1SBQA

Crystal structure of methenyltetrahydrofolate synthetase from mycoplasma pneumoniae at 2.2 resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
164
Chain Sequence
MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIINDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Ligase
molecule keywords 5,10-Methenyltetrahydrofolate synthetase homolog
total genus 45
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1sbqA00
1YDMA 3HY6A 1SBQA 2G40A 1U3GA 3HY4A 1WKCA 1U3FA 1SOUA 3HY3A 2JCBA 3HXTA
chains in the Genus database with same CATH superfamily
5K99A 3X1MA 3DCYA 4DRXA 4BO2A 1JU4A 4QQKA 2K7FA 3EC2A 1MHPA 1Z8FA 3L3BA 2C3UA 2HLDD 2RGXA 1P75A 3WLKX 3VTAA 1VE7A 3JQ8B 2GEDA 1ILWA 2WWWA 4E7OA 2YIVX 4FLMA 4KSYA 4BNHA 1VI5A 2Q6IA 1AKVA 1UKZA 5C2JB 2Z6QA 3VR2D 1KYVA 3RS0A 1SKMA 3GLQA 4JWKA 4F12A 4X1KA 1OX5A 3THXA 4MK4A 4WLFA 1NBEA 4BMPB 2WYUA 1ZS9A 4IOLA 2BT4A 4QGFA 4TL6A 4YRSA 5I9TA 4BQOA 5TPWA 2O7VA 3PFGA 3KZNA 2ZEJA 4N0MA 4D9EA 1Y7HA 3WNCA 4YJHB 4HRYA 3WRWA 3BG5A 2PY6A 3D7SA 3OCCA 5FBQB 4QG3A 2AVNA 3ZZUA 2X6RA 4MDHA 3HEBA 1U3GA 3N0VA 1UDCA 3NHJA 3B20A 1AO0A 1WB4A 1KYZA 1HLFA 1V5FA 2Y71A 1N8NA 4GZLA 3UFXB 4C4PA 3D1JA 5CDFE 1UBMS 3RE1A 4OL9A 1K6MA 2V4ZA 3MZ0A 4A7PA 2D0PB 1EA5A 1UJ2A 1YULA 2DTDA 2WZDA 2HHHB 4DEVA 2BRUC 4PAWA 5F3WB 1FLVA 2XTZA 3WDSA 1LBSA 5BWLA 4YT2A 3NNSA 3A9CA 3PDWA 1YNOA 4E2FA 5A0VA 2DY1A 4G25A 4AJ2A 4EMUA 1JLKA 3IP3A 4JVOA 1WF3A 3AVOA 5TX7A 1WAMA 1ZEJA 2R8YA 1G60A 3OQIA 1TCCA 1USUA 3HB9A 4ZAVA 4MUFA 4IPTA 2P2ZA 4YREA 3ZWOA 2JS7A 4CEIA 2RB4A 4BY9E 5EHQA 5FYDA 5DW0A 1G9SA 4Q7KA 3LQYA 2FWJA 3OETA 1DJMA 3BIJA 4CQNA 3K6RA 4R7ZA 3ZJTA 4O5AA 5HJ7A 3L4BA 1ZX1A 4K9KA 2NX2A 1NR1A 4L9AA 4BUCA 4CN9A 3B70A 3PNVA 3KR0A 5KOHA 3K0CC 1JHZA 3NFYA 1Z2NX 1XKLA 2FUG6 3A2KA 5KNCH 1S8NA 1W6RA 4NBTA 4UVHA 5AVRA 1JIXA 2GEKA 2GEBA 2Q4EA 2RGEA 3LYAA 4JT2A 1A7JA 2FOIA 4KFRA 4C14A 1GFIA 2C9ZA 4HVCA 5K0ZA 3CGWA 3KL4A 4J1NA 1KBZA 4OSEA 5GV8A 5LQUA 1JH9A 4Y6OA 4JR1A 1OX6A 2P4SA 4K0RA 1QX4A 1N3BA 1JG6A 4IO0A 4RA6B 3DEFA 4YJ2B 1VLMA 4MPJA 1XZKA 2M1XA 2Q5OA 3HGTA 1G8FA 3SHOA 1ZGZA 3UJ3X 2VEDA 3I30X 5D85A 3NHZA 5LZ7A 4QFMA 4KI7A 5KVAA 2FDCA 3R75A 4AJ1A 4Z9YA 3LNCA 4W1SA 4A6PA 4QTYA 4UTRA 2G63A 4UCFA 4DILA 3VR4D 1N2XA 4PQEA 3QLUC 2XNSA 2C9CA 1GTRA 2WF8A 1U8YA 1FX1A 1L9XA 3B3FA 4Q47A 3MC1A 1L4UA 1TTPB 2WG0A 2OV2A 2HK8A 3HJHA 3F2VA 3VO8A 1SA0B 1Y8QB 5CT8A 4DNOA 1C3LA 3BHNA 3H1EA 4DDVA 1Q7GA 1XZQA 1E9SA 4Q66C 3LY7A 2XTJA 3V4PB 4D41A 1YZLA 4MQBA 5BSMA 5BNIA 1N92A 5HNKA 1YHYA 5MDHA 3HY3A 1GJRA 3OM1A 3H13A 5EEHA 4P33A 1R6BX 2QNBA 1LLUA 3UENA 1JB1A 4AAYA 3PNOA 1ZOSA 5TV2A 1ATZA 5ALGA 4RA9A 3E1GA 1FVOA 5CG2A 3ME5A 2WIAA 4PZYA 1JDUA 2FWRA 2ORIA 3I73A 1NASA 3UFBA 1XTSA 4DLLA 2DHDA 4AN4A 4Z53A 2CK3A 2RGNA 2MYNA 2XNDA 1BTOA 2NOAA 3DXZA 1FUYB 2PT7A 3WBKA 3CR3C 4ZFNA 2P9CA 2IY9A 3HL4A 5AKHA 4BRSA 1MQAA 5AVUA 1ZSNA 3MJTA 3MQ2A 4RD0A 1ZRSA 5A9TA 121PA 1ZXXA 3IMGA 3ZGYA 3CN9A 5FTLA 4CM5A 5JNSA 2A0XA 5FFNA 1OWNA 1N1MA 1ZVMA 2YNMA 2QR2A 3LQRA 2CC2A 3NWEA 4YX9A 2UVQA 4AKGA 2JRCA 5DOZA 4CLEA 2E87A 4K9NA 5LP6C 2B1RA 4QDKA 1QDUA 3BCRA 1II8B 5TMPA 1AMUA 1B26A 5IM4F 1V2GA 2A9JA 4PGGA 3W6NA 2FN9A 3RC7A 5AUQA 2XUFA 4Z4EA 1AKRA 3K9FC 4I50F 1HYEA 4M54A 4RMGA 1ILEA 5DSXA 1ZONA 4ZVVA 3FTCA 1Y7LA 2OOSA 1PT8A 3T7TA 1VE5A 3ZY4A 1QQBA 4HWRA 4AG3A 3IPLA 1IQRA 2C77A 2YBEA 1TJYA 1TPYA 2VBGA 3M6UA 2L0XA 4YDSA 1NVVQ 3FFBA 7MDHA 2DX7A 1XZCA 4U7DA 3BFJA 1BQEA 3SZOA 4OJYA 4CEHA 5J63A 2F3UA 4L8VA 3EBPA 3PB3A 3JRWA 3VV3A 2FXIA 4D56A 5FUQA 1FYWA 2ZRPA 4FR0A 4GR9A 2BCEA 3PGJA 2AWNA 1LTQA 1ID1A 4YN3A 2G4VA 3RGGA 5IARA 1LBHA 2EFCB 3RTGA 3M4XA 3P96A 3NBAA 4U1RA 4WEOA 1G20E 2QROA 1V37A 2DAPA 3I53A 3EN0A 1YR1A 1GGNA 2PLWA 1VPVA 1GTL1 3BVPA 3P9YA 5FQOA 2VBCA 3FGPA 1DJNA 1U2DC 3F98A 4UU1A 4KXYA 2JAUA 4RQUA 2ENUA 3NNNA 1KDVA 4R8SA 5ALDA 1WD7A 1ZQ1A 2L69A 2XH8A 4JL8A 2OHVA 1UMDA 3MILA 3PUZA 4PVDA 3ISTA 5E3IA 4KIGA 3MHPA 3R8CA 5KIAA 1FTSA 1Z0ZA 5ARDA 4IH9A 1H1LB 1SHTX 1R6VA 3JYOA 3VTKA 3EVEA 1VECA 4XWOA 2EWMA 4LC0A 1U9ZA 1MKYA 3Q7RA 5IP5A 3RAFC 5DCUA 2Y77A 3LBAA 4Y9RA 4HG2A 2ZSFA 1ADBA 1IWPB 3KT8A 4H3SA 4KIJA 1IUOA 2UV8A 1WPRA 1E9RA 1QUFA 4G1BA 4XWAA 4E11A 2B0CA 2BKVA 3EVTA 3WL7A 3EPLA 1QTNA 3JQAA 3L06A 4RZIA 4P7GA 2Q4RA 4X91A 3V7FA 2GJSA 3RT1A 2VJDA 5L4NA 4HDKB 5AM5A 4PHGA 4P4GA 721PA 1RHMA 3UFXA 2W6ID 1OQAA 2ZJOA 1LPAB 3KKKA 4ETWA 5AW6A 3JU3A 3EF0A 1WDKA 5EJIA 2V74B 3AI1A 3I6MA 1U65A 3SQXA 1MOSA 1UEJA 3UXYA 1EESA 3GFOA 3KCNA 3USES 4JJEA 1N7HA 4MWOA 4PYMA 2C7OA 3WBFA 1XD9A 3WS7A 3QOYA 4BWVA 1Y42X 2HRRA 3MBOA 1Y1QA 3CKMA 4TN1A 5A0FA 5U1PA 3ZD7A 3SC6A 2QN7A 3GQBA 2X1MA 3NETA 2XYRA 1X15A 2QORA 2XRMA 2NSJA 3HKEA 1IN4A 1X7DA 2EFJA 4W5HA 3RIHA 4C87A 3QKIA 4DY6A 4X6LA 2JI7A 1K9SA 4A8JB 1DEAA 1EJ0A 1P1JA 2ZVDA 4LJ9A 4UHDA 4Z99A 5BVGB 3TB6A 1W4AA 3CZ5A 4H9GA 4U0JA 1HETA 5F77A 4OM8A 1YMQA 5IK2A 1Q50A 4TXNA 3KVNA 1V4BA 4HLUC 2K2WA 3PC4A 4NX2A 3ZCXA 3BWEA 1C0KA 2JHFA 3E3LA 4RQBA 4A6EA 1QIHA 4F2GA 2AOUB 4Q02A 5FQNA 1Z75A 4ENSA 4H27A 4WFKA 5IABA 2IHUA 1P2VA 2H1RA 3JASA 1YJ8A 3FCXA 2YJTD 2ZVPX 3ELBA 5CLJA 5IH7A 1BXRA 3TM4A 4X71A 3RROA 1J49A 1Q14A 3AONB 2OECA 1QZUA 3AIMA 4ZOLB 4BLQA 3V8BA 3AI7A 4D92A 3PPYA 1ZD9A 2IP1A 2WT9A 4B82A 3HBLA 4CIAA 1X7HA 1KO4A 3BRWA 2XI4A 2ZDQA 5EXEA 3QY0A 5ILGA 1EDOA 4N47A 3WNZA 2UZ0A 2X86A 2WG1A 1S2MA 5ES4B 3T1HB 1VL8A 2KBEA 2GYYA 1NXVA 2RGYA 2X42A 1PN3A 1PYGA 5G41A 1T5TA 5EL0A 3ITNA 2DKFA 1L7XA 4W1PA 1HQCA 1UF9A 3C1OA 3AEYA 1JWLA 3F47A 3EODA 1Y4SA 5SY6A 5KTRA 4F6RB 5BXQC 1E3JA 3HSYA 4YFVA 1SB8A 4IG9A 4I3FA 2ENWA 3KWFA 2VWGA 4YA6A 3CX6A 3RF6A 5EJ8A 2CF5A 4KQHA 1XA3A 4CF7A 2V0CA 1OWLA 3PD1A 2WR8A 4RJLA 1VIMA 1KHHA 3BD7A 4DUGD 4B3TB 2ZK7A 4A8TA 1GZUA 1VLJA 3REGA 3RTDA 4IH1A 1T26A 5HE9A 3HGMA 5AKZA 4EG0A 2BZSA 4Q1FA 3V9PA 5ELXA 1CLUA 3A8TA 4QNNA 3IE1A 1EUZA 1IB6A 5JD4A 4JQYA 4Y1FA 4M3NA 4K6GA 2ZYDA 4KMRA 4G9GA 1AS3A 1ANKA 2MINA 4AC9A 3GJZA 4R69A 1BU5A 2CLLB 2QTAA 2GO7A 3FWNA 2G1AA 2YJ4A 4R68A 2Q62A 1KDPA 4WX2B 1Q6ZA 3QYJA 3SHVA 3WBJA 4WNCA 1INLA 1YS1X 1LX7A 3O26A 5B4UA 1DB3A 4G5RA 3HNPA 1EMDA 3HHPA 1N32B 3Q9LA 4JK3A 2C3YA 2HLHA 2Q27A 3E1SA 3F6RA 3NOVA 2ZBPA 3MAJA 4HHEA 1NP6A 2F6RA 3EG9B 5JBIA 1M67A 2PQ2A 1VI2A 1ENYA 1XRPA 2JLBA 4CG3A 1Q7BA 5C5EA 2Y0BA 1PZFA 1CQXA 4ZXPA 3TTYA 5C7LO 1I7QB 4KVFA 5AVYA 2H08A 3RSQA 3U4HA 4NYJQ 1N77A 5LQNA 4O6VA 3KBOA 4IM7A 2VPXA 3W5BA 1US8A 4CMCA 4EF6A 1AXRA 3OOSA 2AKEA 4L07A 4J16A 1B93A 3WFIA 4AO8A 4NYIQ 1IHOA 1JPJA 2DRIA 1YZKA 4E1VA 5CIQA 4JAVC 2XBLA 1PG2A 1N1DA 3DM9B 2D0OB 3BL5A 2VS1A 2X0JA 2BSXA 3UH0A 4DNFA 4RQAA 4V0OA 2YC4C 3LCMA 1EM8B 1I4WA 1L5MA 3U3DA 4QYIB 1DC4A 4U7TB 4KPEC 4IKOA 1W5FA 5JJBA 2NZ2A 4HADA 2IXEA 5ITSA 2CNKA 3PICA 2HCRA 4N6NA 2EG5A 1WV0A 1E5XA 4TMVA 1UBKS 3GZJA 4BRWA 1NVWQ 4H1HA 1QVRA 2GZ1A 1JB9A 5DYGA 3OA0A 4DMRA 4ENUA 1VPWA 1FYEA 1E4EA 4B5KA 5FADA 3A6DA 4HWTA 3TJZA 4BVBA 2H8GA 4GM4A 3M6FA 1EKXA 1J00A 1UP7A 1BNCA 1OGIA 4GX1A 4R05A 1L4HA 1O3YA 4OYHA 1YJAA 4QLAA 4FEEA 2ZPTX 1DL5A 4IV5A 4RGVA 3C45A 2N46A 4I99A 5B2ZA 4B4OA 3V7WA 3PGVA 3T9AA 3HVKA 2XY4A 2QAJA 3PR2B 2A7XA 2A8YA 3D6FA 1PEAA 2WAAA 1AX9A 3W6OA 5ENVA 3TPZA 2ISQA 1IXYA 5HIKA 1O6FA 1Z73A 3HN7A 1RHKA 4UFNA 3QEOA 3EVCA 1E3WB 2B3TA 2XVZA 4BO4A 4MW2A 2F7SA 3CWZA 1PR6A 3R7AA 2ORWA 4O1HA 5HZKA 1BH6A 3DBVO 1NWHA 3RC2A 2RCNA 4NTZA 1S1MA 1Z47A 3B3JA 1SD5A 3ESBA 4ZMRA 2VT6A 3J7AC 3BL8A 3LJKA 2XRYA 4YB8A 1K7EB 3HB5X 1GGEA 4TZ0A 2FPLA 2X5JO 3HKEB 3MYRA 3PE6A 3SC2B 2Y0PA 1FYXA 2YCLA 1WKVA 2XUJA 4JJ7A 5EZQA 3A10A 1H1DA 4RVSA 1GKKA 4HGZA 4BX0A 3N7AA 3U40A 2VUIB 3DVQX 3REQA 4NEQA 1C4OA 1KS9A 2ZR8A 3NQ41 4RMHA 1N7IA 5F1PA 3NCHA 4C76A 3MWEA 5IAJA 4HLDA 1M8JA 3TPFA 3CFYA 1M1YB 3E4DA 3VR5A 4RM3A 3KIPA 5DYTA 4BNDB 2PD3A 1UOQA 3U80A 3RKUA 1E3EA 3DR5A 4W8OA 2PJZA 4V0QA 4PW0A 4BWGA 2HGZA 1SELA 4JUAA 6CHYA 1U2RA 2NVUA 2CXHA 4AIIA 3DKIA 1SULA 3O4GA 1PW5A 3WMGA 4JEIA 3UAYA 4NZNA 3KDAA 3VHLB 2QXUA 2C5SA 3S27A 3RBXA 1GITA 3PJFA 4RGQA 2DR0A 4ZOLA 4UTPA 1MIHA 1UFOA 5FOWA 3Q3HA 5BUCA 1VCIA 3W6ZA 3DOIA 3QKTA 4RAQA 2GLUA 1KARA 2FOLA 4AKEA 5JTTA 2A0UA 3GY0A 1XVLA 3P9XA 3L93A 5BRJA 1NI4B 1OVMA 3QKSB 3AIKA 1BG6A 4DDWA 3IL2A 1ODKA 3MINB 4OHXA 3R1IA 1X86B 1QCZA 1JNYA 1STOA 3FPJA 2Z2IA 3QKRB 1I9CA 1QP4A 4IIVA 2ZTVA 4IWXA 3TTVA 5ED4A 2X2EA 4Y2SA 4F3TA 4DREA 1V2HE 1VC2A 4L3OA 2AR9A 2BHNA 5JISA 1I1OA 2GCIA 1ZK1A 2Q41A 4IZOA 1S9HA 3H8SA 4L0MA 1CR1A 3I5MA 3BX1A 4URXR 2RHCA 2O2JA 1I36A 1RNLA 5K20A 4AI6A 1C4XA 5L51A 2F17A 1H2EA 3L8DA 4MGHA 2EFGA 5D3ZA 1T3HA 4BRZA 3VC7A 3ZHOA 4I1OA 4F60A 3VBCA 4RF5A 3RS7A 3CRZA 4TZ6A 4IBOA 4IUYA 1IE3A 2PU7A 4FE3A 1FIUA 2R5FA 2HREA 2G80A 1TXGA 3HKBB 1J23A 4ATNA 4BNTA 4DLPA 4U02A 1CUDA 1PCXA 4G6ZA 3EDMA 1JJVA 4YJ2F 3GLGB 2JKYA 5MF6A 3R0QA 4F1KA 2EF1A 1P1BA 1GQQA 2FW6A 2P3LA 5DX8A 1TX4B 1NRJB 2VQDA 1OXMA 1P2SA 3JQDA 5B4VA 5ENDA 1IDOA 4UHEA 3R7SA 4A9AA 1ND6A 3VPCA 5FBVB 2GNPA 4BO8A 2FYTA 1RYNA 4RHXA 4DLYA 1FFYA 4B4WA 2ZS8A 3O21A 4CTOA 4FINA 2SHKA 5H3CA 4EPYA 3AR3A 4QU5A 1ECLA 1O95A 4WESA 3SPXA 1ML3A 2NGRA 5CTAA 3W3AD 4XYLA 2J32A 3ESZA 4R83A 4KH0A 4Y2PA 2HSGA 3FCYA 4FCCA 3RYFB 2YHIB 1W46A 3GH1A 2DJ5A 3JAKB 4K2HA 2RH8A 2EGGA 3LUDA 4UEJA 1WCWA 4RPLA 4W7SA 2JLWA 4LFBB 1WQ3A 2RGAA 1KI2A 3MIIA 4B7UA 1X42A 4DQDA 4ZC1A 3MK31 2G1UA 2QMEA 2J9GA 4OLFA 3O47A 1CUGA 5K6AC 1NG9A 5ESDA 4AZ0B 1WMBA 4JKOA 4EPTA 2I1VB 2H92A 4ZT6A 3R3JA 5FOTA 2VTBA 2QUJA 2PYDA 2VH1A 3Q5EA 4WVLA 2R47A 3ZBUA 1T5HX 3LI2A 3LX6A 5J2UA 5EUMA 2HSZA 2Q3LA 2XOKD 3F7TA 3PFKA 4MWEA 5ALWA 3T52A 1HORA 1R0ZA 4TV8F 3TLKA 4N65A 3IUMA 5DNDA 1YO6A 1V9CA 1QKIA 4IEFB 1TU0A 5BVHA 3E70C 1ZG3A 4HXYA 3K9WA 4AL4A 1GPUA 1BC5A 4ERXA 2PSFA 3CJRA 2FVYA 3CF6R 1ZWLA 3EVNA 4PN3A 1QP8A 4NDAA 1ZH0A 5SYAA 1DJOA 1TZCA 4KWEA 4YCDA 1IUPA 3I3SR 5AK4A 1KAEA 3EPHA 4FE4A 1L5HB 5CB8A 2FV8A 1YB7A 2P5UA 3IBCA 1HT3A 3PRKE 2ZT8A 3P4UA 2P2NA 3HI4A 4D8UA 5AW1A 5KTNA 3TLJA 5EKDA 4B6OA 2FQ1A 4WMLA 4WACA 4GXNA 1V3TA 2FR8C 3VSEA 1SHUX 3TLEA 1POXA 3RSGA 5NULA 5JZBA 4IFEA 3CEMA 2ZZKA 2FPSA 4C4SA 1XV5A 4WVFA 2B5VA 3UJAA 3U39A 4IJWA 5F23A 3ZY2A 1XHLA 3WLNA 4CEIB 1TVCA 4F8EA 4FKBA 3QP9A 5FBZA 3ELUA 1GYRA 3MCVA 3QBVA 4CVNA 4ND5A 3VR2A 2DQSA 1KXJA 4LF4B 1GKIA 4G23A 1TM7E 2A67A 5EG5A 3PWZA 1P2UA 3E7DA 4GMHA 1RXVA 3Q0IA 4ZO6A 1ZD8A 4QXOA 1WW3A 3K8OE 4OA8A 3P0RA 1RXCA 1XZGA 1UQRA 2W6ZA 2ZB2A 3I23A 1FDSA 1PJQA 2EGUA 2X5KO 4DHWA 3UGJA 2FGKA 3FKSA 2WM9B 4YUWA 3QM1A 2SNIE 1AT1A 5A1TA 4FHFA 3IOEA 1RXEA 1A8QA 1M1NB 1XRNA 1XHFA 1H5NA 2FCRA 2L17A 2QE7A 3MQFA 4OFWA 3HB7A 3JRXA 1JLHA 5EKSA 3H99A 3DQQA 3ZX4A 3D31A 3AFMA 3VC3A 4WBNB 5E6RA 2Z4TA 1YB2A 4PU0A 2BM9A 4IIGA 2WE8A 2O1EA 3GDWA 1VGRA 2I7TA 1OROA 4P1ZA 3H6GA 3IAEA 2R7LA 3OOJA 4TL7A 1Z83A 5EHNA 1NJGA 3JPYA 2H3HA 4IDDA 4ML3A 1PV2A 4EG8A 2HLDA 3A32A 3NH9A 1T4GA 2ZT7A 4P34A 4BNKA 2WHRA 1C80A 1J99A 1EZ1A 2FW1A 4B3XA 3ZJVA 1JHMA 5CPBA 3B8EA 3B3AA 4FHZA 1N6HA 5EPUA 2FZLA 4FFLA 2G82A 5KDOA 2NO6A 4QT0A 2PUEA 1C7JA 1OVGA 3IEVA 1J4AA 1OF1A 1M66A 1AC5A 1KKUA 1LPPA 4TWZA 2Q28A 4UBIA 2X3FA 5JYCA 1UXOA 1U28C 2OPBA 1ZBDA 1WMSA 2H4XA 4RANA 4S35A 3WGKA 4M60A 1KVQA 1J8FA 4L2IA 1ZJ4A 2OCBA 4KQ2A 1X6VA 1GUDA 1UZUA 4QA9A 3SZLA 2ZCJA 1M6WA 1YS6A 2ZIAA 3CNQS 3EDYA 4EJSB 3HS3A 3P32A 1KFCB 3EZ7A 1G2OA 5CBPB 4N6OA 2Q07A 4NV1A 4B3HA 4IOJA 2A9RA 5GONB 1U4NA 2ZU0C 1NUSA 2AB0A 2Z58A 4F04A 4PVCA 1F4LA 1C0PA 1SJ9A 2H63A 3G2MA 2B21A 4P3PA 5FKJA 3D8UA 3ZQ6A 2PXXA 5F2KA 5C8DA 1OGJA 4RD6A 3VVCA 2I3ZA 1WUTA 1ONOA 4NIMA 2F3PA 2OXFA 1FRNA 2WNHA 2IDMA 2PZJA 3C41J 1CY4A 4RFSB 3H9GA 5J5AA 5JD3A 4WJLA 3CEJA 3CUSA 4WOBA 3ZHUA 1VQ1A 1YBHA 3C97A 1UBJS 3FSGD 5DTIA 4BP3A 2Z2YA 2R7AA 3PFHA 5DFAA 1CUZA 1DCTA 3IELA 3GAZA 4YRMA 3QWAA 4JI6B 1FFDA 1G20A 2JASA 2IV7A 3KLBA 4YC7A 3OEHD 4PAQA 1YV9A 2OO5C 4LTNA 1PP4A 4U8HA 5TGTA 3CX8A 4KIUA 1SU4A 4JLOA 1KFJB 1VHQA 5E4YA 1QWOA 2GEJA 2PL3A 1NXQA 1PUJA 2I78A 5ALYA 3KUDA 2YFKA 1RKUA 1KAQA 1TVEA 3ESXA 1VRVA 3Q15C 2C2OA 1QWSA 1UJ6A 1VG8A 2GHTA 2IDZA 4I5IA 4LY3A 5TQ0A 5C8VA 1JDSA 4PAOA 1ENOA 2QRZA 3O8OA 4B34A 3ZJYA 4GD3Q 2ZDHA 4UZEA 1P0MA 1EFTA 1GQRA 1QFZA 5HQ3A 1FJXA 2XGOA 4HTAA 3I52A 5LQKA 1HURA 4XVUA 4DR6B 4DIDA 3PR3A 2QN6A 2WU4A 2Y99A 3ZLTA 1ORWA 3ESYA 2ORVA 3BJRA 1Y3CE 4YACA 2YYSA 4KE7A 4KQMA 3OCUA 1EBBA 3DFIA 5TDHA 5LNK1 1ADYA 1QS0B 1RJWA 4TS3A 1OASA 3UXMA 4KO8A 2FMKA 3N2KA 4RZXA 4Y2RA 5BR4A 2IHNA 4ID9A 4GOKA 1GRNA 4QPCA 1UBSB 4LZJA 2Q49A 3G88A 3HR8A 4DR7B 3DOOA 1OSNA 3BXGA 1VCNA 2I2BA 3K0CA 3QXHA 4IOMA 1JA1A 1KHTA 1M2GA 4G26A 3GCXA 3GF4A 1RBMA 1AK9A 4JKYA 4MA5A 5TVGA 4CLXA 5KQPA 2GM4A 4GT1A 2V5VA 1FLAA 1EJBA 1ZUHA 3OPVA 3IMKA 4Y2XA 1E2UA 4CQMA 3V33A 4R2HA 1FMFA 2WHXA 4IVQA 1HRKA 3QMVA 4Y2TA 3ETNA 3GZ4A 4Q7JB 4E5NA 4EHJA 4F9EA 5BYAA 5AHRA 2W6JD 1XMXA 2WKWA 2X1VA 4XW2A 5ED0A 1SCJA 3RVBA 3V4RA 3WL6A 3R7FA 3VU9A 3PHHA 5TGZA 2OZLB 2H1CA 1KQGA 2KMLA 3VR5D 3EZLA 4RK4A 4XJVA 5ALUA 1PIWA 3OSZA 4BP1A 4Q48A 1T3SA 4BP8A 2IFTA 4PZCA 2BM1A 2O2XA 2V9PA 3RRJA 2IY8A 2ZIFA 3DV0A 3SZMA 2D0DA 1KDRA 2GCPA 3LF2A 4MVYA 2NUTB 1G6Q1 3LY5A 3IV7A 1AQUA 3FM9A 4OFXA 3C3CA 4WZAB 1E2PA 1NW6A 4NU5A 1PVDA 2BR3A 3KK0A 1Z5GA 4QUDA 2VPPA 4C30A 4ENRA 1V7CA 2CLEB 4FEAA 4RVUA 5HCNA 1EDZA 4H7EA 1CDZA 3PGMA 4D0SA 4QJ3A 3KJZA 2VDRB 5TT1A 3TMAA 3QVGA 4M83A 1E6KA 1Z74A 2DH6A 3TXAA 4PLVA 5MN4A 2XNKA 3E8MA 2R8RA 2WTXA 3A04A 4ALIA 1JR3E 4A27A 2BZ0A 4D8YA 5DRYA 3B1YA 3VR4H 1M33A 1YQGA 3LUAA 5T6MA 3CXUA 3WGQA 3WLJA 1B8VA 5HILA 1L5WA 1UJCA 5CLIA 3B1WA 3HWSA 2QZPA 3WKAA 1IJKA 4IGIA 2FX2A 1BJKA 2BTQA 3G8CA 3DVLA 2GPSA 4QOSA 3T5CA 4DZZA 4CIBA 3TTXA 2RJOA 1DAPA 3CE6A 1KYIA 3JQGA 2AXNA 4H1UA 1O54A 4X9XA 3N6VA 2DFDA 2ZR0A 5CU7A 2NMVA 4MHSA 2HNKA 1GKYA 3MWYW 2ZS9A 4M7PA 4P32A 4TKLA 4UDNA 3FR7A 5NLLA 1VFNA 2HO5A 3SS9X 3BWYA 5DNEA 5CJPA 2BGNA 4CKZA 2BFEB 4KKXB 4WNIA 4BB6A 4EB8A 4W5TA 3OQ6A 2CJXA 1OXTA 1U3TA 4LMPA 3M8KA 3PEVA 2VHTA 1NGSA 1NURA 2NSHA 2PS1A 4DDMA 1P17A 4BO1A 2ZBUA 4FHGA 1BZYA 1SQSA 1B8UA 1Y8RA 3DJYA 3LHSA 4I4IA 4A4DA 4DXAA 5IBCA 4XWTA 4N48A 1RIFA 3ZNPA 1SCUB 1EK0A 4QYMA 4HTFA 1NWCA 4HATA 4CUKA 2ZIXA 2PEYA 4XWWA 1ABEA 3FHTA 4AJKA 2BGWA 2YN0A 2A9KA 4QPDA 4B8YA 3GBVA 3OEED 4DMMA 4X1OA 3UQZA 3MTEA 5ECWA 3RHFA 3SOZA 2TSYB 1LFAA 3KB1A 5D5PA 5EMMA 2PD6A 2PU5A 1WMAA 2P1DA 3MJCA 1Y8AA 4ZODA 4AULA 4EF5A 4DSAA 3ND7A 4Q3AA 2PBLA 4P0PB 2P4UA 2R4TA 4L16A 3IVGA 4GR4A 3UV7A 1QOZA 4XGQA 1QK4A 4PYRA 3C8DA 2HCJB 1X77A 3QKWA 2GO1A 4PFJA 3ZDZB 3TVDA 2MSNA 3E3NA 2W2OA 5ES3A 3WK6A 4KOEC 5GADl 3QPUA 5DLDA 4BV3A 4AWAA 3ASUA 3PIRA 6LDHA 3C6BA 1WVIA 2YV1A 3EG9A 3AU8A 3GK3A 4L50A 5AKKA 5DJ5A 5FWXB 3QOFA 5JNRA 5DWDA 4A6XA 1KOGA 3E3OA 4EJ2A 3E03A 821PA 4FNGA 3R4CA 1ZVQA 1KEPA 2A14A 4JC5A 3NBXX 4QFCA 1ZLYA 3KPVA 4ZVMA 1QGYA 2VSNA 1PO7A 3HLTA 3HP7A 2EJTA 4C7OB 3K6SA 2VNAA 3SY8A 1NVGA 5HE8A 4EMSA 2DQ4A 3OURA 1XU9A 1NTOA 3REFA 2WPDD 3DMTA 1WIWA 2ZIUB 5T41A 1T3GA 1SOAA 4DJFC 3TKAA 4YI3A 2HJRA 2QGZA 2P9FA 4YIHA 1D1QA 1D2EA 1GU7A 1KFBB 2IHTA 2IZ6A 4H0CA 4AZSA 4J0CA 4QATA 4QUGA 1QHXA 3SIPA 3VSDA 4LVUA 1CY7A 3RVOA 1XEXB 1QVZA 3U4GA 2VF4X 5GM2A 3W2FA 2OKGA 1JFTA 1C30B 4DV3B 5IT5A 1FMLA 2XJ9A 2FLKA 4V3BA 5CLLA 1U11A 1VB5A 1N4DA 2NUAA 4P82A 2J9FB 2CVHA 2W8BB 1HG1A 1O0SA 1XELA 1Z38A 2BHRA 5KJEA 2V7GA 1U1DA 1DCMA 1XDGA 2YV2A 2CJWB 4KN6A 1QG6A 2AV6A 4HUQA 4YUZA 4P92A 3PGA1 3OU2A 1JHDA 3H1FA 3WQQA 3DHNA 3ZE6A 4L4XA 4GKBA 1FU4A 1RC1A 4EG4A 4Z3DA 4NMMA 1Z7WA 3UC9A 4JNKA 1G42A 4DC9A 4NLLA 4HB2A 1TFUA 1SMKA 3A9RA 4QFBA 5LSAA 2PX4A 5HF6A 2OBYA 4GI1A 1KQOA 2V58A 4KR6A 1Z2EA 3MMXA 5FTKA 3IUYA 1CZUA 3MVEA 4AUMA 3NKFA 4FGSA 5CH3A 1N6LA 1K8ZB 2FQXA 3UQYS 4BLOA 3OPYB 3ZW7A 1RAGA 3WL4A 4YRBA 3D02A 1VYTA 2Q7XA 5JO0A 1D8AA 3VR6A 5F7ZA 3TEMA 1N5KA 1UDBA 1P29A 3DWEX 4CLRA 4P98A 4BLUA 2C5BA 1RWNA 2EQBA 5CT5A 4D0RA 1Z4KA 4LV5B 4MKGA 2Y4OA 1E7QA 4X1KB 3THXB 2DC1A 2ZRDA 5JRZA 1MZPA 5FUVA 1RAAA 1CUFA 2HL6A 2FGJA 4XWGA 1ZK3A 4MITA 2P68A 4FC6A 1HLDA 1PE0A 2NVWA 1GVHA 3Q88A 4NRDA 4LXTA 4F84A 1ODJA 1UEXC 3EMKA 4KNYA 3DMHA 3ZTTA 3FTEA 1WHSB 4GRIA 4CT5A 4MKFA 1NUQA 3IALA 3MWEB 4TTJA 3DFMA 3RPEA 1WDWB 1DC8A 2E1PA 4HSGA 5CVVA 5EXTA 2EZTA 3FHCB 5DGIA 4Q9DA 3TZKA 3WSTA 1YA6A 2GTHA 3BMQB 1TDJA 5LB4A 1QF7A 5E3HA 1L7VC 2XHEA 1WB5A 2POCA 3RADC 2RSLA 4L7QA 1X2BA 3T5MA 4DVGA 5IBQA 5BVHB 3C3WA 4M9RA 2GZHA 3FI0A 4KO3S 4UM8B 2ZIEA 1VBFA 4P81A 5LKAA 4RHCA 3K30A 5DHSA 1P7WA 2H85A 3RT9A 3CTMA 4UTNA 3CJTA 4CMHA 4AZWA 3TLAA 3DBRB 2XRFA 2VAMA 3EXEB 3FPLA 3MCZA 4IIXA 1KAOA 2YMLA 4MQ6A 4P84A 1YE5A 1SIBE 4MYDA 3RR2A 1U9IC 4A91A 5CDYA 3RC9A 1ZA2A 1S9DA 3HO8A 4YMHA 4LGCA 2FSGA 1T13A 2QTVB 4LJ7A 3U44B 4OSOA 1D6MA 1KK2A 1PGNA 2QSJA 4TUYF 4ZV9A 3SYNA 3KD2A 1M2HA 4JJAA 2WB2A 1CY8A 1DX6A 1NNI1 1V1JA 3HDQA 4UCWA 2HMAA 1Q11A 5CA0B 3NUGA 1MT0A 1T24A 3IVXA 2C29D 3GQVA 4NCIA 5G1NA 1ZFNA 1UPCA 2RG1A 4YJKA 3S5JA 4YROA 4AJNA 3KCQA 2PUAA 5IUNC 1M10A 4Q93A 3TRFA 5M29A 3MJFA 3WAGA 2ORED 2IP4A 3ILHA 1E2DA 2X2PA 3WOVA 4MUYA 4B17A 4JODA 1E1DA 4L74A 4J6EA 2NZ8A 2AG5A 3CH6A 2XE6A 3PTLA 5IJ0B 2AG6A 2XEDA 3M5WA 1SCDA 2VC2B 3TD9A 3AIIA 1UZAA 1Y9DA 1ZZGA 2BEKA 1E69A 2ID4A 1UKYA 4K9LA 4NQRA 2Y0CA 1N34B 2GETA 4D80A 1WL8A 1OPRA 2P6MA 4J94A 4DLSA 2E4WA 5DWVA 2QSUA 1OZ0A 1WUKS 1CY1A 4UHBA 4OJKA 3MOSA 5KYUA 3WA6A 1L4LA 1D1PA 1GAEO 5AVWA 4QVKA 1YVRA 1X8XA 3H3FA 4R1UA 2C7PA 3PTAA 2H51A 4LJ8A 4URVR 3W05A 4LDZA 3E9YA 3VSCA 1X13A 2ZI5A 4BASA 4NABA 2HMVA 5IBRA 2J3HA 1I7LA 1SVOA 2EFDB 2ZJ2A 3LDUA 3RU3A 1XZDA 3CW2A 3ESQA 4JN6B 2G67A 2PKQO 3N2YA 2PR7A 2VDUE 3B6IA 3QV1A 5TQ2A 2C0CA 5EWLB 3O74A 4CPDA 4UHHA 2JLXA 3EGDB 3W9YA 4DR1B 1NW5A 2CDAA 1RJ9B 3C2QA 1ZUNB 1YIOA 2P9JA 3ENVA 1F5SA 1GY8A 2XV1A 1E63A 1YL7A 3LGAA 3MD9A 1NF3A 3KOZA 1TKBA 1JQJC 1J2RA 1P5JA 3U16A 1RYEA 3IAFA 3OO0A 4H4DA 2KW5A 2QQ0A 3BGWA 4RESA 1NMXA 2EKZA 1VSUA 1ZOOA 1O77A 2C00A 1JWAB 3C4QA 4WFJA 3W90A 3QPCA 1JEQB 2IL1A 4KAJA 4XDGA 2QQFA 5F1YA 2CVOA 3B85A 3HBFA 1Q1AA 4B85A 4EFNA 3D3WA 5E4JA 2CEKA 1XZEA 3FYTA 1G0OA 5C7IO 2AX4A 1U4OA 5THXA 4TVKA 2VJAA 4IHKA 4EA6A 5B2EA 2R6DA 4KR3A 4RFSA 4I4TF 3KXLA 3HRKA 1JYEA 2EHDA 4EMBA 1Z2CA 3BTUA 5FV4A 4TROA 5FTJA 3OX3A 4WK4B 4F85A 3D8SA 3TEJA 3D4PA 5DK4A 4CDMA 2HT1A 1IZ7A 3IE0A 2Q5LA 2I67A 1L8QA 1UC8A 3P26A 4P7FA 1DBIA 3AF6A 1XEWY 2EX0A 3KJFA 4EUSA 1ISRA 3NS7A 3EFBA 3RSFA 5HX7A 2JIZD 5IC5A 3B9RA 3K05A 3U60B 3W2HA 1H8HD 4DSNA 3RK4A 1KJ8A 1WNTA 3CEAA 4HH1A 4PG7A 2PL5A 3VKUA 1NOJA 1DRVA 4BPBA 2O5RA 3WYEA 3ZN2A 1PF7E 3FFWA 4MW0A 4LF6B 3JD4A 4GSLA 7MHTA 1V9LA 1BKDR 2HM7A 3LWZA 4L9RA 2GKOA 4Q9KA 5DYWA 5A6SB 4JI1B 4ZYWA 5J2TB 1NKVA 2OV6A 4N5HX 2XKKA 4QQRA 3C6KA 3TLMA 4ESOA 3BJEA 1QB7A 1QQ6A 2QL7A 1S8AA 2GF9A 4ILEA 3U7RA 1PUXA 1MRNA 2XYVA 3QFTA 4QYTA 1IIBA 3FNQA 5HQ3B 4KYTA 3DSRA 2REQA 3IUQA 1JLMA 4P38A 2J6IA 4JA0A 2JGDB 3CUTA 1AGNA 4N3GA 4ZALA 4F86A 3NHSA 1KKLA 2FSHA 1QC5A 3A70A 3JWHA 5HMLA 3ZIAA 4CQLA 1OAOA 1UMBB 4RBNA 5DGXA 1GL9B 1OLUA 2VSFA 4EUNA 1Z3CA 3RWBA 1E77A 3V8VA 3ZTYA 1BFDA 1J2YA 3OICA 1KY3A 2Z3VA 1X9GA 2EKLA 3I9OA 4QOJA 4PO1A 2RGBA 1HNZB 1H0HA 1Z29A 3X1YA 1PR1A 2PAAA 3WC4A 3WYDA 2KWIA 2IA5A 5IJXA 1YONA 2QPAA 3UO8B 1U3DA 1FTNA 1PAUA 1AHIA 2Q3CA 2X4LA 3Q41A 4RMNA 4U9HS 5HKKD 1IM5A 1EP3B 3G0DA 3VKFA 4I50B 1EIWA 1WE2A 2D2XA 4E14A 3VSAA 4MA4A 3G6WA 1EB8A 3U3OA 4ZYYA 2XDAA 1IIRA 1TQ4A 2FSPA 3BK7A 1ZESA 3IBGA 2VAWA 3MTAA 1ISJA 1XD2B 1Y3DE 4WOJA 1NSYA 3V1KA 4KVGA 2HTFA 3TQHA 4J8PA 5A2QA 4Y9DA 4NZ9A 1UZNA 2GVNA 4KMSA 5K0SA 1RM5A 2PRJA 2ZAIA 3EXIB 4LNAA 1KJYA 4JX9A 3OCZA 1KF0A 2A6PA 2YNMC 3E6AA 4PS0A 4EDHA 5ICCA 1K6IA 5B7QA 4FYPA 1E5VA 5THKA 3HACA 2XUDA 1OAAA 3U5ZB 4I4NA 3IMEA 4Z0NA 1DBVO 2AMVA 2G70A 3GUYA 3V32A 3FUTA 2ZTLA 2QE7D 2Q7DA 1I4EB 1H6CA 5TEWA 1BVRA 1VMDA 4IZHA 1TLFA 3KOYA 4OAPA 3G2IA 5LBIA 2QX8A 2XA2A 1M8GA 4GLLA 2FWIA 4MVJI 4BKUA 1KU0A 2LDXA 1I5RA 3C3KA 5CM8B 4EW6A 2BCGY 5BWMA 4ZEMA 3KXKA 2JFGA 2HRZA 2OHJA 4TTIA 1EXVA 3OP4A 3CX3A 4JUDX 5H70A 4EVIA 5BT8A 5KOYA 4CEJA 3I09A 1QPBA 3BCHA 4UMEA 4HNSA 1NUAA 4GRAA 4Y6PA 2L82A 5ESXA 5FIUA 1F12A 4FNAA 1P81A 3TNDA 1XEAA 2G5GX 2DHQA 3A06A 3GUUA 4RK0A 1B23P 1XN4A 2H1SA 2JVJA 3K7EA 4BMOB 4PLZA 2ZWAA 2NZXA 1T35A 3B6MA 3GLIE 4TYYA 4LHSA 1U04A 4DMCA 3L5OA 1XYYA 2Q2VA 4MVJD 5EE5B 1R2QA 4PG6A 5IHPA 2ECKA 2HW8A 1UFKA 2CE7A 1H6AA 3OCWA 2OV3A 3PA8A 3NOQA 1KJQA 4P83A 4DJDC 4RUKA 1E61A 3BJZA 4LHXA 5BMVF 3WWCA 3M3PA 3KM0A 3SSMA 1P1IA 2N1MA 1FF9A 3KYIB 5GM1A 4QD3A 1K8RA 1JXQA 2DBVO 2I99A 3LHKA 4PQGA 4M0PA 2EERA 4MPDA 1QAQA 3VVLA 3LCJA 2RAPA 1IUNA 3O8OB 1FJ2A 4KLRA 4XSHA 4DBLC 4EYOA 2JA1A 4K1XA 2V9CA 3L0DA 2DP4E 2FMTA 3LPCA 4UC0A 2VT7A 4FB4A 4XPIA 4I8XA 5D51S 2H54A 4CI0B 3H11B 1I2ZA 3FOEC 4L15A 1L8OA 3G2KA 2TECE 2FPOA 5JS1A 5K0BA 3LF1A 4GAEA 1A9XB 1ZMRA 4GLBA 4OXQA 5DSTA 2R4QA 5EWLA 1JALA 1GLGA 1U2SA 1YQUA 1K7YA 1BU8A 2ZI4A 3MWDA 3HUDA 3VU8A 4KXMA 4NCNA 3VGJA 2ONJA 2BUCA 4XYGA 4G1CA 1K4MA 3OM9A 4FBLA 3UJ7A 4PO8A 4W5NA 4W1QA 1JECA 2CMDA 4C3OB 4XXHA 1N0WA 1YJXA 4K05A 4AP5A 2FFBA 1KVTA 4GL2A 3G0GA 1HY3A 2O0HA 4YUXA 1HYBA 1H22A 3ORSA 1Y3FE 2XOKA 3GDFA 2J48A 4G4JA 1NBOA 4QBGB 3E7PA 1XQXA 3OMWA 4HY3A 2JC3A 4E7PA 3KPJA 4MUBA 4ZZIA 4EUFA 1Y1PA 2GASA 2GFHA 1NYTA 1GZVA 3OTGA 4IWYA 4ZZ1A 2WTNA 4JNCA 4ZI7A 2OZLA 5A02A 2IELA 4Y0NA 2PXHA 3N8DA 3NEJA 1YR2A 3ROPA 5C37A 1MABA 4JLKA 5AESA 3LY8A 1EE2A 2GYUA 2IPAB 3B1FA 3NT4A 2ZE6A 3F6SA 4M38A 3TZ6A 4BO9A 2J4CA 1K2VN 3ZS9A 4QC2A 4AK9A 2AYZA 5A5EA 1BVHA 1G8JA 2ZYIA 1CRQA 3JYLA 3OJFA 4H0FA 4EB3A 4JI7B 1J1UA 1G5TA 3A1SA 3TTTA 1WDTA 1JKIA 4XWYA 4YP0A 3DZIA 2IEGA 2RK3A 2P9EA 4DNQA 4DYVA 4ZZ3A 3FNIA 4JI4B 3OIUA 2JLSA 5KVVA 4I5DA 2HH9A 1OT5A 1MPXA 2IPMA 2VHVA 4X20B 3E1KA 2G0TA 1JDTA 5PNTA 1XQVA 3DHYA 3A9UA 3KU4A 3PHIA 3BS4A 2Q4DA 4HWSA 2QAIA 4FHCA 1ZVVA 1WR8A 5HK8A 1UPBA 1Y6GA 4PPYA 1XN1A 3GGCA 4U9IS 5MFPA 3TZCA 1P5ZB 2COKA 1RLUA 1T43A 3KS9A 4HV4A 1E2IA 3P9CA 1F8UA 3W5UA 1C30A 2CYBA 4TLBA 2G06A 2JIDA 4XQEA 4MJLA 1Z13A 1FP7A 4CG2A 1AB6A 3DLTA 4I2NA 2XUHA 5CK5A 2UVPB 1JIUA 2ZCUA 2B4YA 3Q0EA 4D45A 4DQLA 4MUKA 3C6YA 1DMRA 1KR2A 2XWJI 1ECGA 2J33A 3OZBA 2XUKA 4ETNA 4KRFA 1O03A 2OILA 3NAZA 4JEHA 4P8RA 4IRUB 1UDWA 3UATA 1I7PA 2I6GA 2N42A 3PVSA 1TUBB 4PS1A 5D00A 1Q44A 4D8TA 2GTIA 1V11B 3O8DA 2VDOB 3AKCA 3HY4A 3T5TA 1KK3A 1T10A 4ND7A 1NR7A 1SXQA 3U4QA 4GI3A 5J4LA 3IA7A 4WK0B 4GBGA 4YJDA 4EPVA 5BWNA 4FW9A 1TQHA 3FYHA 5JXWA 2VAXA 1CUSA 3QE4A 4ARZA 5DMHA 5CJJA 2V0NA 4MWSA 1XZ8A 1A97A 2B4AA 2OHGA 4Q1EA 4KAXA 3V7NA 4EHBA 2DCMA 5EP1A 4LJLA 2RHTA 3H5LA 1R10A 1B6TA 5FP0A 3OHMA 1Y6FA 4NYMQ 2IYAA 4C7XA 2JFBA 3U6BA 4E09A 1I0LA 1FQKA 2O0KA 4EUKA 4RNCA 4Q1VA 4UVIA 3DO8A 4DIUA 5ICEA 2XBMA 3CSSA 1FB5A 3PLNA 2BHSA 3EXFB 5EEGA 3T7DA 4EG3A 3ZDFA 2WTUA 4FPXA 2II6A 4CW7A 1QFXA 2RHWA 5EQJB 1KFKB 1ZLXA 3WDLA 5LP1A 4ISBA 4CM8B 1BX1A 3KKMA 3FW1A 1TW3A 1CJVC 4GVPA 1FYVA 2D7CA 3VUEA 3LOQA 1B14A 3WNQA 3AT1A 4J2OA 4WNAB 4TMFA 3WMRA 1UMDB 3L6UA 3NVMB 4Q3CA 1G19A 3AEQB 4BIMA 4YRKA 4DM3A 2ZJ4A 1ISPA 3S1AA 4FJ2A 3L1JA 3AY7A 2AFIA 2YRFA 2RHJA 5G02A 1XYGA 3Q7SA 5EWJA 3DXXA 4DABA 1C1XB 4IDOA 1UKEA 2WWRA 3D8HA 4EFKA 1Y34E 2ODBA 2V7QA 4K40A 5ICSA 4RADA 3N86A 4OO3A 3VJRA 1PSDA 4FDAA 1TJNA 3WIEA 3PNQA 4KODA 4LY6A 3WHLA 4UPVA 2A57A 5E6UB 4LDPA 3KWJA 3JAWB 1G8HA 2JFOA 4X65B 1NPYA 2GAIA 2X0KA 2PPVA 4B3SB 2TMKA 4C2AA 2OHHA 5I8WA 3E5RA 3S4YA 4ZOCA 4C6TB 1SXJD 2XGGA 1ML4A 3C24A 4HXGA 2IEAA 3VOTA 4BBAA 3RSOA 1P9OA 1WULS 4BXOB 5JW6A 3H2JA 1S4MA 3C3BA 2WKPA 2GPNA 4O4IA 5I9LA 1YR9A 3HUFA 5BQ5A 3TBHA 2DQKA 1FDRA 4BKOA 4QZVA 3IT0A 3WMWA 1E2MA 2WUEA 3FZGA 3HXTA 4R1PA 4BP9A 2O06A 3LMKA 4JSTA 4ARVA 1SZDA 2ZRCA 1HYGA 3CF2A 3L0BA 5HS6A 1PZXA 3LIIA 1K06A 2DR3A 4P7BA 1FZQA 4LRQA 5F2EA 1BVUA 3SOPA 4IICA 1NX6A 3CZ4A 2FN7A 1O87A 1VKNA 3FJ1A 1SK8A 3I6BA 3ZWVA 3TSWA 2D4AA 3P9QA 3LUBA 2BEWB 3GEEA 4TVBA 3TGLA 1Z63A 5D87A 2IV3A 1NV8A 1ADCA 2YWFA 3Q40A 2FUEA 5K3FA 2ASEA 3H9JA 4D82A 2HIMA 3A0RB 2BFFB 3PC8C 1U90A 1W2HA 1AQJA 1P7VA 1Y6RA 1Y63A 4LRWA 1Q1GA 4N8DA 1M2FA 1EFDN 1HL3A 3WXMA 1YE8A 2GK6A 5CT9A 1JEEA 3DMGA 3M4NA 4R7TA 3MUOA 4KWTA 3TOSA 2V0GA 1PHPA 1ZNXA 3G9XA 4HF7A 4AJPA 4DM7A 2JJ8A 1XD8A 1QH9A 1CEXA 1HA3A 1N2GA 1Y8CA 2I6SA 2RGCA 3OQHA 4K6CA 4TXJA 5GGYA 1SUFA 1SR8A 4GPTA 3VHXA 5K8TA 1E4OA 3MJEA 4NXNB 1ZPDA 4LYDA 2D1FA 4QTZA 1X39A 4OX9Y 4A2WA 1SUDA 1TM5E 1ZL0A 2YCBA 4KC0A 1RXSA 1WMEA 2FZEA 4HNHA 4U2BA 4YRFA 5ESRA 3RC8A 3G9UA 1YZVA 2PTHA 4J1TA 5IAOA 2W2MA 5LQCA 2CF6A 1U0OC 2QRVA 1BWRA 1K7FB 4TV8A 1W5SA 2ZR9A 3G2NA 4JT4A 4CQJA 3T61A 1FFBA 1V0JA 4CM9D 1FZTA 2C84A 4WIAA 1QP0A 2H0QA 1Y9EA 5F4BA 2WHPB 1WSWA 2NZJA 1TJPB 4B6PA 1Q22A 3B82A 3CSUA 3DEKA 3CPJB 2OR3A 4RH0A 4UKDA 3Q0TA 3LTEA 1N9GB 3FWKA 3RVRA 3PEUA 4CL8A 5IXSA 2ZRGA 4HDMB 4KGDA 1QGAA 1JZTA 2CJFA 2ZRAA 5DM1A 4RHUA 5ALRA 1EX6A 4OBBA 1XTJA 4WDRA 5JMWA 3NJ8A 4O25A 3ZY5A 1WEHA 3HRHA 3W7BA 1V7QA 3Q3JB 2CLMB 1JZQA 5MN6A 3O9VA 2Q2QA 3O2JA 4BMNA 4POOA 1DDGA 2ZCVA 4H7DA 3UM9A 1VXRA 1TMKA 4MUAA 2JHPA 3N1UA 2QZZA 3DNMA 4FMDB 2VPTA 3B9BA 5E1BA 4D4KA 4OQQA 2W71A 2OD9A 3HLKA 2RHDA 4MVXA 4E2ZA 3A25A 1NL3A 4WH0A 4X94A 2MT9A 2NP6A 1T5OA 4MNTA 2F9FA 4G97A 3UC5A 3L04A 1J56A 3H8WA 4R40A 5G1PA 1JIKA 4F3RA 4G07A 1DIRA 4RH1A 4M7OA 4OLAA 1G5RA 2KYRA 1H69A 4KDRA 1SCQA 1WDLA 2AN3A 2FF5A 1HI9A 2I1QA 1K6EA 1Y1SA 2OE2A 4XM0A 3N87A 4KVAA 1Y98A 4PX2A 1E9EA 2ZGVA 2MCFA 1DSSG 3RVMA 3QF4A 3T12A 3U3KA 2GD6A 5K0FA 2PKCA 1VG0B 5EGNA 4GWLA 4C3ZA 2QD2A 1YUMA 3ZXYA 1F4VA 2JAQA 4MW7A 4PSAA 1F6WA 1BYIA 3CVVA 1B73A 3L7CA 3LAWA 2RD2A 2XVMA 3RUAA 4XGNA 3DWFA 3M3HA 1Y3BE 3QUQA 4W9NA 1WSBA 1L5LA 3P2MA 2UXDB 2DWQA 7GPBA 2Z6VA 3D3NA 1GNVA 3VAZA 1QANA 1Z5UA 3E35A 5I5GA 2Q0HA 2IUUA 1QZZA 4CE6A 4I6JA 2MYPA 3CRW1 1XLTC 5DF1A 3EAGA 4Q05A 2IBSA 1X80A 3CNOA 1U1FA 4Q5IA 2C2ZA 3ONEA 4MZXA 3LQFA 2RDMA 3Q98A 3QVOA 2V7QD 3EY4A 4KR9A 3IR7A 3O9ZA 1YBMA 4DRZA 3ML1A 4BZZA 1MO2A 1N5RA 1JQEA 5GJCA 1RPNA 3JWIA 3I2JA 2YOGA 3C3DA 1N6RA 4BNDA 3C48A 5M34A 3Q8KA 4JLNA 1D0VA 4ND1A 1LRLA 2P30A 4CMGA 2PX5A 1MPTA 1NNEA 4WUVA 2ZUTA 3GFBA 2VPYA 4GWKA 4A2CA 1LTKA 4IW3B 2BM8A 2PUFA 3PQDA 4RZ2A 1MH9A 4CKWB 3KEFA 2V8BA 2M2IA 4H6XA 2OCKA 4YAKA 1M2OA 2EKBA 2EL7A 1R4MA 3A26A 3V3KA 1HNNA 2GN8A 3A1CA 2PG3A 2ZYVX 1E3QA 3LA8A 3MB5A 4MVJG 1E9DA 3GRZA 1E2QA 2OBMA 4L0DA 4N0DA 4F7DA 4JI8B 2EJUA 4I1SA 1H6BA 1T36B 2CVFA 4AU1A 2VHZA 5IT4A 1X1QA 2FKAA 2I62A 4G01B 4F2DA 1UJNA 3QW4B 3UY4A 3DAYA 3H2KA 1N1EA 1N36B 5KJFA 3WNDA 3T1OA 2BGUA 1XNHA 2WWTA 1DEHA 5ALLA 2VXCA 2ZBFA 3TIGA 5L9AA 3CTPA 1N6NA 3K4QA 2ZUUA 5AK6A 5AD1A 4YALA 5F98A 1F2UA 2I2AA 1PR5A 1SVSA 4EJ0A 2XUAA 2YJ5A 3OQNA 3MGBA 1UPAA 2WP8J 1OWMA 2OKCA 4HN4B 1RD4A 3IIKA 3FGNA 3NYIA 3R3VA 4GPD1 3QX9A 4OK6A 4U0KA 2P62A 3CKYA 4NG5A 5AKJA 3UA3A 1VPDA 4BVAA 1G20B 1U8TA 2O2ZA 1TCVA 4AJ4A 3EOBI 2CLIB 4B3GA 3A14A 3BZBA 1DAOA 1EGVB 1MGPA 3ZZ0A 3JVVA 4RTJA 2YV4A 5C4GB 1QVAA 1ZMOA 3N2NA 2OD7A 1ZGBA 4I4LA 3QVMA 2QW0X 4YUYA 4J9UE 2DBZA 2LIPA 3VR3A 4RS3A 3VHQA 1PJ3A 4PZDA 4IKEA 3HO1A 1DFGA 2ATIA 5C1PA 2O8EA 2WWHA 4BLVA 4NOJA 1A2KC 1PDWA 3EQ9A 4QAQA 4CT4B 4MS4B 4GXTA 5B6IA 4ZOBA 2YQ5A 5CCXA 2IU0A 1N2JA 2C7GA 3W9UA 4KVZA 4RHEA 4RLSA 3CUYA 4L73A 2ACKA 2XMSA 2DHEA 1T8PA 1TIPA 1O8CA 1XCMA 2CYAA 2G28A 3NBFA 2MYUA 4MA0A 4RIEA 2Q9AA 1I13A 1RR6A 1ZIPA 3H11A 4RGYA 4C0QC 2B2NA 2DVMA 2PSJA 3FRHA 1TO1E 1ZJ5A 2VPZA 5KNBH 3KUCA 1Z16A 2QJRA 3EXHA 4ZVTA 1U5CA 4MOWA 1AGYA 1B2RA 3ANXA 4LE2A 1Q83A 1BX0A 2ZQ5A 2ZSDA 4I1PA 1A9SA 3QG5A 1KEEA 2SKCA 3AQIA 2DETA 4GDFA 4J91A 2B5OA 1NI5A 5KS2A 3TNLA 1KPGA 1FEZA 3R41A 2LXNA 4BC0A 5LA6B 4DCTA 1YDEA 3TSZA 2I9PA 5A5FA 5TR9A 3MFQA 4TXMA 2FZGA 2H4HA 4PXSA 4C0XA 1WDMA 3ABIA 2O20A 4MCAA 2RCYA 1PX2A 3SS8A 2Q2WA 3Q12A 2EC5A 5K6RA 1QF6A 3T4UA 3VU9B 2HMTA 3JQAD 4ZJUA 2XZLA 4B2LA 2FG5A 3H86A 4DKXA 3URKA 4KE6A 1QYCA 2OQIA 3BIWA 3WSWA 3PXAA 5EE9A 4BX2A 1Y9ZA 3DF9A 1RWWA 1T2FA 3D5QA 4ZQIA 5J40A 5BN5B 2YVUA 4XR9A 1T4MA 4MSUA 4QHYA 1YKFA 5KC8A 1XXHA 3FHJA 2IBMA 2PS3A 2PJUA 4MYSA 5IYZA 4D81A 5EINA 1JKFA 1OHHA 3GIDA 4IUBS 1SQ0A 2F9MA 2AXPA 4D4GA 3C98A 1R7RA 2R6HA 4GF5A 2P5SA 4Q15A 3FCSB 1VA4A 3VA7A 5FOXA 4PHHA 4HBGA 4DMLA 1WXGA 1L4KA 1K0FA 2EZUA 4I08A 4L9WA 5BSTA 1J20A 2ODPA 3T3MB 3AVVA 1WB6A 3RYHB 1XR3A 1VLVA 1CB0A 2CDRA 3LRPA 3W2GA 3UV6A 4D9KA 2Z1NA 1WA5A 3RT7A 1SVKA 2IGBA 2EW8A 2V6JA 3ANLA 4OQ4A 1JEYA 1P62B 3NHAA 3ESCA 2FG6C 1BXZA 3W1WA 3IQXA 4PPQA 2HSDA 1RLIA 2NU7A 1KC3A 1Y89A 1QYXA 3TZBA 1LWOA 1H2RS 2O5EA 3DKVA 4YIKA 3W5CA 3FPAA 1XPUA 1G8SA 3CPEA 1SUIA 3ES9A 4W99A 3CNNA 3WWZA 1O5TA 5LIRA 1D7OA 4Z7NB 3IUPA 3IQZA 4Q1BA 1EH5A 1VMKA 1WHTB 3A31A 3EPKA 1M83A 2CFIA 4C4RA 3FR8A 1GPYA 2YASA 3KZCA 1X80B 3MAAC 5C46F 4X5OA 4S1PA 1WUJS 3B7GA 4IYRA 3RJMA 3GLFE 4I5EA 2JIQA 3DH0A 2GZRA 2JFPA 3D64A 1N6KA 3T9FA 4JOSA 4LTMA 1QV9A 1A9TA 1P18A 4FXPA 4TXHA 3ADCA 3FPFA 3AKZA 5ALXA 4IIUA 4K5QA 3VISA 5AP9A 3OCYA 4UXHA 4F72A 1DE0A 3QWIA 1AG9A 1J8YF 2FP4B 3HYTA 4AMVA 1XCOA 4G0QA 2FWNA 1ONSA 2CDCA 3GGGA 3N2GA 3SVLA 2ZRBA 2OYCA 3OX1A 4QHSA 1IOZA 3AI3A 3MELA 4H1VA 1WXQA 4RCVA 2JLCA 3RK1A 1ZHFA 2GT1A 3A6PC 1HE4A 3CQ9A 1V8DA 4Q3BA 3NM4A 1IY1A 4TZKA 3A1FA 3KO8A 4D4MA 4MWTA 1I3NA 1Q21A 1G21A 1XEWX 4X8OA 3STXA 3KYCB 3HZOA 1Z12A 1MX9A 1PYOA 5BWCA 4M36A 4PZAA 4I1RA 2OLJA 4LSZA 5ECYA 5ADHA 4INOA 4RF3A 3T7CA 4G9BA 4ZVLA 5T67A 1K63A 4AJOA 1GXSB 1V71A 4D43A 2IIPA 3C7KA 1ZI6A 3HXOA 1LSJA 1O08A 5FOSA 3T7EA 5JJCA 2A5LA 3BHIA 2JGJA 1N33B 4MI9A 4IXMA 3ZV3A 4BNZA 2VP2A 3NM5A 4ALMA 3GFRA 1FRQA 3O92A 2OC9A 3LQ4A 1SUBA 5IM4A 1GZSA 1GN8A 1E3IA 2BVNA 1FNMA 2ZJBA 1EJ2A 1CJUC 3KFXA 3ZHTA 1LK7A 1P77A 1YWGO 4O63O 1BWSA 3MERA 3SBOA 3D1VA 1I1QB 1T0IA 3AJ8A 3AHFA 3NORA 2AHOA 3FNEA 1DWUA 1H0KA 3GJXC 3OE7D 4L8LA 4B6SA 5GTDA 4QT4A 3ED1A 4PZ0A 4DG8A 1DU4A 1TVKA 4RZHA 2WABA 4JQSA 2G4CA 2DPLA 3R5TA 1NXXA 3R5HA 3VYSB 3H84A 3LFUA 5EKXA 4EGCB 2JGIA 4CKCA 1W35A 2YYAA 5BYKA 3E0XA 3NHBA 4R6WA 4BC1A 4RZSA 2Q5HA 3WLTA 4ARBA 1NJ1A 3TQRA 1W30A 2WD8A 2PYZA 3QU7A 1HSZA 4WERA 3O73A 1FSSA 1GCIA 1LLFA 2VJQA 3H6HA 5AYVA 4QKQA 1USWA 2IPLA 4FWIB 4NATA 2HQ1A 3HV2A 2F1IA 1A8IA 2CFRA 2WMDA 5CIYA 1O4WA 1XMPA 2XMRA 2ZULA 2BTOA 3B1KA 1C1DB 3T5GA 1MNQA 2AVDA 4FFRA 4C06A 4G1VA 1NMEA 5LA6F 4DUYB 2VLBA 1T25A 1R9NA 1K68A 1XDSA 3WYNA 5SZJA 4F3KA 4KKVA 4JBIA 5FA6A 1ESCA 2O52A 4O2LA 3L1HA 2AG0A 2W37A 4DIFA 3PDUA 4ZYTA 8GPBA 1II0A 2BYTA 4QDZA 2CXSA 4HZIA 1NPTO 2PUTA 4DNXA 4R71A 3EGWA 2XWQA 4LY9A 1QTIA 3EF3A 2FZWA 2JZCA 5H9WA 5AOCA 2XCOA 2NN3C 1S2LA 4FFSA 1A2QA 1MOPA 1QNLA 2R9VA 4PIPA 3IAAA 2FLVA 1LDBA 2VQSA 3HM2A 3VKVA 3T1TA 4ZRDA 1H2YA 5C52B 3GT3A 3TWOA 5ICFA 2H2AA 3A0UA 2P8SA 3UEOA 3AFHA 3CLSC 4F21A 2GZAA 2W2KB 3DEHA 3WRVA 4PSDA 3BE8A 1I4DD 4JVSB 1GNRA 1XAGA 1BFKA 1JDBB 1KPIA 2P90A 3LU1A 4JVMA 5DV9A 5CBKA 3TEFA 4UBKA 2PL9A 1I6WA 4JUIA 4QPJC 3SYKA 2OPHA 4HDKA 1SIOA 2OCDA 3GLHE 3NHRA 4DC0A 4DCSA 3Q3EA 3MS2A 5GIPE 3UAVA 1SXHA 1TEHA 1LW7A 2CW5A 2WOOA 4LWZA 1AK2A 3O8QA 1DBSA 4L4RA 4ZPJA 1NM5A 5FEMA 2E4VA 3L02A 3CNLA 1J0XO 1GDDA 1B1AA 1OXBB 3GARA 3Q9SA 2IYTA 3SQNA 3LUHA 4KX3A 5JCJD 5M5BA 2W0SA 5JS2A 6Q21A 1GFWA 4NC9A 1PZHA 2YUIA 4XDYA 1ZK4A 4RWEA 3VZBA 2BV3A 4INJA 2F55A 4BWFB 3LYUA 1PEYA 1E8MA 1EI9A 1HT1E 3NYRA 4QSMA 4EATA 1BMFD 3PENA 3VDQA 4ZN6A 4OG2A 3DEAA 1B3BA 3AUYA 2GPBA 3QEAZ 1M1UA 1Z5WA 4RTKA 2ANBA 3OLXA 3CWQA 4JLWA 2XQGA 4K26A 3RYHA 5CW1A 1NYQA 4CKYA 3QSGA 4CN8A 5KTMA 3M5CA 4FX2A 2WRZA 1SRRA 3K35A 2FMFA 3VPAA 3WLRA 4BEVA 3IQGX 1NBHA 3OZEA 4C05A 3CRVA 1CUXA 3HJCA 4MX8A 4Q03A 2FFQA 5CYOA 1TE2A 3OQOA 2VT2A 3K9BA 4KRGA 4MV1A 4OU4A 2I66A 1YCDA 3ZI0A 3BWVA 1ULUA 5HF8A 3T06B 2CMKA 1YQEA 2GVDC 2QTHA 3E5NA 4FMCF 4YXFA 2AFIB 3FY4A 3FDZB 2BD0A 3MT0A 4PNHA 1XUOA 4E1AA 1ECBA 1YRWA 5A2GA 1VKZA 2GXSA 4Q6BA 1KDTA 2FJUA 2JCBA 4JBHA 1ECFA 2OWEA 4CF4A 4RABA 4G0YA 4D97A 4E2YA 3SBXA 1PGQA 2ODAA 1KYTA 4YJHA 3WZMA 2Z6AA 4G2TA 5DP2A 4A36A 3UBTA 1N5MA 3GFVA 1ISIA 2GB4A 5EIFA 5FBKA 2H4JA 1HQYE 2XNHA 3AM1A 2G83A 5CVDA 3KAPA 4LGMA 4DNPA 4DYHA 3BPSA 3GA5A 2COEA 4MUEA 1NNLA 3WTBA 3KYJB 5REQA 2J08A 3FOFC 3R40A 3E5HA 4F1JA 1AIPA 2VTKA 2DECA 1QHHA 3AETA 4XUCA 5E38A 4H7IA 5K1ZA 2Z8YM 3FIUA 3PC6A 4ZAGA 1AKEA 4PV7A 4E15A 4QTTB 3RRXA 1GV1A 1T2EA 1QR6A 1PNTA 2PGJA 2HPHA 5F7XA 4BECA 3TW0A 4W82A 1U7TA 5SY9A 1IEVA 1QHYA 1LSUA 2ZIWB 4A03A 4B76A 1GSHA 4N5MA 3K5PA 3WV5A 1QMPA 3WGMA 2W2PA 2AYXA 3O94A 3KYDB 3ZHRA 3NANA 5KNCA 3C8ZA 3KKPA 2ODWA 3L7MA 3RTBA 4JGIA 1X8JA 1E2LA 1EUDA 1E0DA 5KVSA 1Z0IA 2YW9A 2AQKA 4OSPA 4ZKEA 3KHSA 4G5HA 4KPFC 5A7GA 3HJNA 3OLZA 1UADA 3JQ9A 2KPOA 4N1AA 3VX4A 2YWJA 4IDCA 4EVSA 5ALPA 5T3YA 3TZEA 4IFIA 4NZMA 4JXXA 1UAAA 2NYVA 2AFRA 4UTXA 3SFTA 2PVPA 4V0KA 1UBOS 4OJNA 2VRCD 5JZ9A 2GCOB 4FBGA 1NQWA 4TVOA 5CHEA 2C8KA 1D6JA 4BZWA 2PNJA 1SEPA 4AMGA 4J03A 3L49A 2A7QA 4UMVA 4QOIA 1WW8A 1CRWG 1UP6A 2LD4A 1ZJWA 2NT4A 3LP8A 2OK7A 4ZT7A 4EO7A 1PBNA 3SC3A 3CU5A 1QTQA 4Y6LA 2H6EA 4IGAA 2NO7A 1JTFA 2QIPA 1XAJA 5DKFA 4D3DA 4PCAA 1DI0A 2FZ5A 5KTYA 4YCNA 3TNYA 4HGNA 1FPQA 2IH2A 2Y1DA 4O4LF 5T4BA 1L4GA 2WPNA 2V4UA 4GGMX 1CZRA 3GDGA 3DMPA 3OUUA 3SQLA 3GP8A 2O07A 2WQZA 1N6OA 4MCIA 5E95A 1UH5A 3L7YA 3G17A 4BNIA 3DZGA 4X41A 1GGKA 3GHYA 5CD1A 5LZ5A 1QVWA 3HA5A 4H18A 2AMYA 1OHHD 2NXJA 3I2YX 4L95C 3I92A 1KJIA 2GN9A 4CTNA 4CKWA 3OKPA 2M6RA 1BSVA 4Q9HA 3S8EA 3DV2A 4C7OA 1EFPA 4YPOA 3ONNA 2XA1A 4FGUA 3IIJA 4CF3A 1K6XA 3GLIB 2GF0A 3RG2A 3O1LA 2XIJA 4QASA 4BLWA 4REOA 4GNRA 5L3SB 4GX5A 1OFTA 2VZ0A 3LQ1A 1LNZA 3N58A 4G0NA 3DMTC 2PT5A 1YUBA 2HV9A 1XMIA 1MFPA 5DGCA 5I9SA 1KU6A 2JFUA 1MRSA 5C4IA 2IX3A 5JDCC 1C3OA 1QLHA 2QPTA 2P9GA 4RPGA 3BDAA 1TF2A 5AHXA 2C1XA 2DOKA 3TN7A 3W78A 1O89A 4YMGA 4PG5A 5AJZA 5H16A 3MTDA 4NXMB 2NUPA 2CJWA 2G36A 3C5EA 1MC1A 3ZVMA 2X13A 3OHPA 1SOMA 3JARA 2AOVA 4LECA 1NN0A 4FYJA 5EKUA 2H7VA 5ARCA 1Z08A 3CUEF 1CEQA 3QFRA 2BF7A 5IUKC 5K4AA 1XWFA 2D5CA 3NNDA 1DO0A 1Q91A 5AOBA 4DZTA 1ZM4A 1F7UA 1UFRA 1FRFS 1I1HA 1RBQA 1K1EA 1B3RA 1UK8A 2E55A 2X6QA 3GXOA 1T4DA 2FW8A 4BRUA 4ECAA 3LTNC 1Q6YA 4U00A 1ZINA 4M8IA 4JL5A 4QLOA 1IBSA 3M6WA 2HHCA 1E92A 4Y3UA 3OTOB 3FKJA 3G2JA 1ITZA 1J09A 3O2NA 5CHYA 4Z9BA 1ID8A 3VKGA 2P77A 4URWR 3WLMA 4TSFD 2I87A 4IXDA 3K2EA 2RC5A 1L7OA 3PQEA 1ZL2A 4GYKA 2R44A 1A4RA 3B9QA 3ZC3A 3BFKA 2MWMA 4DCMA 4UOEA 3AH8A 1GFSA 4Y7CA 2WAOA 3OIVA 6NULA 3G2QA 4WKCA 2ASVA 1KS2A 4PRLA 1CC1S 3HXPA 4RZ3A 3SM3A 4CIDA 4ID3A 1XEXA 4E5UA 3RYIA 2Z43A 3D7LA 4BFWA 1SOWA 1Z0FA 4QPPA 2VF7A 4MIOA 3FD8A 1DJPA 3H2SA 1Y5RA 2JIOA 3ELYA 2IIQA 5LQRA 2ZFUA 2Q3BA 1VHTA 1A50B 3EIXA 3G3EA 5BYJA 3WZ2A 4Z4CA 3ZCSA 4BNNA 1W5TA 4J6FA 4NBSA 3N07A 1DXYA 5K5EA 5FWYA 1QOPB 1NAIA 2YDXA 3ZDQA 2Z8YA 1LI5A 5HZGA 4J0HA 1LGYA 1XA4A 3Q3GE 3IDZA 4XX1A 1OFVA 1NR5A 3LWBA 3EDQA 2AE1A 3IJPA 3OIDA 2C83A 2WWVD 3PHJA 4P31A 4OQDA 1L7QA 3A1NA 2AX3A 1D2MA 4MRMA 5ALIA 3FTPA 1XXHB 4TS9A 3E3AA 1YRHA 4CMKA 3P9PA 1FDTA 1ZXLA 2CKMA 2WD9A 3NYWA 5FPTA 1JU3A 3U6KA 3PUJA 1LPNA 3KZKA 5JPIA 4JI3B 3WVNA 2O1WA 1F38A 5KWSA 3U44A 5I3ZA 1NT4A 2YWDA 1QU3A 1L3BA 1W5EA 5IN4A 4HB3A 3IAM6 4F38A 4MP6A 2HA6A 1W1UA 5ERGB 4F93B 1XT6A 2O8FA 5CA0A 5DBOA 5FR2A 2QW1A 3HEAA 3IESA 3KJHA 3NDRA 1AXEA 1XNJA 1RSZA 4LQCA 1TA9A 2NV6A 4W6ZA 2ESRA 4AP9A 4YT4A 4PNZA 3COPA 4OI0A 2IUYA 1ONNA 3NCTA 3U13A 3K6KA 5GZ6A 2B92A 4V2UA 1JBKA 2J59A 5JALA 2V7EA 3IDSA 3IMFA 1BXKA 1RTTA 3BSFA 2IYSA 3P4YA 3RW9A 1CB7A 1VJ1A 4TPKA 2H5IA 4MKZA 3AJRA 5JC8A 1GPBA 1H4VB 3CUUA 1EDBA 4BS9A 2P78A 2WJPA 1T2CA 3OZWA 1KPHA 3SDSA 3BUSA 3L7JA 4BMVA 4DDUA 3TFQA 5CXUA 3I9FA 4ARCA 4M1SA 1P4GA 3GP5A 1GKUB 1QRUA 3ZDYB 4WASA 2R6FA 4BTEA 4CV2A 3VPSA 1U99A 1UOEA 2FEKA 4U7JA 2YRWA 1J8DA 1KSFX 2C54A 2C58A 3O3CA 2AF4C 1AZSC 2Y1FA 4LQDA 3EUEA 2C57A 4IEEA 4GZ3A 3PFFA 2VJMB 4K6OA 3BGDA 3WJ7A 1OT3A 4EJMA 2WUDA 2GFQA 3W9SA 2YL2A 3BT7A 4LBVA 1DBWA 1TGYA 3ZE8A 1KZ1A 1VJTA 4ZZ2A 1H2HA 1P91A 2HLNA 1FOEB 3K16A 4HVAA 2G17A 4J7AA 2CVPA 3HDJA 1UPFA 5FF9A 2JPDA 3C6ZA 4B0OA 1N8TA 4PCVA 5G3ZA 3D8RA 3FYUC 4O29A 2H9AA 4NONA 4R01A 4WQMA 4RK5A 1U2PA 4HL6A 1MT3A 1I7SB 4XVHA 5KYVA 2G09A 3GFQA 1NW8A 3EXHB 3IVMA 2HJVA 3QRWA 1P7CA 3W2IA 3WLPA 1N2CE 3FOBA 4EO9A 1RMYA 4HNRA 3HVRA 1XPOA 2VUUA 2OM6A 4KGXA 1ODCA 1DIOB 1TEXA 4KTTE 4DXHA 5DBHX 2NW6A 3D7MA 2GLXA 1S2OA 3KD3A 3SQDA 1M7HA 1H4SA 2W11A 3G1UA 3IAUA 3BRSA 3OZ7A 1R8QA 2BCJQ 2WFAA 3DCNA 3OPMA 5EQDA 2ATEA 1ZR2A 5EHZA 2GA8A 4CU5A 9ATCA 4MW6A 4F4IA 4II3A 4WY2A 2HBYA 2V55B 2SCUA 1GUFA 4CIYA 4ZGGA 3JXEA 2RGUA 2AG1A 3LPDA 4LOKA 3LUGA 1P7PA 4GZ6A 1XL0A 1U2QA 4F7WA 4M1QA 3EG5A 4V0ME 1G9TA 1FMTA 4CLOA 1AUVA 1THMA 1I5OA 4Q3OA 1BROA 4O1MA 4RVFA 5LPNA 1VIYA 2EBHX 1LK0A 4CODB 2ZXUA 5EXPA 3P9SA 4J3NA 1J6UA 4GWGA 4JUFA 4EGSA 4JJKA 4E4RA 5GJBA 2IOQA 2PH5A 4DLBA 4HYEA 3KPUA 1KGDA 2JJ2D 1GEEA 3QMMA 4CKCB 1R9MA 2UUCB 1R6TA 4B8ZA 4N3AA 3ZW9A 4NU8X 1GKLA 4AYXA 3MHTA 2YZ2A 2QMQA 1R0XA 3O31A 4MUNA 1RXYA 3UWMA 1S8FA 4B5LA 1YACA 3DO6A 1YE3A 1ZRHA 2Z9CA 1XVVA 4O4LB 2MU1A 3AESB 3C3PA 4OMFG 1SZCA 1YOVA 4A0HA 1XMOB 2QM3A 3FZQA 4G1EB 3NWOA 3I3OA 1IMJA 5DW3A 2CLCX 4NZOA 4XYBA 1VYVA 4AWXA 3GELA 2NO5A 3C1TA 1QBGA 2JEOA 3IBYA 1V96A 4GMFA 3QY9A 2X0DA 3WOHA 3QMWA 5EAIA 5TPZA 4MI1A 5EJMA 3L4KA 1Y6ZA 2E6KA 2FWAA 1CZLA 3RF7A 4DRYA 3LYHA 2YQZA 1H2BA 4QYIA 2OL4A 4NULA 2B2XA 4LX0A 2PWYA 4FFMA 4R3UC 2G3YA 4RVHA 5K2MA 2DFVA 2OP0A 3ER9A 3TRKA 5BT9A 4MWGA 3M83A 4P7KA 3AR6A 2IYVA 1E7SA 4BQIA 1EFRA 1PR3A 4LAFA 5DU2A 3B2EA 1M6VB 1UM9A 3A3NA 1WZ2A 4B09A 1XZHA 3QE3A 5FUBA 1QIFA 2GESA 2HLPA 3QUSA 4KXNA 2PUGA 2OLKA 4ZV4A 2Q4TA 1CVIA 1G38A 2ZZNA 1YS4A 1RWMA 2EX1A 4JXZA 3PX7A 3RUCA 1GG2A 4MV5A 3TRDA 1A77A 2CVQA 4LGVA 1CJCA 4LE1A 1OA0A 2A9QA 3CLRC 3CLSD 5F5XA 3AGQA 4R0VA 3RJ5A 5LXTB 2IEBA 3AC0A 1I3LA 2OXRA 5L3RA 4BDTA 2FMUA 1T8TA 1ODLA 5IDYA 5L3VA 3AU9A 5I7VA 1CR4A 1D2AA 5DK6A 2YFHA 4Z4QA 1Z28A 2PWZA 1YHNA 2PRSA 3FB1A 1U0HC 3AF0A 3E4CA 4IAOA 4KXVA 2XB9A 3PQCA 3V46A 2ZXEA 3EXIA 2QLMA 1YB1A 1P31A 2DKNA 4QDXA 2RGGA 4UHFA 4MVJP 3UN1A 4M1ZA 2QTLA 3Q7PA 1IBLB 2ZM6B 1Y37A 1F17A 2Q4BA 3HMKA 3PRHA 4I9NA 2FPIB 4WZAE 4CEHB 4TQGA 5ILQA 3AB7A 4LFAB 5HSGA 1HMPA 2H1LA 2BMFA 2AFHE 2PRKA 2PL1A 1E99A 2R2GA 3Q8WA 4LDQA 4OFBA 5DM2A 1E3WA 1RI1A 1YFKA 1C7RA 5JSYA 3VYUB 3WGHA 3TCXB 5K4HA 1WXIA 3Q9UA 2FKNA 3WJ2A 4YQFA 5CDSA 3CURA 3CEHA 3QBJA 3AB3A 3U4AA 4Q3KA 1FFWA 3Q5DA 1COZA 2HDNB 1M54A 4BFYA 2DFLA 4RDIA 2F8TA 3GFSA 3FZYA 2OP1A 3K96A 3QQPA 1SD1A 5EMJA 3T3EA 5LD2B 1S8OA 4GSYA 2DB3A 2IDKA 4DBLE 3WLHA 1G7CA 4U2FA 3GWZA 3QU9A 1DDOA 4V1CI 4PO3X 4Z2YA 4MDFA 5EWJB 2X5NA 4LC9A 1G6KA 3AB8A 1COWD 1LW6E 1A1SA 3H6KA 4L5AA 3TDKA 2B37A 4CM4B 2B94A 2HPVA 3F78A 3I8OA 3AERA 3UT6A 2RI0A 5I48A 2OOKA 2ABWA 4BFCA 2EVWX 1IMOA 4DY4A 1WZNA 5TQ0B 1KEKA 3PNKA 1U0LA 4RPCA 1CS4C 2DWOA 1RC0A 3L8YA 2XD9A 4FFBB 4OBWA 2XZOA 4X3OA 4AXXA 2YYZA 2XNCA 3ETCA 3LUJA 3JQAB 4KJXA 1KRXA 4DSTA 3I9NA 2W2XA 2Y1KA 3EVBA 2D59A 1V1RB 2AL7A 1NM5C 3MJHA 3UHFA 4Q18A 5B12A 3U7QA 4AKIA 4B4KA 3HCAA 3ZE2B 2QN1A 1NJ6A 2CCJA 4U2CA 2HUNA 2QI9C 3EIFA 5ICMA 1NVFA 2HJWA 1W29A 3NONA 2XGMA 3P5SA 1UPUA 3RNLA 3QKRA 3V55A 1EXWA 3QE0A 5BR8B 3G2HA 1K27A 2FY8A 4PXYA 2EJCA 1P72A 3QUCA 4HR7A 1YI1A 5DVZA 2A30A 2ZI6A 3VR1A 3WLFA 4K8RB 2BI8A 3S70A 1VMEA 2EYUA 2W6QA 5TT0A 4LJYA 2CVZA 5BVGA 1JFFB 1PL6A 2OBNA 1B7GO 3I37X 1HEIA 3H9BA 1OX4B 4WZZA 5EI5A 1LQ2A 3TI9A 4CKBA 1JXMA 4RVGA 4UJ3A 4QTUB 1CV2A 1J39A 2G4LA 3QPVA 3I8SA 5KBYA 3HKBA 1Y8ZA 4XUEA 4LDJA 3NI2A 1PJ8A 2B6HA 4WADA 2PX0A 1MAUA 3TCKA 4MEBA 5HOQA 3O4HA 3HA3A 4ZT5A 1FX0A 4BNYA 4UHKA 5AI6A 4ZI5A 4D6PA 4A6DA 1EFCA 1P33A 1MAVA 4EYSA 1DRJA 1MJNA 3FFAA 5IVPA 4KR7A 2OMEA 2KLHA 2JEZA 3U3XA 1EVJA 2LPMA 2P6NA 5E9QA 2I71A 3CUWA 1LB1B 3FPEA 3GH3A 1A76A 1OTXA 2XLCA 3UZUA 5HOEA 3FLBA 1B15A 4DQVA 3FAKA 3F0TA 3WGIA 1Z4JA 2O4CA 3M6AA 3QU4A 1V8PA 1KSGA 4ZVKA 4UM9D 1I1NA 1SQGA 4Q4DA 4J07A 3S28A 1BE0A 4I4TB 4O4JA 2AZTA 1GPLA 1HNXB 2YHIA 3JAKA 4K9MA 2GR9A 3IP7A 3UCEA 2I33A 4KIWA 1L6IA 4AXBA 3AEUB 4DVJA 1FXUA 1AGRA 3M1YA 3CEPB 2I4NA 5G4KB 2H4ZA 3ADDA 2APJA 3I8XA 2BMAA 3HFGA 2NPFA 1JKMA 1NFQA 4OI1A 3UIEA 5L3QA 3KQKA 5J9FA 2PRZA 2YHBA 2IYFA 3R3XA 5JBNA 5CW2A 2C7QA 4JI5B 1BOFA 2BUBA 1JDNA 1KH1A 2ANCA 3O0TA 4MKRA 2A59A 5EKTA 5J2UB 5AUNB 2BL4A 3R4VA 1E2JA 4OX9B 1LBIA 4IDNA 3SU8A 1HH4A 1TCUA 4KE8A 3C4JA 3WO1A 1N9GA 1XDBA 3C3EA 1LRKA 2AE2A 4ABTA 2N75A 1E9FA 1XE3A 2C7BA 2ZIZA 4CG0A 3SLGA 2PZGA 4ZGWA 5I4IA 2IODA 3AHDA 2C2YA 4CKEB 1BGXT 2QLBA 5AJVB 3RTCA 1K3TA 4S04A 3K5WA 3L4BC 1X38A 2CNWA 4IJKA 4WNYA 4I2VA 4EHKA 3UW3A 2BMEA 3UHAA 4FSDA 2VHQA 2ZREA 3LZDA 5FBRB 3RIEA 2NV2B 2O19A 1E7WA 2IPNA 2C9OA 2GBCA 2WWXA 4XR4A 3U48A 2VQEB 2GAFA 3CLTC 4XA8A 2IYNA 1HE8B 3IR6A 4ZU1X 5JO9A 1AMNA 1PFGA 1GUZA 5JVDA 3U7FB 1PKXA 1ORHA 2F59A 4WDQA 1W9MA 2PAFA 3IXQA 3PQ6A 5ALZA 3VH2A 2IDJA 2RGDA 4ME6A 1S96A 2IYRA 4EL0A 1YQQA 1RJEA 2EOAA 1BHQ1 1KVUA 2J9RA 4E5SA 4JUBA 2FSSA 5JQGB 3GLFB 3B89A 2P65A 1LC3A 3KJNA 4ZVNA 1YZNA 4JU8A 3RYCB 1ZM3A 1ZKDA 4IVNA 1ICEA 1S1CA 1DKNA 1AM4D 3JVIA 4HGYA 3S2FA 4LN1A 4R8MA 4MR7B 4IF6A 1U8EA 4Z0HO 1ZDMA 1MV5A 4X8LA 1TZ2A 1C9YA 1C9NA 1XK7A 2YDYA 4B79A 1TQDA 2MSDB 1LX6A 2HDWA 3F96A 3TKYA 1U98A 3KQQA 2WJ6A 3NRCA 4FKZA 4MAAA 4TWIA 4V39A 3UMGA 2Q6VA 1OH6A 1DQYA 3LT4A 5CX1B 5EJFA 3SHFA 1MN6A 3EEFA 3VYVA 2VUHB 5JAUA 5FCDA 1AKYA 4YQZA 1GRRA 4JU9A 2BEVA 5KOJB 4YJFB