1SBEA

Soybean agglutinin from glycine max
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
234
structure length
231
Chain Sequence
AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENEQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOYBEAN AGGLUTININ
publication title X-ray crystallographic studies of unique cross-linked lattices between four isomeric biantennary oligosaccharides and soybean agglutinin.
pubmed doi rcsb
molecule tags Lectin
total genus 40
structure length 231
sequence length 234
ec nomenclature
pdb deposition date 1995-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sbeA00
1LOCA 3ZYPA 3DGTA 3OPZA 4XJAA 1GICA 1SLLA 2ZAAA 1ULCA 2ZGOA 3ZXFA 4XXPA 4FOVA 3WDTA 5GZFA 4XJ9A 2A6WA 4AGVA 4ISQA 1BYHA 2GNTA 2ZGKA 3IPVB 1I3HA 1EPWA 5DZEA 3WOGA 1RITA 1QOOA 4Y22A 2ZGMA 1B09A 1VAVA 2JE7A 4HL0A 3W59A 1SLAA 4DRVA 1GZCA 3N7JA 1W6PA 1G9AA 3ZVXA 4M3CA 1C1LA 3B00A 2BQPA 1V6MA 1W6OB 2C5DA 5HCFA 2A3WA 2DUOA 1LU1A 1N3QA 1GBGA 1VAMA 2GN7A 2JECA 2VW0A 2WJSA 5GZEA 4PBPA 1IKPA 3RSJA 4UW4A 4YFWA 5H9QA 4Y20B 2NZ9A 2ZHLA 4ISRA 1H30A 5CBLA 3R05A 3AP7A 1Z0HA 2A3YA 3DUIA 4PQ9A 4M00A 4ZKTB 1ENQA 1URXA 2P34A 2AYHA 1SLCA 1VIWB 1UZYA 2P2KA 3N7KA 4PF5A 1JUIA 1N1YA 2EXJA 5GLZA 3KM5A 2EXHA 5SV8A 2KM2A 4DS0A 5GALA 2ZGUA 1XQNA 2R1DA 3OJBA 1LHOA 2W08A 3M3QA 1I1EA 1G9CA 1N1TA 5JOZA 1YRZA 2AENA 2YMZA 1CJPA 1V00A 1S0EA 2DU1A 4XJUA 2GN3A 3PMEA 4GKXA 2D6OX 3UJQA 3PVNA 3WG1A 2WNEA 3V0AA 2DVFA 2HYKA 1W6NB 5GLWA 1DQ2A 2FMDA 3L2YA 2XB6C 1J1TA 1GZWA 2D3PA 3OGGA 3OBTA 5DUUA 4C1XA 1S0DA 1WLWA 1AJKA 2A6XA 3O0WA 1JBCA 5KXEA 1W6PB 1GLHA 3WG2A 3APBA 4ATEA 5GZCA 4M3CB 3BODA 3ZYRA 3ILNA 4XDQA 4CRQA 3M1HA 2DVBA 4R9CA 3FUQA 2R0FA 4YM0A 1LGBA 3VKLA 4FOWA 3SH3A 1IS3A 4FPCA 1BXHA 2RHPA 1W6QB 2ERFA 2XG3A 1S0GA 1DQ5A 4NO4A 4YW2A 1A78A 1ENRA 1O4ZA 3WHTA 1FATA 1S0JA 5T5LA 1AZDA 2ZGRA 3IM0A 3HR9A 3NWKA 4FOYA 4P9YA 4XILA 1QOTA 1IOAA 4XHXA 1SBEA 3UK9A 1YIFA 2A6ZA 3MEPA 1SLTA 2D6LX 1UN1A 1LOGA 4BLJA 3V64A 2ZGSA 1WCSA 5DUXA 1JYIA 1LOBA 1UL9A 2CNAA 2SLIA 5CB7A 2PHFA 4JCKA 4FQ4A 1LEDA 3LCPA 4CZSA 3I4IA 3A0KA 2PHRA 4YM3A 3IKWA 3KQRA 4FPGA 3V0AB 5T50A 4FOQA 3WHUA 4Y26A 4LBQA 2D3RA 1LECA 3FBYA 3ZXLA 1A3KA 1V6JA 5IK7A 1Q8SA 1S0CA 2EIGA 2A7AA 4YZ3A 4FPFA 1IS5A 1YXWA 5DUWA 2WLQA 1WD3A 2CL2A 3POWA 1BJQA 1QMJA 1LTEA 3PJQA 2P3JA 1IS4A 1N1SA 2UURA 1LHUA 1LOFC 5T5PA 1QDCA 2FHRA 4DPNA 1CR7A 2GMEA 3AYDA 4LBLA 1V6NA 5JLVA 1N3PA 1OFSA 3IN9A 3PVEA 3R4SA 3MW3A 4PCRA 2DUPA 3V0BB 3CNAA 4LBOA 5EYYA 3R4UA 2PHXA 1OKQA 1W0PA 2Z42A 3AP5A 1AX2A 2DUQA 1CONA 1AX0A 3O0VA 5H9PA 3WV6A 1Q8OA 5GZDA 4D69A 1SACA 1KDMA 1KJRA 3ILRA 1DZQA 2DWRA 1S1AA 5JVVA 3MW2A 1DFQA 2DYCA 5EXOA 2E6VA 1JW6A 1MS5A 1MZ6A 1FYUA 2NM1A 2YXSA 3RQ0A 4XJWA 4Q8LA 4BM8A 5L73A 3SITA 3WDVA 4Y1VA 3NV1A 2ZHKA 4Z8BA 2A3XA 1UAIA 2ZGQA 1IS6A 3WG4A 2WQZC 5H9SA 3VKOA 2R16A 3N35A 2JKBA 3BTAA 1MVQA 2ARXA 1CVNA 2SBAA 2E53A 1MZ5A 2W52A 4Q1PA 4RL7A 1Q8PA 1WLDA 1WW6A 2VU9A 4XTPA 5JOXA 4YG3A 2GMPA 4XMAA 1Z78A 3MW4A 2R1BA 4XHBA 3RMXA 3WDYA 1F9KA 5CA6A 1GNZA 1H9PA 3ZSMA 5IUQA 4YM2A 4ITCA 3AZVA 3UJOA 3WZ1A 2D44A 4ATFA 3USUA 5JOWA 4M3CE 5DG2A 1MS0A 1H9WA 1ULFA 1ZM1A 3N36A 4LBNA 2A5ZA 4PBOA 2I2SA 4HANA 2E51A 2NN8A 2CY6A 4P14A 2NMOA 1LGNA 1QOSA 2YY1A 2DTYA 1LHWA 4GALA 4OZXA 1CIWA 2AGSA 1YI7A 1SLBA 3SNMA 4XJ8A 1CN1A 1RINA 1DQ6A 2NMNA 1APNA 1NLSA 3ENRA 2WSUA 4XBNA 3QLQA 3T2TA 2JD4A 3PVOA 1AVBA 4XTMA 4XJZA 2YV8A 4Y22B 4MYEA 2P3KA 1AXKA 1GANA 4BPZA 1UZZA 3V65A 3LSDA 3I8TA 4BOWA 2WT0A 1Q8VA 2GNDA 5DZFA 2ZACA 3M3CA 3O5SA 4Q8KA 1CQ9A 1WW7A 2C9AA 4FQZA 1S0IA 1N3OA 1S0BA 1WBFA 2UWCA 4LBMA 1Y7BA 1LULA 4JC1A 3GNEA 1SBDA 4F83A 2ARBA 4CTEA 1W6MA 4FP2A 1UPSA 4U36A 3TAYA 4AGGA 4YFZA 3POYA 5JMCA 1AF9A 1FV2A 1QKQA 2A6YA 2A75A 2VH9A 4XOGA 2ENRA 1HQWA 2AREA 4NOTA 3IMNA 5T52A 1HLCA 1HKDA 2B7YA 1DQ4A 3FLTA 3USUB 2ZHNA 4YW3A 2YROA 4ASMB 3T1MA 1BQPA 3ASIA 5T5OA 1ULDA 3INAA 5KXCA 4AYUA 4YZ5A 3OBRA 3RRDA 2DVAA 1LENA 5LK5A 1ENSA 2DU0A 3JU9A 3AXEA 1C4RA 3C2UA 1N47A 4K20A 1G86A 3AZXA 5CAZA 4FPEA 4AVSA 1TEIA 3AK0A 1RIRA 2P37A 2WSVA 4C1WA 2D7FA 2NYYA 3ZXKA 1Q56A 1QGLA 2TEPA 1A8DA 1GZWB 3ZSLA 4AVTA 4JRAA 2JE9A 4Y24A 3TB0A 3WNXA 3IPVA 4YG0A 2JDZA 4YGEA 4Y1ZA 4GKYA 3T1LA 2OUHA 1AXYA 4XIKA 4YGDA 1S0FA 2WT1A 3H0OA 4YLZA 2ZKNA 1KQRA 2ZA9A 1WW5A 2LALA 5KXDA 3VUOA 1SCRA 1FNZA 2A71A 3AYEA 1FAYA 2ES3A 5EYXA 5T55A 3VKNA 3A0NA 1R1ZA 2CWMA 1FNYA 2OW4A 3WUCA 5IK8A 3SISA 1DLLA 3M2MA 2CWSA 3ZPYA 4R9BA 1SLIA 3AP4A 1W6MB 1LHNA 1BKZA 2W68A 5HCBA 3POSA 4LBQD 4YZ4A 2EXKA 3OY8A 4Y20A 5IK5A 3W58A 5JOYA 3O12A 3BIWE 2ZZJA 3HN1A 4Q1RA 2E7QA 2EF6A 2YZ4A 3AZZA 4Q26A 3SLIA 3ZXJA 5KXBA 3AJYA 3AP6A 1MS9A 5GJ6A 1GYKA 3A4UA 3ILFA 2ZGNA 4AGRA 3FLPA 4P9WA 2DTWA 3B3QE 1YO8A 2DVDA 4YW4A 1QNYA 2GNBA 1AXZA 1JYCA 4YGBA 4GWNA 4FPKA 1JOJA 3WVJA 4BQ1A 2JJ6A 3BOPA 1SFYA 2VXRA 2W39A 2D6MA 1MS4A 1ZA4A 4LBQB 4TYSA 3JUUA 4AWDA 1LOAA 3ATGA 4WVVA 3D5OA 1LEMA 4YZ1A 1W6NA 4YW5A 3WUDA 1C57A 1DYPA 5GM0A 5F9TA 2NP0A 1LGCA 1LODA 1G8WA 3OYWA 2GNMA 2OUJA 1LJ7A 5CNAA 3WLUA 5T5JA 1MS8A 2VW2A 5E8AA 2ZMKA 1HQLA 2DURA 2UWBA 1NXD1 1LOFA 5E89A 1G9BA 2ZGTA 4L8QA 1QU0A 1O4YA 5DZGA 4XMIA 2A6VA 1V6LA 4U2AA 3MPPG 2CTVA 3VV1A 1MACA 2D6PA 1N1VA 2PHTA 4XBQA 3ZSKA 5IT6A 3AJZA 5JDBA 1DGLA 4FP3A 3N7LA 3OY8B 4KBBA 5DG1A 1W6QA 3NV2A 4XBLA 2EALA 1AX1A 2H0BA 2AH2A 3WCRA 4FPJA 3Q9OA 3N3HA 1HDKA 2D6KA 3D4KA 4FPYA 4LBJA 2AUYA 4DFSA 5BYNA 4K21A 3O0XA 4UW3A 4GXLA 4Y1XA 3LSEA 1GNHA 3WCSA 2ZABA 4FPLA 1GKBA 5HCAA 4XIOA 1WD4A 4W65A 4DRRA 1LOEA 3B69A 1LU2A 3RG0A 2A70A 1BZWA 2WKKA 5EWSA 1SCSA 2LTNA 5GLUA 2ZBJA 2Q5TA 3NV4A 2ZHMA 3B9CA 3WDWA 2D6NA 1ONAA 2UU8A 3GALA 4YGCA 1KDKA 3FLRA 4ZXKA 1JXNA 1Q8QA 2EAKA 4GWMA 1UMZA 2ZMNA 1AJOA 3HMYA 3OYWB 1WLCA 5E88A 1D0HA 1IKQA 1WUVA 3WDXA 5GZGA 3ZXEA 1DHKB 1G9FA 4WV8A 1VALA 4XE9A 2OVUA 3AZWA 3SH4A 3UL2A 1X50A 4K1ZA 1LHVA 1V6IA 3VKMA 4XZPA 4UW5A 1PZ9A 1F31A 1W0OA 3ZSJA 4RA0A 5FREA 4BMEA 4WVWA 4Q27A 1CPMA 1ULGA 1PZ8A 1QNWA 3V0BA 2AR6A 1CESA 4YM1A 5IK4A 1DBNA 3AP9A 2PHUA 1JN2P 1D2SA 3AFKA 5F5QA 1FV3A 5T54A 2ZMLA 2ZGPA 1MVEA 2D43A 1G9DA 5DUVA 3AYCA 1LCLA 3VKFC 2DV9A 2P3IA 2PELA 2D3SA 1QF3A 1KJLA 4Y1YA 2GALA 1C1FA 1DQ1A 1GZ9A 4IQPA 4R9DA 1JHNA 4XXAA 1OQ1A 4FPHA 2WT2A 4Y1UA 5GLVA 4UW6A 1KRIA 2DVGA 4I30A 4M01A 4FPOB 4AVVA 1V6OA 1CPNA 2VUAA 2ZGLA 4H55A 5FRAA 3RS6A 3N7MA 3AZYA 4WZFA 1VLNA 1ULEA 1W6OA 3WDUA 2EXIA 1UX6A 1GV9A 1KITA 3B01A 2R49A 4XYXA 4P9XA 1DYKA 4FVVA 2V5YA 3SH5A 4TZDA 3FFZA 1PZ7A 1G7YA 2G4IA 3D6EA 3RMYA 1LESA 4Q2FA 4DQAA 3QCWA 3U4XA 2E7TA 4BLIA 4R9AA 1MS3A 1UKGA 1QDOA 1WBLA 3NV3A 3AXDA 4YW1A 2GMMA 1U0AA 2VY0A 2PHWA 2VW1A 4M3CF 1YYNA 4YG6A 1F5FA 3AX4A 1FX5A 1DIWA 5H9RA 4K1YA 1SBFA 3AYAA 4YZ2A 4GA9A 4LBKA 1V6KA 3M3EA 1MR5A 2CYFA 1DQ0A 2V73A 4SLIA 1GSLA 1MS1A 3M3OA 5DXDA 5GLTA 3WG3A 2R0HA 4BMBA 5AVAA 2GDFA 1WW4A 3FUOA 2UWAA
chains in the Genus database with same CATH superfamily
1LOCA 2BNMA 4Q0PA 4XUPA 1AYN2 2D40A 3P6BA 4GB32 4JZRA 3ZXFA 3CQOA 4L0PA 2VTXA 5LBCA 2RMU2 2MPFA 3KZ4C 1YJLA 2A6WA 4ISQA 1BYHA 2JG9A 4ZHNA 3IPVB 5DZEA 3LAGA 4K8RB 4ZS3A 2JE7A 2IXHA 2WO2A 2Y0IA 3AM2A 4K7JA 4AI1A 3H3LA 1RVF1 1BEV2 2QFEA 3VDBA 1PGSA 5I93A 1W6PA 4ZU7A 5KWRA 1C1LA 2JEMA 2BQPA 1W6OB 1HB4A 1OQEA 3ZR6A 2D5HA 1QY4A 2A3WA 2F17A 4AQTA 5BYNA 5K0UA 3TN93 1HB2A 3VDDA 3GJBA 4UFHA 3RYPA 4KU7A 1HRI3 4UW4A 3RVHA 2YBPA 2HWE3 2NZ9A 1NXMA 5A3TA 1GP6A 2TNFA 2N7GA 4FFHA 3R05A 5FUNA 2JE8A 1JZ5A 2JG8A 3OBAA 5LW9A 3UGGA 1URXA 1RTVA 2AYHA 1SLCA 1L3JA 2B5HA 1FMD2 3N7KA 4UF0A 1N1YA 2XPJA 5J3UA 3I2FA 2O8OA 1QQP2 3MUZ1 4J1WA 4ORFA 2ZGUA 5GALA 3AC0A 3WNNA 4E4SA 1ZREA 4AEDB 1S2KA 2YU2A 5FPUA 5A6YA 1VBA2 5IATA 3LOBA 1N1TA 3VL9A 3OOXA 1YRZA 2AENA 3WDWA 2DU1A 5A6ZA 4NPMA 3RNSA 1A6CA 5FBZA 4EE2A 4FFFA 4P00B 5IVBA 4GKXA 4AHYA 3PVNA 4QPIA 3JBG3 4EWAA 4QHOA 5GLWA 5FP8A 1W3VA 1ZNPA 3ST7A 3L2YA 2V5DA 3VN4A 2E32A 3I97A 2Y6JA 1HB3A 3ZYFA 4LTAA 5CG9A 1K3IA 5J7MA 1JOPA 5K4LA 4DUWA 5FO9B 2J1AA 2C24A 3A23A 5J98B 5JXIA 2YFUA 1UW8A 1JBCA 3O1VA 2CAUA 1GLHA 4S2GA 1ZBA3 3IDEA 4ATEA 4M3CB 3BODA 4EWDA 2G1MA 2Y60A 1RUI1 3M1HA 2Y26A 4P5HA 2Y6FA 1DGWX 2XL9A 1EV11 2RDQA 4RGAA 4FOWA 5CEHA 2OPKA 1IS3A 3I3DA 4QGMA 5FXXA 2O8QA 1PM4A 1W6QB 4E4ZA 1DQ5A 5FZ1A 3RJ2X 5BNQA 1VBB3 1D2QA 1FATA 2GP5A 3GZAA 1HQNA 3U07A 1VB4A 4FTSA 5F37A 2RR12 3BTXA 1SBEA 3UK9A 4QX0A 1YIFA 2D6LX 2RE9A 1HV0A 1LOGA 3WNPA 5G04L 5DUXA 1K42A 3GZUC 4OHVA 3S7IA 2PHFA 1ZBE2 3HQUA 4GD4A 1H2NA 4FQ4A 1W90A 5JZGC 2R042 2VQAA 3SCFA 1HRV2 2ZEXA 1AR93 1MEC3 4YM3A 1WWYA 1FOD1 2AACA 1ND2A 5FFOC 5T50A 3RZMA 1PO12 5FJKA 3WHUA 1REFA 1X8EA 4LBQA 3WINE 4ET7A 4MG2A 4WVMA 5KHHA 3ZXLA 4CCKA 5A3LA 1Q8SA 3ZFFA 3HQRA 1TMF1 4HN0A 3IIAA 4EROA 4FT8A 1ZA7A 4MHRA 1WD3A 1J59A 5FUPA 1QMJA 2PLV3 4IGOA 1LTEA 4JGYC 1JZ2A 3H8OA 1IS4A 1N1SA 4UAPA 4NIDA 2P17A 1O6UA 1UY4A 1AYM3 1LHUA 4D8MA 2FHRA 3U37A 4DPNA 2GMEA 3CJXA 4LBLA 4ZPIA 4QKBA 4WM7C 4YRDA 5BPXA 4FI9A 4DXTA 4O9EA 4QKFA 2QKDA 4E4DX 5HBAA 1WLTA 5A7PA 3PIJA 3VBHC 1NZIA 1OPOA 1X7NA 3AKPA 3PVEA 3AKRA 3R4SA 3WY6A 3MF6A 2Q1MA 4BDVB 4CU6A 2DUPA 3S7EA 2WFF1 3OUJA 1UY2A 2YBSA 3R4UA 1OKQA 3AP5A 4TWTA 1AX2A 2DUQA 2K9ZA 1TME3 1OT5A 2Y6LA 4NWVA 4QXBA 5GZDA 1SACA 1KJRA 2DCYA 3ILRA 1JYXA 2DWRA 4ASLA 1DFQA 1UMIA 3TNPB 5EXOA 2EVXA 1PMHX 1S4CA 3FBMA 1JW6A 1MS5A 1FPN1 5FY7A 4OQ9A 1FYUA 1WA4A 1ZYBA 1KXGA 4IEOA 4BM8A 3VBRC 3AMMA 5LK7B 4Y1VA 4Z8BA 1RHI3 2A3XA 2QQUA 2HWD3 4YYOA 3IAPA 1CX1A 3VKOA 2R16A 1J3RA 1NA1B 1NCRA 2YFZA 3OPTA 1LB2A 1AL21 2Q8EA 1DP0A 1CVNA 4I0AA 1ODMA 1RUC1 1JYNA 3U75A 1IPJA 2W52A 1BBT2 4RL7A 4AF9A 2ADEA 1RUD2 1AR73 4XTPA 3WDYA 5CFDA 3MW4A 2XGXA 2RJ2A 4MXWB 5FAXA 1H9PA 2J1VA 5IUQA 1Y9QA 4E8DA 3GZTB 5DQ0A 2D44A 4JGYA 3USUA 5JOWA 5DG2A 1PNGA 1ULFA 2VNGA 3N36A 2WQ8A 4Z92B 1VB2A 2A5ZA 3J9SA 5FCCA 2VZ1A 3C7FA 4R4ZA 3RYRA 2E51A 4MXVA 4QX3A 4P14A 2YPJA 5F6KA 1W9TA 2AGSA 3ROUA 4XJ8A 3NKGA 1CN1A 3UKTA 1RINA 1DQ6A 4Q4W3 4QQLA 1APNA 1NLSA 3ENRA 4A7ZA 3M8LA 5FZAA 4XBNA 2JD4A 1AVBA 1ASJ3 1RUH1 2JDAA 2JG9B 3KGZA 4XUQA 2G9FA 3AFGA 3T08A 1WA6X 4Y5TA 4BPZA 2FDGA 3LSDA 3ACGA 4LK6A 3FN9A 1BVP1 1YQ5A 3I8TA 4CXXA 2VCMA 1Q8VA 4EN6B 4EV0A 4ZXEA 4LLFA 1DGWA 3M3CA 4YVWC 2WFPA 4Z07A 1WW7A 2HYXA 3JXSA 4FQZA 2LROA 3VHPA 3S30A 2UWCA 4MGQA 4CEYC 1Y7BA 4DINB 1Q43A 3E6BA 5K0UB 3VDDB 4F83A 2ARBA 3GBGA 5FJHA 3BCWA 3BKZA 1H8TB 3U0ZA 4A7KA 4XOGA 1QJX1 2ENRA 5T52A 4MGKE 1D0GA 1HKDA 2EIDA 5A1AA 2J7MA 4JDNA 3FLTA 3ORJA 1ZZ9A 3X29B 3VBUB 1BQPA 1OURA 1Y9MA 4M4RA 5A7WB 5BY5A 3ASIA 1B35A 5BNNA 3H1MA 5JSRA 4OLLA 3H8XA 1S2EA 2LS6A 1FOD2 2NQYA 1LENA 1WMEA 4CEWA 3LGRA 3ACFA 5LK5A 4NIGA 4K20A 1CGPA 1G86A 3RJRA 3SCHA 4AVSA 5DAVA 4CU8A 1TMF2 2ZX1A 2WSVA 4FFIA 4QGNA 3VZOA 2QQJA 2VXJA 2ZOEB 5FZ0A 1QGLA 1VBC1 1A8DA 1L7QA 3U10A 5C9AC 5HPOA 3EMRA 3CU7A 3M4FA 3CLPA 2IVIB 3VZJA 2IXIA 2OXBA 5I0RA 3NAPC 5FZLA 3TB0A 2HH9A 2E31A 4GKYA 3T1LA 2OUHA 4XABA 1UY0A 4YGDA 2MHFA 1UZ0A 3HNBM 2ZKNA 3PUSA 1WW5A 5IYYA 2X05A 4OI4A 1FAYA 2ES3A 2W47A 4WBBA 5A6XA 1O8SA 3WUCA 2ZXQA 2BU9A 1DLLA 4NRMA 2D98A 3AMPA 3ACLA 5GKAC 3ZFGC 1Y9GA 2K46A 5HCBA 3L9JT 3VBSA 1H1IA 1QXRA 4LBQD 1Q3EA 2EXKA 3OY8A 5FV3A 1GUIA 5IK5A 3W58A 2AC1A 2OZJA 1VRH1 4QQPA 2ZZJA 2YUEA 2H6CA 1YC61 5FLHA 1W2TA 3AZZA 5KXBA 2WQ4A 1JMUB 1MS9A 4IEWA 1BVVA 3FLPA 4AOCA 4EN0A 4E2SA 5AC91 4CA9A 3C3VA 3B3QE 1GOHA 1KFXL 2C1FA 3THPA 1AXZA 1ND3C 1POQA 4UFKA 1YHFA 3UYJA 1E5SA 2RM23 3ON7A 3FE5A 2EIBA 1RUC2 2XL7A 4FPKA 4IW3A 4QB1A 2W39A 2X5IC 4Y3OA 4YWAA 3WVJA 2HWF2 4LBQB 4IV3A 5FYUA 4Z1VA 4WVMB 1LOAA 3ATGA 3OCPA 1PX3A 3D5OA 4WVVA 4XFAA 2WRAA 1YWKA 1R082 2YYOA 4Q4V1 2O14A 1LODA 1Q5OA 3S6PA 1PMJX 2MNGA 1LJ7A 3B94A 4EN8B 1SPPA 2J1EA 3SC7X 4LORA 3VBOC 2DURA 4QXCA 2JICA 1PHMA 3FL7A 5KHGA 1LOFA 3TWIA 3IT8A 2ZGTA 3ZYIB 1O4YA 3PTRB 4XMIA 5A7SA 1V6LA 1Z7S3 4DEVA 3K2OA 4WM8A 2XBO3 3VV1A 5HV0A 5FY1A 4IEXA 4TLGA 2VQUA 2XVKA 5IT6A 1XU1A 2BNOA 1QJU3 1XNAA 4KWKA 1S2BA 4KBBA 3M7AA 4XUOA 3THCA 2DCZA 2P6HA 3IWZA 1RB8G 1JODA 1RUH2 1AX1A 4N7UA 1D4M1 4MGYE 1EY2A 2W91A 5EP9A 3WCRA 5FQ0A 3Q9OA 3N3HA 5A3OA 3DPRA 3NQHA 2RS11 2XLGA 5FMCA 1DG6A 1GZTA 1RUF3 1XE0A 1ZX5A 1RUG1 2ARCA 2AUYA 4KH9A 1C5IA 4DFSA 5FKBA 4CYDA 3HPNA 1RUJ3 5HCAA 1QJFA 1US2A 4DY5A 1LOEA 2HWC2 1LU2A 2VQ0A 2Y38A 3K46A 4N9HA 5IJRA 1OLMA 1NLQA 1VPHA 2BNNA 3A21A 1NCRB 3GJAA 2LTNA 4HFSA 2Z79A 5FZ3A 5IAXA 3B9CA 4N53C 5EFUA 4JTNA 1GU3A 3FFQA 3FLRA 3MV01 1AJOA 4UXAA 3HMYA 4CVUA 1XSQA 4A7YA 1D0HA 4NHMA 4RQPC 5ACA1 2WN2A 3WDXA 4CP9B 4V1PA 3PU8A 4NWWA 1A34A 4IL7A 4GIQA 2LRPA 1OPMA 4JGYB 1DHKB 4WV8A 4XE9A 1U5ZA 3GYDA 5JUVA 2OVUA 3SH4A 4DUVA 2QCSB 4CCLA 3I59A 4JKLA 3U4SA 2CHHA 2J1TA 2BOJA 4WM7B 1PZ9A 1MQTC 2CU5A 5G05L 3WNKA 2Q8CA 4ZU4A 4RA0A 4BMEA 4Q27A 1S55A 5CFCA 1CAWA 3ME2A 4GQ7A 1GR3A 2I45A 1CESA 2BWCA 3HQXA 4JVAA 3VBFC 1H2LA 2AEYA 4MX3A 1VBC2 3GHNA 3S57A 1JN2P 3AFKA 1FV3A 1NY71 2H6BA 3OUHA 3AYCA 4BQWA 3I2DA 3WEZA 5I0SA 1REEA 4HBNA 4UBGA 2D3SA 4MGZE 2JX9A 2E7AA 3KMHA 2Y33A 1XE8A 3WW1A 1GZ9A 2A1XA 3KHCA 4XXAA 3FHAA 3VZNA 5FPLA 4AVVA 3ZYGA 4FPOB 3THTA 3N9NA 1V6OA 1CPNA 2GH2A 2LW8A 1F15A 2ZGLA 3DV8A 5FRAA 3GM8A 5FYSA 3HJRA 4AI0A 5CADA 5EJ3A 5FOJB 3C8XA 1K5MA 2R073 1VLNA 4KNCA 1W6OA 5FMOL 2EXIA 2WL1A 1UX6A 4UBHA 4B4QA 1NX9A 4E4HA 1KITA 3B01A 2QE3A 4MH0E 1DYKA 1VRH2 2V5YA 4P9XA 4ES9A 1XE7A 4B4PA 4L2NA 1PM7A 3POFA 3B9IA 3RMYA 3BPZA 3U4XA 5E6HA 4KGQA 3GCWA 3ZIWA 4EQVA 5IVYA 4H3WA 4RQPA 5EJ1B 4NIHA 1QDOA 1WBLA 4CDQA 3PJYA 3AXDA 3MUY1 2Z4FA 2GMMA 1UD1A 1U0AA 4H7MA 1STMA 3NNJA 1HV1A 4LKEA 3OD0A 4MO3M 1YQ6A 4G9SB 1W8NA 4AEDA 3LIHA 1F2NA 2HJIA 2CYFA 2V73A 3N9LA 3ITQA 4HKOA 3LA7A 4SLIA 2OYZA 1M4WA 4F7ZA 1AR63 3WG3A 4LO8A 2O1QA 3WSOA 4XACA 1BJQA 4Y4RA 4YARA 2BGCA 1H2KA 4RHV3 4QQOA 4XJAA 3OPZA 5FMOS 4C0BA 1SFNA 2MEV1 5C3SA 2ZGOA 1GP5A 4XXPA 4FOVA 3WDTA 5GZFA 4AGVA 1RUE3 4GB31 4CU7A 2GNTA 2ZGKA 3AMHA 5CISA 1RITA 3NNMA 1VAVA 1V9U3 2BUKA 3SQOA 3W59A 2QQIA 1GZCA 4LT5A 5FZMA 3JCIA 3AVRA 4DNYA 3WP4A 1NT0A 3DYPA 1G9AA 5FYZA 4M3CA 1OXCA 3B00A 3SEPA 2C5DA 3DCQA 2DUOA 4QD2A 2GN7A 4RR3C 1GBGA 3BTYA 4D7TA 1I6XA 5EHDA 1BEV3 2VMHA 4AI2A 3O1TA 4LUMA 4YFWA 4FXGB 1D4M2 2D5FA 5FK7A 3H1YA 2C26A 3KT7A 4NRQA 5LZ6A 3MYXA 3LFMA 1QJY2 2ZHLA 1E5IA 4HK9A 5C5TA 5FZBA 5CBLA 5K7PA 3RZGA 1RUG2 1Z0HA 1WMXA 5EV7A 1ENQA 1VIWB 1W9WA 4PF5A 4CZSA 3MIFA 2WZPP 4A45A 1YNAA 2KM2A 4MVTA 1DYOA 1XQNA 1YLLA 1O4TA 1G9CA 2VAUA 1CJPA 4XJUA 3PMEA 2JDPA 4GMP3 1YEWA 1HXS2 2PA7A 2G9GA 1XRUA 5L36A 3VD3A 2WNEA 3LZZA 4A42A 4Z2WA 3PTYA 5LBEA 3IAQA 5ACA2 1C3HA 2GZWA 4FFGA 2XB6C 4LQRA 1HB1A 1GZWA 4PQQA 2D3PA 2VNVA 5BUVA 2YHJA 3T2OA 3W20A 3IIIA 4UFMA 2W2IA 4ZZ8A 1S0DA 1WLWA 4O61A 5FYYA 2A6XA 3NAPB 5LY1A 3I49A 1AR83 2YGLA 1FXZA 2BOIA 3O0WA 5F1RA 2TBVA 5KXEA 2CGNA 3PNAA 1J3PA 2HWB3 4MGSA 3K3OA 4WM8B 2DVBA 5FUIA 3MFCA 3FUQA 4RGKA 1PO23 4AQ6A 3VKLA 1QHDA 3SH3A 5FP4A 2AEZA 1F35A 1BXHA 1NOVA 2RHPA 2XG3A 4PIZA 4BQYA 1O4ZA 2E26A 3ZFGB 3BTZA 2X10A 2Y34A 2ZGRA 3HR9A 3DPRB 5HCHA 1QOTA 3CZJA 4QPGC 2A6ZA 3MEPA 2WZR3 1DF0A 4PLNA 5CYYA 4BLJA 3V64A 1OF4A 3ZLIA 2RR11 3E5QA 1NKGA 5F3IA 1X9TA 1ZRIA 4AI3A 4CDWA 1JYIA 2FD8A 4Q4X1 1OQDA 5CG8A 3S0MA 1EUUA 5FZCA 4JKKA 4UFLA 1LEDA 1W99A 3LCPA 1JYWA 4CCEA 2WO7A 2B9VA 2PHRA 3E5UA 3KVBA 4IEVA 2RDRA 1O91A 2VM9A 1ND3B 1SMVA 1J83A 1UXXX 1O7FA 2VUCA 2ZEYA 3DKQA 4LO7A 4FOQA 3GHMA 5ANQA 4Y26A 5C7GA 5FO8B 2R041 2ET1A 5KC6A 1HRV1 2VVEA 2XLAA 1V6JA 1JZ6A 2XJTA 1S0CA 4OFGA 5IWFA 2A7AA 1PO11 1JI6A 4IE6A 3O1PA 2PFWA 3T09A 3ZO0B 4DXZA 4PF1A 2VL4A 1PVC1 1DGRA 3R0RA 4OMCA 1C8M1 1BHGA 4MXWA 4OULA 2UURA 1W2NA 4NJ4A 4QQ2A 2RS33 3AYDA 5K9YA 4EZ4A 3I59B 5LBFA 1H6YA 1V6NA 4QX2A 5JLVA 3I2KA 2RS51 2VBDA 1OFSA 4DO0A 3S5AA 3RGBA 3P1IA 3T4VA 3MFAA 2W3JA 1COV3 2PHXA 4BA6A 4MV2A 2MEV2 5LRRA 4AQSA 2YG0A 4NHYA 1UOGA 4AEKA 1OC1A 2Z42A 5EIYB 2WWSA 3CIHA 3HD8B 1AX0A 1W28A 1UOFA 2A73B 4AVBA 3FX3A 1KDMA 3VD9A 3PUAA 2OX0A 4M0HA 5FPZA 1DZQA 4I09A 5A3UA 1S1AA 2W9XA 4QU1A 4UFJA 5EZWA 2DBIA 5LATA 5A80A 2BZDA 2ADDA 4LNVA 2VGDA 2BVVA 4Q8LA 3VZKA 5L73A 4AEMA 1CJDA 3IBMA 2ET7A 3NV1A 2ZHKA 1UAIA 2ZGQA 3WG4A 2JIGA 1RVF3 1YCIA 1K5MB 1JU4A 4TTGA 2OZ6A 1W8UA 2CGOA 1J1LA 1SZBA 2E63A 3JD72 3K4DA 3U78A 4N53B 4SBVA 4XF1A 1WLDA 1H8TA 1WW6A 4IV1C 1A8MA 1VMJA 1FI2A 1Z78A 5JXHA 1BBT1 4AFCA 4GWJA 4BXSV 5JXGA 5LA9A 1GNZA 1U12A 1RUD1 2ILMA 2X09A 5A70A 4RQPB 5FZOA 4KGGA 3UGFA 3AZVA 1OD3A 3KCYA 4CDQB 1UWWA 2WAOA 3NVCA 4O7XA 3ZSEA 4BQ5A 1ZM1A 4EWEA 1IG3A 3VZLA 3VBUA 5A7WA 4AVCA 5KHJA 3TN91 1UIKA 3FHQA 4PBOA 4HANA 3TEXA 1HRI1 1NE6A 2NN8A 1KS5A 3UNPA 2Q30A 4RFRB 4I01A 1MQTB 4JKMA 2ZEZA 2DTYA 1CZTA 1Y43B 4UWDA 5LA0A 5BV6A 3KHBA 1SLBA 1OD5A 5FLJA 2NMNA 2O0OA 4XW3A 3N4MA 4OI2A 1K5JA 2BFUL 3QLQA 2JKXA 3PVOA 4XUTA 3SXWA 2YV8A 3CZUA 3RYKA 5ABJC 1GANA 4BQ2A 3HOBA 4HETA 5E16A 1LAJA 2WT0A 2GNDA 5DZFA 4GH4C 4H2AA 4RYDA 1CQ9A 5L9BA 2C9AA 3JB8A 2DFBA 2VZUA 4IGPA 4PT6A 3SMHA 5I8SA 4Q0UA 1LULA 4JC1A 3GNEA 5L19A 1RUI3 4QPYA 5FYCA 3BU7A 4AGGA 4YFZA 1EV13 1OVPA 5IVEA 4NMIA 3CKHA 2VZOA 2E9QA 3UKNA 1QKQA 2A75A 2UYAA 1GQHA 3IMNA 4XCBA 1HLCA 1DQ4A 5M0TA 1DDLA 2ZHNA 4Q4X2 1R092 2YROA 4IERA 3T1MA 3RWKX 3MDPA 2PAMA 4YPJA 1IPSA 4GAZA 1ULDA 3INAA 4IEUA 4K9SA 4XFHA 3WP3A 3E6CC 5LCWL 2ORZA 3Q8FA 4INDA 3SKVA 4QHBA 5J48A 5J36A 1ENSA 2DU0A 3JU9A 1VBB1 2ZTNA 5JSPA 1N47A 4BK4A 1HN1A 4CDXC 4CCCA 3AK0A 1RIRA 5E1RA 3LF7A 4C1WA 2D7FA 1PVC2 4MADA 3KCCA 3ZXKA 1C8M2 1RMU2 1GZWB 3ZSLA 5FZFA 3EO6A 2JE9A 3ZOIA 3O14A 4B29A 1QJEA 3ZIXA 2Z5WA 2W95A 2X8KA 4Y1ZA 3NSTA 4YGEA 3OTFA 3QH7A 1UPIA 2B4KA 2RS52 1AR91 2XJQA 1CAXB 1KQRA 2LALA 4RS5C 2IXJA 5A1LA 5ABJA 1PIV2 1SCRA 2A71A 4QHZA 2WUHA 3VKNA 5T55A 4CCOA 3B93A 1PK6C 2VBPA 2OW4A 5IK8A 4N43C 3M2MA 4COZA 2BVBA 5B4XA 4URAA 2RJLA 3KGLA 1W04A 1LHNA 1W6MB 1BKZA 1GWKA 2FZ2A 4OVEA 2RJKA 2PLV1 4RR3B 2WFF3 1OH3A 1ZZCA 1UZVA 4CUGA 2GSYA 5FBJA 2R7EB 3ZXAC 1H4HA 3BIWE 5JCTA 3HN1A 1UF2C 2QQWA 4Q1RA 4S2FA 2JDNA 2YZ4A 3SLIA 2XWBB 3J7MA 3AP6A 5FOBB 3A4UA 3ILFA 5AVPA 4AGRA 4CDWB 1F8VA 2XUEA 5FY4A 2IUWA 5IFPA 1FPN3 1W05A 5FY9A 3TOJA 1ZRFA 1YO8A 1QNYA 4NAOA 5I8YA 3J8F3 1VBE3 4LEJA 4XPVA 4GWNA 2VZQA 4OUSA 1JOJA 1GP4A 2XHKA 2JJ6A 2VOWA 1SFYA 3DL3A 3H3ZA 2D6MA 5K8SA 5CKMA 3PL0A 1MS4A 2ZKLA 3VZMA 4AWDA 2QQPA 5L9VA 5JZGA 1AL23 5KC5A 5FYTA 4RFT0 4D0QA 4I0WB 4Q4Y3 4COYA 4CDXA 3O1UA 2HWF1 2YDEA 3WUDA 4PJYA 5FY0A 5F9TA 4BB3A 3AKTA 1XYNA 1W2AX 4PLMA 2OUJA 5ANNA 1R081 1RHI1 2Y8KA 1ZZ8A 4KWLA 4R4XA 4R8HA 1SEFA 2RDNA 3VD7A 4CP9A 1ZRDA 3BI3A 3TN92 2UWBA 1E5HA 3I54A 2BJSA 1HRI2 4RGGA 3MIBA 2VD7A 2AZ5A 1JYVA 2HWE2 3W5NA 4COWA 5LEJA 4NAMA 5CIRA 2QQKA 4WM7A 4QB6A 3E5XA 3NJZA 4A41A 2PHTA 2BP6A 3VBHA 1DGLA 2WWJA 5EJZB 5DG1A 3LDRA 1M06G 2HEYF 1XB9A 3ETPA 4XBLA 4XFGA 4MOAA 1HJFA 2R063 1VBD3 4H14A 4URTA 4B7EA 4FPJA 4XDOA 1L7LA 3UESA 3POIA 1HDKA 3P3PA 4MHUA 4P5YA 3LOIA 2P5BA 2IXKA 4TN7A 5DDJ3 1QXJA 4UW3A 2QDRA 4Y1XA 2ZABA 4QPGB 1OFNA 4FPLA 4PLOA 4XIOA 1W8TA 3JBG2 3URFA 3RI8A 4IEPA 2A70A 4GMP0 4PIXA 1GQGA 1FT9A 1SCSA 1WMDA 4LUKA 3VBRA 5GLUA 4N8MA 3JQWA 2ZBJA 2HWC1 2Q5TA 2BW8A 3NV4A 4LK7A 2VMIA 2W1SA 2XJRA 1ASJ1 1KDKA 2NPIA 1G6NA 1JXNA 3QBQA 4J25A 4HMZA 1O3RA 3OYWB 1WLCA 2JD9A 5LEKA 2JWPA 1V70A 1ZBA2 3DXUA 3SCGA 5F3EA 1MZEA 4BHPA 5FZOB 5GZGA 5HXMA 1H2MA 1QJX3 1R1A3 3OPWA 2W46A 4OHYA 1VALA 2XONA 1F4AA 3PURA 4XFIA 3P5BA 1V6IA 4XC9A 1VBB2 2OA2A 4CCJA 4C8DA 2XHNA 4K6BA 3ZMOA 4CDUC 4DIQA 4WVWA 4E9KA 1CPMA 1PZ8A 4L97A 4ONUA 1D4VB 2HEWF 3QACA 1VE0A 3V0AB 5F5QA 4LHNA 2TUNA 5JR2A 4LO6B 4N7IA 1OKOA 3EHKA 2GC0A 1BK0A 2ZPXA 1XYOA 3LKJA 4OYUA 4X8NA 1LCLA 4XQWA 3RPQA 2DV9A 2PELA 4W4ZA 4EJRA 1QF3A 1ALYA 1AR92 1MEC2 1NQJA 1DQ1A 2VOVA 1Y4WA 3H9AA 1JHNA 1JTZX 1OQ1A 4FPHA 2BGOA 1TG7A 4UW6A 5L7OC 3AKQA 3RS6A 1RC6A 1W06A 1K45A 5BNOC 3LDBA 3HNMA 2PLV2 2DCJA 5D8AC 4YVWA 3WDUA 4EYUA 1EP0A 5LA2A 5FK8A 1AYM2 1ZVFA 2X53S 2R49A 3NKTA 3HEIA 4XYXA 4FVVA 4CEYA 2XMLA 1PZ7A 1J58A 1UYZA 4LE4A 1LESA 4DQAA 3QCWA 4IV1B 1ZZBA 1XXNA 2XJVA 1UYXA 3NV3A 3POJA 4GULA 3NRUA 3M3IA 2VY0A 1O5LA 3CBNA 1X82A 3Q8EA 1DIWA 1PGW1 3GBFA 4K1YA 4YZ2A 1TME2 4LR4A 2IC1A 2QJVA 2XXZA 1MR5A 2VPVA 1OLRA 5AC93 4BCUA 1W2OA 5FYIA 3M3OA 1MS1A 2B8MA 5DXDA 4A44A 3KT1A 1W39A 1IQAA 3DEMA 2GDFA 4QB2A 4PI0A 1WW4A 5AVAA 2UWAA 3C2UA 3E97A 3OB8A 4KBZA 5F5IA 4CSWA 1EAH3 1OLQA 3DGTA 3FJSA 2VMDA 1ULCA 2BEOA 4B8EA 1RHI2 4G4FA 2WNVC 3I3QA 1OOPC 2HWD2 2DDUA 4Q4V3 1NZCA 4BH9A 4MGTA 5C9AA 1QOOA 2ZGMA 4HL0A 3LEMA 1SLAA 2WNUC 3J7HA 3OGVA 5FIXA 3TBDA 3I7DA 1HX6A 5ABJB 3NAPA 2PAEA 5CU1A 3N7JA 2VCBA 1L7RA 5KHKA 2P1BA 1AR72 4JHZA 3OGSA 5FYBA 1LU1A 1N3QA 1VAMA 2VW0A 5DAXA 2WJSA 5FZ6A 4PBPA 2OKXA 1KFUL 3BN6A 2QBXA 2WABA 3QOPA 4OUMA 5D8AA 5AFEA 4V2WA 2YC0A 3ZFGA 2YPDA 2XKPA 1GOFA 2BYVE 2XH6A 1XNKA 2ZX3A 2A3YA 3DUIA 5ERLA 4M00A 4DOUA 4ZKTB 1QJY1 1RYYA 2P34A 5GLZA 5JIUA 1JUIA 2EXJA 3NNLA 4ZY9A 5SV8A 2RS13 3WNMA 1E57A 3I2IA 4QQHA 2LUWA 2R1DA 3FMGA 1LHOA 2ETEA 5FZKA 3O1MA 1VJ2A 3DN7A 4HSLA 4AG4A 2WWUA 1IZ3A 1QJU1 4LHLA 4Q4W2 5JAXA 1RUNA 2YMZA 5HI0A 2CDPA 4P08A 1ASJ2 2ZEWA 2D6OX 3UJQA 3VHRA 1W03A 2IXLA 1ND3A 5JZGB 3SHRA 1W9SA 2DVFA 3V0AA 3K4ZA 4CDXB 2W1UA 4ZONA 4CXYA 1HXS1 2FMDA 2X5IA 1O5UA 3HIFA 2DCKA 1J1TA 2KD7A 3JQXA 4I2OA 2Y6KA 3OGGA 3OBTA 1P8JA 2NLRA 2VMGA 1AJKA 4IGQA 4OHXA 3GXUA 4V2VA 5KR7A 5SV5A 4BIFA 4AFBA 2P6CA 5GZCA 3C7OA 3VBOA 3ILNA 4CRQA 4JGZC 3K77A 4MGIE 1ENXA 2VR4A 4FTBA 2I07B 5B4NA 2R0FA 4EZHA 1PK6B 3IZOA 3VBHB 5FP9A 5I91A 2IFWA 2PTMA 4FPCA 5F2WA 3FZ3A 3TYJA 1G9DA 2ERFA 4XUNA 1YFXA 4YW2A 1ENRA 3WHTA 2G9ZA 5T5LA 4HLTA 4Q0VA 1Y3TA 1YJKA 2VBBA 3ZKYA 3IM0A 4FOYA 3NWKA 1U5XA 2XOMA 4D7SA 4XHXA 1WZXA 1SLTA 4AVAA 3HBKA 2ZGSA 1OSGA 4DXSA 4XFCA 1W2UA 3GCXA 2CNAA 2QNKA 2SLIA 2W87A 4YSFA 3VBRB 3I4IA 3A0KA 3IKWA 2XR4A 3KQRA 4FPGA 3Q8BA 4E8CA 2XKOA 4IXLA 2ATFA 3K75B 4K8FA 1LECA 4JTOA 3VL8A 4B1MA 1UZWA 1W8FA 1C28A 2RV9A 4N53A 2IXCA 2KA3A 2QDNA 3PUQA 4B3NA 2IZWA 3LPFA 3DXTA 4BQ4A 2CL2A 1LRHA 3POWA 4XFFA 5D2AA 2BBVA 1H8VA 2UYBA 1GNYA 4ARYA 1BCXA 2WS93 3ZDVA 3RZKA 3UKVA 2EIEA 4JX0A 1QDCA 4OMDA 1PGW2 4RN5A 4BXFA 4BYYA 1ST8A 1UKRA 3WP5A 5F3CA 2YC4A 2VJXA 1WCDJ 4LHKA 2WC2A 4IE4A 5AFBA 4OI1A 1QEXA 3MW3A 2HBTA 2V72A 3CNAA 3KT4A 4LBOA 2PYTA 1MQTA 5FP7A 5C3PA 1J84A 5JWPA 5ISLA 3F2ZA 1UU6A 4AZZA 1CONA 3CMGA 3HNYM 5H9PA 3VBFA 3WV6A 5L9RA 1CAUB 2ZS6B 3HT1A 4D69A 4XZUG 3MW2A 2DYCA 2FMYA 4KMQA 2EICA 2RM22 3J26N 1WCKA 2NM1A 1GWLA 1XNBA 1AYN3 3RQ0A 4QX7A 4CXWA 5F5CA 4GB33 3SITA 1REDA 1UX7A 3WDVA 3POBA 2RMU3 1CD3G 1IGOA 4FCAA 2J1SA 1IS6A 5H9SA 1X9PA 1YIPA 3USSA 2JKBA 1UU5A 3D82A 1GMMA 2ARXA 2L9LA 2V09A 4YVWB 1VMFA 2SBAA 3EQEA 2E53A 4AFDA 3UT0A 4CEYB 3KV9A 4MLOA 3CJIC 1RJ7A 2VU9A 3KQ4B 5JOXA 3OD4A 5F3GA 3DKWA 1V9U1 2R1BA 1VAKA 3JD71 3RMXA 1F9KA 1H4GA 4MUVA 1J3QA 4B7KA 5CA6A 2VZPA 2EAAA 3ZSMA 1Z7S2 4ITCA 1NCQC 5A3WA 2XBO2 4E27A 3WZ1A 3GZEA 3NMBA 2ZX0A 4CPBA 1I5PA 2VULA 2FBEA 1LR5A 1MS0A 1QJU2 2LM3A 3MIDA 1XYPA 2XUMA 1OI6A 2XVGA 4LBNA 3K48A 4W6WA 4LHSA 4UYBA 4AFAA 2Z2SB 3NW4A 1FMD3 2VMCA 2QQMA 2NMOA 1LGNA 2YY1A 4GALA 1ACCA 4OZXA 1QQP3 1RUF2 3KV5A 2I74A 3C7HA 4CDUB 1YI7A 3SNMA 1VBA3 2P4EA 1RUJ2 1RXGA 4CE8A 4LOSA 2WSUA 3VD4A 3PDQA 3T2TA 2IWGB 5JMOA 3ZXDA 5A7NA 4AHXA 1OHFA 4XTMA 1HW5A 5C9AB 4MYEA 4AAPA 1AXKA 1PVXA 3CEWA 1DZRA 1WKYA 4NHLA 5FXWA 5BXXA 4AFMA 5FY8A 3I3EA 2H0VA 2QQOA 4AK3A 5LBBA 4GMP1 1KD7A 2VMFA 1CAXA 1W3XA 4QX5A 3PLQA 4META 2BRTA 2PMWB 4G3YC 4I0BA 1S0BA 4QM8A 1HIXA 2WAAA 4LBMA 3VDAA 1F4HA 4UT5A 1SBDA 3WD5A 1QIQA 1W6MA 5BNOB 4FP2A 3AB0A 3TAYA 4F3JA 1ZZ6A 4JQRA 5D8AB 1OH4A 3WF4A 3H8RA 2WR9A 1XU2A 2VZVA 4RR3A 3WQ0A 3WXPA 1AF9A 2OT7A 5A32B 4LLOA 2A6YA 2WLPA 2VH9A 1HQWA 2AREA 3CJIA 3JB4C 3OUIA 1POV3 3AKSA 2HWB1 2VE1A 3MLKA 3PHMA 4FTEA 2GC2A 4NROA 5T5OA 4HXCA 3GDBA 5KXCA 4YZ5A 1R091 2RR13 3E1F1 1OMIA 3OGRA 2DVAA 3MIGA 3IDCB 2Y6HA 4CUBA 4DB5A 5TSWA 1QXPA 4GWIA 1CWPA 3T2QA 4C90A 1CX4A 4D7YA 3AZXA 4CCNA 4FPEA 5IHRA 1UXZA 1TEIA 5FZDA 2F4PA 5FP3A 2P37A 1ZBE3 3PIGA 4N90A 3D0JA 2X5IB 2W1WA 2JG9C 5IAVA 4NE9A 5FPXA 2TEPA 2R043 4LIVA 2ZX4A 4AVTA 1HRV3 5F7UA 5A3NA 2PHDA 1PO13 1SFPA 4Y24A 5IVVA 1RMU1 4CUAA 2QQNA 1KEXA 3J7NA 1OOPB 3EXUA 2JDZA 4YG0A 3WNXA 4E2GA 2R072 2ORXA 1AXYA 4XIKA 1UY3A 1S0FA 3H0OA 1PGL2 4YLZA 2ZA9A 3VUOA 4JDOA 4PIYA 4AL9A 1FNZA 3VBOB 5K0UC 1W8ZA 3N9OA 3A0NA 3SISA 4B1LA 1PIV1 4R9BA 4XDPA 4AEJA 5EQUA 1OA4A 3VGIA 2P3YA 4DZGA 4YZ4A 4XVHA 3MLLA 2JG8C 4NVPA 4A6OA 4Y20A 5JI9A 5FPAA 1U5IA 5JOYA 1CAVB 1XPWA 2RS31 2W0XA 3ZYHA 2C6SA 2E7QA 2EF6A 2PHLA 1ODNA 4Q26A 5FPVA 2VNRA 4XF9A 1AR62 4L99A 1X8MA 2XJSA 5LB6A 2XLFA 4QPGA 4RHV2 1K12A 2GAUA 2DTWA 3KV6A 2DVDA 4K3UA 4LIUA 5FMDA 4NR1A 4CP1A 3HAGA 1JYCA 2GP3A 2IVJA 4QPIC 2F6BA 3TRSB 3OEBA 1JOBA 4BQ1A 3RZLA 4AW7A 1RUE2 1XNDA 2VXRA 2Q1FA 2WYFA 1ZA4A 3VHNA 3JUUA 1LKNA 2Y64A 1LEMA 3FC0A 1W6NA 4IE0A 1V9U2 2HLEA 2YB7A 4EN7B 3J4UH 4P9LA 3P3NA 4Y5SA 1DYPA 2NP0A 1LGCA 4QKNA 1G8WA 3OYWA 4UOJA 5F6LB 2GNMA 4XCAA 3O1OA 3N9PA 4UI9L 4W50A 3WLUA 5JSOA 1BBT3 1MS8A 2VW2A 5E8AA 3VDCA 1HQLA 3D3AA 1RUD3 3RDIA 3THDA 4FO9A 1ZRCA 1UOBA 2E33A 4P02B 1EUTA 5E89A 3WW4A 4L8QA 1G9BA 1QU0A 5F39A 2WA3A 3ZN6B 3H3UA 2A6VA 1X36A 3MPPG 3MF9A 5J09A 4OI0A 3CF6E 1MACA 2D6PA 1UCXA 2HWE1 3OG2A 4JGZB 4E2QA 3ZSKA 1LNSA 3ACIA 1JYTA 4QU2A 3WR0A 4HN1A 5T3NA 3K51A 3N7LA 3WNOA 4J6GA 4Q5OA 4IDZA 3O1SA 3HN3A 3NV2A 3I2OA 3VBFB 2EALA 2H0BA 5C71A 5FXVA 4LBJA 3IDBB 2QTWB 4K21A 3M70A 4GXLA 4LULA 1GNHA 1U5YA 3WCSA 1GKBA 3LD8A 4RSUA 4CPBD 4W65A 3I2GA 3B69A 5FZ8A 3EYPA 3ZMNA 3RG0A 1ND2C 4FXKB 4ARXA 4OUEA 1BZWA 5EWSA 4I3GA 3A22A 2J42A 3JBG1 3LDKA 3K4AA 5J1XA 3ZFFC 2ZHMA 3AL6A 1XNCA 4FSJA 4HZFA 1ONAA 2OQ6A 2UU8A 4YGCA 4BQXA 4ZXKA 1BK1A 1Q8QA 2EAKA 3Q8CA 3ZX7A 2ZMNA 1AR82 1JZ4A 5E88A 4LE3A 2W92A 2HWB2 4D3WA 4KI5M 1W8WA 1ZZ7A 2BGPA 3B02A 1H1MA 1R64A 4IV1A 1ZBA1 1PO22 2BFUS 1AUYA 2VNOA 3LQCA 1G9FA 3ZXEA 3SEEA 1X50A 4K1ZA 5C3QA 5EPAA 1EPZA 2FDFA 4XZPA 5C5UA 3N9MA 4GZ9A 2CGPA 3ZSJA 4P9GA 5CZKA 1ULGA 3UGHA 2KR2A 3OEAA 2AR6A 3V0BA 2J1RA 4YM1A 2WZR2 1T6BX 3LWCA 2PHUA 1D2SA 3OGJA 1H1AA 1FOD3 1MVEA 1SQ4A 1W8HA 3TEYA 3H7JA 5I0UA 1IPKA 4H7LA 1TMF3 2W5FA 2GALA 3WW3A 1C1FA 3GBWA 4L9BA 3I3BA 4AI8A 1O3SA 1NCRC 1OA2A 4LMFA 5DMYA 1I9RA 4Y1UA 4WVZA 5GLVA 1MEC1 1OUXA 2DVGA 2JDUA 3LEGA 4GJYA 3AMQA 4I30A 4HVQA 4N9IA 5C33A 4H55A 1V0AA 1CZVA 3BALA 3I2JA 3KS7A 5JXJA 2V4AA 3ZYJB 3WQ7A 2VZRA 2B9UA 4GH4A 1XSRA 2UY8A 2FCVA 1BMV1 3N9QA 1GV9A 3KD4A 5CFDC 2WN3A 4JHTA 3SH5A 2QZ2A 2RS32 3OBZA 3FFZA 3ZXGA 1UMHA 1G7YA 1AYM1 4QDRA 1JU3A 3CJIB 4BU2A 5J96B 2E7TA 3LEIA 5CKQA 1O3TA 2R6QA 1MS3A 3W5MA 2Y6GA 3PVBB 2QZ3A 1SG3A 1MPXA 3ES1A 3B7MA 1COV2 2PHWA 1NCQB 4M3CF 4LA3A 4DUXA 1F5FA 5H9RA 3BUCA 1SBFA 3AYAA 4OHWA 5A33A 3QD6A 1V6KA 1DQ0A 1GSLA 5GLTA 2R0HA 1T6GC 1TME1 4NN0A 4QKDA 2JENA 1O3QA 3ZYPA 2HEVF 4KG0A 3ES4A 3MIEA 4QMAA 1GICA 1SLLA 2ZAAA 3ZFEC 4XF4A 5F5AA 1RUC3 4XJ9A 2XDVA 2HWF3 4HOOA 4PDWC 4QPWA 1RVF2 1I3HA 1EPWA 3NJYA 3WOGA 4Y22A 3J8F1 2QUOA 1VBE1 1B09A 2HWD1 3NJVA 2VECA 1NAEA 3R6SA 4AXOA 5I8TA 1GWMA 2OIIA 1R083 5FZIA 4DRVA 4DY3A 2Q8DA 3T0AA 2CDOA 1XBFA 4OHZA 4A6SA 1JUHA 5HV4A 3RZHA 2WZ8A 3ZVXA 3T0DA 1IHMA 4Q4Y1 4LO5B 4I02A 4RS5A 1V6MA 5HCFA 1AL0G 2FDKA 2X29A 2JECA 5FZ4A 5GZEA 3PUHA 1AR71 2VOKA 1PK6A 3ELNA 3MV11 3MBWA 3VB9A 1VRBA 5FZ9A 1IKPA 4N43A 3RSJA 3OSDA 5H9QA 3KF5A 2XVLA 4Y20B 2FQPA 1XC6A 2DBNA 3J7LA 4ISRA 1H30A 4DXRA 3AP7A 4IESA 4D94A 4PQ9A 4Y5Z0 1X33A 3CDZB 3EBRA 4HVOA 1B35C 5BNNC 2JB8A 2BV4A 1UZYA 2P2KA 2VCCA 4AYUA 3WNLA 3KM5A 2EXHA 4DS0A 3PMSA 4CEWC 1RUH3 4QT6A 5JPNB 3OJBA 2W08A 1EYBA 2VQTA 3M3QA 4HPKA 1I1EA 2VZ3A 1MZFA 2FCUA 5JOZA 2VZSA 1V00A 1S0EA 1XNTA 2GN3A 2R061 1VBD1 4Q4W1 3WG1A 3NJXA 2HYKA 1XJAA 1O8PA 1W6NB 2HWC3 1NE4A 1DQ2A 3DECA 3H1WA 4WZCA 5DDJ1 1VR3A 2QVSB 3ZFEA 1D7PM 3T3YA 2BDRA 5DUUA 4C1XA 1KGYA 4L92A 4X8PA 4A4AA 1OLME 2VG9A 5IW0A 3TEZA 2JIJA 1RUI2 2VZTA 2C4XA 4PDWA 5B2GB 1QH6A 1W6PB 3WG2A 2VTXJ 3APBA 5DAPA 1EV12 3U11A 3ZYRA 4XDQA 1O59A 3VBSC 4JRLA 4QDSA 1UQXA 3HVDA 3MLJA 4R9CA 4YM0A 5C3OA 3WF2A 1LGBA 1UYPA 4NRPA 4W8JA 4YW6A 3I2HA 4AI9A 4YW7A 1S0GA 4NO4A 1A78A 2DFCA 1S0JA 1OA3A 1POV0 2OPWA 1R1A1 2G19A 1AZDA 3KWVA 4XILA 2JG8B 4P9YA 1CAUA 2WA4A 1IOAA 3LB9A 4UF0B 4QX1A 3ZKUA 1UN1A 1VBC3 4EN9B 4D6RA 2KXLA 2B45X 1WCSA 1LOBA 1UL9A 4AAXA 5CB7A 3WP6A 5I0DA 4M4PA 3T4HB 3G6JB 4HKWA 5FMBA 4JCKA 3FHIB 2PXJA 4IV3C 3KSCA 2Q0AA 1BMV2 2DCTA 4TLFA 5C4WC 3HT2A 1TNRA 4QPIB 2D3RA 3FBYA 5C8CC 1A3KA 5C8WA 5IK7A 5I0TA 4LKDA 4OQ8A 5FR3A 5FZGA 2EIGA 4YNIA 4YZ3A 1JHJA 4FPFA 1IS5A 1YXWA 3PU3A 5DUWA 1YFYA 2Q4SA 2WLQA 3VHOA 3PJQA 4IE5A 2P3JA 4BK5A 2ZCWA 2XJPA 2F4LA 1LOFC 1VRH3 4KQ7A 5T5PA 5FYHA 1CR7A 2VC9A 4IUGA 4WM8C 2GH8A 4IETA 2WFF2 5LA1A 1N3PA 3IN9A 3WF0A 4XQDA 4LXLA 3BVCA 4PCRA 3BB6A 1PMIA 2HBUA 3V0BB 5EYYA 2OS2A 1W8OA 5D1IA 5F8PA 1XOYA 3WX5A 1W0PA 4CDUA 3DPRC 4KWJA 2Z69A 3O0VA 2XJUA 1Q8OA 1FPN2 4ASKA 4XF0A 5FYMA 2B39A 5JVVA 3J8F2 1VBE2 2BERA 5A1FA 2YGMA 3BIEA 2E6VA 1OBNA 3K3NA 3IB3A 1MZ6A 4F8AA 2YXSA 2FZ1A 4XJWA 5LY2A 3U14A 5BNPC 4ZZ5A 2RM21 3GF6A 1AL22 4Q4Y2 4CU9A 1NLRA 1OVSA 4YVSC 4K40A 2WQZC 1NG0A 2XWJB 4HONA 4S2DA 3N35A 3L2HA 1BLZA 1EAH1 1SHWB 5FO7B 1ND2B 1GQPA 4A2UA 3POEA 4GH4B 3BTAA 4HKLA 1MVQA 5L7OA 3ZDSA 2BBAA 2VVDA 5C4WA 3ZFFB 4CCMA 1MZ5A 4Q1PA 2B46X 3C7GA 2FDJA 1Q8PA 2RVAA 3BPSA 2ZJCA 4PHZA 3T30A 3NO8A 5BNOA 4KWUA 3ACHA 2GU9A 2GMPA 4XMAA 4YG3A 4QXHA 4XHBA 5C8CA 5A32A 1UYYA 5IVJA 4YM2A 3WF3A 1D4M3 2RG4A 4XAAA 3UJOA 1AHSA 4ATFA 4M3CE 2R32A 1QJY3 1H9WA 4D6SA 1Z7S1 3LIGA 5A3PA 3FWEA 4HT1T 1YQ8A 2XBO1 5FPBA 1RUG3 2RDSA 3WF1A 5A33B 5CFCC 5KXDA 2I2SA 5CKNA 2R062 1VBD2 1NQDA 4XURA 3TNQA 4QM9A 2CY6A 2QQVA 3H7YA 4I3PA 4C91A 4Y4YA 2JDKA 2FCTA 1QOSA 1LHWA 5DDJ2 1CIWA 1I5ZA 3A7QA 1YQCA 2WNOA 2WIIB 4O9GA 1RUF1 1UOJA 3ABZA 1H0BA 2VTFA 1ULOA 3DYMA 3NNGA 1HXS3 5J37A 3I3MA 5C3RA 1RUJ1 4XJZA 2OQ7A 4Y22B 1SDDB 2P3KA 3C7EA 5D21A 2WNVA 5ACA3 1UZZA 1CIYA 1OOPA 3LEKA 3MIHA 4LPLA 3V65A 5FLIA 4BOWA 4ZS2A 4CP2A 1K5MC 3JZVA 2JDHA 3LE0A 2ZACA 4NPLA 3O5SA 5A7OA 3WQ1A 4Q8KA 5BNPA 2WNUA 4NIAA 2QQLA 3KF3A 1S0IA 1N3OA 4RS5B 1WBFA 2EA7A 4CUCA 1SDWA 5CVRA 4BQ3A 1GOGA 2VCAA 4YVSA 2PAKA 1TE1B 4N43B 4CTEA 4FAHA 5KBFA 1UPSA 1QJX2 1R1A2 4U36A 3POYA 5JMCA 4HK8A 3POGA 4NHXA 5CFDB 4XEZA 1QWRA 4TXWA 1FV2A 2WO3A 5DN2A 4CDQC 4QGLA 1JZ3A 4NOTA 1UO9A 1UY1A 1CAVA 4P9IA 2B7YA 3WQBA 3USUB 2JB4A 3LA3A 4YW3A 4AEDC 2W1QA 4ASMB 2PN5A 1JH5A 3HWJA 4HPKB 2GC1A 4ES8A 3OBRA 3RRDA 4LO4B 4HG6B 1DU3D 2CSGA 3AXEA 1C4RA 4FBFA 5IVFA 4XQ4A 5CAZA 3ZN5A 1KS4A 2K2SA 2VO5A 3RWNA 5FTTC 1VP6A 2NYYA 1WMFA 1Q56A 3NNFA 2B42B 4KU8A 4S2HA 5JR7B 3ZFEB 4JRAA 4ZU5A 5KHIA 3ZPOA 2YU1A 3IPVA 4Z2AA 4BWOA 3MICA 5APAA 1YFUA 4PDWB 1IG0A 3BOWA 1OUSA 4J1XA 4JAAA 1UNBA 2WT1A 4LA2A 3OF1A 3ECQA 2R30A 4LITA 3MHZA 2Y0OA 5C6CA 4A3ZA 3GGLA 1RUOA 2R071 3AYEA 4HVRA 5EYXA 5F2SA 1PX4A 1R1ZA 1PGL1 2CWMA 1FNYA 4NPRA 5FZHA 3ZPYA 2CWSA 3ZN6A 1TQ5A 1YQ2A 4R52A 1SLIA 3AP4A 2C9KA 2VOXA 2W68A 4JGZA 5JI7A 5A7QA 5FDBA 3POSA 3KV4A 4BISA 3VLBB 2DF7A 2WS91 1TZOA 5FKCA 2IFRA 3O12A 4A3XA 5A6QA 2D97A 4FAGA 2YC2A 2XQRA 4IEYA 3ZXJA 2MEV3 3U1XA 5AC92 3AJYA 5FYVA 4CCDA 2C0ZA 1GYKA 5FY5A 5GJ6A 2ZGNA 3O7OA 1B35B 4C0HA 4P9WA 5BNNB 4JQTA 3ETQA 3MGUA 4Q0QA 4OCTA 2BWAA 1AR61 1EAH2 3Q8AA 4YW4A 4AHWA 2GNBA 4CEWB 3H50A 4X6RB 4YGBA 3D8CA 4MSVA 4RHV1 1GFF2 3BOPA 4LKSA 3AL5A 4COVA 2YBKA 4LOTA 4TYSA 4Q4V2 3QH6A 3PUIA 3HBZA 4BE3A 4YZ1A 1H6XA 2XQXA 3B5LB 1RUE1 3IDAA 3R4DB 4YW5A 1C57A 4IEQA 5GM0A 1AYN1 1W0NA 2J22A 5DPNA 2JDMA 5JIAA 3E6DA 2K0GA 2RMU1 1W9FA 3IMMA 5CNAA 3JD73 5T5JA 2ZMKA 3EJKA 4NHKA 3W9AA 2WBKA 4NIIA 4AR2A 1NXD1 1YI9A 1TNFA 4P9JA 4KG8A 1NUKA 1OF3A 2BTVC 2VMEA 3BYWA 4MZUA 1BEV1 5DZGA 4PI2A 4U2AA 3T2PA 3AMNA 2CTVA 3VBSB 1N1VA 1WGPA 4XBQA 5JDBA 3AJZA 4FP3A 4GJZA 3LPGA 3OY8B 4L11A 1ZRRA 3F95A 3LA2A 1W6QA 3DF0A 4RD7A 3V56A 2VUJA 3RZJA 2RS12 4JV4A 2WYSA 3S5QA 2AH2A 4UFIA 4BJ0A 5LWBA 1QH7A 2D6KA 3UV9A 4CDWC 4COUA 3D4KA 4FPYA 1IQDC 2ZZQA 3O0XA 1T2XA 2WO1A 3BGAA 3LSEA 1QJZA 3O1RA 1JS9A 1WD4A 1FMD1 1NA1C 3UETA 4DRRA 4LJHA 4XAEA 2JDYA 5DAWA 1QQP1 2ZAHA 3KCXA 1C5HA 2WKKA 3KB5A 2Q8OA 2V4VA 4QWNA 1RJ8A 2HKXA 1UIJA 2WINB 1NYWA 3LFIA 1VBA1 3DYOA 4IV3B 4D6QA 5L7OB 1HN0A 3MZHA 1PNFA 2D6NA 5C4WB 1ULPA 2W94A 3EB7A 3H42B 3ZYBA 2ID4A 3GALA 4HSJA 4AE2A 4DEQA 5FZEA 4AHZA 4GWMA 1UMZA 4W6XA 4QAWA 5C8CB 4JDMA 1C8NA 2FDHA 5F32A 1F5JA 2UY9A 2PQQA 2FDIA 2J1UA 1IKQA 1WUVA 3RZZA 1AR81 3MI8A 1SPPB 3WW2A 4QDQA 3RFRA 4LKFA 5DABA 4AQ2A 1WCUA 3AZWA 3KVAA 3UL2A 2CAVA 1DGRN 1LHVA 1NCQA 1PO21 4QXKA 4XETA 2GC3A 3VKMA 2D93A 1E5RA 1RL3A 1VMHA 2JXAA 1F31A 1W0OA 4UW5A 5FXZA 5FREA 1DCSA 4Q4X3 4Z82A 1R093 1QNWA 2ARAA 5IVCA 3BU0A 2BPA2 4OZOA 5C70A 5IK4A 1NY72 1DBNA 3AP9A 4TSVA 2VVFA 1POV1 3WT3A 5T54A 4BIOA 3TEWA 2ZMLA 1DLCA 2ZGPA 2D43A 5IFTA 5FQ0B 3CHXA 2WZR1 5DUVA 5LRSA 3ZM8A 1DZTA 1YFWA 3MPBA 3VKFC 2P3IA 4B4RA 5FWJA 3AVSA 1KJLA 3MO4A 4Y33A 4Y1YA 1WCQA 2WNVB 3ZR5A 2PQSA 1PVC3 4IQPA 5A3MA 4R9DA 1JZ8A 4KL1A 1RXFA 1C8M3 1RMU3 2WT2A 1KRIA 1CZSA 4M01A 5FWEA 2ZX2A 5LASA 2VUAA 3H8UA 5BNPB 2WNUB 3G7DA 5DAQA 3N7MA 1NA1A 1ZBE1 5FZ7A 4XFBA 3VDDC 4DMIA 4O65A 4M0NA 4YVSB 3AZYA 4WZFA 2Q1ZB 1H8TC 1ULEA 4Q29A 3VD5A 1W9YA 2VOTA 4Q0SA 2RS53 4BZ4A 5JPMB 4XF3A 2WS92 1US3A 4TZDA 1PIV3 2VUDA 4IEZA 1RGSA 2CV6A 4W6YA 5HXVA 2G4IA 2WZEA 3D6EA 2WDBA 4Q2FA 3W21A 3ZN4A 1HJGA 4BLIA 4CP0A 3NL1A 4R9AA 4X6QB 1TVGA 3VBUC 1YUDA 1UKGA 1UU4A 4YW1A 3RI9A 2VW1A 3D0SA 1YYNA 4YG6A 3SKJE 3AX4A 4NUBA 1FX5A 3T0BA 3CO2A 3ALQA 3KLSA 4GA9A 1JZ7A 4LBKA 1COV1 3M3EA 4QX8A 5CFCB 1CAWB 3CL1A 4BMBA 4IE7A 3FUOA
chains in the Genus database with same CATH topology
1LOCA 2BNMA 4Q0PA 1AYN2 2D40A 4GB32 3ZXFA 2RMU2 2MPFA 3KZ4C 1YJLA 2A6WA 4ISQA 1BYHA 2JG9A 3IPVB 5DZEA 3LAGA 2JE7A 2IXHA 2Y0IA 3AM2A 4K7JA 4AI1A 1RVF1 1BEV2 2QFEA 1PGSA 5I93A 1W6PA 4ZU7A 5KWRA 1C1LA 2JEMA 2BQPA 1W6OB 1OQEA 2D5HA 1QY4A 2A3WA 5BYNA 4AQTA 5K0UA 3TN93 3VDDA 3RYPA 4KU7A 1HRI3 4UW4A 2HWE3 2NZ9A 1NXMA 2TNFA 2N7GA 3R05A 2JG8A 1URXA 1RTVA 2AYHA 1SLCA 1L3JA 2B5HA 1FMD2 3N7KA 2XPJA 1N1YA 5J3UA 4ORFA 2O8OA 1QQP2 4J1WA 5GALA 2ZGUA 1ZREA 4E4SA 4AEDB 1S2KA 1VBA2 3LOBA 1N1TA 3VL9A 1YRZA 2AENA 3WDWA 2DU1A 3RNSA 1A6CA 5FBZA 4GKXA 4AHYA 3PVNA 4QPIA 3JBG3 4EWAA 5GLWA 1ZNPA 3ST7A 3L2YA 3VN4A 4LTAA 5CG9A 5J7MA 5FO9B 5J98B 1UW8A 1JBCA 2CAUA 1GLHA 4S2GA 1ZBA3 3IDEA 4ATEA 4M3CB 3BODA 4EWDA 1RUI1 3M1HA 2Y26A 4P5HA 1DGWX 2XL9A 1EV11 4RGAA 4FOWA 2OPKA 1IS3A 4QGMA 2O8QA 1W6QB 4E4ZA 1DQ5A 3RJ2X 5BNQA 1VBB3 1D2QA 1FATA 3GZAA 1HQNA 3U07A 1VB4A 4FTSA 2RR12 1SBEA 3UK9A 1YIFA 2D6LX 2RE9A 1HV0A 1LOGA 5DUXA 3GZUC 4OHVA 3S7IA 2PHFA 1ZBE2 1H2NA 4FQ4A 5JZGC 2R042 2VQAA 3SCFA 1HRV2 4YM3A 1AR93 1MEC3 1FOD1 1ND2A 5FFOC 5T50A 1PO12 3WHUA 1REFA 1X8EA 4LBQA 3WINE 4WVMA 5KHHA 3ZXLA 5A3LA 1Q8SA 3ZFFA 4HN0A 1TMF1 3IIAA 4EROA 4FT8A 1WD3A 1J59A 1QMJA 2PLV3 4JGYC 1LTEA 1IS4A 1N1SA 2P17A 1AYM3 1LHUA 2FHRA 4DPNA 2GMEA 3CJXA 4LBLA 5BPXA 4YRDA 4WM7C 4E4DX 4O9EA 2QKDA 5HBAA 1WLTA 3VBHC 1OPOA 1X7NA 3AKPA 3PVEA 3AKRA 3R4SA 3WY6A 3MF6A 2Q1MA 2DUPA 3S7EA 2WFF1 3R4UA 1OKQA 3AP5A 4TWTA 1AX2A 2DUQA 2K9ZA 1TME3 4NWVA 5GZDA 1SACA 1KJRA 2DCYA 3ILRA 2DWRA 4ASLA 1DFQA 3TNPB 5EXOA 2EVXA 3FBMA 1JW6A 1MS5A 1FPN1 1FYUA 1WA4A 1ZYBA 1KXGA 4IEOA 4BM8A 3VBRC 3AMMA 5LK7B 4Y1VA 4Z8BA 1RHI3 2A3XA 2HWD3 4YYOA 3VKOA 2R16A 1J3RA 1NA1B 1NCRA 1LB2A 1AL21 1CVNA 4I0AA 1RUC1 1IPJA 2W52A 1BBT2 4RL7A 1RUD2 1AR73 4XTPA 3WDYA 5CFDA 3MW4A 2XGXA 4MXWB 5FAXA 1H9PA 5IUQA 1Y9QA 3GZTB 2D44A 4JGYA 3USUA 5JOWA 5DG2A 1PNGA 1ULFA 2VNGA 3N36A 4Z92B 1VB2A 2A5ZA 3J9SA 5FCCA 4R4ZA 3RYRA 2E51A 4MXVA 4P14A 2YPJA 5F6KA 2AGSA 3ROUA 4XJ8A 3NKGA 1CN1A 3UKTA 1RINA 1DQ6A 4Q4W3 4QQLA 1APNA 1NLSA 3ENRA 4A7ZA 3M8LA 4XBNA 2JD4A 1AVBA 1ASJ3 1RUH1 2JG9B 3KGZA 2G9FA 3AFGA 4BPZA 3LSDA 3I8TA 1BVP1 1Q8VA 4EN6B 4EV0A 4LLFA 1DGWA 3M3CA 4YVWC 2WFPA 4Z07A 1WW7A 3VHPA 4FQZA 3S30A 2UWCA 4CEYC 1Y7BA 4DINB 1Q43A 3E6BA 5K0UB 3VDDB 4F83A 2ARBA 3GBGA 3BCWA 1H8TB 3U0ZA 4A7KA 4XOGA 1QJX1 2ENRA 5T52A 4MGKE 1D0GA 1HKDA 4JDNA 3FLTA 1ZZ9A 3X29B 3VBUB 1BQPA 3ASIA 1B35A 5BNNA 3H1MA 5JSRA 4OLLA 2NQYA 1FOD2 1LENA 1WMEA 4CEWA 3LGRA 5LK5A 4K20A 1CGPA 1G86A 3RJRA 3SCHA 4AVSA 1TMF2 2ZX1A 2WSVA 4QGNA 3VZOA 2ZOEB 1QGLA 1VBC1 1A8DA 3U10A 5C9AC 3CU7A 3M4FA 3CLPA 3VZJA 2IXIA 5I0RA 3NAPC 3TB0A 4GKYA 3T1LA 2OUHA 4YGDA 2MHFA 2ZKNA 1WW5A 4OI4A 1FAYA 2ES3A 4WBBA 3WUCA 1DLLA 2D98A 3AMPA 3ACLA 5GKAC 3ZFGC 5HCBA 3VBSA 3L9JT 1H1IA 1QXRA 4LBQD 1Q3EA 2EXKA 3OY8A 5IK5A 3W58A 2OZJA 1VRH1 4QQPA 2ZZJA 2YUEA 2H6CA 5FLHA 5KXBA 3AZZA 2WQ4A 1MS9A 4IEWA 1BVVA 3FLPA 4EN0A 4E2SA 5AC91 3C3VA 3B3QE 1KFXL 2C1FA 3THPA 1AXZA 1ND3C 1YHFA 2RM23 3FE5A 4FPKA 1RUC2 2XL7A 3WVJA 2W39A 2X5IC 2HWF2 4LBQB 4IV3A 4Z1VA 4WVMB 1LOAA 3ATGA 3OCPA 3D5OA 4WVVA 4XFAA 1YWKA 1R082 2YYOA 4Q4V1 1LODA 1Q5OA 3S6PA 2MNGA 1LJ7A 3B94A 4EN8B 3VBOC 2DURA 2JICA 1PHMA 5KHGA 1LOFA 3TWIA 3IT8A 2ZGTA 3ZYIB 1O4YA 4XMIA 1V6LA 1Z7S3 4WM8A 3VV1A 2XBO3 4IEXA 2XVKA 5IT6A 1XU1A 2BNOA 1QJU3 4KWKA 1S2BA 4KBBA 3M7AA 2DCZA 3IWZA 1RB8G 1RUH2 1AX1A 4N7UA 1D4M1 4MGYE 1EY2A 3WCRA 5FQ0A 3Q9OA 3N3HA 3DPRA 2RS11 2XLGA 4AF9A 1DG6A 1RUF3 1ZX5A 2AUYA 4KH9A 1RUG1 4DFSA 1C5IA 4CYDA 1RUJ3 5HCAA 4DY5A 1LOEA 2HWC2 1LU2A 2VQ0A 2Y38A 1RUOA 4N9HA 2BNNA 1NCRB 2LTNA 4HFSA 2Z79A 3B9CA 4N53C 5EFUA 4JTNA 3FFQA 3FLRA 1AJOA 4UXAA 3HMYA 4A7YA 1D0HA 4NHMA 4RQPC 5ACA1 3WDXA 4V1PA 4NWWA 4IL7A 4GIQA 1OPMA 4JGYB 1DHKB 4WV8A 4XE9A 1U5ZA 3GYDA 2OVUA 3SH4A 2QCSB 3I59A 4WM7B 1PZ9A 1MQTC 4ZU4A 4RA0A 4BMEA 4Q27A 1S55A 5CFCA 1CAWA 3ME2A 4GQ7A 1GR3A 2I45A 1CESA 2BWCA 3HQXA 4JVAA 3VBFC 1H2LA 4MX3A 1VBC2 3GHNA 1JN2P 3AFKA 1FV3A 1NY71 2H6BA 3AYCA 3I2DA 5I0SA 1REEA 4HBNA 4UBGA 2D3SA 4MGZE 2JX9A 2E7AA 3KMHA 1XE8A 3WW1A 1GZ9A 4XXAA 3VZNA 4AVVA 3ZYGA 4FPOB 3THTA 1V6OA 1CPNA 2GH2A 2ZGLA 5FRAA 3DV8A 4AI0A 5CADA 5EJ3A 5FOJB 1K5MA 2R073 1VLNA 4KNCA 1W6OA 5FMOL 2EXIA 2WL1A 1UX6A 4UBHA 4B4QA 1KITA 3B01A 2QE3A 4MH0E 1DYKA 1VRH2 2V5YA 4P9XA 4ES9A 1XE7A 4B4PA 4L2NA 1PM7A 3B9IA 3RMYA 3BPZA 3U4XA 4KGQA 3ZIWA 4H3WA 4RQPA 1QDOA 1WBLA 4CDQA 3PJYA 3AXDA 2GMMA 1UD1A 1U0AA 4H7MA 1HV1A 3OD0A 4G9SB 4AEDA 1F2NA 2HJIA 2CYFA 2V73A 4SLIA 4HKOA 2OYZA 3LA7A 4F7ZA 1M4WA 1AR63 3WG3A 4LO8A 2O1QA 4YARA 1BJQA 2BGCA 1H2KA 4RHV3 4QQOA 4XJAA 3OPZA 5FMOS 4C0BA 1SFNA 2MEV1 2ZGOA 4XXPA 4FOVA 3WDTA 5GZFA 4AGVA 1RUE3 4GB31 2GNTA 2ZGKA 3AMHA 1RITA 1VAVA 1V9U3 2BUKA 3W59A 1GZCA 4LT5A 3JCIA 4DNYA 3WP4A 1G9AA 4M3CA 3B00A 2C5DA 2DUOA 4QD2A 2GN7A 4RR3C 1GBGA 4D7TA 1I6XA 1BEV3 2VMHA 4AI2A 4LUMA 4YFWA 4FXGB 1D4M2 2D5FA 3H1YA 3KT7A 3MYXA 1QJY2 2ZHLA 4HK9A 5K7PA 5CBLA 1RUG2 1Z0HA 5EV7A 1ENQA 1VIWB 4PF5A 4CZSA 3MIFA 2WZPP 1YNAA 2KM2A 4MVTA 1YLLA 1XQNA 1O4TA 1G9CA 1CJPA 4XJUA 3PMEA 4GMP3 1HXS2 2PA7A 2G9GA 1XRUA 5L36A 2WNEA 3LZZA 4Z2WA 3PTYA 5ACA2 1C3HA 2GZWA 2XB6C 1GZWA 2D3PA 5BUVA 2YHJA 1S0DA 1WLWA 2A6XA 3NAPB 1AR83 2YGLA 1FXZA 5F1RA 3O0WA 2TBVA 5KXEA 2CGNA 3PNAA 1J3PA 2HWB3 4WM8B 2DVBA 3MFCA 3FUQA 4AQ6A 1PO23 3VKLA 1QHDA 3SH3A 1BXHA 1NOVA 2RHPA 2XG3A 4PIZA 1O4ZA 3ZFGB 2ZGRA 3HR9A 3DPRB 1QOTA 4QPGC 2A6ZA 3MEPA 2WZR3 1DF0A 4PLNA 4BLJA 3V64A 2RR11 3E5QA 4CDWA 1JYIA 4AI3A 4Q4X1 1OQDA 5CG8A 3S0MA 1LEDA 3LCPA 3E5UA 2PHRA 4IEVA 4LA3A 1ZRCA 1O91A 1ND3B 1SMVA 1O7FA 4LO7A 3V0AB 4FOQA 3GHMA 4Y26A 5FO8B 2R041 2ET1A 5KC6A 1HRV1 2VVEA 2XLAA 1V6JA 2XJTA 1S0CA 4OFGA 2A7AA 1PO11 2PFWA 3ZO0B 4DXZA 1PVC1 1DGRA 3R0RA 1C8M1 4MXWA 4OULA 2UURA 4QQ2A 2RS33 3AYDA 5K9YA 3I59B 1V6NA 5JLVA 2RS51 1OFSA 3MFAA 1COV3 2PHXA 4BA6A 4MV2A 2MEV2 5LRRA 4AQSA 4AEKA 2Z42A 2WWSA 3HD8B 1AX0A 2A73B 4AVBA 3FX3A 1KDMA 4M0HA 5FPZA 1DZQA 4I09A 1S1AA 5EZWA 4LNVA 2VGDA 2BVVA 4Q8LA 3VZKA 5L73A 4AEMA 1CJDA 3IBMA 2ET7A 3NV1A 2ZHKA 1UAIA 2ZGQA 3WG4A 1RVF3 1YCIA 1K5MB 2OZ6A 2CGOA 1J1LA 2E63A 3JD72 4N53B 4SBVA 4XF1A 1WLDA 1H8TA 1WW6A 4IV1C 1A8MA 1Z78A 1FI2A 1BBT1 4AFCA 1GNZA 1U12A 1RUD1 2ILMA 4RQPB 4KGGA 3AZVA 3KCYA 4CDQB 3NVCA 3ZSEA 1ZM1A 4EWEA 3VZLA 3VBUA 4AVCA 5KHJA 3TN91 1UIKA 4PBOA 4HANA 1HRI1 1NE6A 2NN8A 1KS5A 2Q30A 4I01A 1MQTB 2DTYA 1Y43B 5BV6A 1SLBA 1OD5A 5FLJA 2NMNA 2O0OA 4XW3A 3N4MA 4OI2A 2BFUL 3QLQA 3PVOA 3SXWA 2YV8A 3RYKA 5ABJC 1GANA 4HETA 5E16A 2WT0A 2GNDA 5DZFA 4GH4C 1CQ9A 2C9AA 3JB8A 2DFBA 3SMHA 5I8SA 4Q0UA 1LULA 4JC1A 3GNEA 5L19A 1RUI3 4QPYA 3BU7A 4AGGA 4YFZA 1EV13 2E9QA 3UKNA 1QKQA 2A75A 2UYAA 1GQHA 3IMNA 1HLCA 1DQ4A 1DDLA 2ZHNA 4Q4X2 1R092 2YROA 4IERA 3T1MA 3MDPA 2PAMA 4XFHA 1ULDA 3INAA 4IEUA 4K9SA 3WP3A 3E6CC 4INDA 5J48A 4QHBA 5J36A 1ENSA 2DU0A 3JU9A 1VBB1 2ZTNA 5JSPA 1N47A 4CDXC 3AK0A 1RIRA 5E1RA 4C1WA 2D7FA 1PVC2 3KCCA 3ZXKA 1C8M2 1RMU2 1GZWB 3ZSLA 3EO6A 2JE9A 3O14A 4B29A 3ZIXA 2Z5WA 2X8KA 4Y1ZA 3NSTA 4YGEA 3OTFA 3QH7A 1UPIA 2RS52 1AR91 2XJQA 1CAXB 1KQRA 2LALA 4RS5C 2IXJA 5ABJA 5KXDA 1PIV2 1SCRA 2A71A 3VKNA 5T55A 3B93A 1PK6C 2OW4A 5IK8A 4N43C 3M2MA 4COZA 2BVBA 2RJLA 3KGLA 1W6MB 1LHNA 1BKZA 2FZ2A 4OVEA 2RJKA 2PLV1 4RR3B 2WFF3 1ZZCA 2GSYA 3ZXAC 1H4HA 3BIWE 5JCTA 3HN1A 1UF2C 4Q1RA 4S2FA 2YZ4A 3SLIA 2XWBB 3AP6A 5FOBB 3A4UA 3ILFA 5AVPA 4AGRA 4CDWB 1F8VA 1FPN3 3TOJA 1ZRFA 1YO8A 1QNYA 5I8YA 3J8F3 1VBE3 4LEJA 4XPVA 4GWNA 4OUSA 1JOJA 2XHKA 2JJ6A 2VOWA 1SFYA 3DL3A 3H3ZA 2D6MA 5K8SA 1MS4A 2ZKLA 3VZMA 4AWDA 2QQPA 5JZGA 1AL23 5KC5A 4RFT0 4I0WB 4Q4Y3 4COYA 4CDXA 2HWF1 2YDEA 3WUDA 4PJYA 5F9TA 3AKTA 1XYNA 4PLMA 2OUJA 1R081 1RHI1 1ZZ8A 4KWLA 4R4XA 4R8HA 1SEFA 1ZRDA 3TN92 2UWBA 3I54A 1HRI2 4RGGA 3MIBA 2AZ5A 2HWE2 4COWA 5LEJA 5CIRA 4WM7A 3E5XA 3NJ