1SBEA

Soybean agglutinin from glycine max
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
234
structure length
231
Chain Sequence
AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENEQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOYBEAN AGGLUTININ
publication title X-ray crystallographic studies of unique cross-linked lattices between four isomeric biantennary oligosaccharides and soybean agglutinin.
pubmed doi rcsb
molecule tags Lectin
total genus 40
structure length 231
sequence length 234
ec nomenclature
pdb deposition date 1995-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sbeA00
4WV8A 3ZPYA 3M3OA 5T50A 2EAKA 2WLQA 4GWNA 4YGCA 3OY8A 4XMIA 3VKMA 3TB0A 4DFSA 3A0KA 2VW1A 2R16A 3AXDA 1Z78A 2DUPA 4L8QA 4YW4A 3AJZA 4YFWA 2WT1A 4Q2FA 2BQPA 3USUB 3WUDA 2V73A 3O5SA 4UW6A 3L2YA 3WCRA 4K20A 1W6OB 3DGTA 4K1YA 2PHRA 3UL2A 1LCLA 5E88A 1W6NB 5EWSA 1Q8QA 3AP4A 1DFQA 3B69A 5E8AA 1LULA 1UZZA 3ILFA 4R9CA 5DUXA 4Y1UA 1JHNA 2B7YA 3RMYA 3A4UA 1A8DA 1S0JA 1FATA 3AZXA 1CIWA 2EF6A 3MPPG 1SCRA 2AGSA 2GN7A 1G86A 5JOWA 2W08A 4M3CB 1ULGA 2A71A 4ZXKA 1WBLA 3AJYA 1N3PA 3AP6A 3OBRA 1VAVA 1VIWB 1BZWA 5L73A 3ZYRA 1MS1A 3C2UA 1SLAA 3NV2A 3OPZA 2GNBA 2UURA 4FQ4A 4P9WA 1HKDA 2ZGRA 3WDTA 4UW3A 2CWMA 3APBA 3N35A 2D6MA 4IQPA 4XJZA 1DGLA 4LBQB 1RIRA 3AX4A 1KITA 4BLIA 1H9WA 4K1ZA 3AXEA 2YROA 3FLPA 4KBBA 4ATFA 5JOZA 3N36A 3FLTA 2EXIA 1LTEA 1V6LA 3VUOA 1NXD1 3O0VA 1GNZA 2CL2A 2DU0A 5H9SA 4YZ2A 4FPKA 2CNAA 5JOXA 2AENA 1GSLA 2ES3A 3ENRA 1RINA 1WBFA 1ULEA 2AUYA 4GALA 5T5PA 1I1EA 1AF9A 1IOAA 3WHUA 1UAIA 4LBQD 4DPNA 2A6WA 1U0AA 1N1VA 4FPEA 5GM0A 1YO8A 2NN8A 3N7LA 3NV4A 2AYHA 2R0HA 1SFYA 1BYHA 1I3HA 3KQRA 3R4UA 4GXLA 5DUUA 5JVVA 1Q8SA 2HYKA 2CY6A 1GZWA 2XG3A 2ZGSA 4FPFA 3ZSKA 2RHPA 1BQPA 1GICA 1YI7A 2DTWA 3MW2A 5T5JA 3CNAA 1IS3A 4YM0A 1WW6A 1Q8VA 5KXCA 4XXPA 3WG2A 4YM3A 2A6ZA 1LGBA 4XJUA 1IKQA 3NV1A 1IS6A 4MYEA 3AP9A 2ZGPA 2JDZA 2DVBA 3V0BB 2R1DA 2WQZC 3PVEA 4C1XA 1H9PA 2P37A 3SH3A 1BXHA 4FPJA 2UU8A 4XYXA 4ISRA 1WD3A 4Y22A 2GNDA 2OVUA 1KJLA 5SV8A 4XJ8A 5HCFA 1N47A 4YG3A 4BMEA 1W6QB 2A5ZA 4Q8LA 4Q1RA 4W65A 5KXEA 4YLZA 4Q1PA 1LHNA 5DG1A 4Q8KA 2JKBA 1KRIA 1W6PB 1V6MA 2D6PA 1GKBA 4FP2A 3TAYA 1GZCA 4M01A 2Z42A 1Q8PA 2A7AA 3FUQA 2WJSA 5GALA 2PELA 1URXA 4AWDA 4JRAA 1ENSA 1HQWA 3FUOA 5IUQA 5DZEA 1PZ8A 1KDKA 2H0BA 1R1ZA 1C57A 1W0PA 4Y1ZA 1CJPA 1IKPA 1AX0A 1WLCA 2ZHKA 1IS5A 1V6JA 4AGVA 3RQ0A 3NWKA 3SLIA 1V6IA 3SISA 2ZHMA 5GLWA 1FV3A 3ZXEA 2XB6C 1V6NA 4TZDA 2C5DA 2E53A 2W52A 2JJ6A 4XMAA 3M2MA 3T1LA 4YGDA 2D6OX 1DZQA 3SH4A 3WDXA 2DVFA 4XIKA 2E6VA 2ARXA 4YW2A 3LCPA 3VKOA 3WDUA 3HMYA 3OJBA 2VXRA 1SLBA 3I4IA 1CESA 1LOBA 2OW4A 1ULFA 3OYWB 4GKYA 2NM1A 1V6OA 4WVVA 1F9KA 5T5LA 1SLLA 2EXHA 4YZ3A 2ZACA 2D3SA 2ZGNA 1C1FA 5T5OA 4RL7A 4AVVA 4XHXA 4FP3A 1WUVA 2AREA 2UWAA 1QNWA 3M3CA 4AVSA 1LHOA 4R9AA 5EXOA 2ZGOA 2ZGTA 2GMPA 1MZ6A 3B3QE 4ASMB 1APNA 1RITA 1WD4A 2D44A 2JD4A 4LBMA 2PHUA 2YV8A 1MR5A 4YGEA 5JOYA 5KXBA 5IT6A 2VUAA 5DZFA 3ZVXA 1JYCA 4Y20A 2DUQA 2DURA 4CTEA 2AH2A 2D3PA 3M3EA 1WW4A 4SLIA 3V0AB 1F31A 1LOEA 5CBLA 3SNMA 2DUOA 1QGLA 1S0FA 3ZSLA 2A70A 1GV9A 1ULDA 1YXWA 4DRRA 4LBJA 1ZA4A 4XJWA 3WG1A 2A6VA 3WDYA 4R9BA 3QLQA 3N3HA 4BOWA 5EYXA 1LOFC 3ATGA 2A3WA 3WOGA 1OQ1A 3VKLA 3T2TA 3AYCA 1JN2P 3IKWA 2G4IA 3OY8B 4TYSA 5GZCA 1B09A 1S0IA 4YM1A 1MACA 2ZGMA 1JXNA 4FPLA 1CN1A 4ITCA 5CB7A 3WDWA 1UKGA 2P3IA 3I8TA 4H55A 1G9CA 2VW0A 2YXSA 2ZA9A 1SACA 5H9PA 2D6NA 1Q8OA 1S0CA 1H30A 3B00A 4PF5A 1LHVA 3WNXA 1QF3A 2GMEA 2ZGQA 2VY0A 1UN1A 1G7YA 2EIGA 1HQLA 2PHXA 3OBTA 2A3XA 3SITA 1DYKA 2SBAA 2DVAA 4FQZA 2E51A 3N7KA 2ZHLA 1LECA 2P34A 1JOJA 4F83A 4FVVA 4YZ1A 1MVQA 3Q9OA 3JU9A 3LSDA 4BPZA 2VW2A 4FOYA 2KM2A 2W68A 1WCSA 4Y1YA 2A6YA 1XQNA 2WNEA 3NV3A 5H9QA 5H9RA 1N3OA 5GZEA 1G9DA 1LEMA 3PVNA 4K21A 2GNMA 1CQ9A 4XXAA 2ZZJA 2DVGA 2OUJA 2CWSA 1AVBA 4LBLA 2LTNA 4LBOA 5GLVA 1LENA 3ZXFA 1CONA 2AR6A 3FFZA 3AK0A 1LODA 5F9TA 1DQ6A 1MS3A 1UL9A 3AZWA 3INAA 3POYA 4XE9A 5JLVA 3POSA 1LU1A 1O4ZA 1WLWA 1V00A 2WT0A 1S0BA 5CNAA 1YRZA 2A6XA 2P3JA 2A75A 1MS0A 1QOTA 3GALA 1LOFA 4LBKA 4YG0A 5JDBA 2VH9A 1BKZA 4GKXA 2ZGLA 1SBDA 3ASIA 2GN3A 2PHFA 1YYNA 1DYPA 1ZM1A 4Q27A 4XILA 3MEPA 4C1WA 4YFZA 4RA0A 5T54A 1W6MA 5DG2A 1D0HA 2ZGKA 3D6EA 3O0XA 1S1AA 5DXDA 3BTAA 2YZ4A 1UMZA 1S0EA 3ILNA 1LHWA 3IM0A 2Q5TA 3POWA 5AVAA 5T52A 2D43A 1MZ5A 4P9YA 4AVTA 1UX6A 3ZXKA 3RMXA 3USUA 4CRQA 1GZWB 3BIWE 1AXKA 4FPCA 3ZSJA 2DVDA 3IPVA 1QMJA 4ZKTB 3WLUA 1W6OA 1VLNA 2ZABA 1W6NA 3VKNA 4XBLA 3KM5A 4ISQA 3QCWA 1VALA 2ENRA 3PJQA 3ZXJA 5EYYA 5DZGA 3B01A 2D3RA 1IS4A 1A3KA 2I2SA 1G9AA 3WDVA 3M3QA 1MS9A 3ZXLA 3GNEA 1QNYA 3R05A 2ZHNA 3AFKA 2E7TA 4R9DA 4Y24A 3WZ1A 2GNTA 3AZVA 1QOOA 1SBEA 2P3KA 4Y1VA 2NP0A 4M3CA 1YIFA 4Y22B 3O12A 1CPMA 1LOCA 3WV6A 1D2SA 2W39A 4Q26A 3HR9A 1WW5A 1FYUA 1HDKA 2UWBA 1AXYA 1SLIA 1N1YA 2V5YA 1DBNA 1MVEA 1Q56A 3SH5A 1MS4A 2NMOA 5KXDA 5HCAA 5IK8A 1WW7A 1AX2A 3D4KA 4FPGA 3UK9A 1ULCA 4CZSA 4LBQA 3V65A 3WG3A 1ONAA 5GLUA 5HCBA 5FREA 1VAMA 2NZ9A 4DQAA 4Z8BA 4FPYA 3T1MA 1FAYA 1SCSA 5IK5A 4BM8A 3IPVB 3WUCA 2PHWA 1HLCA 4UW5A 2D6LX 2GALA 1WLDA 5GJ6A 1AXZA 1LU2A 1OFSA 4GA9A 1TEIA 1QU0A 4AGRA 2DV9A 1J1TA 1LOGA 1UPSA 4GWMA 3AYAA 2FMDA 3A0NA 1JBCA 5BYNA 4XTMA 3B9CA 1C1LA 3RSJA 2LALA 1O4YA 5GZFA 2YY1A 1LGCA 3AP7A 2E7QA 1G9FA 1OKQA 1QOSA 2JE7A 2NMNA 1LESA 2ZGUA 4XJ9A 1EPWA 2WKKA 4AGGA 2ZMKA 4JCKA 3RS6A 4LBNA 4YW1A 1DIWA 5F5QA 4FOQA 2WT2A 4FPOB 3VKFC 5DUVA 4DS0A 3V0BA 3UJOA 1JUIA 3PMEA 2NYYA 4FOVA 4NO4A 4I30A 1NLSA 3RRDA 1DQ4A 1CVNA 4Y1XA 3IMNA 4XBNA 4PQ9A 1A78A 4YZ5A 2D7FA 3V64A 5IK4A 2ZKNA 3W59A 1W6QA 2EXKA 2ZBJA 5GLZA 5JMCA 5IK7A 1W0OA 4PBOA 4Y20B 1W6PA 2ZAAA 3H0OA 3W58A 1DQ0A 2ARBA 3WVJA 1GNHA 1DQ5A 4YM2A 5GLTA 1QDOA 1GANA 4XDQA 4PBPA 4WVWA 2A3YA 3LSEA 5DUWA 4XHBA 1Y7BA 1FNYA 5CAZA 1GZ9A 5GZGA 3HN1A 3AZYA 2DU1A 2ZMNA 3AP5A 5GZDA 4XBQA 3AZZA 4HL0A 3R4SA 5FRAA 2FHRA 1AJKA 3U4XA 2SLIA 4XTPA 1S0GA 1KDMA 2GDFA 1GBGA 5E89A 1N3QA 1LEDA 5T55A 5CA6A 4BQ1A 1N1TA 1FNZA 1CR7A 1Z0HA 2EALA 1UZYA 2YMZA 2DWRA 4OZXA 1SBFA 4YG6A 2WSVA 4YGBA 2R1BA 2DTYA 3WG4A 1PZ9A 2ERFA 1F5FA 3AYDA 1JW6A 3BODA 3VV1A 1ENRA 4M00A 1DQ2A 2GMMA 3ZYPA 4YW5A 3MW3A 2JE9A 1AX1A 2PHTA 4M3CE 3OYWA 4PCRA 4Y26A 1G8WA 1V6KA 3WCSA 2OUHA 3O0WA 4YZ4A 3N7JA 3UJQA 1AZDA 4FPHA 4P9XA 1GYKA 4U2AA 4M3CF 1X50A 4ATEA 4XZPA 1S0DA 3RG0A 4BLJA 2D6KA 1BJQA 1MS5A 3ILRA 2P2KA 1SLTA 4U36A 4WZFA 3WHTA 3DUIA 1SLCA 1ENQA 4XIOA 4HANA 4FOWA 1LHUA 2R49A 3AYEA 3IN9A 3M1HA 1QKQA 3OGGA 4BMBA 2CYFA 3MW4A 1AJOA 4XOGA 3FLRA 1N1SA 1MS8A 1PZ7A 2DYCA 3PVOA 4YW3A 5LK5A 3ZSMA 2TEPA 1GLHA 1LOAA 1G9BA 2R0FA 1C4RA 2CTVA 1KQRA 2C9AA 3FBYA 2ZMLA 3JUUA 1DQ1A 3V0AA 4JC1A 1FV2A 1QDCA 4P14A 4DRVA 1DHKB 1DLLA 2JECA 4UW4A 2EXJA 3N7MA 2UWCA 1LGNA 4D69A 4NOTA 1FX5A 1LJ7A 1KJRA 1W6MB 3BOPA 4XJAA 4AYUA 1JYIA 3D5OA 2VU9A 2WSUA 1CPNA
chains in the Genus database with same CATH superfamily
1WMXA 4YGCA 4QDQA 1TZOA 3A0KA 4AQTA 2R6QA 1Z78A 2DUPA 4YW4A 4IE4A 3POJA 1RC6A 3DKWA 3BKZA 2BQPA 5FYVA 2CAUA 1Z7S3 1AR71 3ZFFA 3N9MA 1DGWA 2W3JA 5FZAA 2B9VA 2PHRA 2X5IB 4DY5A 3NJVA 5FZ9A 3Q8CA 1Q8QA 3AP4A 3B69A 3C7EA 3MICA 1TME3 1OOPB 1UZZA 2RR11 3ILFA 4H7LA 1XXNA 4QQLA 2HWC1 5DUXA 3C7HA 4OMDA 4CDQC 4EZ4A 3RMYA 4PI0A 3A4UA 1Y9MA 3FL7A 4C0HA 1MZEA 1UX7A 1PVC1 2EF6A 1VPHA 3VBRC 2I07B 3ZYFA 1G86A 2W08A 2R041 3SEPA 1H2KA 4ZXKA 4IEOA 4UYBA 1WBLA 1SG3A 1N3PA 1RMU2 1V9U3 2IZWA 2W87A 3RWNA 4BE3A 1JZ2A 1UYXA 1SPPA 3C2UA 5IAVA 4GJZA 1IHMA 1QH7A 2GNBA 2UURA 4JZRA 2XUEA 3WNMA 3GGLA 4DUVA 2ZGRA 4QQ2A 3GCWA 4UW3A 4NVPA 5CFCB 2K0GA 1ZZ9A 3APBA 3U37A 2C0ZA 2BJSA 4LORA 1RIRA 3MIDA 3ETQA 1H9WA 3M7AA 4KL1A 1W9TA 3AXEA 2YROA 1DGRA 4KBBA 3NNLA 2XHNA 4ATFA 5JOZA 2EXIA 4DIQA 1LTEA 1V6LA 2CU5A 2Q8CA 1JYXA 2FCUA 4R52A 1QJX3 2VNRA 1HRV2 2W1UA 5H9SA 1VBC2 2XWBB 2AENA 4RR3B 3MGUA 3ZR5A 5T5PA 4GALA 3ZFGA 4BA6A 1DYOA 1AF9A 2VMIA 3HD8B 1CZSA 1HXS2 4P00B 1CAVA 2E32A 3VBUA 1N1VA 5C9AA 5L7OC 2RVAA 5JI7A 1OF3A 3UV9A 4XFHA 2QQJA 2AYHA 3ETPA 3NV4A 1RVF1 3BOWA 4GXLA 4FAHA 3EO6A 3DECA 1VBD2 3MIBA 4AFBA 3QOPA 2RHPA 3T2OA 1GICA 2DTWA 4HG6B 3MUZ1 1PNGA 1IS3A 1W8NA 3KMHA 1PK6B 3FJSA 3LDBA 4S2GA 3WNKA 2FDJA 3WG2A 2Y6JA 1GOFA 1WMDA 2VTFA 4GMP3 4EWEA 4K9SA 1RUD3 5FP3A 1IS6A 3AP9A 3OBZA 5CADA 3UKNA 1WGPA 3SCGA 5A3NA 3V0BB 3CKHA 2R1DA 4C1XA 1H9PA 4OFGA 3MF9A 4FPJA 1UMHA 2OVUA 1KJLA 1JH5A 4JDMA 4YVWC 4XJ8A 2HWD3 3ZMNA 4E4DX 5LY1A 2N7GA 4YG3A 2A5ZA 5AFBA 4BJ0A 4N8MA 5D8AC 4CDXA 4YLZA 3FX3A 5DG1A 2JXAA 1GKBA 1YUDA 1GZCA 4CUCA 1OPMA 4C90A 4QX0A 1RUH1 2G9ZA 4I0BA 5LATA 3LOBA 2OIIA 1Y3TA 2ZCWA 4LO8A 4BIFA 1HQWA 5HV4A 2B45X 1QY4A 3U75A 4FFIA 3CQOA 5FZ6A 1C57A 1JZ4A 4Y1ZA 4DOUA 1AX0A 2ZHKA 1XYOA 2C9KA 2DFCA 4GAZA 5I8YA 1KGYA 1QXJA 3K51A 4GB33 4AEDA 2GAUA 4EN6B 4HFSA 2LROA 2VTXJ 2W52A 2ORZA 2W1SA 5FZHA 1BVP1 4XFGA 1JOPA 5HI0A 3M2MA 3OBAA 4Z07A 3DYPA 4CSWA 3K3NA 2WO7A 4YGDA 3SXWA 3G6JB 3TEXA 5A3TA 1C8M3 2ARXA 2E6VA 2QDNA 3GDBA 3WDUA 5FDBA 5HV0A 1UU6A 2VOXA 4M0NA 1BVVA 1BK1A 1SLBA 1LOBA 4G9SB 2OQ6A 3C7GA 5C3OA 4QXHA 3KHCA 2NM1A 1V6OA 3WF1A 4WVVA 4MV2A 5F6KA 1DDLA 4QU1A 2EXHA 2ZGNA 1C1FA 4RD7A 4XFBA 2XXZA 5T5OA 4RL7A 5FWJA 4IL7A 3LGRA 5CISA 1QNWA 2WYSA 4AVSA 1WA4A 1LHOA 1MEC2 1L7QA 1RGSA 3A23A 4A6OA 2GMPA 3B3QE 1APNA 2D44A 4XPVA 5D2AA 2QQKA 3PDQA 4LBMA 3EBRA 2YV8A 4KG8A 3KB5A 1HRI2 4UOJA 4N43A 2XOMA 4AI2A 3LFIA 1CIYA 2WZR3 1UY2A 5I0SA 2DFBA 4K3UA 3ZDVA 3ZVXA 1KD7A 4KU7A 2G9FA 4OHXA 4CTEA 2QJVA 3RZMA 2YFUA 3I2IA 2ZS6B 5KHKA 2VCMA 4QWNA 3T4VA 5CBLA 1VAKA 3JD71 5JSOA 3LIHA 4X6QB 3WY6A 2IUWA 4FI9A 1RMU3 1OA2A 3VDDA 1YXWA 1ZA4A 4CU6A 2XJTA 1AR81 2A6VA 4R9BA 3QLQA 3ZN5A 2OS2A 3N3HA 1QHDA 2F17A 2R071 4YWAA 3I54A 1JYVA 2PQSA 1OQ1A 4QU2A 5FZOA 1UIKA 3T2TA 2W0XA 3AMQA 5LRRA 5AC93 2MPFA 1R081 1B09A 1MACA 4ITCA 4FPLA 2G1MA 3CBNA 1UIJA 2P3IA 3VBHC 1G9CA 3I59A 3IDBB 5FLIA 1U5YA 3VZKA 3I2JA 1PVXA 3BIEA 5J96B 5I0UA 5H9PA 4DB5A 4N9HA 1H30A 5F3EA 1PGW2 1KFUL 5EZWA 2Q8EA 5FPVA 2WO3A 3VZOA 4E2SA 2ZGQA 2VY0A 4Z2AA 3POIA 1W8WA 2EIGA 4JAAA 3OBTA 4V1PA 3H8XA 2A3XA 1POV1 5I0DA 2SBAA 4JGZB 2DVAA 4A4AA 1JZ7A 1J3RA 3N7KA 4XZUG 3VD5A 4FVVA 4YZ1A 1MQTC 1HV1A 2BWCA 4BPZA 2OPKA 5FY7A 1FPN2 1QJZA 2E33A 4OHWA 5CKMA 1RUE1 2VUCA 2A6YA 1VBD3 1XQNA 3GZEA 1N3OA 1YIPA 1G9DA 3HT2A 1QJFA 2ZZJA 4Y5Z0 2UYAA 2ZPXA 4UF0B 1AVBA 4KGQA 1RUJ3 2HWE2 1GOGA 1UCXA 1CONA 2AR6A 3K2OA 5F9TA 4WVZA 4CDWC 4RS5B 1VBA2 1H6XA 1V00A 3E97A 2Q4SA 3ZYJB 3I2OA 3I3EA 2P3JA 2RS13 4LBKA 4X6RB 3CJXA 3LKJA 4GKXA 4NAMA 1NY72 3WNOA 4DNYA 2ADEA 2PHFA 1PO22 4P9IA 3VDBA 2VNGA 1W3VA 4PJYA 1FOD2 2RJKA 4LHKA 4AEJA 3S7EA 1ZBA1 1AYN1 2EIBA 4C1WA 5K0UC 4AR2A 5DG2A 3VD9A 4LT5A 1NCQA 3AFGA 2RS53 2IFRA 4Q4Y1 3K4ZA 3BTAA 1S0EA 4AAPA 1LHWA 5T52A 2Q5TA 3FBMA 4AVTA 3VDCA 1SQ4A 1PO13 4CRQA 3L2HA 3SHRA 3W20A 1J83A 1ZRDA 4NIDA 2DVDA 4ZKTB 4CDQB 2FDKA 1W04A 4URTA 2X5IA 4QB1A 2RS33 3D0SA 1VALA 1OOPA 2W1QA 5FXXA 3VBRB 5FYYA 5DZGA 3OGRA 4FFGA 4K6BA 5FZ7A 4YRDA 1A3KA 5F3GA 2Q0AA 4A7KA 5LW9A 1H1IA 2OZ6A 1EYBA 3JZVA 4HETA 4OQ9A 3KV6A 2IVIB 1OVPA 4Y24A 4AEMA 2PAKA 2QQOA 4CCCA 2P3KA 3EXUA 2LW8A 4PLMA 2ZXQA 1O4TA 2DF7A 3WV6A 4CCEA 2MNGA 1D2SA 1RUF1 2W47A 3SMHA 4F7ZA 1XNAA 5DDJ2 3A7QA 3SCFA 1ACCA 1U5IA 4A44A 1IZ3A 4QT6A 1Q56A 5CFCA 1MS4A 1JI6A 5KXDA 4XW3A 3F95A 3AL5A 1AX2A 4FPGA 4CZSA 1MEC3 4NHKA 3WG3A 1YCIA 5EP9A 1CAUB 4NUBA 4J6GA 5GLUA 2VG9A 2WFF2 3PU8A 1UY3A 2PXJA 2NZ9A 4DQAA 4Z8BA 1HRI3 3HQUA 4ES9A 5L7OB 1RXGA 4AEKA 3ACFA 4RR3A 1VBB2 4BB3A 2J7MA 3LQCA 4BQ3A 4EROA 5KHGA 2TUNA 1S2BA 1RHI3 1F35A 3WUCA 2ZTNA 1HLCA 5IFPA 2D6LX 3NO8A 1WLDA 3LWCA 4IEUA 3OGVA 2HWF2 3IDEA 1AL22 2D40A 1LOGA 1UPSA 2QZ3A 4I3PA 3B9CA 3LF7A 2QQPA 1C1LA 4E4SA 5DAPA 2LALA 2Y8KA 3CZJA 1OKQA 1WCDJ 4A42A 4UT5A 1AR91 5L36A 1GUIA 4E4HA 2ZMKA 5FYHA 1UY0A 1BK0A 3KGZA 5F5QA 2VQ0A 3IAQA 5ANQA 3V0BA 4A7ZA 4QXCA 3UGFA 4JGYC 5D8AB 4DUXA 1DU3D 2NYYA 4I30A 1NE6A 3U10A 1ND2C 2W91A 4FBFA 1P8JA 2FZ1A 5FZ3A 1WCQA 4YNIA 2B4KA 2LUWA 4AZZA 2OZJA 2ZKLA 3GZTB 4LTAA 5GLZA 4YZ5A 1OOPC 2JE8A 5F5AA 4KU8A 3MV01 2ZAAA 1GWLA 2VMHA 2VZTA 4PT6A 4Y20B 5EQUA 4V2WA 1DQ5A 4PF1A 1FPN3 1QDOA 4XDQA 5JI9A 3KT1A 1JYNA 5DMYA 5FP9A 1RUI2 3EMRA 5CU1A 2V09A 4MG2A 4ZU5A 1H8VA 3LDKA 4UBGA 5ACA2 1RUC1 2DU1A 3SKJE 1ZBE2 5A7SA 3KSCA 2JWPA 4MLOA 3CMGA 3R4SA 4JV4A 4PDWC 5FRAA 4A2UA 3WNNA 4LOTA 1E5IA 4KWLA 4HKOA 5FZFA 1K5MC 2QNKA 2XBO1 4EV0A 1VB4A 4Q4V2 1H2MA 2HYXA 2WNUC 2X09A 1N1TA 3D82A 1Z0HA 4N53B 1W8FA 4V2VA 4BQ1A 1BMV2 4AQ6A 4HVQA 4A45A 1SBFA 3WQ7A 4I0AA 3I3QA 1NUKA 2WSVA 4YGBA 2WS92 3HNMA 3OCPA 2RM22 1PO23 1FT9A 3I3DA 4AFMA 1JW6A 4AHZA 3LD8A 5A7WB 3J7LA 2OXBA 1SFPA 5J98B 2PHTA 4D8MA 1WLTA 4DXTA 2Q1FA 3R0RA 1V6KA 2WQ8A 2YHJA 4QX7A 4YZ4A 3WQ0A 1PIV2 4FPHA 1GYKA 2BGCA 1NOVA 4U2AA 3ZIXA 4AQ2A 4S2HA 4C0BA 1R092 2D6KA 4U36A 3WHTA 1EY2A 2ZEWA 3AM2A 4MGZE 1W28A 3O1RA 1VRH2 2WDBA 4HPKA 2EVXA 1SLCA 4ZZ5A 4XIOA 2XVLA 4FOWA 1ZZ7A 3M1HA 2Z5WA 3OGGA 5FPBA 2ARAA 3OF1A 3ZFEC 2VOVA 3MW4A 4FXKB 2DCKA 2H6BA 1PK6C 5EJ3A 2CSGA 4R4XA 2DCYA 5FP4A 1AYM1 2AC1A 2JG8C 2TEPA 1GLHA 4P9LA 4NIAA 1LOAA 4RHV2 2CTVA 1WMEA 2JDKA 2RMU2 4P5YA 3IDCB 2ZMLA 4JC1A 3R6SA 3TN91 3HOBA 4XUQA 2B9UA 4DRVA 3NNJA 4BISA 3BTZA 5IVJA 5FY1A 1H6YA 3TOJA 1OURA 3UT0A 5IW0A 1H1AA 1KJRA 3BOPA 1JYIA 3VBHB 5JOXA 2VU9A 2WSUA 4RQPC 3POYA 4Y26A 4YW1A 5FUPA 3ZPYA 5A70A 4GWNA 1SHWB 4PQQA 1DZRA 2EA7A 2VW1A 3B94A 2XLGA 3AJZA 2WN2A 3RFRA 2WFF3 2WT1A 4RSUA 3WW1A 3WF2A 3ZOIA 2BYVE 5C33A 3O5SA 1NZCA 3L2YA 4HSLA 1TME2 4MGKE 3UL2A 3KV5A 2VCCA 2X29A 1VBB3 1QJU1 5LRSA 1MQTB 1HQNA 4NAOA 5E8AA 3SC7X 5FLHA 3B93A 1JZ8A 4Y1UA 1QQP3 1VJ2A 1D0GA 1AL0G 1AL23 2YG0A 1XE8A 4K8RB 2JDNA 3KF5A 4FFHA 1V9U2 1W2UA 2AGSA 4Q4W2 1UOBA 3DF0A 2QQUA 1ULGA 2A71A 3PJYA 5KHIA 1YI9A 2GH2A 2VMEA 3O1PA 5FK8A 4CDWB 3AVRA 3OBRA 2OX0A 3P3PA 1VAVA 1BZWA 1UU4A 3H8OA 3IT8A 1SLAA 3MIHA 3NV2A 3OPZA 4UF0A 3VN4A 4BWOA 4D7TA 4DEQA 5C8CB 3CIHA 1NQDA 4FQ4A 2PN5A 3BTXA 2B8MA 2BDRA 5LB6A 4GWIA 1SDDB 3T3YA 1PX3A 4I02A 4RS5A 3FHAA 2CWMA 4KBZA 4W6WA 2D6MA 4D7SA 3HBKA 3L9JT 1DGLA 3ZYHA 1PGL1 1AR73 4XACA 5K0UB 1D2QA 4N9IA 3Q8FA 1QJX2 4LIUA 3ZM8A 2MEV2 2IFWA 3EQEA 3FLTA 4IEQA 4IE0A 3KCXA 1D4M2 3O0VA 5FMOL 1XE0A 1UNBA 1A6CA 2RR13 2Y60A 3EYPA 2CNAA 3HEIA 5FYCA 1GSLA 4TLFA 2GU9A 1RINA 1WBFA 1ULEA 2P5BA 1RJ7A 4IE6A 4WVMB 1IOAA 5D21A 2YC0A 4DPNA 1XC6A 1RUI3 5GM0A 1ZRFA 5JZGC 5A6ZA 1YO8A 2NN8A 1PMJX 2R043 3AKRA 3FN9A 3R4UA 3H3ZA 1SFYA 1BYHA 3KQRA 4RGKA 5FZMA 5JVVA 5ACA3 1ZBE3 2HYKA 5IHRA 2V72A 2ZGSA 3PUAA 4OUEA 5LEJA 2K9ZA 1COV1 2AACA 2Y26A 3H9AA 3MW2A 4QGLA 2DBNA 4QHBA 4CDQA 1UQXA 4QHOA 2FQPA 1Q8VA 2XQRA 5KXCA 3U0ZA 1RUD2 3CLPA 5FMDA 2BVVA 3VBRA 4XJUA 3OEBA 5ANNA 3MFCA 2FDFA 4MYEA 3K46A 2ZGPA 2JDZA 4IGPA 4O65A 4I0WB 1J58A 2DVBA 3WP6A 5A3UA 3VZMA 2XL9A 2W2IA 4CP1A 4D6RA 1BXHA 2UU8A 4ISRA 5HXMA 2GNDA 2Q8DA 2FD8A 4W4ZA 5SV8A 5HCFA 3S57A 1FI2A 5FY8A 3DYMA 4Q8LA 4W65A 1KRIA 2DBIA 4I01A 4JGZC 3GZAA 4FP2A 1AUYA 3OUJA 4NIIA 2Z42A 5A7OA 4ZZ8A 2A7AA 1GR3A 1POQA 1R093 1RVF3 1FXZA 2PELA 2WJSA 1VR3A 3DXUA 3IWZA 3OD0A 4JRAA 4KGGA 3ZR6A 1ENSA 5JIAA 1ZRIA 1CAUA 1W8HA 1PZ8A 1R1ZA 1SFNA 1IG0A 4YYOA 1WLCA 1IS5A 1NQJA 1V6JA 3KV4A 4MADA 5L7OA 4DEVA 1H4GA 4OLLA 4YVSC 1OF4A 5GLWA 1FV3A 3I3BA 4RHV3 2XB6C 2R062 1V6NA 1RL3A 2C5DA 1EAH2 4RYDA 5FZKA 2O8QA 1C8M2 2EIDA 3DPRC 2XJRA 2D6OX 4QM8A 4CEWC 4MGTA 4OYUA 4XIKA 4Z2WA 1CZVA 2VL4A 5CG9A 3CU7A 5C6CA 3H42B 3QH6A 4TSVA 3GJBA 4AFAA 3I4IA 4HLTA 1CESA 4BQ5A 1ZBA2 5K8SA 3JB8A 3OYWB 1F2NA 4GKYA 3RWKX 1JZ3A 2FBEA 1JODA 1PHMA 1SLLA 2O1QA 3H8UA 4JQRA 4YZ3A 2VOKA 2IXHA 3BVCA 4IE7A 4JGYB 1W8TA 4MUVA 2PYTA 4AVVA 1FMD1 3J8F1 4OZOA 3N4MA 1WUVA 1ND2B 2UWAA 2WNVC 5M0TA 4YVWA 1BHGA 1QJY1 3M3CA 4NRMA 4QX1A 3D3AA 1ALYA 4PIYA 5D8AA 5FJKA 4GIQA 1BLZA 1OA4A 2QQMA 1RITA 3RI9A 2WZR2 2JD4A 5JOYA 2VM9A 5JXJA 2H0VA 5DAVA 4B1LA 4YW6A 1YNAA 4Y20A 2AH2A 2VQTA 1WW4A 3RGBA 1Q3EA 4H3WA 4PDWB 4Q4W3 3V0AB 2RDSA 2IC1A 1C8NA 2RDNA 4FFFA 1S0FA 3ZSLA 1K5MB 3K4AA 4LO5B 2WNUB 2C26A 4IV1C 1JHJA 5J1XA 2RG4A 5AC92 2OPWA 1LOFC 1VBE1 1Q43A 3NL1A 4XF3A 3SH3A 2JDYA 3Q8EA 5KHJA 5FK7A 1YQ5A 3I49A 4XQDA 5HXVA 1WA6X 4AWDA 5GZCA 2QQIA 1TMF1 3HWJA 4IDZA 1F4HA 1OD3A 1JXNA 2ZOEB 1CN1A 4N53A 5I0TA 3HIFA 1UKGA 4Q4X1 4RN5A 3TRSB 3ZYIB 1WZXA 2MEV3 2VW0A 2YXSA 2D6NA 1D4M3 4ES8A 1HJGA 4PF5A 1QF3A 5A7WA 2WUHA 5K7PA 1B35C 1S55A 2LRPA 2PHXA 3BU7A 4LO7A 1PM4A 3H1MA 1DYKA 5EFUA 4YSFA 4KMQA 1JU4A 5FZ8A 4UWDA 3ALQA 4IUGA 4QX3A 3Q9OA 2HEWF 2Z2SB 3JU9A 3LSDA 4GD4A 4QM9A 5FWEA 3ZFEB 1YEWA 2VW2A 3HAGA 4H7MA 5KC5A 4XQWA 2WNEA 5H9QA 3NV3A 2HBUA 4IE5A 5H9RA 4FAGA 1UXZA 1AR83 1RUJ2 1LEMA 2JG8B 2R073 2V4VA 3PVNA 5C7GA 4FT8A 2YPDA 2LTNA 5GLVA 1R083 3ZXFA 2XKPA 4D7YA 4META 1LODA 1X36A 2PLV1 5FYBA 1IQDC 1UL9A 2BBAA 5ERLA 1NKGA 2RS12 2Y6HA 2VZVA 3POSA 4LA3A 1O4ZA 4DO0A 4NIHA 3UNPA 5CNAA 1X9PA 1YRZA 2VULA 3V56A 1IQAA 1ZVFA 2Y0OA 5JDBA 3PVBB 4QPGC 2XQXA 1BKZA 2P6CA 1E57A 2BOJA 3AL6A 4QXBA 4RQPB 4FCAA 1C5HA 1W2NA 1YYNA 2XPJA 1DGWX 4Q27A 4XILA 1POV3 2ZAHA 5A7QA 4N7IA 5T54A 4F3JA 2RS52 3VBHA 2ZGKA 4HN1A 3D6EA 3O0XA 1BBT1 1OLMA 3JBG2 4CVUA 4COWA 3A22A 5JSRA 2YZ4A 1PO12 3AB0A 3ILNA 3IM0A 5AVAA 3POWA 5IYYA 4L9BA 1UX6A 4MZUA 4OI2A 5LEKA 1GZWB 2RS32 4L92A 5B2GB 5C3SA 4FPCA 5BNOB 3IPVA 1VLNA 3KT7A 3VB9A 3NJZA 1F8VA 3KM5A 1MQTA 4LE4A 5FYTA 2R063 5CKQA 2ENRA 3PJQA 3AVSA 1LKNA 2VMFA 3ZXJA 4Z92B 4IV3C 1EAH3 3WW4A 3B01A 3WW3A 2BUKA 1IS4A 1OH4A 1Z7S1 3UYJA 1TE1B 4OVEA 1Q5OA 2ZEZA 4N53C 3ZXLA 5BNPC 3GNEA 1QNYA 4E2GA 3R05A 2ZHNA 4NWWA 3AFKA 4YW7A 3U1XA 3WXPA 3ZLIA 5L9RA 1H2LA 3H3LA 1EP0A 1H8TC 5FYIA 5FXWA 1QOOA 2VECA 2CGPA 4Y1VA 4EQVA 1YIFA 1AYN3 1ZBA3 4Y22B 3NW4A 1CPMA 2KXLA 5FMCA 2XH6A 3BPSA 4CDWA 5F5IA 1OKOA 4QD2A 5BNNC 1YFWA 4QXKA 5C8CA 3HR9A 1U5ZA 2ZX0A 3PNAA 1HDKA 2UWBA 5FKBA 1SLIA 1PGSA 3GYDA 3THPA 3SH5A 4COZA 2NMOA 1W8UA 5TSWA 5L9VA 1WW7A 3UK9A 5C5UA 2Q8OA 3V65A 2P4EA 5FZ1A 5K0UA 3IAPA 2VPVA 1OT5A 4PI2A 3NNFA 3RZGA 3KCCA 3DN7A 3POFA 4HN0A 3KHBA 1HN0A 2ZX1A 1O5LA 1RHI2 2Q1MA 4TWTA 5JIUA 5K9YA 5JZGB 2WWUA 1US3A 1FAYA 1SCSA 2D98A 3AMHA 1R1A1 4WVMA 3WNPA 5LZ6A 5GJ6A 1H4HA 4AI9A 1TEIA 4K7JA 1QU0A 1XSRA 2DV9A 2D5HA 4GWMA 4CCKA 4CCOA 5JAXA 2FMDA 1JBCA 3E6BA 1HB3A 2X8KA 4OHYA 2JDUA 2GH8A 3RSJA 4NPLA 5GZFA 1AR61 2JE7A 1LESA 3LA3A 4AGGA 1UY4A 1WMFA 2XVGA 1Y9GA 4JCKA 3RS6A 3G7DA 4LBNA 4NPRA 1O3SA 3NJYA 2YUEA 4FOQA 3D0JA 4GMP0 5FY4A 3VKFC 4DS0A 3UJOA 3P6BA 4LHNA 5FLJA 4ZU7A 4BXSV 2HBTA 3CO2A 1GFF2 1QXPA 1UD1A 3OPWA 4FOVA 1T2XA 5D1IA 3J9SA 1DQ4A 2BERA 2C24A 2CDPA 3ON7A 1F4AA 4PQ9A 5BY5A 3RZJA 2JB4A 3V64A 5IK4A 2ZKNA 3W59A 3BTYA 3LEKA 4INDA 2P6HA 2VOWA 2WIIB 4HOOA 4KWUA 2ARBA 5J3UA 3WF0A 5F3CA 3GHMA 5JMOA 2OT7A 5G05L 3RI8A 4A3XA 2HWD1 2PHDA 4BK4A 3H8RA 2YDEA 4Y4YA 4YVSB 2BFUS 1NYWA 1YJKA 5GZGA 3BB6A 3AZYA 2ZMNA 3NQHA 5GZDA 5FOBB 3AZZA 4PIXA 5F7UA 2HWB1 3POEA 5AFEA 4XTPA 1VMHA 5KC6A 3VZNA 1S0GA 5C8CC 1KDMA 3DPRB 4CEWB 1NCRC 1N3QA 1PMIA 2IXLA 2CGNA 3PUIA 1GQPA 2EALA 2YMZA 4FTBA 4I09A 3MZHA 4MO3M 1IGOA 1REEA 3MLLA 4PLOA 3WG4A 1NG0A 2QVSB 1PZ9A 2ERFA 2WAOA 4GB31 1SDWA 3AYDA 3GHNA 1ENRA 4WM7C 4M00A 1DQ2A 3WD5A 3RZLA 1ZRCA 2YC4A 3PTRB 3OYWA 2JDHA 2WNVB 1W2AX 1RUOA 4K8FA 1IPJA 1G8WA 2BP6A 4CU7A 2XJPA 2EAAA 2VCBA 3JBG3 5F32A 3WCSA 2OUHA 1O7FA 3O0WA 4M0HA 5FIXA 1RJ8A 3N7JA 4JGYA 3UJQA 5A7PA 3TNQA 4AOCA 5FPXA 2RV9A 5LA2A 3VZJA 1X50A 1ND2A 3KLSA 2Q1ZB 1ZYBA 1OMIA 3ILRA 4WZFA 1GNYA 2VZRA 2BFUL 2YPJA 3DEMA 3OPTA 4IXLA 5FY5A 3POBA 1LHUA 2R49A 3AYEA 1US2A 2MHFA 1QKQA 3BUCA 4QX8A 5IFTA 1UYYA 1VB2A 5JPNB 1X8EA 3UKTA 4DINB 3FLRA 1N1SA 1MS8A 2DYCA 3I7DA 3PVOA 1OXCA 5LK5A 3ZSMA 1O6UA 1QH6A 3NAPB 4MXWB 2QQVA 2R0FA 3CDZB 5FZLA 1OHFA 3ELNA 1C4RA 2I74A 1G9BA 1KQRA 4IV1B 2JENA 1XU1A 4PDWA 3UESA 1DQ1A 1MPXA 4LEJA 3V0AA 4EN7B 5EPAA 5FZEA 1K5MA 1DHKB 1GQHA 3POGA 2WNUA 1GOHA 4UW4A 2EXJA 2UWCA 4BQXA 1W6MB 4XJAA 3NKGA 1ASJ2 3AKQA 2UY8A 4XETA 3ASIA 4E8CA 1CPNA 2QKDA 2EAKA 2WLQA 2ZX2A 1RMU1 3HQXA 4XMIA 2VUJA 2YC2A 2VBBA 3AXDA 4OHZA 4L8QA 4YFWA 4CDUC 2FDIA 1B35B 5C9AB 5KR7A 5IVVA 2WZEA 3WUDA 2FCVA 1REDA 2V73A 4G3YC 4CUBA 1TG7A 5DAXA 2Y6LA 3S5AA 4K20A 1W6OB 4HKLA 4MXVA 1YC61 2Y6GA 1AYM3 1QQP2 3RDIA 1HIXA 3WX5A 4JTNA 1O3QA 4R9CA 3W9AA 3PURA 2X05A 4Q5OA 2IXIA 1HRV1 3QBQA 4AL9A 1VBC1 4ET7A 2YYOA 1A8DA 1S0JA 1FATA 3AZXA 1CIWA 1DP0A 3MPPG 3ZFEA 4CUGA 3LA7A 4LQRA 1SCRA 1PK6A 4M3CB 1HXS1 4CP0A 3ZYBA 2WABA 3E1F1 2JG8A 1AHSA 2RJ2A 3AJYA 3AP6A 3JXSA 1LB2A 1VIWB 4O9EA 3P1IA 2WINB 1HJFA 3LFMA 3QD6A 3HPNA 1RTVA 1CAWB 4QPGB 4CYDA 3WDTA 4NPMA 1AR72 2P1BA 5FBJA 3THCA 4BH9A 1YFUA 2EICA 1W8OA 2RE9A 4IQPA 4CEYC 4EZHA 4LBQB 1UXXX 1XNDA 3KS7A 3ME2A 3FLPA 2RR12 2BRTA 3JCIA 4RQPA 4W6YA 3ZN6B 4CP2A 1QJU3 3CJIC 3S30A 2HWC2 4AVAA 3VUOA 4MH0E 2WWSA 1GNZA 2CL2A 2DU0A 5LY2A 4YZ2A 4FPKA 1UOJA 3I2DA 2WWJA 1PVC2 2ES3A 2VVDA 3GM8A 3ZKUA 4DMIA 2AUYA 4NHXA 3O1MA 1I1EA 4R8HA 2PAEA 3TNPB 4Q0UA 3WINE 2R042 3IZOA 1UAIA 1HW5A 3AMPA 1UZ0A 1YLLA 3S7IA 2BU9A 4MX3A 2O14A 2R0HA 2W95A 1I3HA 5DUUA 2GZWA 5A33B 1O59A 1Q8SA 2QBXA 1GZWA 4IV3B 3S5QA 3ZSKA 4KQ7A 5T5JA 5BNOA 5BNPB 2VE1A 2XGXA 4QX2A 3CNAA 2D97A 1CWPA 4AHXA 3SKVA 3TEYA 4KG0A 1H8TB 4C8DA 1LGBA 2BNMA 4B7EA 3T09A 3NV1A 2RDQA 4CCJA 2DCJA 3OTFA 4O61A 5FUNA 5F39A 4CPBA 2BW8A 5BNNB 3PVEA 2HJIA 4EWAA 3O1OA 1XE7A 3N9NA 2BWAA 2GP5A 4XYXA 1WD3A 2WAAA 4Y22A 1J84A 3LPGA 4OCTA 3O1TA 2GC3A 1UW8A 4H14A 4L97A 1N47A 5A32A 3NKTA 5IVYA 4BMEA 4Q1RA 4Q1PA 4Q8KA 1RVF2 2BNOA 2JKBA 1V6MA 2D6PA 3HJRA 3IDAA 3TAYA 4M01A 1TQ5A 3LA2A 4I3GA 3WT3A 1J1LA 1W99A 1STMA 1URXA 5FUIA 4DZGA 4MGIE 5IUQA 3S6PA 4UFJA 3SQOA 3VBOC 1COV3 4EN8B 1CX1A 1CJPA 1IKPA 1K5JA 4D94A 3W21A 5C5TA 4MGYE 2OYZA 1EV11 3RQ0A 3NWKA 3SLIA 5JZGA 3SISA 2ZHMA 4LJHA 1ND3C 2WRAA 3FC0A 1ZNPA 5F37A 4UFIA 4TZDA 1T6BX 3C3VA 2E53A 2E26A 1M4WA 3T2QA 2JJ6A 1JYTA 2YU2A 1CZTA 1HRI1 3O7OA 3WP5A 3TBDA 3T1LA 1DZQA 3C7OA 4L0PA 5J7MA 3WDXA 3VL8A 5JXHA 1W0NA 5I93A 3VKOA 3HMYA 4IW3A 3OJBA 2VXRA 1RXFA 1ASJ3 2BGOA 2OW4A 2VQUA 1ULFA 1YQCA 1RUH2 5C3QA 2ZEXA 1F9KA 4MHRA 5C4WC 3PHMA 4NN0A 4XAEA 2PQQA 1E5SA 2BPA2 1UZWA 3FWEA 4FP3A 3MBWA 5FMOS 1S2KA 2AREA 4G4FA 5FZ4A 5IVCA 2F6BA 4UFKA 4N90A 4R9AA 3IIIA 2ZGOA 2VZ1A 5IWFA 3OUIA 1YFXA 4ASMB 4JGZA 1WD4A 5BNOC 2JG9C 4QB6A 3O1VA 1ULPA 1IG3A 5C3PA 1DGRN 1D4VB 1I5ZA 2J1VA 2Y6KA 5IT6A 2O8OA 4UFHA 4AF9A 5DZFA 3I2HA 1PGW1 2PAMA 2DUQA 2ZEYA 2JIGA 2DURA 2WBKA 2D3PA 2YBPA 4ZHNA 5BNQA 4ZXEA 1XU2A 4CXXA 4Z1VA 5I0RA 3LAGA 1LOEA 5LCWL 4XAAA 1W3XA 4A41A 2DUOA 3T2PA 1QGLA 4YVSA 1NCRB 3T08A 1ULDA 4CU9A 3FHIB 3FZ3A 1H2NA 4DRRA 5JXGA 4LBJA 4XF4A 2IXCA 4K40A 2WZPP 5FOJB 3FFQA 2B39A 2VMGA 1FPN1 4BOWA 2VZOA 2A3WA 3WOGA 1ULOA 3VKLA 5FKCA 5I8TA 3DPRA 4CEWA 4AFDA 2PTMA 1WCUA 2G4IA 4CP9B 4QB2A 3OY8B 4QPIC 5CZKA 1QJY3 5CB7A 3WDWA 4WM7B 4CE8A 4KH9A 1OQEA 2HWE1 4QKNA 4AXOA 3I8TA 1KS4A 4NE9A 3NRUA 3QACA 1KFXL 4XUOA 4XCAA 2HWC3 1Q8OA 1S0CA 1ZREA 2UY9A 4TN7A 4HVOA 4LK7A 3VBFC 5JCTA 1OUXA 1VBA1 2VQAA 2BGPA 3SEEA 2Y34A 2XR4A 2Z4FA 4LHLA 1PVC3 2GMEA 1UN1A 3MO4A 3VL9A 2WNVA 4EE2A 1HQLA 3CEWA 3JD72 3MLKA 3N9OA 1R1A2 1ODNA 4PHZA 4CXYA 1J3QA 1NY71 2PHLA 4FQZA 3T0DA 4BXFA 1PO21 2GC0A 4OI1A 2ZHLA 1FOD1 5IVFA 2P34A 4F83A 4Q0QA 1AR82 4ZS2A 4FOYA 2R072 2KM2A 3FE5A 3HT1A 4Y1YA 4ZY9A 1K45A 4HMZA 3B02A 4AAXA 1L3JA 5GZEA 4K21A 3FHQA 1R082 2GNMA 2VVFA 3LOIA 1CQ9A 2TBVA 2XMLA 4XXAA 2JD9A 1CAXB 3VBSC 5BUVA 3KV9A 4W50A 3WNLA 1F5JA 3FFZA 1GP6A 2DCZA 1MS3A 3AZWA 1W39A 4Q0SA 4MXWA 4Q4X3 3E5XA 4GQ7A 2J42A 5JLVA 1UU5A 3MPBA 1WLWA 1UOGA 2WT0A 1S0BA 5FZOB 4IV1A 2VOTA 4J1WA 2A75A 1PNFA 3GALA 3MFAA 1LOFA 1I9RA 3N9PA 5GALA 3FMGA 4HZFA 2ZGLA 1V70A 1SBDA 1QXRA 2Y6FA 3B7MA 2GN3A 5F2SA 3RZZA 5GKAC 1XSQA 5F6LB 1DYPA 1DCSA 1ZM1A 3QH7A 3HN3A 2V4AA 4RA0A 1W6MA 2JICA 4CDUB 1HB1A 4DY3A 1RUE2 1J3PA 3B5LB 4LO4B 5FV3A 2ORXA 4AFCA 4URAA 3PUQA 4CCDA 3MIFA 5J48A 1X9TA 4XUPA 5DDJ1 1QWRA 5IVBA 1OH3A 2D43A 5LA1A 3IBMA 4P9YA 3PU3A 1B35A 3X29B 5ABJC 3BIWE 1AXKA 5I91A 3ZSJA 3TEWA 1QMJA 3WLUA 1W6OA 2W92A 4QPYA 1W2TA 2QTWB 2Y33A 4ARYA 2PLV3 4WM8C 4ISQA 1RUG1 2WFF1 2YGLA 5C8WA 3D8CA 3P3NA 2D3RA 2I2SA 1G9AA 1YQ6A 3WP3A 3EB7A 3M3QA 1MS9A 1OVSA 3S0MA 4R9DA 1AYN2 1VBB1 1UKRA 2GNTA 3CZUA 3AZVA 4CCMA 4Z82A 2NP0A 4M3CA 3O12A 2J22A 4Q4Y2 4E4ZA 1S4CA 1RUH3 4HVRA 5B4NA 2HWF1 2W39A 2ZX3A 1AL21 1KEXA 1WW5A 1ZZBA 3U11A 4CEYB 3BN6A 5C70A 1OSGA 1AXYA 1W9SA 1N1YA 1XPWA 1CAWA 4QPGA 2XJQA 1MVEA 4CPBD 4LKSA 3KF3A 3CJIB 3PIJA 3RVHA 1XYNA 4Q0PA 3D4KA 1H1MA 3J7MA 4I2OA 3K75B 4LBQA 4RFRB 4AVBA 1ONAA 4CUAA 2K2SA 3J26N 1VAMA 3DL3A 3ZN6A 3I3MA 3H3UA 3H1YA 3AKTA 3LIGA 2WA4A 4HT1T 4OHVA 1ODMA 2E9QA 1NA1C 5FPUA 5FYSA 2FDHA 3T1MA 2FCTA 2VBDA 3HQRA 1ZZ8A 5IK5A 4M4PA 1WWYA 2DCTA 4XF9A 1OFNA 5KWRA 4UW5A 3JQXA 1NAEA 1E5HA 3NAPC 5A3MA 3T0BA 4NRPA 1I6XA 5CG8A 3LPFA 4AGRA 2QQLA 1RUF2 5FZDA 2A1XA 2JDMA 4N7UA 5A33A 5SV5A 3WR0A 3A0NA 4NHLA 1X8MA 3T4HB 1PM7A 4IV3A 3M8LA 4XTMA 4BIOA 4FTSA 5DN2A 5LBEA 5I8SA 1O4YA 2JDAA 4W6XA 2YY1A 5BNPA 1LGCA 1RUI1 2E7QA 1G9FA 1QOSA 4GA9A 1CD3G 4CA9A 4BCUA 1EPWA 1H8TA 2W5FA 5ACA1 3ZN4A 3DKQA 1ZBE1 3ACHA 4CCLA 5IAXA 4TXWA 1LAJA 2QZ2A 4H2AA 1DIWA 4FPOB 4E8DA 2GSYA 3I2GA 5BNNA 1OQDA 2IWGB 4Q4V1 3RJ2X 4LKDA 1BMV1 1U5XA 1JUIA 3PMEA 4LO6B 1NLSA 4GH4C 1O3RA 2E31A 1W06A 1CVNA 5IATA 4XBNA 3CF6E 2WS91 3JD73 4QQPA 1A78A 1OBNA 1R1A3 4LITA 5F2WA 2RM21 5JMCA 2EXKA 2D5FA 3EHKA 4XFIA 4QPWA 3VBOB 5A3LA 1W0OA 4Q29A 4XABA 5IK7A 4XUNA 5CFDC 2KR2A 4J1XA 2W46A 3W58A 4XVHA 3WVJA 1LNSA 1A34A 1GNHA 4YM2A 4MVTA 1GANA 4PBPA 3CL1A 2A3YA 2PFWA 1OLME 2WYFA 5JPMB 3OG2A 1Y7BA 2A73B 4JKMA 1ND3B 1ZZCA 2B46X 1L7RA 1PIV1 1AR92 4XURA 5FQ0B 3AP5A 1AR63 2XONA 4XBQA 3U4XA 3U78A 1R091 3KD4A 3PIGA 3I97A 5FPLA 1VRH1 1NT0A 1LEDA 3IIAA 4KNCA 4XF1A 1JZ5A 1WKYA 1JS9A 2DWRA 4GWJA 3UGGA 3K77A 3PLQA 3RZKA 4OZXA 1BEV1 2NLRA 2WQ4A 2R1BA 2DTYA 3K4DA 3MV11 5DPNA 4GULA 1SZBA 5FJHA 2I45A 4XFFA 4ZONA 1QEXA 5C4WB 5FPZA 4RHV1 2GC2A 3BODA 3KCYA 2GMMA 4QDRA 2RMU1 2VGDA 4Y33A 3K48A 4XFCA 3RYPA 3JB4C 4PCRA 4QKBA 1HB2A 1C3HA 1RUE3 1NE4A 4CU8A 1YQ2A 4QAWA 4JTOA 3ZFFC 2XVKA 4UXAA 3BYWA 2JB8A 1AZDA 1RUC2 4P9XA 4Y4RA 3THTA 3U07A 4DXRA 4ATEA 5FFOC 4S2FA 3NNMA 4XZPA 4YPJA 1S0DA 2JG9B 4LUMA 3AKSA 1BJQA 1MS5A 4IEZA 2UYBA 1SLTA 4LKFA 2IVJA 4QX5A 1A8MA 1XB9A 2L9LA 2XBO2 3DUIA 2HWB3 4L99A 3WEZA 3F2ZA 4B3NA 3VD7A 2VZUA 4E9KA 5FXVA 2VXJA 1RYYA 3ACIA 3GJAA 1AJOA 2BNNA 3TEZA 2J1UA 1PZ7A 1I5PA 4LE3A 4BU2A 4IESA 1TME1 2XHKA 3MIEA 2WO1A 5FBZA 2IXJA 4EN0A 3FBYA 3JUUA 4UI9L 1UOFA 1XRUA 2LM3A 1FV2A 3A21A 1O3TA 1QDCA 2R32A 3PUSA 4Q4Y3 1NCRA 4D6QA 1OLQA 2JECA 2P17A 1C5IA 5FY9A 4QPIB 4XFAA 4Y5SA 1LGNA 4NHYA 4NOTA 1FX5A 1YFYA 4O7XA 1V9U1 3D5OA 4Q4W1 3DXTA 4WZCA 1W90A 5BXXA 2KA3A 4WV8A 3M3OA 5T50A 4BHPA 4CP9A 3OY8A 2WZ8A 5LASA 2VUDA 4LXLA 3TB0A 1YJLA 3VBFB 3VKMA 4DFSA 4WM7A 5FO7B 2R16A 1K42A 2NQYA 5A7NA 3E6DA 3ZFGC 3EJKA 2ZX4A 1XJAA 3NSTA 4OUSA 4Q2FA 4IERA 3VGIA 4A6SA 3BU0A 2LS6A 3IB3A 5FZ0A 3USUB 3LE0A 5FYUA 4UW6A 3KGLA 1AYM2 3VBUC 5C9AC 1NLRA 3WCRA 4B4RA 4BQYA 3DGTA 4K1YA 1EV12 1EUTA 1LCLA 1TNFA 1W6NB 1X82A 5E88A 1VMJA 5EWSA 1DFQA 4HPKB 1GU3A 3HVDA 3RYRA 1QJX1 1LULA 1CJDA 2MEV1 1DF0A 1UZVA 1D4M1 3TN92 2QQNA 1JHNA 2B7YA 4AI8A 2XJSA 4JDNA 1RUF3 2JDPA 5F5CA 3R4DB 3LEMA 3VBSB 5BV6A 1MZFA 2GN7A 5JOWA 1HV0A 3ZXAC 4XUTA 4AG4A 3KVAA 5L73A 3ZYRA 5CVRA 1MS1A 4OMCA 4QGNA 1CAXA 1F15A 2QCSB 2CV6A 2WFPA 4ZU4A 4AHYA 3HBZA 1HKDA 4P9WA 4ZPIA 2J1TA 3NMBA 3HNYM 4HBNA 5J09A 3WQ1A 4GMP1 3N35A 3MDPA 4XJZA 5CIRA 5HCHA 4MGQA 1RUD1 4CDXC 1QJU2 1W2OA 3AX4A 1KITA 4OULA 4UBHA 4BLIA 4K1ZA 1V0AA 2XLAA 2CDOA 4QMAA 4ARXA 2J1RA 3N36A 1R64A 1NXD1 2KD7A 4NR1A 2V5DA 1T6GC 4DXZA 1G6NA 5E16A 5FAXA 4ZS3A 3ENRA 4L11A 4LUKA 4NHMA 3ZXDA 1HRV3 4CDUA 5HBAA 1VBC3 1POV0 2JEMA 5ABJB 4MSVA 3WHUA 5A1AA 4LBQD 2JKXA 2A6WA 1U0AA 4LLFA 2O0OA 4FPEA 3ZX7A 1VRBA 4AVCA 3NVCA 4COUA 1HXS3 4AEDC 3N7LA 4HKWA 4WM8B 4LR4A 1AR93 2BVBA 3ZO0B 5FO9B 2CY6A 4Y5TA 2XG3A 5LA9A 1W03A 4FPFA 5FYMA 1BQPA 1YI7A 1W8ZA 3GBGA 4YM0A 1WW6A 2ZZQA 4P08A 4CCNA 1PGL2 3ZKYA 2WLPA 4XXPA 5T3NA 1REFA 4YM3A 3MLJA 5CYYA 2A6ZA 4IEPA 1H0BA 2C1FA 1IKQA 4RGAA 4QQOA 3WF3A 1Y43B 1W05A 2PA7A 2VMCA 1S2EA 2WQZC 4QKFA 5A3OA 2R061 2P37A 2QUOA 1UYPA 2ADDA 3ABZA 2J1EA 2ARCA 2VBPA 2D93A 5JR7B 1EAH1 3VHOA 4AK3A 3OD4A 3C7FA 2EIEA 1C8M1 1W6QB 4GZ9A 4XCBA 4CEYA 2VZQA 5KXEA 1LHNA 1RUC3 1VP6A 1W6PB 1HB4A 3CJIA 1Q8PA 1COV2 4N43C 2J1SA 1NA1B 2PMWB 4OI4A 4OUMA 3ST7A 2XBO3 1J59A 3FUOA 5DZEA 3H1WA 1KDKA 2H0BA 3ITQA 4W8JA 4B1MA 1QJEA 4LMFA 1W0PA 4FSJA 2ET1A 4NJ4A 2TNFA 2ETEA 4HK9A 5A80A 3WQBA 4AGVA 3WSOA 4M4RA 2W94A 1V6IA 2XWJB 3J4UH 1WCKA 4OQ8A 4BQ4A 1VE0A 4LIVA 3VDDC 2QQWA 2CHHA 3ZXEA 4B4PA 5A1LA 3VHNA 2WZR1 5L9BA 4NWVA 4XMAA 1YHFA 2X10A 3E5UA 3U14A 4HXCA 3SH4A 2DVFA 1UWWA 4YW2A 2G9GA 2X53S 3LCPA 1LRHA 2OA2A 4NRQA 4QQHA 3JQWA 3VHPA 4BYYA 4NMIA 5FO8B 3MUY1 3BGAA 5J36A 4LKEA 2WL1A 3MHZA 2YB7A 2GC1A 3OSDA 3SCHA 5JUVA 5T5LA 5LA0A 2B5HA 2ZACA 2D3SA 2VZ3A 1YWKA 3BPZA 4JKLA 4XHXA 2Y64A 2CAVA 4GH4B 5AC91 3GBWA 2H6CA 2YFZA 1OD5A 3ZMOA 5DABA 4AI1A 1OA3A 1ST8A 2WNOA 5EXOA 4X8NA 1EV13 2ZGTA 2FZ2A 1MZ6A 5CFDB 5JSPA 2IXKA 1HN1A 2PHUA 1MR5A 1OUSA 4YGEA 1RUG2 5KXBA 5JWPA 3TN93 2VUAA 3J7NA 3N9LA 3OOXA 4X8PA 4ORFA 5E6HA 3VBOA 5A6YA 1JYCA 5A6QA 4OI0A 1XNCA 2HKXA 3M3EA 2J1AA 3N9QA 4SLIA 5A3PA 1F31A 3ES4A 4R4ZA 5EJZB 3SNMA 1ZRRA 2YGMA 1X33A 2A70A 1ND3A 1GV9A 3O14A 1NXMA 1C28A 1UPIA 2VZPA 5FP8A 5FQ0A 1VBD1 3C8XA 5LWBA 4XJWA 1FMD2 2WO2A 3J8F2 3WG1A 1JMUB 3U4SA 1EUUA 3FUQA 3WDYA 4QDSA 5EYXA 1LR5A 3ATGA 4JQTA 1DG6A 4ONUA 1QJY2 3AYCA 5KBFA 1JN2P 3IKWA 1K3IA 1RUJ1 4TYSA 1S0IA 4A3ZA 4YM1A 2ZGMA 3ZXGA 2VO5A 1OPOA 4RGGA 4PIZA 3OB8A 1OI6A 4H55A 4ASKA 2VZSA 1NCQC 4AW7A 2ZA9A 1SACA 3I2KA 2WA3A 3I2FA 2FDGA 5C4WA 3B00A 2RS11 2HEVF 1LHVA 3ZFFB 3WNXA 2AZ5A 1TNRA 2Q30A 3MYXA 4L2NA 4YVWB 3ZPOA 3O1UA 5C71A 1IPSA 4UAPA 1KS5A 3K3OA 1G7YA 3KWVA 2E63A 4NROA 1HX6A 3SITA 4LULA 2E51A 2R7EB 3ZIWA 4IGOA 4EN9B 3USSA 2X5IC 1LECA 4JHZA 1JOJA 3E6CC 1MVQA 2C6SA 1Y4WA 2RS51 5JXIA 1VMFA 2JG9A 3M70A 4LHSA 1VBE2 2W68A 1O8PA 1WCSA 3Q8AA 3ZYGA 1JOBA 3JBG1 4RFT0 4QGMA 5FMBA 1TMF2 4LNVA 1PO11 3T30A 1SPPB 2DVGA 1GWKA 2CWSA 2OUJA 4LBLA 4B8EA 4LBOA 4Q4X2 1LENA 5KHHA 4IETA 2RS31 3AK0A 4D0QA 1O8SA 1O5UA 5E1RA 1DQ6A 3RZHA 2HWE3 3INAA 4XE9A 5F3IA 1Y9QA 1LU1A 4MOAA 3LB9A 2HH9A 3MI8A 3UKVA 2A6XA 4XDPA 4YARA 1MS0A 1QOTA 4LPLA 1DLCA 4YG0A 1VBA3 1SEFA 3ORJA 2VH9A 3WW2A 1UF2C 5CFCC 4B4QA 4AI3A 1OLRA 2W9XA 4XQ4A 2VTXA 2ATFA 4QPIA 3MEPA 1ZX5A 2W1WA 3DYOA 5G04L 4YFZA 3KQ4B 4E2QA 4HK8A 4LLOA 3NJXA 3AMMA 4P9GA 1GWMA 2Z69A 1GP4A 1D0HA 1EPZA 1FOD3 4O9GA 3ZFGB 5K4LA 4TTGA 1S1AA 1CGPA 5DXDA 2ZJCA 3BALA 2ET7A 3ES1A 3OUHA 1CAVB 1XNBA 4SBVA 3VBUB 3RPQA 3VBFA 3VD3A 5FP7A 3OGSA 4JX0A 1NX9A 1UMZA 5A6XA 5FPAA 1GQGA 3KT4A 4RR3C 1DZTA 3NNGA 1MZ5A 2YBSA 1K12A 3ZXKA 3RMXA 3USUA 1MEC1 1ENXA 2JX9A 2PLV2 3DV8A 1L7LA 3AMNA 3H7YA 2VR4A 2ZABA 1W6NA 3B9IA 3VKNA 3VLBB 4XBLA 4BK5A 1PMHX 3DCQA 2XJVA 1XBFA 1ZA7A 5EYYA 1XOYA 5A3WA 3UETA 4EWDA 2C4XA 5JR2A 2OKXA 4AE2A 3WDVA 1W9WA 3RJRA 1BEV2 1RHI1 1KXGA 1TVGA 4LA2A 1JTZX 2E7TA 1ZZ6A 3WZ1A 5CKNA 3VBSA 3ECQA 1SBEA 2Z79A 3MIGA 3GBFA 1JU3A 1BBT2 4Y3OA 1LOCA 1OC1A 5APAA 3LDRA 4Q26A 1W9FA 1XNKA 4WBBA 1FYUA 2B42B 2ID4A 4CDXB 5L19A 4IEYA 4KWJA 3ACGA 5F1RA 2XUMA 2V5YA 5FTTC 4D3WA 1E5RA 1DBNA 5DDJ3 4HSJA 1O91A 2E7AA 1UYZA 1XYPA 5AVPA 5HCAA 5IK8A 4PLNA 5LBCA 2XLFA 1ULCA 2F4PA 5J37A 3GCXA 3PL0A 5FREA 5HCBA 3T0AA 2WR9A 2F4LA 2RJLA 2WN3A 4FTEA 1Z7S2 2YBKA 2VNVA 1RUG3 4FPYA 4GJYA 4AEDB 2VCAA 2YU1A 2BBVA 4IEWA 2VNOA 4BM8A 3IPVB 4TLGA 3VHRA 2PHWA 3THDA 2XDVA 2WC2A 3LEGA 3AKPA 4LOSA 4BDVB 5ABJA 2GALA 1W9YA 1AXZA 1LU2A 1OFSA 4MGSA 2QDRA 5A1FA 2VD7A 2BTVC 2OQ7A 3VZLA 5FY0A 4P02B 1J1TA 3W5MA 3AYAA 3AC0A 4WM8A 4NIGA 3RNSA 4KI5M 2HWF3 1FMD3 3J8F3 4FO9A 5BYNA 1QIQA 1GP5A 5F8PA 3ZDSA 3H50A 1CX4A 3AP7A 3OEAA 1RUNA 2NMNA 1UO9A 2ZGUA 4JKKA 4XJ9A 2WKKA 3URFA 5FZBA 4C91A 4JHTA 4B29A 3BI3A 4BZ4A 4JVAA 2Y38A 4AHWA 4EJRA 2WT2A 4XF0A 5EV7A 5DUVA 5BPXA 4E27A 3ZSEA 4BQ2A 2VMDA 4IEXA 3WP4A 4NO4A 4QKDA 4HONA 2BZDA 3RRDA 4P5HA 4Y1XA 1GMMA 3IMNA 4DUWA 1M06G 2AEYA 2D7FA 2VVEA 4N43B 1W6QA 2ZBJA 1SMVA 5FZIA 5DAWA 4PBOA 4COYA 1W6PA 3H0OA 3W5NA 1DQ0A 1UMIA 1GZTA 1BCXA 5GLTA 3M4FA 3MF6A 1VBE3 3Q8BA 4COVA 4WVWA 5FXZA 1JZ6A 5FCCA 3LSEA 5DUWA 1NA1A 4XHBA 1AR62 2GP3A 1PX4A 1FNYA 3P5BA 2AEZA 5CAZA 1GZ9A 1TMF3 3HN1A 3VDDB 5LBFA 1JYWA 3PTYA 4BQWA 5CEHA 3NAPA 3PUHA 4HL0A 5A32B 5EHDA 4AI0A 4D6SA 2FHRA 1AJKA 2SLIA 4CXWA 5FZGA 4F8AA 5C3RA 2GDFA 1GBGA 4XDOA 5E89A 3CHXA 2BEOA 2FMYA 2QE3A 5EJ1B 2P3YA 5T55A 1JUHA 5CA6A 1FNZA 1CR7A 2VJXA 4QHZA 1UZYA 4ASLA 2BV4A 3GXUA 4Q4V3 4YG6A 2G19A 1RB8G 2JIJA 3BCWA 3I59B 3O1SA 4DXSA 1F5FA 2HEYF 4UFLA 2WS93 3VV1A 1D7PM 3ZYPA 5HPOA 2RM23 1X7NA 5DQ0A 3MW3A 4YW5A 1YQ8A 2JE9A 1AX1A 3M3IA 2NPIA 5DAQA 4M3CE 5FZCA 2HWD2 3IMMA 4B7KA 5LBBA 3H7JA 2HLEA 4IGQA 1UY1A 3J7HA 4AQSA 3TYJA 3E5QA 3VDAA 4M3CF 4GH4A 4FXGB 4JRLA 1ASJ1 3PMSA 3ACLA 2HWB2 1PIV3 4XEZA 3RG0A 4BLJA 5IVEA 4A7YA 3LEIA 2P2KA 5IJRA 5FYZA 1NLQA 4JDOA 3GF6A 2Y0IA 4MHUA 5ISLA 1ENQA 1XNTA 2VC9A 4HANA 3IN9A 3ROUA 2K46A 2RDRA 5CFDA 2XKOA 3HNBM 3RYKA 1VRH3 4UFMA 4BMBA 3GZUC 2CYFA 3OGJA 5B4XA 4XOGA 3LZZA 4YW3A 3UGHA 4P9JA 1BEV3 2VAUA 3KZ4C 4GB32 2ILMA 5FR3A 5LK7B 4Q0VA 5EIYB 2CGOA 1U12A 2C9AA 1QQP1 4IEVA 4KWKA 2XJUA 3TWIA 4S2DA 2RMU3 1NZIA 1BBT3 2XL7A 3KVBA 4P14A 3VD4A 4RS5C 1DLLA 1IPKA 2QFEA 2R30A 2BOIA 3N7MA 4D69A 4J25A 1LJ7A 4AYUA 4LK6A 4XC9A 2DDUA 4EYUA 3WF4A 3QCWA 1NCQB
chains in the Genus database with same CATH topology
4YGCA 3A0KA 4AQTA 2R6QA 1Z78A 2DUPA 4YW4A 1RC6A 3DKWA 2BQPA 2CAUA 1Z7S3 1AR71 3ZFFA 1DGWA 2PHRA 2X5IB 4DY5A 1Q8QA 3AP4A 3B69A 3MICA 1TME3 1OOPB 1UZZA 2RR11 3ILFA 4H7LA 1XXNA 4QQLA 2HWC1 5DUXA 4CDQC 3RMYA 3A4UA 4C0HA 1MZEA 1PVC1 2EF6A 3VBRC 2I07B 1G86A 2W08A 2R041 1H2KA 4ZXKA 4IEOA 1WBLA 2IZWA 1N3PA 1RMU2 1V9U3 3RWNA 4BE3A 3C2UA 1IHMA 1QH7A 2GNBA 2UURA 2ZGRA 4QQ2A 4UW3A 4NVPA 5CFCB 2K0GA 1ZZ9A 3APBA 2C0ZA 1RIRA 3MIDA 3ETQA 1H9WA 3M7AA 4KL1A 3AXEA 2YROA 1DGRA 4KBBA 4ATFA 5JOZA 2EXIA 1LTEA 1V6LA 4R52A 1QJX3 2VNRA 1HRV2 5H9SA 1VBC2 2XWBB 2AENA 4RR3B 3MGUA 5T5PA 4GALA 3ZFGA 4BA6A 1AF9A 2VMIA 3HD8B 1HXS2 1CAVA 3VBUA 5L7OC 1N1VA 5C9AA 5JI7A 3UV9A 4XFHA 3NV4A 2AYHA 1RVF1 3BOWA 4GXLA 4FAHA 3EO6A 1VBD2 3MIBA 4AFBA 3QOPA 2RHPA 1GICA 2DTWA 1PNGA 1IS3A 3KMHA 1PK6B 3FJSA 4S2GA 3WG2A 1WMDA 4EWEA 4GMP3 4K9SA 1RUD3 1IS6A 3AP9A 5CADA 3UKNA 1WGPA 3SCGA 3V0BB 2R1DA 4C1XA 1H9PA 4OFGA 3MF9A 4FPJA 2OVUA 1KJLA 1JH5A 4JDMA 4YVWC 4XJ8A 2HWD3 3ZMNA 4E4DX 2N7GA 4YG3A 2A5ZA 5AFBA 5D8AC 4CDXA 4YLZA 3FX3A 5DG1A 2JXAA 1GKBA 1YUDA 1GZCA 1OPMA 4C90A 1RUH1 4I0BA 3LOBA 2OIIA 1Y3TA 2ZCWA 4LO8A 4BIFA 1HQWA 2B45X 1QY4A 1C57A 4Y1ZA 4DOUA 1AX0A 2ZHKA 1XYOA 2DFCA 5I8YA 1QXJA 3K51A 4GB33 4AEDA 2GAUA 4EN6B 4HFSA 2W52A 1BVP1 4XFGA 5HI0A 3M2MA 4Z07A 4YGDA 3SXWA 3G6JB 1C8M3 2ARXA 2E6VA 2QDNA 5FDBA 3WDUA 1UU6A 2VOXA 4M0NA 1BVVA 1BK1A 1SLBA 1LOBA 4G9SB 2NM1A 1V6OA 4WVVA 4MV2A 5F6KA 1DDLA 2EXHA 2ZGNA 1C1FA 4RD7A 4XFBA 5T5OA 4RL7A 4IL7A 3LGRA 1QNWA 4AVSA 1WA4A 1LHOA 1MEC2 1RGSA 2GMPA 3B3QE 1APNA 2D44A 4XPVA 4LBMA 3EBRA 2YV8A 4KG8A 3KB5A 1HRI2 4N43A 5I0SA 4AI2A 2WZR3 2DFBA 4K3UA 3ZVXA 1KD7A 4KU7A 2G9FA 4OHXA 4CTEA 2QJVA 2ZS6B 5KHKA 5CBLA 1VAKA 3JD71 5JSOA 4X6QB 3WY6A 1RMU3 1OA2A 3VDDA 1YXWA 1ZA4A 2XJTA 1AR81 2A6VA 4R9BA 3QLQA 3ZN5A 3N3HA 5A32A 1QHDA 2R071 3I54A 1OQ1A 4QU2A 3T2TA 1UIKA 2W0XA 3AMQA 5LRRA 5AC93 2MPFA 1R081 1B09A 1MACA 4ITCA 4FPLA 1UIJA 2P3IA 3VBHC 1G9CA 3I59A 3IDBB 5FLIA 1U5YA 3VZKA 1PVXA 5J96B 5I0UA 5H9PA 4DB5A 4N9HA 1H30A 1PGW2 1KFUL 5EZWA 3VZOA 4E2SA 2ZGQA 2VY0A 2EIGA 4JAAA 3OBTA 4V1PA 2A3XA 1POV1 2SBAA 4JGZB 2DVAA 1J3RA 3N7KA 4FVVA 4YZ1A 1MQTC 1HV1A 2BWCA 4BPZA 2OPKA 1FPN2 1QJZA 4OHWA 1RUE1 2A6YA 1VBD3 1XQNA 1N3OA 1YIPA 1G9DA 3HT2A 2ZZJA 4Y5Z0 2UYAA 2ZPXA 1AVBA 4KGQA 1RUJ3 2HWE2 1UCXA 1CONA 2AR6A 5F9TA 4WVZA 4CDWC 4RS5B 1VBA2 1V00A 3E97A 2Q4SA 3ZYJB 2P3JA 2RS13 4LBKA 4X6RB 3CJXA 3LKJA 4GKXA 1NY72 4DNYA 2PHFA 1PO22 4P9IA 2VNGA 4PJYA 1FOD2 2RJKA 4LHKA 3S7EA 1ZBA1 1AYN1 4C1WA 5K0UC 5DG2A 4LT5A 1NCQA 3AFGA 2RS53 2IFRA 4Q4Y1 3BTAA 1S0EA 1LHWA 5T52A 2Q5TA 3FBMA 4AVTA 1SQ4A 1PO13 4CRQA 3L2HA 3SHRA 1ZRDA 2DVDA 4ZKTB 4CDQB 4URTA 2X5IA 2RS33 3D0SA 1VALA 1OOPA 3VBRB 5DZGA 4K6BA 4YRDA 1A3KA 2Q0AA 4A7KA 1H1IA 2OZ6A 1EYBA 3JZVA 4HETA 4Y24A 4AEMA 2PAKA 2P3KA 3EXUA 4PLMA 1O4TA 2DF7A 3WV6A 2MNGA 1D2SA 1RUF1 3SMHA 4F7ZA 5DDJ2 3SCFA 1U5IA 1IZ3A 4QT6A 1Q56A 5CFCA 1MS4A 5KXDA 4XW3A 1AX2A 4FPGA 4CZSA 1MEC3 4NHKA 3WG3A 1YCIA 1CAUB 4J6GA 5GLUA 2VG9A 2WFF2 2NZ9A 4DQAA 4Z8BA 1HRI3 4ES9A 5L7OB 4AEKA 4RR3A 1VBB2 4EROA 5KHGA 2TUNA 1S2BA 1RHI3 3WUCA 2ZTNA 1HLCA 2D6LX 3NO8A 1WLDA 3LWCA 4IEUA 2HWF2 3IDEA 1AL22 2D40A 1LOGA 1UPSA 2QZ3A 4I3PA 3B9CA 2QQPA 1C1LA 4E4SA 2LALA 1OKQA 1WCDJ 1AR91 5L36A 2ZMKA 3KGZA 5F5QA 2VQ0A 3V0BA 4A7ZA 4JGYC 5D8AB 1DU3D 2NYYA 4I30A 1NE6A 3U10A 1ND2C 2FZ1A 4YNIA 2LUWA 4YZ5A 2OZJA 2ZKLA 3GZTB 4LTAA 5GLZA 1OOPC 4KU8A 4Y20B 2ZAAA 2VMHA 1DQ5A 1FPN3 1QDOA 4XDQA 5JI9A 3KT1A 1RUI2 5CU1A 2V09A 4ZU5A 1H8VA 4UBGA 5ACA2 1RUC1 2DU1A 1ZBE2 3KSCA 4MLOA 4JV4A 3R4SA 4PDWC 4A2UA 5FRAA 4KWLA 4HKOA 1K5MC 2QNKA 2XBO1 4EV0A 1VB4A 4Q4V2 1H2MA 2WNUC 4BQ1A 1N1TA 3D82A 1Z0HA 4N53B 1BMV2 4AQ6A 4HVQA 1SBFA 3WQ7A 4I0AA 2WSVA 4YGBA 2WS92 3OCPA 2RM22 1PO23 1FT9A 4AFMA 1JW6A 4AHZA 5J98B 2PHTA 1WLTA 3R0RA 1V6KA 2YHJA 4YZ4A 3WQ0A 1PIV2 4FPHA 1GYKA 2BGCA 1NOVA 4U2AA 3ZIXA 4AQ2A 4S2HA 4C0BA 1R092 2D6KA 4U36A 3WHTA 1EY2A 3AM2A 4MGZE 1VRH2 4HPKA 2EVXA 1SLCA 4XIOA 2XVLA 4FOWA 1ZZ7A 3M1HA 2Z5WA 3OGGA 3OF1A 3ZFEC 2VOVA 3MW4A 4FXKB 2DCKA 2H6BA 1PK6C 5EJ3A 4R4XA 2DCYA 1AYM1 2JG8C 2TEPA 4P9LA 1GLHA 1LOAA 4RHV2 2CTVA 1WMEA 2RMU2 3IDCB 2ZMLA 4JC1A 3R6SA 3TN91 2B9UA 4DRVA 3TOJA 1H1AA 1KJRA 3BOPA 1JYIA 3VBHB 5JOXA 2VU9A 2WSUA 4RQPC 3POYA 4Y26A 4YW1A 3ZPYA 4GWNA 1DZRA 2EA7A 2VW1A 3B94A 2XLGA 3AJZA 2WFF3 2WT1A 4RSUA 3WW1A 2BYVE 5C33A 3O5SA 1NZCA 3L2YA 4HSLA 1TME2 4MGKE 3UL2A 2X29A 1VBB3 1QJU1 5LRSA 1MQTB 1HQNA 5E8AA 5FLHA 3B93A 4Y1UA 1QQP3 1VJ2A 1D0GA 1AL0G 1AL23 1XE8A 1V9U2 1W2UA 2AGSA 4Q4W2 3DF0A 5KHIA 1ULGA 2A71A 3PJYA 1YI9A 2GH2A 4CDWB 3OBRA 3P3PA 1VAVA 1BZWA 1UU4A 3IT8A 1SLAA 3MIHA 3NV2A 3OPZA 3VN4A 4BWOA 4D7TA 5C8CB 1NQDA 4FQ4A 2PN5A 2B8MA 4RS5A 4I02A 2CWMA 4W6WA 2D6MA 4D7SA 1PGL1 3L9JT 1DGLA 1AR73 5K0UB 1D2QA 4N9IA 1QJX2 2MEV2 2IFWA 3EQEA 3FLTA 4IEQA 3KCXA 1D4M2 3O0VA 5FMOL 1A6CA 2RR13 2CNAA 1GSLA 4TLFA 2GU9A 1RINA 1WBFA 1ULEA 1RJ7A 4WVMB 1IOAA 2YC0A 4DPNA 1RUI3 5GM0A 1ZRFA 5JZGC 1YO8A 2NN8A 2R043 3AKRA 3R4UA 3H3ZA 1SFYA 1BYHA 3KQRA 5ACA3 5JVVA 1ZBE3 2HYKA 2ZGSA 5LEJA 2K9ZA 1COV1 2Y26A 3H9AA 3MW2A 4QGLA 4QHBA 4CDQA 2FQPA 1Q8VA 5KXCA 3U0ZA 1RUD2 3CLPA 2BVVA 3VBRA 4XJUA 3MFCA 4MYEA 2ZGPA 2JDZA 4I0WB 1J58A 2DVBA 3WP6A 3VZMA 2XL9A 4CP1A 1BXHA 2UU8A 4ISRA 2GNDA 5SV8A 5HCFA 1FI2A 4Q8LA 4W65A 1KRIA 4I01A 4JGZC 3GZAA 4FP2A 1AUYA 2Z42A 1R093 1GR3A 2WJSA 1RVF3 2A7AA 1FXZA 2PELA 3FUQA 1VR3A 3IWZA 3OD0A 4JRAA 4KGGA 4AEJA 4AWDA 1ENSA 5JIAA 1CAUA 1PZ8A 1R1ZA 1SFNA 4YYOA 1WLCA 1IS5A 1NQJA 1V6JA 5L7OA 1H4GA 4OLLA 4YVSC 5GLWA 1FV3A 4RHV3 2XB6C 2R062 1V6NA 1RL3A 2C5DA 1EAH2 2O8QA 1C8M2 3DPRC 2XJRA 2D6OX 4QM8A 4CEWC 4XIKA 4Z2WA 5CG9A 3CU7A 5C6CA 3QH6A 4TSVA 4AFAA 3I4IA 4HLTA 1CESA 1ZBA2 5K8SA 3JB8A 3OYWB 1F2NA 4GKYA 2FBEA 2O1QA 1PHMA 1SLLA 3H8UA 4JQRA 4YZ3A 2VOKA 2IXHA 4JGYB 4MUVA 4AVVA 2PYTA 1FMD1 3J8F1 3N4MA 1WUVA 1ND2B 2UWAA 2WNVC 4YVWA 1QJY1 3M3CA 1ALYA 4PIYA 5D8AA 4GIQA 1OA4A 1RITA 3RI9A 2WZR2 2JD4A 5JOYA 2H0VA 1YNAA 4Y20A 2AH2A 1WW4A 1Q3EA 4H3WA 4PDWB 4Q4W3 3V0AB 2IC1A 1C8NA 1S0FA 3ZSLA 1K5MB 4LO5B 2WNUB 4IV1C 5AC92 1LOFC 1VBE1 1Q43A 3NL1A 4XF3A 5KHJA 4XQDA 5HXVA 5GZCA 1TMF1 3HWJA 4N53A 1JXNA 2ZOEB 1CN1A 5I0TA 3HIFA 1UKGA 4Q4X1 3TRSB 3ZYIB 2MEV3 2VW0A 2YXSA 2D6NA 1D4M3 4ES8A 4PF5A 1QF3A 5K7PA 1B35C 1S55A 2PHXA 3BU7A 4LO7A 3H1MA 1DYKA 5EFUA 4YSFA 3ALQA 3Q9OA 2HEWF 2Z2SB 3JU9A 3LSDA 4QM9A 3ZFEB 2VW2A 3HAGA 4H7MA 5KC5A 4XQWA 2WNEA 5H9QA 3NV3A 5H9RA 4FAGA 1AR83 1RUJ2 1LEMA 2JG8B 2R073 3PVNA 4FT8A 2LTNA 5GLVA 1R083 3ZXFA 2XKPA 4D7YA 4META 1LODA 1X36A 2PLV1 1UL9A 2RS12 3POSA 4LA3A 1O4ZA 5CNAA 1YRZA 2VULA 3V56A 2Y0OA 1IQAA 1ZVFA 5JDBA 3PVBB 4QPGC 1BKZA 4RQPB 1E57A 4FCAA 1C5HA 1YYNA 2XPJA 1DGWX 4Q27A 4XILA 1POV3 2ZAHA 4N7IA 5T54A 4F3JA 2RS52 3VBHA 2ZGKA 4HN1A 3D6EA 3O0XA 1BBT1 3JBG2 4COWA 5JSRA 2YZ4A 1PO12 3AB0A 3ILNA 3IM0A 5AVAA 3POWA 4L9BA 1UX6A 4MZUA 4OI2A 5LEKA 1GZWB 2RS32 4L92A 5B2GB 4FPCA 5BNOB 3IPVA 1VLNA 3KT7A 3NJZA 1F8VA 3KM5A 1MQTA 4LE4A 2R063 4Z92B 2ENRA 3PJQA 1LKNA 3ZXJA 4IV3C 1EAH3 3WW4A 3B01A 3WW3A 2BUKA 1IS4A 1Z7S1 1TE1B 4OVEA 1Q5OA 5BNPC 4N53C 3ZXLA 3GNEA 1QNYA 4E2GA 3R05A 2ZHNA 4NWWA 3AFKA 3WXPA 1H2LA 1EP0A 1H8TC 1QOOA 2VECA 2CGPA 4Y1VA 1YIFA 1AYN3 1ZBA3 4Y22B 3NW4A 1CPMA 2KXLA 2XH6A 4CDWA 4QD2A 5BNNC 1YFWA 4QXKA 5C8CA 3HR9A 1U5ZA 2ZX0A 3PNAA 1HDKA 2UWBA 1SLIA 1PGSA 3GYDA 3THPA 3SH5A 4COZA 2NMOA 5TSWA 1WW7A 3UK9A 2Q8OA 3V65A 5K0UA 2VPVA 3KCCA 3DN7A 4HN0A 5K9YA 2ZX1A 1O5LA 1RHI2 2Q1MA 4TWTA 5JIUA 5JZGB 1FAYA 1SCSA 2D98A 3AMHA 1R1A1 4WVMA 5GJ6A 1H4HA 1TEIA 4K7JA 1QU0A 2DV9A 2D5HA 4GWMA 5JAXA 2FMDA 1JBCA 3E6BA 2X8KA 4OHYA 2GH8A 3RSJA 5GZFA 1AR61 2JE7A 1LESA 3LA3A 4AGGA 1WMFA 2XVGA 4JCKA 3RS6A 3G7DA 4LBNA 4NPRA 1O3SA 2YUEA 4FOQA 3D0JA 4GMP0 3VKFC 4DS0A 3UJOA 4LHNA 5FLJA 4ZU7A 3CO2A 1GF