1SBQA

Crystal structure of methenyltetrahydrofolate synthetase from mycoplasma pneumoniae at 2.2 resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
164
Chain Sequence
b'MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIINDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-Methenyltetrahydrofolate synthetase homolog
publication title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Ligase
total genus 45
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1sbqA00
3HXTA 1SOUA 3HY3A 1YDMA 1WKCA 1SBQA 2JCBA 3HY4A 2G40A 1U3GA 3HY6A 1U3FA
chains in the Genus database with same CATH superfamily
3INRA 3V80A 4ALLA 1GR0A 4G1EB 2N47A 1KVQA 1SCIA 2B1JA 2XDQB 3HMKA 2FG5A 1MNQA 4KJZA 2PJRA 2Q1XA 4KQ2A 3EVNA 2X9VA 3PF9A 3DZKA 1COWA 1SD5A 4Y0AA 2CDCA 4YQYA 2GAAA 5BQXA 2BFDA 1F6BA 3OTOB 5FHRA 5SZJA 3WISA 4DJJA 2XZLA 1LDYA 3F4LA 4X94A 4GPEA 4J9UE 1P4AA 3GJYA 2REQB 2NTEA 4W1SA 4MO2A 2PBLA 4IM7A 5AI6A 4MUGA 3RC1A 1BXRA 3DMTC 3PHLA 1M72A 1P62B 4HEHA 4Z1OA 1Z35A 3W7AA 2AYYA 1UAAA 2C2XA 1YQEA 3R5JA 3VPSA 1ST3A 3IR7A 4YO8A 4IJVA 1JHDA 1IBRA 1L7MA 521PA 4D56A 4PANA 4DDWA 2YMLA 1C9YA 1CLEA 1G16A 4P7GA 4QYWA 3JQAD 4F7WA 3RSZA 2GB4A 4XQGA 1MU0A 1HBJA 3A9UA 4J1TA 3IMEA 2BTOA 2OAEA 5H82A 1GTG1 2JATA 2G8LA 3TUJC 1TK2A 3DCJA 4N3AA 4P4SB 2IX3A 3F96A 2AE2A 2X0NA 2VL7A 3KM0A 4QDKA 3CVYA 3H9UA 3ONVA 4R68A 4IJWA 2CD9A 4GBED 3D3EA 2NYVA 4EYEA 1GO2A 5BSGA 4O08A 1N2BA 2VEDA 3LKDA 2J3IA 3KDSE 1ECPA 4TQAA 4IIXA 4W5JA 2V3WA 3KEMA 2XLBA 4E3WA 4R05A 3YASA 1DG1G 1IEWA 1XD8A 1Y1KE 3TG2A 1S8FA 1UEJA 8ADHA 2X9NA 3G7NA 3LUKA 2QLLA 4OBWA 4K8RB 3DMGA 4Z0NA 2J6CA 3DFKA 3LI2A 4KU4A 4WK6A 4MS4A 3KB8A 4X8LA 4EWLA 5AVXA 3C8UA 1JMKC 5KYUB 2NXCA 1X38A 4H9GA 2Y1GA 1CUSA 1H0SA 2FKAA 2HC9A 3RC7A 3SSOA 4EUKA 4OY3A 5DXJA 1CJUC 2A57A 1GYRA 1HE5A 1DOAA 5DNAA 4N0PA 3PC3A 2NX2A 3NOVA 4J0JA 4QU8A 5WRFA 1M34A 2Y9MB 3FSGD 3QLVA 1QGUB 3TSWA 1EUZA 1GL7A 4M21A 2WV9A 2X1MA 1LDNA 5IWCA 2C88A 3W3ZB 4Q82A 3TM4A 1ZOOA 4D3SA 3RSLA 2SNIE 3OTIA 3Q3CA 2FR0A 1C4XA 2IBSA 4HPWA 2ZANA 4Q4LA 3WWZA 4N49A 4TVKA 3EBOA 1PS9A 5IKXA 1CZHA 2ONKA 1GFZA 3BG5A 3MTBA 1QOZA 4IDEA 4BX3A 4IUDS 5EIWA 5EERA 3VDRA 2HF2A 2HQSA 4LGMA 3L77A 4M1OA 4C03A 1EX7A 3T12A 4KYVA 1KZ6A 2BUAA 1L6RA 1Z74A 1DIRA 3EXG1 2JZOA 2G6BA 3MGKA 1L4EA 5IP5A 3HG7A 4UE2A 3MMNA 2VRCD 5JDCA 1PJ8A 4ZA2A 2EFJA 3AZPA 3QVGB 2R7AA 4Q16A 3ZS8A 2PXHA 3DOUA 5JPCA 1RAEA 4QM7A 4CZ2A 4OQ4A 5FA5A 1MOSA 3KCNA 2QNBA 2P5YA 2FPKA 2YNMC 2Q6VA 3VO8A 5HSGA 2XB6A 4MS1A 3FB1A 4PO3X 1SEPA 1V2HE 1I0IA 1HYHA 4XB6B 2C9OA 3VVMA 4DQXA 5ITVA 1BFUA 4GWLA 2PZGA 3DAYA 4WACA 5A9TA 4G0NA 5SYMA 3TRHA 4ETIA 4NRDA 2XUQA 4P7KA 2AWOA 1P0MA 3OEWA 2OHIA 3QEMB 4IDFA 4D9BA 4F4CA 2B61A 2CUKA 3JSXA 4QJ5A 4LMRA 2EZ9A 4JI0B 2LGJA 4ZVQA 3IXLA 3JAWA 3F6YA 3IAS1 2IZ5A 4IDBA 4IIFA 2XNSA 4OQYA 2W2LD 3Q15C 1GUYA 4HH1A 5CVDA 3JALB 1Q0RA 3IOCA 4MH0R 1V9SA 3U9SA 1WB5A 2G28A 4JB2A 5F4ZA 1Y3DE 1V9LA 3FOFC 3L4KA 1V6SA 3ONFA 1PUXA 2I80A 3LECA 5F98A 3E1GA 4M99A 1DU4A 4TV8B 4E07A 1SUDA 4QAJA 4FCWA 2WJWA 2WU3A 1T3LA 4GRAA 4ON9A 5E95A 3FY4A 1DAMA 1OYWA 2FP3A 3GEDA 2LR0A 2I3GA 1JDZA 5CU7A 2LCQA 3UAWA 4QGGA 1JDPA 4D8UA 1TC2A 3IDOA 2HK6A 3BXHA 3FCUB 2W6JD 3TI7A 3PR2B 4MYUA 4LF5B 3WZMA 1KZ7B 1OZHA 2AMFA 5I7HA 3KSAC 1GHTA 5B7NA 1L8LA 3QK7A 3UJ8A 1UPBA 3L5KA 4YAKA 2J67A 5K99A 1OAKA 3GP5A 3VV2A 3BM5A 1AUXA 5M29A 2E4YA 2XDQA 2F8MA 3FNGA 3WWDA 1M7BA 3WRXA 2CXTA 2QV7A 4OHXA 4YGXB 3ZD6A 4YC7A 3LRPA 1YV9A 4Q4CA 3RVJA 1D8TA 4D3YA 1ACLA 4HAVA 4QOSA 1GKUB 2HK9A 3TDKA 3VFDA 1SPBS 1SK8A 4FGWA 1QKKA 1L5VA 1TJNA 2CVPA 2REQA 4J4HA 4J7XA 4G5XA 2LCFA 2FUG6 2EJBA 4QAQA 3VKFA 3K4QA 2XUFA 4UJ3A 3MT9A 4RANA 3S2EA 1R4ZA 3ZZ1A 4BNIA 1NG1A 2C78A 1WBDA 1SN7A 1D1TA 1T9AA 2QJFA 4NBRA 4TV8F 1FTQA 1XTRA 3QBEA 4A2WA 2I2WA 3QM1A 4P7FA 1JGTA 1OASA 1BE0A 2PL9A 3EC7A 4LYEA 4WLEA 3WC4A 1ESMA 1L5YA 2ORED 1H9CA 1EUDB 4ES6A 4XRRA 3AZQA 1YKFA 4M8LA 2RJOA 5K2OA 1HGXA 3HU1A 5EQTA 2I8LA 3ZLJA 2BGGA 4P4SA 4PE5B 3RHSA 2GTIA 5K0JA 1K1EA 4S04A 4BUCA 1VC2A 4ENTA 1F17A 3MWLA 1QX3A 4I4NA 1TYBE 3PD1A 1OPRA 1WPRA 1B15A 3OZIA 2C2OA 1ZICA 5T5QA 2C5GA 3QU9A 5DYTA 3S2IA 1AKUA 4HNVA 1FYWA 2ZIXB 2JIQA 1Z2EA 3VDXA 3W2TA 2G4LA 2VZLA 3L0BA 3NT2A 4XEUA 2ZRGA 4OJQA 4KREA 4BP8A 5AUQA 1KO7A 2NADA 1NT2A 4A27A 1YFLA 4H77A 5LYJB 2I33A 1SZDA 1G9TA 1Y8ZA 3EZYA 5KYUA 4FDVA 4TV9B 5DOZA 4JJZA 4MX8A 4BEVA 1ITZA 4KE8A 2HOQA 2HWKA 2XMCA 1K7CA 1ULAA 5CAEB 1BHSA 3DWGA 1UMBA 3I2YX 3F1KA 4J49A 3U49A 4WECA 4F38A 5A5GA 1VG9B 4AMUA 4CMJA 3RBXA 5AVOA 2DHRA 4OXYA 2IHTA 1DDOA 2K2WA 3F46A 3P94A 1QGUA 4J4TA 3ICWA 4MA4A 3S81A 1R6DA 1T9GS 4B7XA 4DT1B 5MN4A 4JL5A 3W0LB 1J99A 3P96A 2EFEB 2Z2KA 1X6VA 2OCAA 3KFXA 3WXBA 4BZPA 1ESZA 1KGDA 1ID1A 3C24A 3IQFA 4RMHA 2PUHA 4AL4A 1S8AA 3NHLA 5TGZA 4CVNA 3QZUA 2Y8EA 5H7XA 1HX7A 1WZUA 4R41A 5AW5A 1IB0A 2ZT7A 4B3FX 1FUKA 2HYIC 1YNOA 3QJ5A 2NOAA 1MORA 4EEZA 5BW4A 5CCBA 4UMFA 4DUGA 3IILA 4B47A 4Z7OB 3LFUA 2C95A 1N5LA 1XYVA 2WUDA 3IQGX 4OL9A 4QU0A 3WJAA 5DRTA 4YRNA 5JYEA 3S8YA 2IH4A 1QG2A 3HN2A 3QVGA 1UJ6A 1CUWA 4C3VA 1U0OC 4TMWA 1O6FA 3BE5A 4ND5A 1C7ZA 4KB5A 5LYJF 1RI5A 4AWBA 4Y2SA 2V8BA 4BIIA 4TV9F 1MB2A 2WWWA 1NKTA 3G8YA 3GEMA 4S1NA 5DJ5A 2ACEA 4ADSG 4AUMA 1XFAA 3NRBA 3BXFA 1WDMA 3O3NB 3OP1A 3BBPA 3EDYA 2MWMA 4Q47A 1NHWA 3ZD9A 4B1FA 3ZZNA 1FYVA 1G4AE 1KQ3A 1Z82A 2B35A 2NN3C 4TS4A 1MCZA 1RWOA 3EGEA 2EBFX 2QTAA 4J7AA 4HS4A 3UB4A 4YMTA 2O1WA 1RMQA 2I54A 1QPBA 3GRAA 3ZDAA 5ESDA 3QEMA 3I2KA 3IQEA 3TR5A 3B82A 4MVJP 4C3UA 4D8TA 1RRPA 4PLFA 3KPYA 1MAVA 3W2FA 1OC4A 3GMDA 3TL3A 4BZQA 2VQFB 3EWAA 1JHPA 4CMGA 2JIRA 3AILA 4IKEA 4D4HA 1PVVA 3JALA 1GEGA 3KQNA 3UIEA 4DXAA 4C05A 4XQ0A 3JWGA 4IEIA 4PS0A 1LRLA 4CHGA 4I1OA 3O7MA 1IULA 2I9PA 2WUFA 4F11A 4TV8A 5J3JA 5DCUA 3BOSA 2Z08A 5DWVA 2HQ1A 3GBPA 1ZIDA 1ZIOA 5P8WA 3GFBA 2DGDA 2KE5A 3G5UA 2Z57A 1YZUA 3LY5A 1U0GA 1DOZA 1JZQA 2FMHA 2MR5A 4X7PA 1IJBA 4AY3A 3PGXA 2O2HA 4ZCRA 3BWBA 4YFVA 3HZRA 2WTAA 3REQB 4PS1A 1GWNA 2QTVB 2AFIE 2PBRA 4H2DA 2AFIB 3K16A 3ONEA 4M87A 1JR3D 2GK3A 4RSGA 4DV1B 3CBQA 1QV9A 1K3FA 1JPJA 1UBGA 4M1YA 4DLTA 2IXBA 1EGMB 1Z33A 2I6XA 2YV4A 1DUSA 4EA8A 3SXUB 1D3AA 4Q1CA 2JASA 2KWIA 3EE6A 5CNJA 4B46A 5E7JA 1E96A 3QX7A 4U7WA 4RVCA 2VNHA 3SEAA 3SYTA 4C87A 4EG0A 3OHPA 3OTGA 4WESA 5FA8A 3S0JA 1SJ9A 5JEDA 2OQVA 3KHKA 1KFKB 2AK2A 3GZNB 2B5VA 4TTSA 5JRDS 2YVQA 1ZP6A 3KB6A 4K9KA 3K1JA 1DX6A 1EK6A 4ZOLB 1U1DA 1QNFA 1ZRNA 5GJWC 4B9EA 4D6PA 2P2NA 4D92A 1RWQA 2BSXA 4M86A 4DN6A 4D80A 1VB5A 3N5CA 5L3RA 2CE2X 3A6JA 4FHGA 4HVCA 5M04A 5DNVA 3T9CA 3L6DA 3TKYA 3CVVA 1UADA 1EUDA 5KYVA 4HNQA 4TS1A 3N70A 1CR0A 1Y48E 2BF7A 1RQRA 4LJSA 1EXMA 5BN1A 1Z62A 2GPWA 2XV1A 3AHJA 3B78A 1IBSA 4PLZA 2GYYA 1U2ZA 1PSWA 4RKRA 4O6VA 1JBQA 2YC4C 3JVDA 4DBZA 3RUFA 4DQ0A 1LQTA 1TO6A 1HTBA 3A6DA 3ETJA 2HCRA 3DZ8A 3IIIA 4J0IA 4QG7A 2PT9A 4XYGA 3UWMA 4CT0A 5LUAA 3FMPB 4Q9JA 1I7PA 2ZIXA 4HVAA 3THSA 3ED5A 3H5IA 5JZMA 1A2QA 2IU3A 3DHNA 5A3RA 1EWKA 3WYCA 4GM1A 3NNSA 4YX9A 5LYJA 2PSFA 1Z63A 3EDQA 3HR4A 2X5XA 2JJMA 3NTXA 3EWNA 3BXXA 4TV9A 1XKLA 1MFPA 3A4NA 2CL5A 3D2LA 1GDTA 4KHZA 3D54D 5JNWA 5CAEA 2JKVA 3L07A 4KN9S 2QL9A 4RTJA 2GHIA 3F7NA 2C31A 3DMTA 3OIDA 4ZOLF 3CCCA 3F74A 5K3DA 1PK9A 2BM0A 1TPYA 4OHVA 4LPKA 1J6UA 1ZZEA 1DBRA 3O74A 4GVLA 4DT1A 5ED4A 2CL0X 5A62A 1RQ2A 4FYVA 3DKPA 3ICQB 4D4GA 2HIHA 1PZHA 2Q9AA 4G2NA 3OIYA 4L0MA 4POAA 3R3HA 3VAYA 4CM8B 4DHWA 3Q7RA 5CPBA 1Y9JA 2CF5A 1RRGA 1KEEB 1OGJA 4MW1A 2ZPTX 3H1EA 1VL0A 4ZQCB 3ZX4A 1J2YA 3X1MA 3S1LA 3GFOA 2EF0A 3F2VA 3WGVA 1MIOB 3KVYA 3NZEA 3EPLA 5G53C 2G7MC 2VS1A 3BMQB 1IIRA 4FYPA 4N47A 1X7HA 3HB1A 3RFXA 4GUDA 4RXUA 4BVAA 3DXZA 4GSYA 3ZHXA 1N3IA 2Q5OA 4B71A 5HQJA 1ULSA 3ETHA 1MUUA 5L40A 1W52X 3AUXA 3CU5A 2VUIB 1KL7A 4CM3A 2YTZA 1AOXA 2BCJQ 3KBOA 3K2BA 2F1OA 3EY9A 4RJJA 1Y4ZA 4RK5A 4AYXA 3O73A 1T3HA 4KG7A 1NNLA 2X9LA 2B8TA 1RADA 4R3NA 3GAZA 3VU3A 3WYFA 5BXYA 5BSFA 4J0HA 1SG9A 3EF3A 2BAGA 5EY5B 1KJNA 1M5TA 3JZDA 2JG3A 5D8DA 2UXDB 1JLHA 4RC9A 1U7HA 3RV3A 2I4RA 4CUKA 4J3FA 2R1TB 4HF7A 3BJZA 4C21A 5AVWA 1Z25A 2GCNA 3KLMX 3LOQA 4KI0A 3SGLA 2O2XA 2CYBA 3V6LA 1VHTA 3TVTA 3HSYA 1FP4B 3GCGA 2PS0A 2XB9A 3UUEA 1A7KA 2AZXA 2Q7DA 3SIRA 1X3SA 3EMBA 5AH0A 3OESA 4G8DA 3ZDFA 4YMLA 4JI3B 5JD6A 1BS2A 2OESA 2PPLA 4WJZA 3RC2A 3AL3A 5DLPA 3NEAA 4QVIA 2V55B 5BWBA 1OREA 1WA5A 4TMTA 2E5LB 1QZXA 3L3BA 3CVUA 3QE0A 2C4KA 1JQAA 3UMCA 4LA4A 3DEAA 2K5UA 3MWDB 4EUNA 2CLFB 4Z4IA 3ACDA 3RAJA 3OM1A 1Q6ZA 2BGRA 1TL7C 4E2ZA 3F8SA 3L7BA 1KP3A 2FPUA 2CL6X 1B3BA 3FHLA 4M0MA 3SK0A 2OORC 3R23A 1EDOA 5ARDA 3O38A 3K3PA 5EAIA 4R8SA 5DH9A 3DONA 4J91A 1QO0D 3GMTA 3ZWBA 3UOAB 2J9ZB 1GGFA 3REQA 3B3FA 3A1DA 1SVWA 4B0OA 1U02A 5AUNB 1VECA 1Z5NA 2Z5VA 4MUYA 4RSMA 3EVDA 1CY1A 2AFIA 4FN4A 5FAXA 3PQ7A 3UNXA 5BP7A 3EQ7A 5EJ8A 3NW9A 4DQVA 1PUIA 4QDUA 1EWVA 2CVOA 2IZOA 1DELA 4AJ9A 4NONA 1RKQA 5E9AA 2B0JA 1HFWA 3SXUA 3TDMA 5KYTA 1T8RA 3GLTA 4OX9Y 3HO6A 1MB3A 5JVDB 5HWSA 1DEHA 1E0DA 1OKKD 1ZX1A 3HI6A 1HV8A 4B84A 2V7XA 5DM4A 1U7UA 3FZNA 1ATIA 4X8HA 2A0WA 2GO7A 2W9XA 1CB7A 1L2TA 2VKTA 1F7VA 3OH8A 3KDAA 5BSRA 4A5OA 3RT7A 1TW2A 2FZKA 3GZNA 1G5PA 2PL1A 3JQ8B 3KXDA 2B92A 4RIEA 3TB4A 5F73A 4DV3B 1MC8A 2XHEA 3P71T 4ZOLA 1YOBA 1S8NA 1THGA 4N82A 4PYJA 3NHRA 2HCBA 1DX9A 1QZZA 10MHA 2QE7D 1XXHB 5TC4A 4C7BA 4E2YA 1AXGA 1P4HA 4B6RA 1WU8A 3UXEA 4JFAA 1JBKA 4U6SA 4QT0A 1O3YA 2JFYA 4S2EA 1PFUA 1NOJA 1Z9BA 3T7AA 2WWFA 2CLIB 4M1QA 4V0ME 1SXJB 1MD9A 4C6HA 4CMKA 1J2JA 2R25B 2WUGA 3KQOA 3M81A 4L74A 5DW0A 3FETA 2PZFA 1EFTA 2IOYA 2P0YA 1CEEA 5K7SA 5BN4B 2DUMA 4PLTA 3D8BA 1WIWA 2WTNA 2CDRA 4OB7A 2QZSA 2O8VA 3A7DA 2GEFA 3BWVA 3RUIA 3WAGA 4DA7A 2X0EA 2L0XA 1K63A 2UUBB 5JVDF 3M33A 1U8FO 2J7PA 1X1TA 3MPUA 4LMAA 4W5TA 2ZUBA 1YJAA 1T34A 1IQRA 4RIIA 1TFUA 1WEKA 1YJQA 2H7YA 2JD0A 1MJGM 2W4MA 3GRFA 3IELA 1ZUNB 3KPUA 1E1MA 4H7KA 1QB7A 4QRDA 3MMSA 1BA2A 4ZCIA 3CKLA 1M6WA 4GI7A 3PQ8A 2ZRHA 1E0SA 3DP9A 3BULA 1P5HA 3KXIA 3QVSA 3REGA 1RQLA 2ZJZA 4N5IX 1VQ1A 2CHEA 4ID3A 4J0CA 4PSCA 1AS3A 3PWKA 1O58A 3ZJYA 4H7EA 4CM8A 5DFAA 2QK4A 1PVDA 2PFSA 4NQZA 1OI3A 3QV1A 3BIFA 3LDUA 4DDVA 1C0IA 1KEEA 4B33A 1QQ6A 3AJ9A 3LXXA 1U8YA 4PLGA 2BLNA 2NTYC 2VSOA 3IA7A 1LDGA 4B6PA 2VCEA 4LSWA 1Q50A 5E3HA 1MIOA 1NU6A 1PP4A 3TAXA 1YB1A 4CDRA 3BMQA 4KVZA 1U7OA 5FFNA 4BO0A 3OUTA 4L9WA 1PT6A 4PFQA 3CSDA 4E08A 4TRJA 1ST2A 1ODKA 4EPYA 1W6RA 5TPWB 5EZ5A 2Q2WA 4WFJA 3LVQE 4R71A 4DLKA 5HUJA 1FSGA 1P5ZB 1TKBA 4BFSA 3U7GA 1JVBA 1YQWA 1NUTA 1EYZA 1GZUA 2J48A 4MYDA 1KJ9A 3TEJA 3A58B 5BNTA 3K94A 2G6TA 3LO5A 1E9RA 3LAWA 1G1MA 4H4CA 3QMVA 2CEAA 4HLUC 2YIVX 4OH1A 5LJLA 1UBSB 2F1RA 4KAJA 2FPLA 1A88A 4JJ7A 2A30A 3AJDA 3H5VA 2OR3A 2I1VB 3ND8A 4MB2A 4RHFA 3RREA 2AJDA 3V5NA 3Q1LA 4JQZA 4OQFA 3VZRA 1EM6A 1L5MA 3W4KA 2GLXA 3ZWVA 3BMXA 2FF5A 4AUNA 1YR7A 2B1QA 2IYYA 3FPFA 4KGZA 1YC2A 1FP4A 4OHFA 3VBCA 5IHXA 5G0SA 3BA1A 5B1EA 4D41A 2ZM6B 1SBZA 3IJRA 2IZ0A 1NTRA 4H1WA 2C4MA 3ONWA 3W1WA 3IUMA 1YXMA 1IEVA 4R1OA 3WO0A 3ZVLA 2GETA 4JI4B 1ETHA 1VGVA 3B12A 4LRYA 3AF1A 2VDMB 2QRKA 5KEIA 1AQLA 2ZW9A 3MWDA 1EDDA 4S1VA 1AS0A 3BHMA 5H80A 4RKYA 4BVJA 1AQYA 1XLVA 1HETA 1FFWA 2AJBA 4LOLA 5D3KA 3OQ6A 3O9ZA 2WY2D 3SEFA 2X9GA 4JA0A 1TUGA 4UBLA 2Q4DA 5B6JA 2YXBA 2R97A 5DX8A 4XLTA 2EWVA 4TYNA 5KYXB 1LLFA 4G36A 1M66A 4CJXA 1CNEA 3AY7A 3I2HA 2CCKA 2YWFA 2ZUVA 1A9PA 4DPKA 5BR1A 1BMQA 1NVWQ 2R44A 2ZLBA 4RL4A 1YIDA 3BD7A 4B32A 3WIDA 1BJRE 1Z15A 3L4EA 3S7TA 5CCXA 1U2EA 3CUWA 3QH4A 3P19A 3UMVA 2DFKB 3E9EA 1NMSA 3MC1A 3EZLA 3OHSX 4G6ZA 4JSRA 5JVDA 2O1EA 4C0JA 1ECJA 3W78A 1AA9A 3M1LA 3I9FA 3GVCA 1HDRA 2C1XA 2GPTA 2DBVO 1XZJA 5DTRA 1NW8A 3ZBTA 2O59A 3P1JA 4H35A 2ENUA 1LZLA 5LMNB 2YXLA 1GAEO 2V58A 4CRWB 3KWMA 3OQIB 3V2HA 3JQ8A 1KQPA 3LL7A 4A6EA 5CJJA 1BDHA 1WUYA 2H16A 1RDFA 2DSTA 3ME5A 3ZQ4A 4MQ5A 4TKVB 2ZQYA 3SFVA 4EY8A 4RTKA 2B5WA 3O75A 1M2FA 1W1WA 3AEXA 1XXHA 1CVIA 3FVVA 2YXEA 1ZRHA 4Z86A 4QIHA 5FIUA 4BO2A 2Z2IA 4C0KA 4DSTA 4U9UA 1K75A 1O9HA 1YSCA 3FKJA 6LDHA 3FKQA 2Q6OA 2X0DA 1SXJA 4HWSA 4V0MA 3RIHA 4JJIA 3LM8A 1RYBA 5DHSA 1E1QD 3T6KA 1XP5A 3SF8B 4ARVA 5KSZA 3AR9A 4J16A 4CMAA 1MO6A 3OBBA 5BN4A 3IE0A 5IJZA 1CRZA 4G1FA 2WWYA 5CVEA 4CG1A 1DIBA 4U0KA 4F2HA 1PJ2A 4R83A 2YWCA 4I8XA 4AJOA 4BNLA 2EIXA 4IJKA 4RQUA 5EKSA 5KTKA 4UNQA 1RXVA 4IGEA 3WP0A 3DAFA 4BVFA 4AJJA 2CFTA 1YQ9A 3PGJA 1L6IA 3G8BA 4KQ9A 5I4IA 2WKRA 4RKQA 1ZUNA 3R3UA 2X6RA 3MM4A 4MPRA 4QNRA 1CQJB 1NV9A 3PXGA 4PINA 3R7AA 4FKMA 4G5QA 2Z2YA 1R2QA 3EQ8A 1N4DA 4DRYA 3FMOB 5BVHB 3GLFE 4YMVA 3GLFB 1QMPA 2JDID 3A3NA 3OZAA 2E89A 4RVUA 2VLIA 1LUAA 4Z7NB 1L9XA 1Y5RA 3MINB 4I99A 1M1YE 3S5UA 1Y7PA 1BXZA 2PZ8A 3A2MA 3LGAA 3DBLB 4I1YA 1SXHA 4BB5A 3PEYA 4G9BA 5AI4A 5EIBD 2W42A 1JQJC 1F2VA 1P7CA 2BGUA 4XASA 3IXQA 2XBLA 1FP1D 1F8UA 1OW3B 3A1CA 3AFMA 1NPTO 4X63A 3ZEIA 4B6SA 4AJLA 4DNXA 2WAAA 1Q3HA 3T5GA 4YJGB 5CEEA 3CR7A 1NVVQ 1UMKA 2I3BA 4MV1A 5IK2D 1NF2A 2BOVA 4Q03A 1Y4DE 3A4LA 1OXUA 3N2EA 4I9FA 4JK3A 4RABA 4RHEA 5TPWA 3TFWA 3ZKAA 3FROA 4NL4H 5HS6A 1BOOA 3O4FA 3RTDA 5AW2A 3A06A 2C7PA 2VP5A 4XRGA 5DBEX 4DADA 1ZN7A 2AUTA 2XRMA 3U7IA 1ADJA 3VR5D 4GBJA 1LCIA 4URHA 1DAIA 1E6MA 1F8YA 2AJLI 5G1OA 3T7KA 3AVVA 4AF8A 3R9WA 4BVHA 5ALRA 1GTL1 3JTMA 5EQDA 1E98A 3HFRA 4AY2A 1D9XA 2QAJA 3RKRA 4TTJA 1MOPA 1TEXA 3NHMA 3ZX5A 1ZS9A 4TWAA 1H2YA 5I7RA 3O92A 3QG1A 4NFSA 1Z6XA 4KXNA 3OC0A 3SE7A 5IDWA 3I6YA 3HEMA 1XVAA 4GKAA 1EHIA 3T7JA 2A5FA 1ZDMA 4MSUA 2ZI4A 4MVJD 3ESBA 3WYDA 4OMDA 1TJPB 5FNVB 3NWEA 4FC6A 1UDCA 2QLJA 4JGBA 4IICA 4LV5B 1CR6A 3O93A 1LW7A 3B1KA 3LUCA 5U4XA 1MB0A 4HHEA 1HXHA 2RIRA 5FULA 1DWUA 1DMRA 4JSYA 2WU8A 4K0RA 3IT1A 4EYGA 2BEJA 1U5AA 2CJFA 4XVHA 1DZIA 3CN9A 3WWOA 1RJGA 4B2PA 1C3VA 2Y4OA 1TAQA 1L5SA 2OQRA 4IOMA 3RGWS 3ZZ0A 2AJTA 3LF2A 2ZUCA 2R86A 4A8TA 1K7SN 4FYYA 4D9FA 2DWQA 5KYXA 4QTUB 3U7RA 1XVLA 1RXSA 4E13A 3ET4A 4KOEC 2FOLA 3HI4A 1T8TA 1GKIA 4XCXA 4G0UA 4FOLA 2O0LA 4GXRA 4X3OA 4OI2A 1EXNA 4PCAA 4MLDA 2QU8A 3KT3A 4DA9A 3T1HB 4EJFA 1KKUA 3J7AC 2XSZD 5CFZA 3E27A 2CV0A 3OOSA 3RJ5A 3GX1A 2HRQA 2PGAA 3TI9A 3W4JA 1W7AA 2CNDA 1QBGA 2I62A 3WMEA 2OBNA 4C29A 1L7XA 2PH1A 1XUOA 1JEJA 1O97C 3KWLA 4W5WA 5BYJA 2XMRA 1AM4D 4RY9A 2QQGA 4S0ZA 4YRSA 2D2VA 4ENWA 3P0FA 2ZKLA 1BGXT 2B34A 5HA5A 4TT8A 1NYLA 2IOFA 1KQOA 3OQIA 3RS8A 1Q1NA 1E3QA 4ZI7B 1F7UA 3EVFA 4K5QA 4ZT4A 3I2FA 4AKGA 3E0XA 3IA2A 1OHHA 2A84A 4M8IA 4HRAA 4TKVA 3KXKA 5ICFA 4ZV4A 5IBCA 4PWYA 4OXQA 1SBCA 5EP3A 3EF0A 1E5XA 1VCMA 3MJRA 4NBSA 5FNVF 1YNSA 4WUVA 1Z5OA 3QFRA 4KQ6A 3BA6A 4MPTA 5LZ7A 3NDJA 3C0KA 1WMEA 5IH3A 3AFHA 2GKOA 2QEQA 4NNPA 2XXBA 4IO0A 5EZYB 5IC5A 1KKMA 5K3EA 2XKAA 1NVBA 2OZPA 1DXYA 1U2GC 2PH3A 3SF8A 5AW1A 4LOKA 3V8NA 4I14A 2YVAA 4WDRA 2VBFA 2HAEA 3LZ6A 4A3SA 5M5BA 3HU5A 1DPFA 2DWUA 2QYSA 3QE9Y 1SA0B 2ZDHA 5JCJD 1I3LA 4HQRA 4R9RA 1X7YB 4D3DA 3BXOA 3DT9A 2W2QA 2CE7A 2IZ7A 1BE8A 3KTAB 4RY0A 4F84A 4OXKA 3S29A 5LNK6 4ZPJA 1NBAA 2PUWA 3KK0A 2P27A 2IIBA 1F12A 3WGUA 1X8XA 2OA0A 4WZBE 4CFYA 4DXHA 2HA5A 4WZBB 4C89A 4C07A 2L69A 3RANA 2CZCA 3FOAA 4G37A 2COUA 4QSMA 4E5YA 8LDHA 5JANA 2D1FA 4MPPA 1ACMA 4WOCA 1BWRA 3KELA 1UOEA 1XTUA 3DGFC 3TR6A 1VL6A 2Z9CA 2ODEA 1CQJA 2ZWIA 3D1LA 3RRBA 4ZI7F 4Y2VA 4F2DA 1XFDA 2R3SA 2HU7A 2W6PA 3DDOA 3GRRA 5DTEA 2FUCA 3ZHZA 1YI8A 1G4HA 1ND5A 1Q3TA 1ZOSA 3NP7A 4NZYA 5BVHA 3GLFA 2AOWA 4E6PA 1IVSA 4DREA 2I1WA 1PZFA 3HL0A 4AIRA 2NYAA 1DKRA 2FP4B 3P9IA 5AP9A 4C0AC 1QF9A 4E22A 3MINA 4Y7DA 4W5HA 2IPOA 1N25A 4C4XA 3MTEA 4PPFA 1KP9A 3R77A 1B3RA 1A3CA 3DBLA 3B20A 1LPNA 2IZZA 4ALJA 8GPBA 1P61B 2X77A 1ESDA 4OGGA 5EZYF 2ZRFA 1L3IA 4HN4B 2E49A 5A4AA 1XWIA 3JD1A 3JR3A 2HF7A 4IEEA 5B4VA 4LJAA 4GO1A 2WMYA 2HPZA 1UJ4A 3IUSA 1HE3A 3VJKA 4YJGA 3ZU6A 1B2RA 4BVKA 3CRRA 5CTJA 1P0CA 5TY0A 4K7JA 1P5FA 5E6RB 3C45A 1DPGA 3OFND 1Q7GA 4C2AA 3EYAA 5K3OA 1LH0A 1XWWA 1E6KA 2E87A 2XDWA 3NETA 4EB6A 4AMGA 4DC0A 1J0EA 4Y6PA 3M4NA 2C5AA 1XZCA 1YR8A 1I0ZA 7GPBA 1T2UA 2YV3A 5IZCA 3KSRA 2OCXA 2PX2A 2RC6A 2XYQA 3C6YA 5F35A 2Y05A 3I5AA 4MJ3A 3SHQA 1AKTA 3AM5A 2VT3A 3QLUC 4MA0A 1UC9A 3LY9A 4HI0E 4DA0A 4Z4FA 3IUJA 4YRLA 1NBOA 1W48A 3BRQA 5I7SA 2Q6IA 4OJKA 3Q0EA 4QJBA 5A71A 4KLZA 4ZT6A 1NQAO 1EIZA 1G5TA 3TDNA 2WKWA 3VR4D 4EYKA 1RM0A 1U8XX 1QE0A 2RBKA 1SULA 1H9BA 1D6MA 1XTIA 1BE6A 1CQIB 1TQ6A 2HJVA 1WJGA 4I3GA 4D42A 5HUQA 5M7EA 4JUIA 1G3RA 1BMFA 2AW5A 2CVFA 2PN1A 4ZVRA 4BOYA 4GYKA 1M83A 3F4KA 4B6GA 3U7HB 2P6NA 2WYIA 4UHKA 3AY0A 3LOUA 3AIMA 4HR7A 5JSUA 2GFHA 3HGQA 3DBOB 5FNVA 5JS7A 2WDPA 3GC6A 5AJUA 3BTSA 1AGXA 3G13A 4LXTA 4A03A 2NSJA 1DAHA 3EYWA 2E9SA 3OTWA 5JBIA 4YT4A 4MUAA 4KDCA 4ETNA 3ZCUA 4EKNB 4JLJA 4JUCA 4XPZA 3ZYCA 2BHRA 5CIQA 5ALXA 2WT9A 1U9CA 2A9OA 1DC8A 3NDRA 3OOHA 4JMPA 4KIFA 5EGNA 3JQQA 5J5AA 2H9YA 2L2QA 5JLAA 4MB6A 1S1MA 3F6PA 4JENA 2D8AA 4L6CA 4JJAA 3WGGA 1IMOA 2H4ZA 2O2ZA 3AQ4A 3PFFA 4ZCSA 5ER9A 1E2QA 4AJEA 1RXWA 2BYTA 4EUFA 2F67A 3ZE2B 1FU8A 1PZNA 4FFDA 4HLUA 5K6RA 5JROA 4QQ8A 2JF0A 3B6ZA 4ZC8A 3EAGA 5JH7B 4B8YA 4F1KA 2QD1A 3CLUD 3BFXA 3HCEA 2J32A 2ORIA 3G0BA 5K4GA 3BAFA 2OMEA 3K9LA 2BEWA 4HGOA 3NJ8A 5C4GB 2QTWB 2HDNB 3IOBA 4WSOA 4ZALA 4ZVMA 2V6BA 2UU9B 1BOFA 1JW9B 2B2NA 1QPGA 3QVMA 4ZVTA 3V1UA 4PEVA 4N6NA 1U6JA 2ZJ5A 1ZK3A 1B2LA 2VTBB 2ODNA 2SHKA 3NQ41 3A27A 2L17A 1CZKA 5FQNA 3WTCA 2QVBA 3TX6A 4M46A 2A5JA 3WHIA 3NIDB 4KQWA 4B09A 1P31A 1OR8A 2AQ8A 4EY7A 4ZI7A 5C8YB 4GFDA 4C7MA 1SBQA 5BY2A 2IYEA 1PJRA 5L7WA 2WMNB 4UE3S 1GG9A 1CYDA 2HJRA 5THQA 3K8YA 2CKMA 3QUQA 4BP3A 4R51A 2UUCB 3NTVA 1J8VA 2Q5JA 3H2YA 3V8EA 4IUBS 1CTQA 1CX9B 5TVKA 5KZMB 1ZGBA 5HMLA 3WIEA 2EBUA 4IH9A 4Y2YA 2IXGA 4LGYA 3TFQA 1UFQA 1P8JA 1DCMA 2Q4TA 2FX2A 4MVJH 4Z9BA 5JU6A 2C0PA 1M2JA 3I2GA 3IAUA 5EZYA 1K0FA 4ZEXA 1WB9A 2V98A 2O8CB 1NQWA 2R8ZA 4ARUA 4WBSA 3E3NA 3BJMA 3P9SA 4RM2A 3WLOA 2HW8A 5K1ZA 5CYFA 2OMKA 4L72A 1P0PA 4N5MA 4OMUA 5A7GA 3M8KA 1QFZA 4L8GA 4W9NC 1J8FA 1SA0A 2WIDA 4WFIA 2WFLB 3N2KB 5JH7F 5ECWA 1IHYA 1OOEA 1R88A 3KTAA 3MBIA 4LY6A 1KY3A 1RRVA 2AOVA 2HJ9A 3H13A 3MJSA 3NM4A 2XOKD 2ZYVX 3E9QA 4JBGA 3RRXA 1WZCA 3MJVA 5DYNA 3CVOA 4MAFA 4AZ3B 3UMJA 2Q3BA 1B16A 1WAMA 1QQBA 4AT1A 1S96A 1UC8A 3HC7A 4KRYA 1BG6A 4WZBA 2C2MA 1HURA 3QMPA 1GYPA 1HF3A 2FK7A 2ZCUA 4BZWA 3I5XA 3OTHA 4TM7A 2JEZA 2A8YA 4EJ2A 4X7MA 1EXDA 1F1JA 5C8YF 5I9MA 4UFNA 1P4RA 2IPAB 3IEPA 2ZAOA 2H1HA 1OGIA 2OC4A 4R98A 2CK3A 2HKIA 3NBYC 5GZ6A 4PU0A 3TWOA 3FPKA 3F5FA 3QWBA 4BJ3A 3HU3A 2WJHA 3P9RA 1MHTA 5IT0A 3CF4G 1ECGA 3QU4A 4KWCA 4QX6A 3OIGA 1CP2A 4DJ5X 1YDFA 3DEJA 3D9QX 2FP4A 4HJXA 2GM3A 3L7MA 4JBWA 5FUBA 3SDSA 3A9TA 1JVNA 1RFLA 2HA2A 3IQWA 3P27A 4P54A 3R74A 2G36A 1RM4A 1ZESA 3GI1A 4GECA 6Q21A 2ECFA 4L8YA 4HLDA 3G79A 5EQFA 4XFJA 3D7LA 4URVR 1APBA 4UTPA 3IO3A 2FR8C 1GKYA 2OAGA 3QVXA 1BVRA 2YHUA 5D7NA 5AM0A 4CG2A 1QXSA 3P9CA 4HSEA 3D7NA 4KL8S 8ATCA 3AHDA 4H6PA 2AG6A 2ZI6A 3D8TA 2OZLB 2VBIA 2WSSD 4RCZA 2CZGA 1B0PA 1FSSA 3TTYA 5HKBA 2DQYA 4X20B 1NW6A 3UQYS 4OA5A 3UTDA 5A9RA 3K70D 5IBRA 5E6RA 2UYQA 2DAPA 5F33A 4PCLA 3F7TA 3CLRC 4YN3A 2BF4A 2AZTA 1VSBA 1Z5WA 1LBHA 2HA4A 3DLAA 2M9MA 3K1AB 1D4OA 4IDCA 4LUCA 4PX3A 5IAGA 1G59A 5KKAA 4XIGS 3MFYA 4ND3A 2FDCA 4XDGA 4FFMA 3DFIA 3F5DA 3WQRA 3TG8A 1N8NA 3VMFA 4CFSA 3AT1A 4OOFA 1H2WA 3F8TA 4N40A 3FH0A 5TEWA 4AWXA 4EECA 4LZJA 2ZWVA 2FG6C 5B1DA 1I5RA 4JLUA 5EFOA 3EPJA 4LE2A 3FDFA 2WP0A 2AOTB 3NBAA 1UEIA 3VNQA 4GC5A 1GZ4A 2PRSA 4U6NA 4N5NA 4ETWA 2UZ4A 3B6EA 1EWRA 3WNZA 3CR8A 3JYOA 3M6UA 3R6WA 3ZUGA 4C0QC 4F72A 3WDSA 3OT5A 1G5IA 3GCWA 2ZB3A 3I9KA 4WXHA 3E4CA 3I8XA 1EH5A 4UPEA 4NX2A 1CQIA 3LDAA 4FX5A 4OFXA 4TL7A 4L5JA 2O23A 1SBIA 4MVWA 1R64A 3STVA 3WYAA 1YZYA 3ZV7A 1H4QA 4QRHA 1E3DA 2YN2A 1YQXA 2X15A 2BFNA 2VYVD 1VE9A 3AR5A 3T4EA 5EGSA 4L7QA 4RESA 4GEKA 2IF2A 2Q1YA 1G8YA 1NQTA 1O89A 2VHZA 4FLEA 2A67A 3AZOA 2EV9A 3AEZA 4X1KB 1NV8A 4J1SA 3V8QA 2BONA 1A9SA 1N6OA 5F12A 1G21E 4P80A 3G2PA 5AM2A 1Z2DA 3QX8A 4CT5A 2ARKA 1LEHA 1WP9A 4GD3Q 2WW8A 4I1SA 4WAUA 1WPQA 1K27A 4FSDA 4JYCA 3OLWA 2JHFA 4NH4A 5FAKA 5B2ZA 3U80A 1DEOA 3TIFA 1R8SA 1E62A 3FM9A 3SQWA 3GDHA 5JH7A 5L3SB 5B53A 3PQCA 1G8AA 1T4BA 3INYA 2QOEA 3T34A 1NJ2A 2JZNA 2IUUA 3IP9A 5DNEA 2VJAA 2XZTA 3ZS9A 4F0JA 5AKEA 3GJ3A 5EXSA 2ZIZA 4Z0HO 4B3IA 2VTBA 1U5BB 3Q6NA 5E2IA 1ZD4A 1JEOA 1NMEA 1BU8A 2J3MA 3EAQA 3FCYA 2B3DA 3H3FA 2TMDA 2EYUA 1H5QA 3IP1A 3TTXA 1TPZA 2JVKA 5JJBA 5C8YA 2JJQA 1N0WA 3ADOA 1NR5A 4KVAA 5DI9A 2IPLA 4IRMA 4UFPA 1O54A 2HPHA 2NPIA 1K7XB 2VPYA 2Y66A 2C5HA 5U4QA 5LPNA 1RT9A 3QHPA 5H59A 4JT4A 1DGQA 4B44A 4BQSA 1XAJA 5CXQA 1M10A 2O0KA 3KQYA 3QNWA 1QUEA 4UAVA 4OGLA 4RXTA 3TRIA 2JKZA 1BFKA 1O1YA 3WB2A 3HV0A 5IVPA 2JGFA 3PR1A 1YTLA 4XYEA 4Y2GA 1QP7A 1H93A 5JNLA 2GXSA 4FIZA 4U7GA 1ZH2A 2OY0A 2W6NA 2P8JA 4NMMA 2QP9X 1N0HA 2C9DA 4GPIB 4F9GA 2AKYA 3EQ9A 3UATA 4YP0A 2O8CA 1AV7A 2WWVD 3TLGA 3R6GA 1ZLYA 2AW3A 2VR1A 4JB0A 4JNCA 4EY4A 1HKUA 1C3OB 3FWPA 2B4QA 2JGIA 4OHBA 3NASA 1QHGA 1Y9AA 3I45A 1DDGA 3N2KA 3DV0B 3SSMA 2QUAA 2QBYB 1GARA 4NU6A 3W9SA 1PJTA 1ZI9A 2PDAA 3ZXYA 4AZ3A 5EKXA 3PE6A 1F0KA 1I6LA 1PLLA 1WW3A 3EXEA 2D59A 2ZRKA 4UULA 5T4FA 1QP8A 2GGSA 3BJIC 4LYYA 3S8EA 1DG3A 1HYEA 1TEVA 3LV8A 4R8RA 1HL7A 1RXIA 2YASA 1V1JA 2Y76A 3I73A 4GYYA 4FKBA 1SHZA 3G2HA 4WKGA 5EMHA 4E21A 5JJ5A 2XA2A 2AMLA 2NQ8A 4B85A 3IMFA 4C0LA 1GSIA 5KNBD 1JHRA 3ENQA 1T0IA 2UUPA 4NK4A 5IABA 4HH4A 4HNTA 2PKYX 3CURA 1EVEA 2CVQA 4TMZA 5TT1A 1VIAA 4EHJA 3OJEA 4K9MA 1SKBA 2C2ZA 3CWQA 4NMWA 5D87A 1T2EA 3AY6A 3A9VA 2JLUA 1MNAA 4RNCA 1DAKA 3TIVA 3W5DA 4C1BA 4CU2A 1II9A 2I6TA 1U1CA 2VYNA 1N2ZA 2XODA 5DM0A 2QPTA 3K9CA 3QF7A 2EJVA 1CUFA 3G0HA 4KR3A 2FH5B 1GPWB 1U2GA 4HWGA 4WJLA 2B36A 2OZLA 4C7XA 1I2ZA 1YRLA 5BV2P 4XXHA 3TN7A 4MHSA 4OQPA 4UCFA 2O2IA 3MZ0A 4X20A 4DSAA 3TOCA 1L4FA 3GA0A 4NHEA 4IG4A 1A5AB 2E4UA 5IJXA 3ZGVA 4EVSA 4FOOA 1JG4A 3UKJA 5IS2A 4TS9A 2AHRA 1N5RA 1ZK4A 2N0SA 3K1AA 4KV9A 5JY6A 3KU4A 3R5SA 3QPBA 4QO7A 2IYSA 5JR3A 3AJ8A 2C3UA 1JIVA 4YRDA 2YMMA 3KYCB 4HMOA 4MW5A 5DM70 1FZQA 2XNKA 3ANLA 4QUBA 5EZ6B 2I91A 1Z5UA 1RAGA 2QQEA 2AR7A 5KU1A 2WUVA 3CE9A 1JMVA 2EKPA 2DTEA 3H2GA 3PUIA 1FJXA 1T9DA 1VZ3A 1N9ZA 2P9JA 1IXRC 2AOTA 3KJGA 3NVDA 1NN0A 1LQ2A 2W48A 4KR9A 4IRXA 2B5OA 2W22A 4OP1A 2PZAA 3RTCA 3UMYA 4KPYA 1DADA 1QHNA 3BZUA 4D79A 2Y0EA 3MCZA 3SR4A 1Y9DA 2W93A 1UFOA 1E6WA 3ES9A 4L2IB 1CS0B 2PWBA 5HFJA 3LQ4A 4UD2A 4K6KA 1LX6A 2RGEA 3G59A 3OCZA 1IPEA 1R7RA 3RHZA 1R4MB 3H3JA 5CGZA 5FPHA 1I1HA 3SYNA 1GU7A 1V2GA 1QFXA 4LJ8A 3AVQA 2G80A 2IGBA 2CFIA 2PT5A 3I58A 3PEUA 1GIAA 5T57A 4Z4EA 1KYWA 4C4ZA 3F6BX 2O5EA 1IY0A 2QLTA 4EMSA 1L4LA 4AJPA 4FZ3A 3DDSA 4KK4A 3F71A 4QT4A 5EP1A 1V5FA 1EP9A 1SCAA 4X1KA 3ZZMA 4CL2A 5FOSA 4J76A 1KQGA 2OCGA 5PNTA 2A2ZA 1SO8A 4M0LA 1JHAA 5HOQA 5IMSA 1GL9B 1ZWKA 2DWOA 2J0EA 5AMXA 3KKNA 3OPNA 4K6GA 4QXMA 5L3SA 2NZVG 2X3UA 1R50A 2VDQB 2XNJA 4FYIA 2Q7XA 3BL6A 3OZWA 2I2BA 1QTRA 2QMZA 4ZRMA 1V37A 1G8JA 3QLUA 2FEXA 2GCPA 1QVAA 3DQQA 4QQKA 5DN6A 3ZV5A 3KU1A 3D6TB 4N5LA 3HGMA 4K1XA 4G23A 4L08A 4O59O 3BILA 3U48A 1ND6A 1IBCA 1U5BA 1ZSYA 5BR8B 3A4VA 5ALKA 4LCBA 2JAXA 3MERA 4QKQA 2I5PO 4YUAA 1X19A 4J90A 2G0AA 2BV3A 2HDOA 3ZJTA 2NQ2C 3R5TA 4N3BA 4QBGB 3ACCA 1OFHA 1HT1E 1P2SA 2HK7A 4UNIA 4JVLA 3UENA 1ZAYA 4BQOA 3ZYZA 4TKZA 1BW9B 4IZ6A 3A3YA 4TQGA 3BB4A 1DE0A 1OLXB 4U7FA 4DMKA 1D7AA 3KYIB 4PIPA 4XLLA 3LSYA 2QKYA 5U1PA 1QB8A 2K6GA 3RSQA 3NHUA 1CC1S 2C9YA 1DNPA 1GNVA 2JFFA 4P82A 3WJ1A 4IDNA 1O5IA 1XA3A 4RX1A 3EMDA 3ZJVA 4EGAA 2XQFA 3NBQA 3UJ3X 3LFTA 1CEYA 3D0OA 4HFNA 1IBMB 1XRLA 1C3OA 4OO3A 1NONA 5IVKA 1OH6A 4MQBA 3UT5B 3KKMA 1IXKA 2AE1A 4PVCA 5BWMA 5HS4A 1Y5MA 3ZIAD 1R0SA 2XT6A 3DV0A 2GM4A 1W581 2QBYA 1YUNA 5TPZA 5ESWA 3C8HA 2WT8A 5GM2A 3RH0A 1KAQA 1GG2A 2X6TA 4HQ6A 4GOLD 4P5EA 2BHSA 5C1DA 1CV2A 1UXHA 2BMDA 1IHDA 2FW7A 3BH6A 3NYRA 2P2GA 2ZI9A 5L3ZA 3IKLA 3VU1A 3JQ9C 1XROA 4FW8A 5BSEA 3SBOA 2QR2A 3JQFC 1K2WA 2RHCA 2ZZMA 2DZDA 1LU9A 3LUAA 4PWZA 1QV6A 1A8HA 1B6TA 2P1RA 4ZV9A 4RK1A 3J81k 2ZYAA 1LNSA 4MCIA 4YONB 3SNHA 1WHTB 1P39A 4ENQA 4G25A 5LZ8A 3IKTA 4FILA 3IOYA 1GUBA 1W93A 3T5BA 3ZBPA 1ECBA 4G5SA 4CF4A 3AMVA 2TYSB 4L4UA 4ZEVA 1G0OA 1QRSA 3MD0A 2WI8A 3G6KA 2PKEA 3C4JA 4B81A 3JQAB 1FTGA 1WMBA 4WK0B 3FOEC 3CX8A 4GZLA 1TD1A 5BSMA 4K6HA 4P58A 3LK6A 5JAHA 5JXJA 1OFTA 1X8JA 2FEOA 3KUXA 4RMJA 1QIHA 1FVHA 3KVNA 5FR1A 4F4JA 3HUEA 2WZQA 3DEKA 3DGEC 4Y1GA 5AKKA 3T7IA 4DM4A 5CD1A 2ZUWA 5FTKA 3RK1A 3ER9A 3JWEA 3UUWA 3ZHTA 3AR6A 1H69A 4W9NA 4ME6A 1YQDA 2UVQA 3PQDA 3U4AA 4I3FA 4LHSA 4X93A 3WADA 2AXNA 5FI1B 4YPOA 5L6LB 1VLZA 2ENWA 4FK8A 5EE5B 1FXSA 1S3GA 4BNNA 4DSNA 3IVXA 2EZTA 5JC1A 1CERA 1DCKA 2OKCA 2VNAA 3QKIA 3CNLA 3WOVA 2GN9A 2WG2A 3OI7A 4R2WA 4RF2A 2EHJA 3EPRA 2NU7B 4IX1A 2VLBA 5MFZA 2N1BA 4LDNA 4M6WB 1NTOA 3ZK7A 3KYCA 2G5GX 4QGFA 3COSA 3F9RA 4J07A 1TYEB 4Y6SA 4C6TB 16PKA 5K3FB 2ZR7A 4BMVA 1TD9A 3MUEA 1OZ0A 5EZQA 3RRFA 4PV7A 4LN1A 2PIDA 3PT5A 1F8GA 4MKFA 4UUBA 4EL0A 4LRXA 4K46A 3WA6A 3SD7A 2VQ6A 3ZY2A 3P9ZA 1QGED 3ENWA 3MMXA 5HBGA 4HDAA 4IDHA 2YQ4A 1S1CA 3NPMA 4B31A 1JLSA 2IYFA 2JJ1A 3BKWA 3OZUA 4L2IA 1JQBA 2ZBFA 5TE9A 1FNBA 1CS0A 3O3OB 5BQOA 4BJHB 4I4CA 3DMDA 5JYBA 3VYSB 2B4YA 2FR8A 3HCBA 2IU4A 1R4MA 1X0XA 2UVPB 3DMRA 1PEKE 2Q0QA 3K5IA 4KMRA 4IJ5A 4P4TA 4X3CA 5EJAA 5FEUA 1FP7A 1HDGO 3PE3A 1TU3A 1FYXA 2YVLA 1SB9A 1SD2A 4RHCA 1KRWA 4LDJA 5C3UA 3ELYA 1R0YA 2VAVA 3H42B 2JLCA 3EG9B 3GO4A 1LBIA 3ZGYA 5CHEA 2Z5FA 5EP2A 4NLLA 1EFAA 4ZVKA 1E6CA 4ZJYA 4BNVA 3BTOA 4GSKA 2G1KA 4MMXB 3GJRA 4I1RA 1QSGA 2QNRA 1HDYA 2ATEA 1KWKA 3BMNB 2ABWA 1EK0A 1LC0A 2ZBEA 1E6LA 3K6KA 4FBMA 2JANA 1WMDA 2ZB8A 2C58A 1PTKA 1S2OA 3L40A 3MF4A 2REXB 1N2EA 4V24A 1CUBA 1QH8B 5JG7A 1IUNA 2GPBA 2DCUA 2Q3EA 2VHYA 1NDHA 4KNWA 2CHUA 2HLDA 1C4WA 2ASEA 1QVZA 1Y4SA 2O5RA 3EGOA 2LPMA 2BDUA 3MSCA 2NSYA 4NKRA 3CCBA 4EEXA 5BV8A 1COWD 4CR7A 3FNRA 4DCUA 4NZ9A 2J45A 4TLDA 3W6ZA 1DO0A 1S89A 4FGJA 4KGDA 3NUQA 1FTWA 4DYDA 4AJ2A 2PAAA 2ZUFA 2PRYA 1WKBA 3HKBB 3OBIA 4L1KA 3P5BA 2CYAA 2G1PA 1BW9A 1XAIA 3L1HA 4DE5A 3IUQA 1OLXA 2RKOA 2WYHA 4EG4A 3TW4A 2GBLC 1ZITA 4RZ3A 4BLSA 3AVYA 3V1NA 3BFKA 2ZJ2A 2HXSA 2GLUA 3RF7A 2CSXA 2KMLA 4QHSA 4UM8B 4I5FA 1NYRA 4X9XA 4KTTE 4CN9A 1N4AA 4F4FA 2I4LA 4MWZA 1O5TA 1S9DA 2H7VA 5JMPA 4YV0A 3LSTA 2GUGA 3H2BA 2VOJA 1RYMA 4LF7B 4BBPA 2CXNA 3TVYA 3MGBA 1EBBA 2DU8A 2QPAA 4FOSA 4ILKA 4NH0A 4G8JA 3UT5A 4E14A 3GLUA 3BF7A 3H1FA 4BFZA 3E9RA 1P81A 2GEBA 1ODFA 4QFCA 2ODTX 4NDAA 4S3MA 1CEXA 5THXA 4BAGA 1AB6A 2R7MA 3ESQA 4ITRC 1RLUA 1KDZA 4ZK6A 2YOGA 4Q6WA 5G4LA 4PC1A 5CVUA 4FHDA 3CMCO 1S2GA 4RLSA 1FDRA 2WAMA 5CLIA 4GR4A 5IJ9B 2YINC 3C3JA 2PD4A 3U7QB 3MJHA 4C43A 4DNPA 4TLCA 2IHUA 4XJTA 1O9GA 3O1IC 5HE8A 5BURA 4D82A 3PNOA 1F51E 5JW6A 1ICIA 4J6FA 1WHTA 1J25A 4EKGA 3CB2A 1WUTA 4TROA 4JUDX 3UG6A 1Y33E 3KHSA 4CF3A 1KRXA 5SY6A 2XUDA 4IS3A 1RJFA 1IRIA 4IXWA 4YCJA 3LNCA 3GRYA 1ZL2A 5IHPA 4YIKA 3P9XA 4FQ7A 1FYFA 3SJBA 1SVMA 4BNYA 3HWX1 1T15A 1VM6A 3JQAA 3R4CA 3KETA 2QJOA 1CY0A 1KGSA 1M7GA 3GLHE 4M37A 2GBFA 4HAUA 4YUYA 3GLHB 1G8GA 4IGIA 2QX8A 3HPQA 2OD2A 4RV5A 1AQ6A 1U8ZA 2XI4A 2P5UA 3OX2A 1QRAA 3QF4B 3AUYA 4LGVA 4YASA 3HXOA 4MEJA 1KDTA 4HZGA 4EHKA 1JZTA 4A91A 4P32A 3ZEAA 3I2JA 5AKGA 5JV5A 4TTIA 3F3KA 1MT3A 3LCCA 3MLBA 2D4HA 4F4UA 2IP4A 4RADA 4EVQA 4BKOA 2OZVA 4FEGA 4X84A 5H68A 3TZHA 2NU7A 5EVJA 1I8TA 5LBIA 2OOSA 4M6WA 4QEKA 4NBLA 1W36D 4JP2A 2Z5GA 4C6TA 1TAGA 2O2GA 1XRPA 2FUKA 5K3FA 2QTHA 3SOPA 3GWGA 2OD9A 1LB1B 1UXIA 3DVRX 4EF5A 1RPJA 4ABTA 1PKXA 2BTQB 2CXHA 5LLDA 1QTQA 4IQGA 3T35A 4F45A 1NMQA 3SY8A 5KIAA 1NMXA 3H5OA 4D8WA 1KO5A 1U5CA 3LRTA 3BQNB 4II3A 1YBAA 3FSGA 5BRNA 3QUCA 3WNCA 1A71A 4TN1A 4CL3A 4BJ1A 4LTDA 2CLSA 1SNYA 1YVDA 4HXGA 5IPFA 2V3VA 1WD5A 4JUAA 1MVLA 2N1MA 2EDAA 4KTVE 4WASA 2GWHA 1TT7A 1J8MF 4KQGA 1EBFA 1AHNA 1NATA 1X74A 2H1RA 3KVVA 3URMA 1SVOA 3AG5A 3X1WA 3B1ZA 2UVPA 2C5SA 4FVTA 3I9LA 1TYAE 2OZKA 1MN6A 3IDZA 1C0KA 4FDLA 4X85A 5J40A 2Y27A 5J2UB 1DARA 1ZJZA 2ZBQA 2FE1A 1CJVC 1P1RA 3GF4A 2B4TO 1XV5A 2NXWA 3GWZA 1QOPB 1LDMA 4KNVA 4X3PA 1LI7A 1SU4A 4LYGA 4CLOB 3EG9A 4H31A 3RVMA 3W3AD 5KHAA 2PKWA 4YRMA 1UIRA 4CEJB 3L7CA 2B78A 2HHJA 2X8LA 1QYVA 3DDWA 2EGGA 1HYQA 2JW5A 4ZI2A 2VRCA 4GKBA 3I8SA 3RHTA 4NYMQ 2IHNA 5B7GA 2QQ5A 1JKIA 4URXR 3CLKA 3PX3A 1L4BA 3H5NA 3KG2A 3REOA 3BMNA 3D59A 3DBHB 3WMGA 1LC3A 2NAFA 3G6WA 3N2IA 1GPDG 1UXGA 1E32A 2QAGB 3V4FA 5C8DA 1ZI8A 5PGMA 4DR1B 2XMZA 3N05A 1QH8A 5SZIA 4PGMA 4U7PB 4EFLA 1U65A 2H0AA 3NG1A 2R8XA 4YDQA 2JIDA 3OCVA 3SG0A 1E2FA 4CKXA 3QYAA 2BKLA 3Q3GE 4W1RA 3B9BA 1JFVA 3CZQA 2FOIA 1QRTA 2KJQA 1XMXA 4GR9A 3OA0A 3SBDA 4P1ZA 1G8PA 1K98A 2FSIA 3ER8A 2IFTA 3H9QA 2DY0A 5CPFA 2P90A 3D5TA 1KEZA 1EK2A 1F6WA 1FQJA 1B6GA 2WYOA 3HLTA 4PZ0A 2IGTA 1AURA 3CIOA 1HNNA 2W2LA 3HKBA 1ZRSA 4IUCS 2YW2A 4Y6RA 3TTTA 3E5RA 3VNAA 4RJ2A 2V7TA 3ROXA 2G72A 1KTIA 4W5QA 5J2UF 3ZVKA 2GASA 3VTAA 5TNXA 4CF6A 2PKQO 4PAOA 1T26A 3WLTA 2VJCA 3CPHA 3G8DA 5J4YA 1GXSB 2H3HA 5TF4A 2X41A 3GG9A 1UXJA 4DCNA 1A1VA 2H8KA 5I5EA 1YWGO 2KQUA 1T43A 3AINA 5BR4A 1CY8A 4X44A 4YDSA 4B34A 1NJFA 1RBZA 2PUEA 1NUSA 2W6JA 1HNXB 4PYNA 2QXTA 2WJIA 4DMCA 1K68A 2C07A 3FHJA 3C97A 3T1OA 1GGJA 4PAGA 1QHYA 4X8MA 1EWTA 3B1XA 3CRMA 3DC2A 2F9FA 5CLGA 1YMUA 4Q7LA 1JR3E 5CW2A 1EWQA 2FVYA 3DKVA 2EBHX 5G2OA 3TTVA 3EFOB 4PC2A 4MS3B 2NTJA 2OXEA 1XNRB 4ARBA 4BECA 1GYQA 4KYTA 3E61A 4R84A 2Q3LA 1IUOA 3QQPA 2EU8A 1KOJA 4GHWA 4HO1X 3T3DA 1ZM9A 5KTTA 3AESB 1SHLA 1T0BA 1FS5A 3ZPXA 1SK9A 1W0CA 3C16C 2ET6A 3T5DA 1EXWA 5BRJA 3TSZA 4N12A 1ZHOA 4ML3A 5IJ9A 3U7QA 2ZRPA 3CXUA 2C3YA 1N2GA 2NGRA 2RHMA 4RUKA 4DHEA 2YJ6A 3IIMA 1GOTA 1M73E 3FCOA 4ZVPA 5C5DA 5IVIA 4HK4A 4ENRA 4Z49A 4ZJPA 1VBKA 4UUNA 4JHXA 5JFGA 3ZXUB 1JWLA 1Y9EA 5B3LA 5B6IA 2VQEB 3R2JA 4AECA 5LLSA 3P2EA 5AESA 1P44A 3OPVA 3RF6A 5FWYB 1K9VF 5FV4A 4M7PA 1O95D 4IIGA 5AVJA 3TE6A 1SXPA 1QFJA 4EBBA 1SXQA 1RLMA 3NBFA 5JS1A 1GUAA 4D4KA 3AL0C 2PY6A 2VWPA 2C20A 2EXXA 3GLHA 5EINA 3CWCA 1I6KA 4G07A 4FGSA 4IKPA 2WWRA 3ZDCA 5F2EA 2MCFA 4BLOA 4K0KB 1TXGA 2WEKA 4FFBB 4C6SA 3DEYX 3QF4A 3SZOA 5CB6A 2PX4A 4M7RA 1XMQB 2MR6A 1PNQA 4OFBA 3P9QA 1CFJA 1F0NA 4O29A 4KFCA 1F48A 4GICA 3H9EO 2RB5A 3VVBA 1HMPA 2C2WA 2QZ9A 2BUCA 3QW2A 5CM9C 3FVRA 2IU6A 2Y6UA 1KYZA 1CQZA 1J21A 1GCOA 2ECPA 4ZO9A 1FTSA 4C7KA 2BPOA 2MSWA 1WCIB 2A1TR 3WLRA 1AMUA 4F6LA 1D2NA 4XAQA 3TK1A 4JYBA 4OHRA 3JQFA 4KLCA 5AM4A 4Q3OA 1YDHA 2KM1A 5FI0B 2G06A 1XELA 1OXMA 1PDVA 1JNYA 2FHPA 5FYQA 3VYTB 1A1SA 4WBNB 2Y0DA 2VJOA 2BTQA 1SUFA 4XIIA 2J0SA 2NQTA 1DI0A 1JAXA 1NF3A 1BS9A 2GZMA 2Q3CA 3PCXA 2X0KA 3FW1A 3PJFA 4K9NA 1E9BA 5FPPA 3VUEA 3K05A 4B7UA 3NRCA 2EFYA 4KWHA 2F8TA 3NIWA 2BL4A 3QLEA 4X8OA 1JE0A 2CFRA 3GZ4A 5TQ2B 3DLHA 4QDZA 1JTVA 2FPGA 4CM6A 5BSWA 4AZWA 1GAJA 2EG9A 3IVRA 5I51A 2F1KA 4I9GA 3MCVA 1SHUX 4Y0VA 5AW0A 4RTSA 1QIMA 2CB9A 3HUFA 4O1IA 4QREA 5J2UA 1EA5A 2D3WA 3TSCA 1H1LB 4UEJA 3BICA 3MWKA 1GT91 1L7QA 4QOGA 3I62A 4JBIA 421PA 4IJMA 4LC1A 3MQ2A 1AXEA 3SXJA 1MJNA 3N8IA 4KFRA 1F0YA 5DNDA 4CLOA 4ZAVA 1I7LA 3IEMA 1PJLA 5BW5A 4CEJA 1FVXA 2GFQA 2GRUA 3A05A 1HSZA 3WQHA 3CX7A 1XRQA 4Y6QA 5HXAA 2V97A 3LKBA 1HFEL 5ICSA 1OILA 1WVIA 4XWKA 4E1VA 2DB3A 1Q44A 2V74B 3DBHA 4DQDA 5DIFA 3EVCA 4XGQA 3N2GB 4ZO6A 2BFOA 1T1GA 2QAGA 3D81A 3RIYA 1FC0A 1Z38A 1D0VA 1GKLA 5AI0A 2P2SA 3GJ8A 1GRVA 1SZCA 3IH5A 1TCVA 4LVUA 3RVBA 4PSUA 5C31A 4K8OA 3GA5A 1J7JA 1WETA 1Y3HA 2JPDA 2PQ2A 1UPFA 1G3MA 3K0CC 3KC2A 3L4SO 4MTCA 5CH3A 1IOWA 4OGFA 3C48A 2ZJYA 3L7LA 5LB4A 1OBCA 5T4BA 2VHXA 4AX8A 4B8ZA 3THXA 2BGIA 5C4IA 4I6EA 3ZLVA 1II0A 3FOZA 3NOOA 3P2YA 2DUNA 1EE2A 3ANNA 1TO1E 4I1UA 4Z7QB 3J81A 4F91B 1G9XA 4UAUA 1HT2E 3OZBA 2PX8A 3IODA 4GX0A 3PQFA 2E5FA 4HAIA 4H17A 4Q9DA 2AG1A 4XA8A 1SHTX 5EXEA 3KQTA 1GXSA 4ARAA 4XW2A 4BBZA 1TAUA 4WMLA 1NVMB 1WP4A 4YRAA 1YJBA 2GD1O 5DTQA 4N65A 4L3VA 4LK3A 1RVDA 2OYRA 1P1CA 1BD4A 1P0IA 2BJHA 4C0BA 2EDCA 3RS0A 1Q84A 3FVQA 4Y9SA 5K09A 1QC5B 1ZIPA 2LNDA 5HTOA 5LSAA 3FGNA 3H1TA 3M9LA 4TZTA 1Z0FA 1FTYA 2BFCB 4NCJA 1H23A 1R6VA 2VF8A 3PYXA 2EARA 3W3AH 3OMLA 1D0SA 1NI4B 1G64A 1WCXA 2AI2A 1ZQ1A 1MJFA 4FUQA 3WQSB 4IIEA 1OJLA 1HNWB 1JR3A 2PU7A 3KX2A 2G70A 3G88A 4MS3A 3UV6A 3LLMA 3QVVA 3TRJA 1IQPA 2J3HA 4XSHA 3TOVA 3TZLA 4E4YA 3QKUA 2EX1A 1PJZA 3AESA 4TLMB 4OQXA 3PQ2A 3RSOA 2BSQA 1TJYA 2E1PA 1TM4E 1YCFA 1Z26A 2CDAA 3CW2A 3NJ4A 4RU1A 3ZI4A 5CR9A 2PFKA 4CI0B 4FE4A 1HC7A 1XLTA 3B7PA 3IKVA 3GEIA 4LZAA 3E18A 4UEQA 2P6RA 2O3JA 2FZ4A 3D6MA 3GFFA 3TMAA 4AKSA 3NHFA 5CT9A 4ARSA 3OPMA 5KYGA 4KPEC 1IYZA 3Q88A 1KZGB 3D6JA 3EEBA 1M75A 2PZMA 4PHCA 1CG6A 7ADHA 3U9TA 3IL2A 2JCSA 4CIWA 3V00A 3OURA 5ERXA 4NBVA 4RS3A 3PGLA 2GWRA 3LUJA 2XCSB 4TRMA 2QHXA 5A3SA 4UTNA 3W9YA 1Y63A 2GBLA 5FWYA 5JCXA 1NNEA 2CVHA 5AK3A 1NPDA 2I8CA 2W8ZA 1BHQ1 2GJKA 1GL6A 2WHEA 5P21A 2WAOA 4P84A 3WRYC 3FG9A 5C35A 3GT7A 3BHIA 4B75A 3LBIA 4MKZA 2AMVA 2ATVA 1FNMA 2ZCVA 3RS2A 4NCIA 4WH0A 5EIBC 5GPBA 1T36B 3ENNA 3E8SA 2X4IA 4FFBA 3C3KA 3GN2A 3UK7A 4YAEA 4PHGA 3HK2A 3P52A 3LGSA 4DL9A 3MWFA 4POOA 3VJMA 1WDLA 5KWSA 1Q83A 2AA3A 4NBNA 1MRSA 2OAQ1 4HDCA 4HGYA 4O3MA 5FUVA 4L02A 1QIEA 4LXQA 4ZZ2A 1B43A 1QGYA 2JGRA 2XW6A 5GTDA 2HXYA 2QVYX 2VP0A 1SKYE 2UZAA 3KOZA 4MRAA 3IUNA 5TMPA 2JHPA 4LTNA 2OFPA 4ZDKA 3RS7A 1M33A 1WCIA 4EKDA 2WF5A 1A9QA 3LPCA 4IQ8A 1G18A 4OHMA 3I6BA 2BCEA 3ICCA 1U7PA 3H7AA 4RJTA 4UBIA 1I2AA 1P1HA 3EARA 1R0RE 5ELMA 2IYWA 3ZNPA 3SICE 1X86B 3C39A 4LOAA 4A7PA 4BLWA 4O0LA 2GHRA 5AT1A 1YR1A 4BWFB 1T6NA 2DKNA 4FKZA 2R9VA 3NTLA 4FEAA 1ZW6A 3QE4A 1DQSA 3DZBA 3GLRA 1XBTA 1TM2A 2GTPA 3FNIA 3PJGA 5CB8A 1YFZA 4EI9A 3A6FA 4GE3A 4DBLC 1KMIY 3WFIA 1VPEA 3JR7A 1BKSB 4N9WA 5ALFA 4CTMA 5TQ2A 1DWQA 5AI5A 5BW6B 3VBEA 4CYMA 4MV5A 3O2NA 4EAAA 2FWBA 3FHCB 4LQLA 2QLBA 3EBLA 3VAAA 3GRUA 3QITA 4G1MB 4UQLA 1KMNA 3PXBA 2HXGA 3OLXA 4EENA 1H1LA 3UFXB 3S2GA 1U94A 1U98A 1W4CA 1TQHA 4ALMA 4KACA 4DKJA 5K3SA 2QI9C 2AEEA 1QMGA 5K0LA 4K9RA 3TLEA 3WSTA 3DL0A 2ODAA 4WKOA 1FSFA 1ZAKA 4PN3A 1YRHA 1N36B 2KX7A 5KNDA 4X62B 3A4YA 3UJBA 2C97A 2P3LA 1CUXA 1JKJB 2Z43A 2ZYDA 5BSTA 4AO7A 1ZONA 2P0AA 1QHHB 1JTFA 1LK7A 2BGKA 2X4DA 3F1LA 4INJA 4YR9A 5CDFE 1NZDA 4QJ3A 3N2GA 4ZK2A 4AF6A 4A1OA 1O4WA 3TMKA 4BVGA 2F3QA 2QP3A 3C85A 4EITA 1TADA 4U3JB 4V3CA 3L46A 1CUVA 2VDWB 4JGIA 3OZDA 1IEXA 1SXGA 4KQMA 1IWOA 5IUNC 3NFRA 1PFGA 2YXDA 1L4HA 4JROA 5E7IA 3I0NA 4XPIB 1FNNA 1SIBE 5CCEA 2RMKA 1MENA 4H1VA 1YZQA 2YUTA 4DLSA 4YO7A 4EMTA 3FNEA 1ZI6A 1WEHA 2FPRA 3AF4A 4NV0A 4P3OA 4ND4A 1M7HA 3P97A 4I2VA 5HTKA 5I7FA 2EJTA 2G4CA 2POCA 2C82A 2ZT8A 3A4TA 3D0KA 3QX9A 4ROSA 3ZQ6A 3ZWPA 3CWZA 1Z88A 3ESAA 1UWKA 2C54A 2VATA 5ALUA 4R8KA 1WO8A 3CZCA 4DOMA 5KB3A 3AR8A 2HQRA 2R84A 5M2QA 2QA5A 1AKNA 4NEGA 2PL3A 4RLHA 1G60A 5E9QA 4Z4CA 4IF6A 2JIOA 2WKSA 1HTTA 2NP7A 3E9DA 2A5YB 2I03A 2F8LA 3GZTB 1B1CA 4IVRA 4ENSA 1QC5A 1MOQA 3AB8A 5ES4B 1W5AA 2NW6A 4K3VA 1S2NA 2WICA 1BS1A 1LY1A 1QO0A 2B6HA 2BFCA 2QUBA 2H51A 3H05A 3O82A 2ACVA 3QUTA 4TWBA 1YF3A 3IIKA 1NI4A 4WGGA 4X5OA 2GH1A 4W6QA 2OCLA 3GLQA 2OHFA 3GNTA 3DE6X 2W71A 4TYYA 1W1UA 4H7JA 1IJFA 4KX5A 1FP2A 4MQUA 3CNEA 3Q7SA 3MCAA 4IQ0A 3RVDA 2WIAA 3KV3O 2C9BA 3V8BA 3VNUA 4DWOA 1OKKA 3DKIA 4BO8A 5JPDA 3TR0A 2XMGA 5EIFA 2R6CA 1DKLA 4OBBA 5IKMA 2QUZA 4TOIA 4YUVA 3A36A 3N0XA 4PIVA 5LNK1 1WXGA 1GAXA 5MDHA 4F3KA 1QANA 2RGYA 3AHIA 2GYUA 2YXPX 2Y1EA 1E0KA 3EZ9A 3G0GA 4Q3KA 4YRZA 3LT0A 4EJ0A 2CNNA 2LIVA 4J3JA 3VYWA 2ZBRA 1QHSA 1ARZA 4FJ2A 4PONA 3UKDA 4OTZA 5JRZA 1J5XA 2H00A 3PVCA 1E1NA 4OXXA 4RPJA 2ZVPX 2D2IA 1ULTA 4XD7D 1VMKA 3W05A 1QK5A 2ZTMA 3DHYA 3P0EA 4UQOA 5CLQA 4CQMD 1XJCA 4G4JA 3OMXA 1NY5A 1UJBA 5K0TA 4JV5B 2GN4A 4BAUA 2HWWA 1OQAA 3ZU2A 4LSGA 1QGZA 3KZ1E 1T36A 3C3MA 1M8JA 2HQBA 3SN6A 3HJRA 3K0BA 4PGGA 5CYOA 4EKIA 1E7QA 3O1LA 1VIYA 2C3OA 3LWDA 3ZHUA 1CZLA 3LYHA 4ND6A 1G66A 5HQ3B 2JAQA 1P2UA 1X13A 1H0KA 1XTQA 2PJUA 3CPJB 4RGYA 3UW1A 1JDBC 4Y2HA 4J3NA 4QUEA 5EJ5A 5FL7D 5HRAA 2PWZA 1YU9A 5IAAA 4J0DA 4HAYA 3P8ZA 4PCVA 1WE2A 1MR3F 1U1FA 2EJUA 3E22B 2QJWA 3NDIA 1DQRA 3AU9A 3LC2O 1JU4A 1UDWA 1OSNA 2JEOA 2H07A 4JVOA 1LSSA 2EZ4A 3A1VA 3CPSA 2QVXX 3PWSA 4K6FA 5E1MA 4ZYYA 2D6FA 3RADC 2ZUDA 3AI2A 3EQ2A 1H85A 2GOYA 3RS3A 5ITWA 3ZTTA 4L3WA 5HPYB 2CLKB 3EPKA 2PKQP 2Q21A 3AX6A 2GDZA 1C30B 3I61A 1I4EB 1QAQA 1GAWA 3PKZA 3U19A 4WBXC 1MX9A 2HBYA 3UMGA 3TNJA 1Z0AA 2AR0A 3CZMA 2Y1OA 4HFJA 4JT8A 2HA7A 1C8KA 4HN2A 2H1WA 4N18A 1T1IA 1JIQA 1USIA 3OIWA 2O9JA 4KO2S 4KXUA 4DMRA 2VI5A 5B5SA 4Q05A 4URFA 5I7EA 3E2IA 3R5KA 4P9NA 1THZA 1NJ1A 3H1AA 3EGWA 4HAOA 4ZAFA 4HRXA 3PC6A 5EC8A 4KQFA 2AN1A 4Y9UA 3ROGA 5C1IA 3SM3A 4TL6A 3C87A 1H6BA 2B83A 3WMWA 3SHWA 3OD1A 1DWOA 4KSCA 5AVYA 2XE6A 5GGXA 3HJHA 4B6QA 3IESA 4JP8A 5A05A 3P45A 4FJ1A 3RK4A 4CE6A 4FUTA 3BCHA 4LECA 5C7OO 2QRPA 1GPNA 1PG0A 1JKJA 4RXMA 4EUEA 4JEHA 3SHVA 1QHHA 1PCXA 3WLSA 5HYVA 4LZWA 1E1DA 4WY2A 5CDFA 4UDXX 1GSOA 1T5HX 4BNGA 1SR8A 1DBWA 1KA9H 3WMRA 1FVOA 1HG1A 1OFUA 3PJEA 4GVXA 2E4ZA 2QW1A 4Q12A 4AG6A 2XOXA 1T25A 1XZMA 4U3JA 2CSUA 1RTTA 2VDWA 3T1TA 1WMAA 3K5HA 1DKNA 4M0EA 4DDUA 1H5UA 4HQLA 3NM5A 4OVKA 4Q1AA 5J63A 2D06A 1L5ZA 2IHYA 1WLYA 4XPIA 3NHJA 3SE0A 3CYFA 4U2GA 4DBLE 1JG1A 1DHTA 1JSZA 3PPWA 5FUWA 1EP1B 3P0IA 1ZIXA 2JHAA 4WI1A 1GUDA 1O2DA 3UJPA 3IEUA 4Q7JB 4DNQA 4D9HA 1T4MA 2ZSKA 3OUUA 4I81A 2G8NA 2HV8A 4MULA 4B6OA 4RD0A 1E9VA 2YWBA 2EW2A 2AG5A 5F7ZA 3TLBA 4BE7B 4MAMA 3D6VA 3IVCA 4KFUA 3DBRB 4X1OA 4MVJE 5DWDA 3USES 4D81A 3SFZA 1C14A 3N3AC 4DCCA 3L6OO 5C2JB 3DD1A 2GJ4A 2X5NA 4QYSA 4XI9A 3O2JA 4K9QA 4EJSC 3JSAA 5LZ9A 3HXQA 3LC7O 4QSHA 1J2RA 1K8RA 1VLJA 2O05A 1PO7A 2MINB 2ZI3A 4CQLB 2GJ8A 1SIWA 2VDOB 2WQZA 4FNOA 4XX1A 3ZE0B 4G0WA 4CEIB 1G8FA 2ZYTX 3IDSA 3OT1B 4JJ6A 4HYTA 5JSQA 2IVZA 2Z4SA 4RSHA 1T24A 3RBAA 3THOA 1QFSA 4TLBA 3IP3A 4BGVA 4ZGBA 5KC9A 3GPBA 1PNRA 4QM6A 3EIWA 4OHPA 3C1TA 1RAIA 2CKDA 4FW9A 3IX7A 3R40A 4X65B 3H2KA 2V6GA 1VG8A 3CH5A 2IXTA 3UJNA 1TECE 3FZEA 1P3Y1 1ZYUA 1EZZA 1O57A 4D9EA 4ZT2A 3CUSA 3K0CA 3SJZA 1QQAA 4OU4A 2R00C 3FBWA 4ZCLA 5LQJA 1AXRA 1AQIA 3ESXA 3FTPA 4EA9A 2AZMA 3GRKA 1F8FA 4X0EA 3ZWKA 4KI7A 3TF5A 5KU7A 1I4WA 1U0EA 1CPYA 3KSBC 1RE0A 1TE2A 1ZHHA 1QIJA 2P9CA 5F1KA 3HYRA 1J4AA 5DEIA 4P4UA 1HE4A 2GXQA 4HQFA 4LXXA 4MVJF 2LP4Y 4RZIA 1DVRA 3UAOA 1Z0IA 5EEGA 3R09A 3W6NA 1E66A 4UDYX 4Q9NA 5HF5A 2ZRCA 2QI9F 3NORA 4UHHA 4XWTA 3V4SA 1UFRA 3BDVA 1WXEA 2WWXA 3DQZA 4G4IA 3F3MA 4GLOA 3HPRA 3A9RA 4UXHA 4UBJA 1YUMA 2CC2A 4RF5A 5FBVB 5K8IA 2PCLA 3MBOA 3PUVA 4XVRA 4A15A 4XWWA 5LD2B 1KS2A 5K05A 1HLPA 3OLQA 3Q5EA 4X41A 3UZUA 2QDXA 3N6RA 3BEDA 2O2SA 4QOJA 4ER6A 4DRXB 2QSUA 1GQOA 2K7ZA 3G0CA 4IZHA 4D8YA 1GNLA 2HHCA 1ZD1A 3KTDA 3QI2A 4FIDA 2BWJA 2B2CA 3OCJA 4MJ7A 1P73A 5HQ3A 5JWOA 4JI2B 1WL8A 3V7YA 4YGYA 3WGZA 4YJFB 2WB2A 4BZZA 4WPGA 2FRXA 5IDVA 5IANA 2XE8A 4KQCA 4DS3A 5AUPB 1R5JA 4LF8B 3E22A 2P69A 2BCGY 3TMYA 1DKMA 2G9NA 5I8WA 1CRWG 3DYIA 4MA5A 2YS6A 3BH7A 5H16A 3QOFA 3RV4A 1MVOA 1XDSA 5ALPA 3UJ9A 2TMKA 3NIGB 1SBHA 4R0NA 1P2VA 1KBOA 1Q74A 2VUUA 4XDYA 1PIWA 4A26A 1X92A 1XEAA 2D3TA 3EXHC 4H08A 1TVMA 3EASA 3ICOA 4RYDA 1ADGA 1M2VB 1C30A 3WK6A 1FLVA 2CUTA 2NNWB 5SZKB 2AJ8A 2NTNA 2FMIA 2ZWOA 2PD6A 2JDIA 2VT2A 4V03A 3VR1A 3DV9A 4JC5A 1Z0DA 4W8HA 5K3AA 1QDUA 1ZD3A 3MW8A 4P3NA 4B4WA 1GQQA 5KJFA 2DTDA 3KOXA 4HNGA 4LISA 5A5DA 4OAOA 5ILOA 1E99A 2H4FA 4GBMA 4DV2B 4WOKA 3KJNA 1ESCA 2L42A 3OECA 3PUJA 3IGFA 4LPSA 5A1TA 1PR1A 2FFHA 3A1TA 4J0KA 3KKKA 4ZEWA 3UJCA 2Q7OE 2HMWA 3DE2X 3N8NA 4IXMA 4MHTA 1WF3A 4EH1A 4DEXA 4IDDA 5UKDA 2J07A 3X2SA 4MGIR 4PHFA 3D8SA 9GPBA 5DSXA 3CO5A 1I3CA 1KK2A 1XEWY 5IK2A 3U4GA 3T5PA 1O0CA 5JHGB 4AG5A 1FUEA 1LLCA 2VNJA 1GZ5A 3HJNA 2FRDC 2WA1A 1JDBB 2HD4A 2OO7A 2XWPA 5SY9A 4KDEA 1IM5A 5EYPB 2JGEA 1F4VA 1XPOA 4KQIA 1DCTA 3SC4A 2EC5A 4GQAA 3WK5A 5FX2A 4Z0PA 4MVXA 1E2BA 2G82A 4F9EA 2VQ3A 4AICA 1NDUA 4ER7A 1H1DA 1KWGA 5HBRA 2BM8A 5DX1A 4R01A 2PGXA 5IC4A 2V5AA 4YP5A 4MYRA 3VR5A 1Y5IA 2FLKA 3FVWA 4RTNA 1QHFA 3HDHA 3OOJA 4L6AA 2AKEA 2W43A 3EC2A 4OJYA 2XUKA 4RD3A 1Y7HA 2X0JA 5JZ9A 4DCVA 4DJFC 2XUAA 2A1IA 4J7UA 3RSFA 3W5JA 1OZFA 1EBUA 3TBHA 1NT4A 5BNFA 1GPLA 3EQ6A 2O8NA 4MUXA 4OQQA 3DM5A 1U2SA 4KLNA 4K9OA 1YDEA 3IQXA 1P9NA 1ISJA 3KWJA 3LTNC 1X1BA 1I32A 1NN3A 5KTPA 3A14A 1OHHD 1PGNA 1JT9A 2V4MA 1A8UA 3DBRA 4UBKA 2OXFA 4D6YA 3UN1A 3HKCA 3E4DA 3VH4A 5ESRA 4DC9A 1OD6A 1UOPA 1T3TA 4F12A 5JXHA 1HFJA 2IYLD 4TXLA 4GX2A 1S3IA 4TMKA 2JAUA 4G1BA 1QYDA 1P75A 3K0HA 4G97A 4U02A 1JSCA 2BM9A 3DOJA 1NW3A 4CQLA 2MINA 1B8OA 3CINA 5BO5A 4CEIA 4BKRA 3OT1A 3EIUA 3FYSA 4Q9AA 3HB0A 3R3ZA 1XTPA 4PTLA 5H0IA 3L7JA 1NSTA 4UW9A 1RQPA 1TRHA 2XAAA 2YC2C 3MIZA 3SVTA 4HPXB 2QROA 1WUKS 1ZO8A 4WY8A 1X2EA 1U4SA 3AC0A 3WR5A 1L4MA 4INOA 4HNHA 2Q5IA 1OU4A 4PPQA 5CM2Z 4TX1A 4KXWA 3A2NA 3EQZA 3TBKA 4G63A 4DCMA 9ABPA 4HEJA 2XSZA 5JZOA 4LFCB 2WIGA 1R9NA 4IP0A 3CTMA 3PGMA 4JLOA 2RHWA 4QXQA 5FYDA 3NBMA 4GKKB 4QA9A 1CDEA 1MTZA 3NC4A 5BWCA 1UKCA 2FK8A 2WTMA 3RABA 4J7CA 4BYGA 4JXZA 1KETA 4PNZA 3DEHA 4G0MA 4PRZA 2SICE 2FN3A 3Q8KA 4W7HA 5G4KB 3K53A 1S02A 1R5NA 1XQ6A 5LMZA 4LJRA 2CXPA 1M2WA 3K0FB 2AIRA 1IRXA 3QBDA 3EJWA 4YJDA 5EHQA 3WKEA 5K9ZA 1BX0A 4EJSB 1V7CA 4GM4A 3SZGA 2WWGA 4QPJC 2DBRA 3DOHA 3HVJA 4R1PA 5DU2A 4MUMA 2DXIA 5LQCA 1ACJA 4LI0A 3F5MA 4UZFA 1YDWA 2C04A 2D5LA 2CN1A 3W6OA 4WOBA 4KDRA 3QELB 1MQ9A 5CXXA 5FR2A 1D4AA 4FGZA 4FP9A 3M6LA 1RMTA 1UBEA 5J4HA 4DRXA 1ES9A 1GQRA<