN6A 2XLGA 4FQZA 3TN92 3WDYA 2K0GA 2OZ6A 1Z0HA 2IFWA 1DU3D 1BBT2 2A3XA 2ZTNA 3S7IA 4YARA 1AYM3 1HV0A 4DOUA 1EV11 4KG8A 2EXHA 2FHRA 2EIGA 1LOFC 3V0AB 4W65A 4K9SA 3RWNA 1EAH3 2WL1A 2ZX2A 1OOPA 4AI0A 2WS91 3VBRC 5D8AB 4AK3A 3NKGA 2DCTA 2CWMA 2DUQA 1BKZA 3AFGA 4DQAA 4DY5A 2E53A 2O1QA 5KHJA 4DRVA 5JZGC 1WGPA 1VBE1 2YY1A 1AR93 1POV1 2RJLA 2WLQA 2YPJA 1UW8A 3CJIA 3FJSA 1AL0G 2HWD2 4DB5A 3BIWE 2JECA 4FPLA 2H6CA 2QZ3A 3NL1A 2NLRA 3LGRA 3UJOA 2PYTA 2RS12 5EXOA 1HLCA 3RZZA 3WQ0A 3WX5A 2X5IA 3LKJA 5DG2A 3SH4A 2SBAA 1AVBA 1QXRA 2XJUA 4HANA 4K21A 1JUHA 2YUEA 1UKGA 3WV6A 5K8SA 5BNNB 4ES9A 4LO8A 4YW4A 1NY71 5T3NA 1W6MB 1ASJ3 4CTEA 4YM3A 3AXDA 5FMOS 1GZWB 4CDXB 3VZLA 4GKYA 3MF9A 1BEV1 1MACA 2D3RA 1VAMA 3GYDA 1HRI2 4OHZA 4OI1A 1NA1B 4X6RB 1LOEA 4XETA 1IS3A 2ZGLA 1ZRCA 1YI7A 5GZCA 3RSJA 3U0ZA 4JTNA 3ZVXA 5JI9A 2ZGNA 5T5PA 1DGRN 1H2LA 2WT2A 3WNXA 3WG2A 3VHOA 2XLAA 1EV12 1SACA 5J09A 2ARBA 5EZWA 5GLUA 1A8DA 1KD7A 1JH5A 2IXLA 1O4ZA 4JDMA 2RS31 3MZHA 1ASJ1 1ZBA2 4M0HA 1RUC1 4WM8B 2P2KA 1LECA 1VBD2 4U36A 5F6LB 3JB4C 1RGSA 2O8QA 3AYEA 3NWKA 5GZEA 1H4GA 1CX4A 5BNPB 1WMDA 1Q8PA 3ZSLA 2VG9A 1BMV1 2CWSA 3T1LA 1UZYA 1PIV3 5I0RA 1J3QA 1Z78A 1N3OA 4GWNA 4HPKA 2ZA9A 2DVDA 2OW4A 3H7JA 1IOAA 1MQTB 1U12A 3VBHC 5BNQA 1ND2B 2VECA 3IPVB 5H9QA 2DCYA 2H6BA 4QXKA 4AE2A 1RHI2 2P3JA 1O5LA 2WFF1 4Q0SA 4YM1A 1TEIA 4OFGA 4YM0A 4RR3B 2XVKA 4PDWA 2VOXA 5CB7A 4CP0A 2ES3A 4XBQA 1HXS1 1R091 1RUE2 1OQEA 3AYCA 3NVCA 1XU1A 4XQWA 2JJ6A 2UY9A 4S2DA 4X6QB 1Y3TA 4F83A 1LHWA 3EQEA 4BA6A 2E9QA 4RGAA 4COYA 4C91A 2BVVA 4XMIA 4GALA 5KXEA 5J96B 1D4M2 5DZEA 5JSRA 3ZN5A 1O3RA 1RUNA 1W0OA 1PIV2 3LCPA 3PNAA 1X8EA 5L73A 2HWC3 3AB0A 2YXSA 1V6IA 1ZRFA 3TN93 4AHZA 2GAUA 2D6LX 1FOD2 5FCCA 2YC0A 1LHUA 1ULFA 1LCLA 1O7FA 3OY8A 4RD7A 5C9AA 3KGZA 3HMYA 1MVEA 4AI1A 2QKDA 2HEWF 4XJUA 4AVVA 4AVSA 4ZU4A 1CIWA 4RFT0 3MGUA 3BODA 2DU0A 1AL21 4E27A 1ENXA 4XXPA 4RQPC 2VVEA 5IT6A 2BBVA 1HQLA 3ALQA 2R041 4UXAA 1ZVFA 4D7SA 3VUOA 2UWAA 2NMNA 1COV2 4Z82A 2DFBA 4XJ8A 3NJZA 3TNQA 2P17A 3ILRA 5EYYA 1HRI3 1S2BA 1SEFA 5JI7A 1MZ6A 2LUWA 4ZU5A 1H8TB 2R0HA 1RMU2 2H0VA 3KZ4C 3ZIWA 2ZS6B 4QPIB 1RUG2 4P9JA 2JDZA 2WNEA 3L9JT 2R061 1ULDA 2YYOA 2GN3A 2A6YA 3MFAA 4B3NA 5E88A 1SLBA 5GLZA 2QQPA 3CO2A 1TME3 5K9YA 3ZIXA 2R0FA 1UKRA 4HLTA 4R52A 5GZGA 4AEKA 1U5ZA 4FTSA 5JPNB 2DCJA 3E97A 2TNFA 3FX3A 1R082 1IKPA 3M1HA 3OGJA 4RS5B 1QJU2 5HCBA 1NE4A 1IGOA 5KHIA 4I2OA 1MEC2 2D93A 3GBGA 4IEUA 2W68A 3RS6A 5FPZA 3CNAA 3PMEA 4LBLA 1AX1A 2VMGA 2RR12 5FO9B 1HRV2 1PK6C 4BMEA 3NKTA 3PJYA 1B35C 1XQNA 3M4FA 2WIIB 3M3OA 2RS32 1OA2A 1PK6A 2E7TA 4W6XA 3USUA 2WNVC 3WDTA 3O14A 4FP3A 2WC2A 4H7MA 2HWB2 3VBRA 1TNRA 4JVAA 4C0HA 5CFCA 1M4WA 1WA4A 1ZBE1 4CDQC 2PLV2 2ZGKA 4FPFA 4GMP3 4XF4A 3RQ0A 3FFQA 2A75A 1DQ1A 1V6JA 1VBB1 4R9BA 3ZFGC 4XXAA 3WD5A 4Z2WA 5HBAA 1JYCA 2GH2A 3WCRA 5J37A 4P9WA 2DVGA 4IV1A 3ZSEA 2W08A 2D7FA 2K2SA 2AR6A 3E5UA 5HI0A 5LRSA 2YV8A 3VBFB 5BY5A 1R093 1URXA 1S2KA 1FV2A 3ACLA 3U11A 1FT9A 2D5FA 2NYYA 4Q2FA 2OZJA 3HD8B 4I0AA 1ULEA 3PTYA 2GC0A 1FPN1 5BUVA 2B42B 3B02A 5GZFA 4Q26A 4I01A 1V6OA 4Z07A 1MS1A 3E5XA 3KMHA 5DDJ1 4DFSA 1QJY1 2WNUC 3RNSA 4BPZA 2ARXA 3QLQA 1PIV1 3B9CA 3L2HA 1RINA