1SBRA

The structure and function of b. subtilis ykof gene product: the complex with thiamin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
186
structure length
182
Chain Sequence
b'RIAGFRFSLYPMTDDFISVIKSALAATDTSKVWTKTDHISTVLRGSIDHVFDAAKAIYLHAANSEQHIVMNGTFSIGCPGDTQGDTYLKRVNEDAVRGLKAEAPCQFALYPMNEPDYMGLIMEAVDIAKAQGTFVQGVHYASELDGDAHDVFSTLEAVFRMAEQQTNHITMTVNLSANSPSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ykoF
publication title The Structure and Ligand Binding Properties of the B.subtilis YkoF Gene Product, a Member of a Novel Family of Thiamin/HMP-binding Proteins
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligand binding protein
total genus 50
structure length 182
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07615 Ykof YKOF-related Family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sbrA02
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sbrA01
1SBRA 1YQHA 1VK8A 2EKYA 1LXNA 2EPIA 1S7HA 2IBOA 1LXJA 1S99A
chains in the Genus database with same CATH superfamily
2RU9A 2I9SA 3CO9A 3T5HA 3FBCA 5HK4A 3CCLS 4Y65A 3FEYB 1RT5A 2IPOB 4NCGB 1UZDA 3HD1A 2D9OA 2H5EA 1K0VA 2FJVA 1BXNA 2UUAF 4WFAQ 1KD1T 2XZTB 2FJAB 2XS2A 3MR6A 4C9DA 4AD6A 4DPWA 1U1OA 1M5KC 1KLMB 5K9FA 1FFGB 3GE9A 1KOHA 4K4XA 4C8OA 3M32A 3TZWA 1QDUB 2MHEA 2ASLA 5AE1A 5K8NA 3RB6A 3OR1A 3LWLA 2W4PA 1LW2A 2ZM6J 3K8VA 4X65F 2RILA 2QJ3A 5HP1B 2FVCA 2XC9A 1RA7A 3GU0A 3CC4S 2DHGA 1GH8A 3JSMB 3W3SA 1X4CA 2DO0A 2ZDOA 4DG1A 2ZD1B 2VOOA 1NKCA 4DFPA 1IR0A 3MMAB 3WHIA 5I3QA 2FPHX 2JLFA 2DCUB 3M8PA 1X0PA 1XMBA 5EUHA 4ES1A 3NOCA 3MAHA 4HACA 1IKYB 4U96A 2H3EB 3AB2B 3ENAA 4DLEA 2J9DE 4LFBF 4ID8A 5GAGU 4YP3A 2XYPB 3Q24A 2CG8A 3FZBA 1T3OA 1D9AA 4WYLA 1CJVB 3C3LA 3BKTA 1NJWA 2CNKB 1DQ9A 2ZDPA 4X4QA 4J9MA 4DF4A 2CDQA 4WP9A 3PJ9A 3J7AN 3EVMA 3MOZA 1X4HA 8RUCA 4DV1F 1RQ0A 2FHJD 1CJTA 3BBFA 4AYBD 1G2EA 2KZMA 4AL7A 2J9EA 1UFKA 1GMWD 3FDSA 4J9UE 1RAEB 4PXEA 4ED0A 1RTHB 1N36J 5L9XA 4HI1A 4GVBA 4BBYA 1TL5A 2AEFA 4RPFA 5JVHQ 4B3MJ 3MAAB 2YKPA 3MUMP 5L38A 4DV3J 4DV5J 4YB7A 1G1XA 2KU7A 2ZH5A 2F9DA 1TP7A 4ZPCA 2YQ1A 2AJ0A 2YNGB 5F9LA 3UNYA 1LK7A 4Q43A 4TU8A 4YMEA 1HWJA 1S7HA 1SKUB 5L1JA 3OTBA 2M70A 2VKRA 2QZ8A 2HHHJ 3CVKA 4OYAA 2EXUA 2PT0A 3T5KA 2EK1A 4TLQA 1S12A 1S6PA 1HNZF 1H72C 4W4MA 3KTQA 1HI0P 2AZ1A 3KUGA 1FK9B 4LSLA 5IM0B 1RYSA 3OVBA 1S6UA 3W5ZA 2VV5A 3PW4A 1X60A 2C2NA 1VBXA 3BS9A 3KK3A 1DTTA 2WVFA 1S10A 3M6VA 4NA2A 2O66A 1RISA 2L08A 4CM2A 1Q5YA 4NLDA 3RYLA 4ENOA 4WFYA 3MPWA 4DL0C 5ETRA 2RH3A 2IJNA 3W2VA 2O5DA 2Y0SD 2IMOA 4LQ3A 3D4JA 4LF5F 3X3UA 3M8RA 5C2CA 4OHZA 2DBBA 1UW9A 2DXFA 1XMOF 5ETPA 1GX6A 2R3VA 4ZN1A 3TARA 4LBPA 3M05A 4CO0A 1Y4ZB 4OHXA 1KR4A 3FBBA 4WWSA 4JB8B 1K44A 4DL3A 4WIIA 3HSDA 1SJ1A 2QMXA 3K5MA 2QSWA 4JI0J 3HX9A 1EB0A 2DEJA 3HVTB 3DU5A 1YZ6A 1YKWA 4ECUA 3N0VA 2MY8A 2XEXA 2QLJB 4RWWA 2EVZA 4DUZF 2FZKB 4ZP8A 3ITHB 3N6LA 1HNVB 2CADA 1RT7A 4DFMA 4K2JA 2IDLA 1RT5B 2VG6A 3BR8A 4J9RA 2X3GA 2MZQA 4AL6A 3O6QA 2LQ9A 2FVQA 2XMKA 2Y1JA 3M2UA 1Q81T 3IBWA 3AQOA 2Q79A 5CZXA 4MFBA 1F60B 2COLA 3IRXA 4QJVA 4WZMA 4NA1A 1TFWA 3OL7A 3MR5A 4ZLPA 1RBLA 1JNZB 1VK8A 3M32B 4Y00A 4LIRA 2KN4A 5HQLA 1KVKA 1ZTTA 1MU2B 2HNDA 3U1LA 2W9AA 4X4VA 2X3DA 1R43A 2VL1A 3OTOJ 3AT1B 1B70B 5H9EK 5KFSA 1LW2B 1B3TA 2XLJA 1FD8A 1NRKA 4F4WA 2IM3A 3GQCA 1T9WA 5KT3A 4O0NA 4JI2J 3QJLA 3DOKA 4O0IA 1GK8A 5B0GA 4CLZA 3D9BA 2CJYB 4TY8A 1X9SA 1KS2A 2UUCJ 4UOFA 4CT8A 3SFUA 3M8PB 2QFIA 5ETVA 1D09B 2AWZA 1Q79A 3BGFA 1W26A 1EZZB 4XO0A 1UTAA 1JLEA 3NAIA 3KNAA 1CVJA 2SXLA 1FWKA 4X66F 3M9OB 5A8WA 3H42A 2RMLA 4PG7A 4IDKB 5LJ3Y 2F65A 4ECSA 2MZSA 5A6WA 3MD1A 1S9EA 4ZJQA 2XCPA 3BJYA 1I1GA 1SCJB 1RADB 1KTVA 1FEEA 3IR5B 3TAQA 2VODA 3A8KA 3BB5A 1NEEA 2DGWA 3DRYA 1YX2A 1TV6A 3KLFB 4WIQA 3OSNA 4X4TA 2CJQA 3L7OA 4YHHJ 1RWOB 3BKUA 2XSFA 4DV4J 1FRMA 1P1LA 1IBMF 1IN0A 4WKRA 1YVFA 1NDLA 1IKXA 1VQ6S 4KTQA 1X5OA 4JI6F 2ILYA 1VBZA 3I55S 5J2PA 4WK3A 4ER8A 2KVQE 2DNOA 4RWXA 2KM8B 1RT2A 3FK4A 4DSIA 1UMJA 3TUIC 4HYKA 2D1CA 3GZ7A 4M5GA 1RWVB 1LK5A 4DQIA 3KHHA 2GVDB 3CF5Q 3J7Z5 4LSLB 2OD4A 1FRIA 4ZPTR 2HFVA 2YXLA 1DTTB 3D66A 5HANA 2F7VA 2D74B 3MR3A 5D78A 4X4SA 4M5DB 2W7OA 4F50A 4GKKF 1T7PA 1TUVA 3FFIA 1GXTA 2ZE2A 2V4RA 3W2VB 2KTQA 2HQDA 2WK4A 1P8GA 4QQBA 2RIJA 1D8ZA 5IQQA 4YR0A 3EPGA 3NGTA 3HKZD 4ZVTB 4FXWA 2BJDA 2R8GA 4X65J 1QAXA 5G0RA 3T1HF 3SZ2A 3BO4A 2FDNA 2J0XA 2QRRA 1JLQB 1ICEB 1XR6A 2QE5A 3AB4B 4EK2A 3R5JB 3J80Y 2XMWA 4PG4A 4KRWA 4U67Q 2BQ3A 2K3KA 1ELOA 1HBUA 3ZTPA 4B9UA 4Y28C 4RJVA 1WJ9A 4WFBQ 4UY85 1R8HA 2HBQB 3OR2A 2XO6A 1HBOA 2Z2MA 1NJYA 4CO1A 3TWZA 4LFBJ 2BKOA 2R8KA 3OHAA 4ZPVR 2OMOA 1T9TA 4BHQA 3JB9k 5D0EA 5F0WA 2CVIA 4YDDB 2VG6B 1TKZB 4QWAA 4D3HA 2DGOA 4HHJA 4ECTA 4QW8A 1CG2A 2OJ3A 3M2UB 1HARA 4O3RA 2BJ3A 3KHRA 2HFNA 1VC6A 4A47A 4DV1J 5HVFA 3ONQA 2WVEA 3J7YU 1X9WA 4A8SA 1NLKL 1AYEA 1LXJA 2W2MP 2HVDA 1U1MA 1VQ4S 4CI0B 4PABA 1Z1ZA 4CZCA 3GYNA 1VS3A 1SKSA 2DNYA 2C2RA 3GCWP 2DTJA 4F4AA 3DOKB 4CYUA 1M5HA 4DR3F 2G2OA 3QRPA 1P1TA 4FKXA 3OTEA 4MJKA 5IT9U 3W5YA 4HR2A 1HNZJ 4WE1B 2OEMA 2EC2A 4NA3A 2GVZA 1BE4A 3W8GA 1ZYQA 3UO0A 4QR1A 2V2KA 1ZM2A 3Q89A 4NYPA 5A8WB 4KGVB 4NZ7A 1HQ2A 2Q6CA 4L3NA 2WW8A 5KFLA 3VGUA 3A8EA 4ZPBA 1S9EB 3OJSA 4ED7A 1UJ6A 3E01B 2B4UA 1D9DA 2MB0B 2EWHA 2V63A 4NZ6A 4DJBA 2G9OA 3PW5A 2FQQB 4BS2A 4LF5J 3M4XA 5AXNA 2P2CB 3NWRA 3S8SA 5KFFA 1XMOJ 4ECVA 1L3UA 5C5JA 1R0CB 3RBEA 4QIEA 1OPZA 1RT1A 3DU6A 4F02A 4MKYA 3L95X 3OVSA 1IKXB 5IV4A 3ILIA 4URSA 2W9CA 2VFSA 4HEA9 1WSRA 5J2PB 2MKCA 1S1WB 4KB7A 3FQKA 3CDUA 1ZM3A 1RT2B 1NPPA 2MQ8A 1RAOA 4O3PA 3B8HA 1YDLA 2LXIA 4G6VB 1T9XA 2KL8A 3DDNA 1T03B 4DUZJ 2K7KA 2HNYA 2AT1B 4F3OA 1JNRB 2CQHA 1HYSA 2ZH6A 3CJ3A 4Q5VA 3BKFA 4ZIWA 1SXLA 5L8RC 2MY7A 3PNIA 5K8PA 4WTYA 4FYDA 1GT8A 2QC3A 2EFOA 2W24A 5E3CA 1FX2A 1A6LA 4DR7J 5C24B 1ITPA 4RNMA 3BPSP 2B56A 5JMNA 1Y3JA 1NJZA 1I3OB 1CSJA 4DV6F 3PTWA 5D15A 4NASA 1JKHB 4C8LA 3QWPA 4ZS6A 1S6OA 3D0IE 2CQ4A 1R3NA 2PE8A 5AE3A 3IR6B 2IRXA 3UD4P 1H7XA 4WBFA 1S1UB 2M52A 5LSLA 5KTQA 1RYRA 2V2VA 4C48A 4FVCA 2QFJA 1HBUB 2FVRA 3HSZA 3UN2A 4F36A 3TVYA 3M6WA 1GQEA 1Q8KA 3TEGA 2CJKA 2Z57B 1T02A 3E3XA 2VC1A 4N47A 5F8LA 4X66J 3UR0A 4LF9F 1B0TA 3C66A 2EEYA 2VG5A 2E7XA 2ZKTA 3K2YA 1RT6B 5GAHU 2JOQA 4DV7F 2H4WB 3QAEA 4ZCLA 1OJ4A 4QZVB 4PRFA 1R27B 5DZ6A 2HMIA 2RD5C 3CT9A 4ECWA 3LWMA 4F2SA 2ZHAA 4A8OA 2IVYA 5F8JA 1Z2ZA 1IWAA 1FXLA 4PUOA 4CLWA 2D7SA 1IBMJ 2P6SA 2HS3A 3KJFB 2HZVA 4I64A 4FKYA 3MCNA 2LEAA 3THTA 3ZZPA 2P5VA 4CT9A 1C1BA 2J9CA 2CQBA 2CZ9A 2MSSA 1Y5NB 4MAKA 4IFYB 2RU3A 4JI6J 2B4PA 3NXZA 2HQ3A 3U27A 5E0OA 5FJ4A 4MIWA 4B3RF 3GG0A 3PJXA 3POTB 3V6KA 1RCXB 2CPJA 1G6BA 4G65A 5M2UA 4KC5A 3FCHA 3C6TA 1QJHA 2VPWB 9ATCB 2BKPA 1IJFB 4A8WA 1IUJA 1VMBA 3M8SA 1JQGA 1IQZA 4I69A 3KLHB 1RTDB 2DISA 3E51A 1Q4RA 4BDPA 1BGXT 1MROA 4DZ6A 4TU9A 2AYBA 4E0DA 4UOCA 4FVMA 1N6QB 2VU5A 5BXIA 3KLEA 3ISND 2VDIA 2B7BB 2WOMB 4GKKJ 1FXRA 1FDNA 2VB6A 3SV4A 1F1BB 2PFFB 1WHYA 4KGZB 3GV5B 1O51A 2XNQA 1XJWB 4OL8A 1RTZA 2M8HA 2BRLA 2FTRA 1YGYA 2WVDA 2WCXA 4WP8A 2JL9A 4YY3J 4ZVOB 2AX0A 1DHMA 1RT1B 4C6AA 1HI1A 1S0OA 1VQKS 5IXUA 1K1QA 2VBWA 1FO1A 1Y10A 3HHLC 4DX8H 3G82A 1NK6A 1QE1A 1UEVA 4MKBA 2D41A 1WELA 1SQFA 1FJCA 1X4BA 2Q6BA 4FN5A 5HMXA 1U47A 3MFHA 2XO7A 2DNPA 3CDAA 2OPSB 2E1RA 1RABB 4EFAC 1URNA 2YKQA 2E66A 1E6YA 5B0CA 5F3TA 4ATNA 2LQJA 4DQSA 1U26A 4USKA 2ABYA 2HNYB 1VQOS 4L76A 3HT3A 2GJFA 4R5PB 3NGRA 1HYSB 1SJRA 1U24A 4CCHA 1ZZFA 2HGLA 1LEOA 4DX6A 4EZ6A 1GX5A 2W4DA 2I38A 5H9FJ 4KKOA 5IC6B 2KHCA 5F8MA 5LSOA 4ZK7M 3W8PA 1K9MT 3TVKA 4DFKA 2Z2ZA 5DDOC 2A18A 3R27A 2NSCA 5D4PA 1YQHA 2OH2A 2B7CB 4U95A 3TW0A 1S99A 4YB1P 1PAUB 3HI9A 3T6JA 3TYTA 4FXVA 4Z2XA 1IM6A 3QT5A 1RAIB 3MMCA 3NWGA 2CQ2A 1YJTA 4G3IA 3PFOA 3A8IA 2ASYA 3VQSA 3AHPA 1UA1A 3EWGA 5A0YB 1RWNB 4DR3J 4PWUA 3FSXA 2HW3A 2YWWA 3QPIA 3KJQB 3B82A 4I7FA 3CD0A 2K7JA 5ADZA 1YWXA 2Z30B 1NZ8A 4FBTA 2YPZA 3CWJA 4KHPF 4CTAB 5AXMA 2ZOFA 4B9VA 3GR0A 2UUBF 2C3OA 1JLFA 2H54B 3QNWB 2AZ3A 3IGNA 3DRRB 2VQFJ 2N7YA 1VQSA 4Y34A 2QV6A 4CO5A 2AHOB 4K5RA 1NK7A 1TL7A 5D3GB 1S1VA 3FCWA 3OL9A 2LU1A 1Q7YT 1S48A 3R6GB 4ILMA 4O44A 1KDNA 1NHVA 1X4AA 1WEXA 2YWEA 1SL0A 3LAKA 4OYPA 5KFXA 5CCMA 2CNLB 2RQKA 2DPIA 1QD1A 2U2FA 2ZUAA 2XY7A 4PUOB 2OGUA 4CO4A 2C2DA 5KFOA 3K0JA 2M4MA 2OFHX 2C2MB 2ZH7A 1IKVB 3TX0A 5CYJA 1S4FA 2F4FA 3TQEA 5T7LA 2R2SA 3Q8YA 4NX9A 3BO3A 2HHUA 2KVIA 2E5HA 1YLXA 4HTJA 3NGDA 3JXOA 3SFGA 3ZNUA 3FSYA 4F2RA 4DX5A 3C6TB 3IBCB 4C8MA 4X4OA 3H5XA 1F6TA 3F73A 2YTCA 3C16B 4K2XA 3PR5B 3OL8A 4O4RA 2KJVA 4ILRA 1X5SA 3CUNA 2OSQA 3RR8A 1BMQB 2B4OA 2Z8QA 1MROB 2ZJRQ 4C11B 5GAEI 1FEHA 3QT7A 2O01C 1EP4A 4NXMF 2CAJA 4JV2A 3QZ8A 3LP0B 3MF5A 2ZZNA 2HLTA 5BJRA 2BM1A 2GQ2A 2XYHB 2XGQA 3CMAS 4K4YA 4X62J 4L72B 4EBCA 4DQPA 4DOZA 4RUCA 2RS8A 1AUSL 3PY8A 4DV6J 1S1TA 3FEXB 5B0BA 2DHSA 3H40A 2VUGA 3I5CA 4WCEQ 2KG1A 2BA9A 5LXYA 2F5GA 3DOMA 2BW7A 3CCWA 3DI6A 1QE1B 3N79A 4RUHA 3Q22A 2FGOA 2CPYA 4PXDA 3P5BP 2LA6A 3DRSA 2VF3A 3H2LA 2NPFA 2I8EA 3LGHA 4OLOA 3EM1A 3NOGA 4L6V3 2WZ1A 2C2EA 1U1RA 3Q8RB 3BBBA 8AT1B 5LT5A 1Q5VA 3C8YA 2F4VF 3UNGC 3T6BA 5KG1A 3OTDA 3CJRA 4LF9J 3MEDA 2QYGA 3FUYA 3I5BA 3LH2S 1MMLA 4OMFG 4DQRA 3EVOA 4AXJA 1FRKA 1Y9OA 1WNEA 2EG1A 3WIUA 1R8BA 4OIXA 2PEHA 4DV7J 1XNRJ 3VALA 2ZOMA 4DR4J 1PAEX 2G1HA 5I42A 1KN6A 4M5HA 5KT2A 3OHBA 3GIIA 3PO4A 2OO4A 2VBXA 3I32A 2D3ZA 3VAGA 3GJRB 2LP4A 3TR5A 2GNKA 4P72A 3AXKA 1CQNA 4Q8FA 2ILZA 2CNOB 2AP6A 1NNDA 2DR7A 2FIUA 3MMCB 3ZTOA 4NLGA 2GQQA 3DYAA 5HLFA 1LWEA 2AGOA 2QA2A 1L3VA 3U7JA 4V1Ak 2QIFA 3NP5A 5J2QB 3KJVB 4I7FB 4QYZJ 2RUSA 3V2UC 4LUBA 2KXHA 4OJ3A 4X4NA 2XG8A 3D2WA 1HBMA 2MGZA 3DLLQ 2W2OP 5KFTA 3W60A 4KR0B 1JLFB 2B9XA 3HFZB 5EN1A 1CPZA 2BRKA 3GR1A 3N5FA 3TA1A 2R7QA 3CCSS 3QJPA 5DLGA 1TL7B 2M0GB 5KFKA 2IM2A 2CZVC 3GIMA 2C2KB 1M5OC 1JLCA 2HWHA 4I6WA 3ICLA 4QR0A 3KNGA 3IWNC 4CQ1A 1MG7A 3I82A 4I6YA 3J81j 3CJKA 2B9EA 2X1AA 4NE9C 3EXYA 4ANDA 2DRAA 1XIQA 4QU6A 3CCQS 1LXNA 2V4JA 1TUGB 4DPUA 3LPYA 4NXNJ 2C3UA 5I3PA 2ZH4A 3QFWA 3KLGB 2HNZA 4DWIA 2ACMA 4PQUB 3BDPA 2DXEA 2ZH2A 3D28A 3JQKA 4A8FA 2BW2A 3H5UA 2VC0A 2LYVA 4B3OB 1N0UA 4ZCIA 1R0AA 1EJ7L 2W8LA 1RU1A 1EQ0A 3QBCA 1TZ0A 4H4KC 4UZCA 5ETQA 2XGPA 4U7CA 2DGVA 2NR0A 3CMQA 4MMOA 4KQZA 2FVPA 3H59A 1REVA 3R2DJ 1QY7A 1QLNA 4DV0F 1ZA1B 3GB0A 1ZOTA 1U2RA 3AFGA 3I6PA 3T19A 4NEZA 2AYEA 2VPZB 1R6YA 1NH8A 1WDDA 5KFGA 3PCOB 3QIPA 5BYSA 5T41A 2WSEC 3MMJA 4HT5A 1QVGR 3MM7A 2Z2LA 2EKNA 3NNCA 2A3JA 5CCLA 3MECA 2LQ8A 2VG7B 4Q0BA 4KFBB 3DI6B 1NK5A 4MIAA 3LA0A 3GG1A 2XM3A 1RWWB 2DGUA 3UWTA 1LW0B 1TMJA 2XS7A 2NCKL 3VAKA 3OLAA 2VDHA 4GO5X 2IRUA 3Q8PB 3KHGA 1DLOA 4CO3A 2B6AA 4KHPJ 2CUYA 3DN9A 5KFIA 3SSSA 1AT1B 2UUBJ 2PMWA 2RNEA 4FPRA 4GO7X 3VF0B 3P8BB 5AT1B 4N5SA 3MEDB 1WHVA 2YNHB 5E3RA 4EMDA 1CJKB 4ZJLA 1XN9A 3D1QA 4ZLLA 2BZ2A 4PR6A 1XTZA 3H0PA 2M88A 5I42B 2GJ2A 3M8YA 4Z7YA 1ROFA 2CJXB 3TP2A 2I5JB 3R5CA 4DR1F 3ZZTA 2BXJA 4NLWA 2YX4A 3UW1A 2DVIA 3I9V9 5KT5A 1QM9A 2IJRA 5A8RB 3QO9A 3CTRA 1PJ7A 1DFDA 3MPYA 2MQMA 4J9KA 2BUNA 3DYAB 2H65B 2OSRA 1WI6A 3G8QA 1LWEB 5K14B 3GIKA 2CXEA 2F40A 5LSRA 5IOLA 1IXKA 2QEXS 3ZFVA 2KM8C 2M9KA 3RW6A 2FY1A 3HD2A 1RAHB 4DS4A 3CCES 2PA3A 2DNZA 3A12A 2HFUA 3BGRB 4KAIA 1S57A 1N5YB 1HBMB 2LCWA 3SEOA 1SH0A 4OI1A 1H2UX 3HXMA 5IT9Y 3D0HE 3HHNB 3P5TL 2DK2A 1U6BA 4CP5A 1S9FA 3MCSA 5LOQA 5JXSA 3GILA 3P4UB 2AJ1A 3DLJA 4XIUA 4UT4A 1IVZA 4NXMJ 2J7WA 1TKXA 5THWA 1CC8A 4MK9A 1LWFA 1JLCB 3WDOA 3NGSA 2DGTA 3ZZ0A 3BZQA 1LV5A 3D1HA 3E8OA 4M1KA 2V67A 5KFCA 3IO1A 3MXHP 2YX7A 2CRLA 3I87A 1OWXA 5D0RA 1Q8IA 3PX6A 4P2FA 3I96A 2ZZTA 1BLUA 4NPOA 2RQMA 2MKKA 2CQCA 3KUEA 4IG0B 2H1YA 3J7ZT 4DPXA 4LSNA 3R9LA 1EIYB 1VLOA 4Q45A 2VZ9A 4HLBA 2V50A 1VQ8S 3BH7B 2ZJPQ 4GKJJ 1PG5B 2WHOA 2YKAA 3RB3A 4ANEA 5B08A 3LGNA 2BANA 3IG1B 2M8DB 1YIJS 4OLPA 5D8HB 1R0AB 2F4VJ 1UVNA 3W2WA 3VAIA 4X4RA 1X4GA 3CD5A 1BY9A 5HSPA 1SV5B 2OAUA 4K0KF 2VIHA 1N34F 1SJ3P 2LDIA 3D5MA 2E5IA 3M2VB 4DMZA 4V19X 4GRSA 3PIOQ 2OIHA 1HMVA 4RW7B 1K8AT 1H2VZ 1QSSA 1VRQC 2V69A 1SH2A 3QIPB 5KG0A 5E3QA 4ZPDA 4GVLA 2QLFB 4ZVEA 2XY6A 1MSWD 1C4CA 2XMVA 4P74A 4IH7A 1MWZA 4CM0A 1HQEA 4J5OA 3TOQA 1KRPA 4RL1A 4M94A 5F8NA 4FF3A 4Q0BB 4MH8A 2W7PA 4PZVA 3B6BA 1SUQA 2D3UA 1FA0A 3S7RA 2R7RA 2VJVA 5DRKA 1OQ3A 3G6VA 1OYEA 4LVOP 5LMUF 3H7HB 1Y11A 5GMDA 2ZKUA 4EEYA 4BWJA 1QTNB 4YS2A 3DGVA 3WC2A 1CS4B 1H6KX 4NLXA 4I2QB 2XSJA 4LIWA 3FCVA 2IA0A 1YBAA 3PFEA 2EBEA 3ILLA 2QA4G 4IRKA 1UL3A 2LQBA 4KIAA 2XMMA 1ZAVA 4RU2A 2N82B 3LQVA 4NLYA 3I56S 1UEKA 1V9OA 4CIOA 2GS8A 3AD8C 2EPIA 3HSJA 3ET6A 4QWEA 1HI8A 4ZP6A 2G0JA 5IZHA 5KT7A 2KFNA 2W9BB 1V3SA 2XLKA 2YNFB 3OBIA 2E5JA 1KTQA 2XHWA 1Q1KA 2HS4A 5CYMA 3AJ2A 3PG9A 1FCAA 5M2RA 4DCPB 3RAXA 2KH9A 2VH7A 5HROB 1R8CA 1UWBB 4ZLNA 2C3PA 1TK5A 1NSAA 5DDPC 3R5GA 1Q7LB 3L7PA 2B5JA 4AT1B 1W2IA 2MZJA 2J9DA 3U02A 4I6AA 1HHQA 3GLJA 4WZQA 2OELA 1JLBA 4RLEA 3MWBA 3HLUA 3UCGA 1YRUA 1TAUA 4IH6A 3GMGA 1Z4UA 2OHDA 1MWYA 3DNCA 2JFKA 4RX6A 1RB0A 3ILJA 4ZN3A 1H2TZ 4QPTA 3KXDA 2CPXA 4DV0J 3IA0A 4WU2A 2G2YA 5HBMB 5L46A 4UTGA 5E41A 3K89A 3W9IA 1JXVA 3BEGB 4CRJA 4O4GA 4EI2A 2RB7A 2XI3A 3D6FB 2CWXA 2CNNB 3ZC4A 2IM0A 3DDKA 1TU0B 1WC4A 1NDCA 2KZZA 3H98A 2KYXA 3GP9A 4Z7CA 1QSYA 1S49A 1QAYA 3KMSA 5JUMA 3QLHA 4KH0B 1L3TA 2GGPA 5C2GA 2GIQA 3D67A 5B7WA 3IS9A 3LP2B 3D3CJ 4ZVUB 3EMTA 3C19A 2QN6B 4LSNB 5I4MA 4UUWA 1V6HA 2DITA 3T1AA 3VAFA 3P45B 3BGLA 2FJBB 3AOAA 1YRTA 1OSDA 2POKA 1X5PA 1V3ZA 1SJ4P 3M6XA 7FD1A 2BANB 3BSNA 1Q16B 4OV1A 2DGQA 2VPYB 5MAOA 4AUKA 1TL1A 3CEDA 1WOSA 1H3DA 2BOAA 4U8VA 2E1CA 1NK8A 1TKTA 2HQGA 5KFDA 1VK3A 3IGVA 3VVTA 2FUG9 4N76A 4C3LA 4P71A 2RE1A 1OSCA 3OL6A 4P52A 2CG4A 4Y2IA 5E2QA 1HD1A 4DR1J 2N4CA 3AOBA 2CPHA 3N9UC 3DFEA 4CLYA 3K7RA 2IC3B 2HFSA 2MQLA 3FNNA 1FX4A 5J1NA 1JXEA 1Y0HA 2B51A 3GIRA 3BN7A 2HRYA 3P6YC 2UVUA 2JC0A 1SUQB 3M2RA 4X2BA 2CPDA 5M2PA 5KOXA 4C8NA 3AXMA 2UUTA 3KKFA 2YH1A 3P3DA 3I0SA 3CJ8A 3H4DA 4PAAA 5H9FK 3TUPA 3KDOA 3AOCA 3VAMA 3R6LB 1HWLA 4UOGA 4F7VA 2VQEF 5DLFA 1F0XA 1FKOA 3K5NA 1Y00A 1AW0A 1F9HA 1RWUA 2NS1B 5GVQA 1HNXF 1EARA 5J2MA 4QIGA 4ELUA 1K47A 3T9ZA 5DGBA 1NHKL 1RBOB 4NI2A 3W9HA 1DY3A 1ZAXA 4NLTA 1VRTA 2HFZA 5KG6A 1QSLA 3P96A 2HQCA 3A3OB 2QMUB 1SIWB 2IAJB 6FD1A 5HMZA 2ZVSA 2CPEA 2J76E 2KKHA 1N0VC 4CH7A 2CVEA 4WK1A 4USUA 1H0HB 4IR1A 1FE0A 1FVSA 3H90A 4LF7J 4JV5F 3CIMA 1X7VA 2VFUA 1VJWA 3DOLA 4KH1B 5CYMB 4JV1A 3EZUA 2RF2B 4KJIA 4KO0A 1RT4A 3TAMA 4P73A 4OFZA 2DKOB 2DNGA 4EO6A 2Z2YB 3PYFA 3MUTP 2OFGX 2NXNA 4DUYF 3U1MA 1Q86T 4DR5F 1CC7A 3I0RB 4MT1A 3V81A 2DIVA 2Z4PA 3SQOP 1C0TA 4MKAA 2OD6A 1N8RT 2X1FA 1TUWA 1WD6A 2E7VA 4UW2A 1RTIB 1IBKF 3RUBL 3UFCX 3TZXA 3EZOA 1UVJA 2DNMA 5DM7Q 3PX4A 1X4DA 1U8WA 4HVZA 4K0KJ 4NEYA 1N34J 2WONA 3EUNA 3ENVA 2PSZA 5DQGA 2OI2A 2HBZB 6AT1B 3L9ZA 1NHUA 2W2NP 4TU7A 3HFKA 4ID5B 1DRZA 4M63A 4UOHA 1XK8A 3TI0A 4MIBA 1BQNB 5KG5A 4I67A 1NK0A 1KWMA 3US5A 4N7TA 1K1SA 1SL2A 1NBEB 2B3TB 3IS9B 5SZTA 2R8HA 1S72S 2FJEB 4IO1A 3W65A 1HQUA 3A4TA 1E6VB 2UVRA 2RRBA 4Y3CA 2RHSB 3EXCX 2ZUGA 2OPPB 3SQGB 3D6HB 3UPFA 2PI5A 4JOUA 2GA7A 2NZCA 3MM5B 2E7WA 1NJXA 1FF2A 4IR9A 4DL6A 3TJAA 2CPZA 1FWPA 1TL1B 3KK1A 2GAGC 1PGZA 3SDEA 4DCJB 2FJXA 3B4DA 2HHTA 4ZVQB 4C0HA 1EKRA 1Q8LA 2F1FA 5KT6A 1U0HA 2AJFE 5E5NA 3C6UA 4LF8F 5CQGA 4ERDA 2MTLA 3BQ1A 5KG4A 1ULRA 1YK9A 5LXRA 1U02A 2QO3A 4H4OB 3RBDA 4JUZA 3R7BB 3VAHA 3OXFA 4AFFA 2HWIA 2DRDA 1GNKA 3CCRS 3M30A 2BJ9A 4DSLA 4J9VA 1BHNA 2XLIA 3MTKA 1TL3A 2ZJQQ 1VYAA 4P2SA 1EETA 5IT0A 1OY8A 4PCQA 1SQGA 4R8UA 1JB0C 2GFFA 2F8HA 2RDDA 1WKJA 2LFVA 3BN4A 3FC9A 4N56A 1F3FA 4FYVB 2Q43A 3GPAA 1NH7A 2FLOA 1FKPB 1HPZB 6FDRA 2OPRB 4LF6J 4B3SF 5B0FA 4DN0A 4PG8A 1NDPA 1NXIA 3QGIA 5A8KB 2J7UA 2ROEA 3HHDA 4U8YA 2R2TA 1NAQA 5BYQA 3MPDA 2JDJA 4I1TA 4LF1A 2H9ZA 5KFZA 4NI2B 1VRTB 2C28A 3M8QA 5ETOA 4JYAF 2IMWP 3W7BA 3PACA 4G1PA 1K73T 4QR2A 2JVOA 3WC0A 4YQWA 4JI4F 3NEKA 2ROPA 3OT9A 3OFHA 1MLAA 1VRUB 2D3OR 1N5SA 4QYZK 1RJJA 1UVMA 1GXUA 2GMJA 3TO8A 4NLRA 1NDKA 4USMA 3VZHA 4OHYA 1NSKL 4ZKAA 3DOLB 5A76A 2WB1D 3D6MB 2HRTA 4ICLA 3IFEA 4I0WA 3S1TA 1RT4B 3EGNA 2A1BA 2W25A 5FDLA 1FWLA 1RWKB 2CQ0A 2EI5A 4PKDB 3W63A 2CA9A 2UXBF 2DHXA 1M1KT 3IWLA 2BX6A 5KG3A 1EX8A 1QVFR 4DEZA 4LVNP 1HR0F 2FJDB 1C1CA 3PRVA 4B02A 3CDBA 1N52B 2FGCA 2ZC3A 3A3PB 5GADU 1SC1B 1FDAA 2R2UA 4DL7A 2JSXA 4JP8A 1WC0A 1EKSA 2B4VA 3OR1B 4OX8A 2GO8A 2WONB 3PYDA 4IO9Q 2FYXA 3FJ2A 2L9DA 3SMZA 5HQ8A 4RU9A 4DG1B 2HFOA 4WTOB 1NB2A 3FBFA 4PEOA 4H4MA 1UVLA 4O3QA 3O8WA 1LFWA 4C0BA 2DY9A 1UEUA 5C25A 1RLCL 3V6DA 3CJSA 3TJ8A 4CLPA 4LREA 3G4SS 2B43A 3Q8VA 4HACB 5E3AA 1QAIA 5L1KA 1CJUA 3HHLA 3FRYA 3DMJA 4QIVA 1N5QA 1WC6A 2RQCA 1S0VA 4J9SA 2E44A 1CLFA 2X1GA 4LFAF 5IWAF 2FHMA 2RSQA 2YNIA 4LR7A 2MQQA 1YJNS 1BQMA 4D3GA 4WPAA 3DLHA 2AD9A 4L75A 2BOPA 4ELTA 4V19J 1HQUB 3PHTA 2A0FB 3MPUB 1WHXA 1O0PA 5B0DA 1CJTB 4U6PA 2VQEJ 2GJIA 4PXBA 4ECQA 4K7QA 4GVBB 3CMES 1SH3A 3O3LA 3I4HX 4AXIA 4F0HA 1A7GE 2ZWPA 2DNQA 1N48A 4I2PA 2ZC4A 3HVRA 2VICA 1RHJB 2O67A 3UN5A 1NKEA 2YKMA 2QSFA 5I3UA 3V4IA 3C6UB 4KBIA 2VPXB 4FNHA 1YRXA 2DR6A 4S0MA 4OX9F 4ZP7A 4WYWA 4ECRA 5FD1A 4W92B 2E1MC 3QRQA 2C1EB 1U1NA 2MPUA 2J8AA 2M7SA 3N5BA 1S6PB 2IBKA 2UXCF 3VZIA 3BYRA 4JV5J 4OI4A 2LXFA 3C15A 2D69A 2H48B 3M30B 2ZNYA 3WX4A 2NXJA 1T3NA 5CYQA 3CJ4A 2G13A 5HATA 4K59A 4RNHA 1RK8A 4X64F 3BBCA 3ZZRA 3KK3B 4DU8A 3VV2B 1WEZA 1N33F 2ACYA 4YEAA 4BC9A 4G1QA 5H1SV 4ZIVA 4R8UB 2OP5A 2V68A 4YN3B 5F9NA 2UUAJ 1I5OB 3JQJA 1U7LA 4DUYJ 2AW0A 4DR5J 2BYCA 3EYZA 2QT7A 3L7UA 4DQQA 4OQJA 3D68A 1S4EA 3QGPA 4NLSA 2H51B 1IBKJ 4A48A 2WTFA 3OXGA 5ETNA 5GAGI 4O23A 5AE2A 1UAWA 4PXCA 1WF2A 2O3DA 3D6TB 3MEEA 3AD7C 4J9LA 3AODA 2BE2A 3M8QB 1VDHA 2MKIA 2Y1LB 2XMAA 1XWLA 4P9SA 3F0NA 1RT3A 3DLGA 5D77A 4ZHRA 2B8QA 3V6HA 3WIVA 4NLPA 1RT7B 3QT8A 4B9MA 1FI4A 1UKUA 2BEFA 3K5OA 1RWPB 2HHHF 4EU0A 1S9GA 1T95A 3FVYA 5HAOA 1ZH5A 5ETTA 2G4BA 3AA9A 5EHHA 1N32F 5J1EA 3C14A 1PC4A 3MEKA 4MFBB 4HI2A 3IRXB 2N3LA 2HVZA 1C1CB 2AF6A 2KB2A 2HBYB 2BMBA 1X31C 2HNDB 4NCGA 2OKQA 2DJWA 2HVEA 4WFNQ 3LPEA 3PDNA 1S97A 3MPVA 4F04B 3MAQA 1ZS6A 2LVWA 1KLMA 1DBDA 2ZOGA 1I51B 2RDJA 2CDRB 2JZ5A 4LF8J 4USIA 5E7OB 4H4MB 3BSCA 4TY8B 1N54B 2JVRA 5C25B 4TLRA 4F4KA 1F5AA 4ECYA 3ETOA 3SBMA 1IKWA 2J6TA 2XQCA 3JSMA 3MR7A 4ZVPB 4Q7AA 5FLXU 1JLEB 1TL4A 1CJUB 1ZA2B 3EZ5A 3QQCD 2ZD1A 1UPPA 2W8KA 2DB1A 4JI0F 3MMAA 1O5JA 3KLIA 1YHQS 3OFEA 1GMVA 3RZAA 1FTCA 2AJ2A 5D4OA 2Y8WA 3AJ1A 1IKYA 3G8SA 1RKIA 2CKWA 5DETA 1Q95G 1VBYA 2QA1A 3IR7B 3MCOA 4EYHB 3S6EA 3AQPA 4OZLA 4RBTA 5IT4A 2L9WA 1T8EA 1TV6B 3TX8A 2JEIA 4NLUA 1CJVA 4OZ0A 1SC4B 1DAXA 3LAMA 3AH6A 3CJQA 4ANCA 5KG2A 5L1IA 1KOOA 3JTPA 4DHVA 4P7TA 2RT3A 4I2PB 4ZMMA 1WKLA 3KHLA 2EFNA 1Y5IB 3D0GE 4M5NA 1JJ2R 5CA5A 5I3UB 5EGYA 1RBAA 2MLXA 4RW6A 4ZPAA 2Y8YA 1MWQA 3VQTA 5KOWA 4JYAJ 1VQLS 3HMJG 3MAAA 4JI4J 1XNQF 4F67A 3KFWX 2YBVA 1WHWA 1YITS 3IRWP 3BSAA 3OV7A 4RZRA 3H25A 3HT0A 1OPIA 1RU2A 2QX0A 5HO4A 4LF4F 3M7VA 1RI7A 2CJ9A 3SSRA 4G1QB 3UN3A 3Q83A 4Y2KA 1IR1A 4QW9A 1VQYA 3V6JA 1FK9A 3FFIB 5IM0A 3KUHA 4C8ZA 1HR0J 2ZE2B 2LMIA 1RHMB 4A4JA 5HL7Q 4M5LA 3KG4A 5DDRC 3LUYA 3ZZOA 3MEGA 2V2QA 3QATA 1QUVA 4K4SA 5F8GA 4RO0A 1YJ7A 4AE5A 3RRGA 5G0RB 3ZTQA 3W64A 4LT6A 4F4YA 3MFIA 3MEEB 4UQGA 1UJ4A 1RKJA 3K58A 1WTFA 4F25A 3QSYB 3C46A 1BWVA 2NXCA 5K8MA 4C97A 3UCZP 4DU7A 5E33A 2J0QD 3BREA 1XR5A 2H5IB 1VIXA 4FZVA 2PO4A 4M5KA 1AA1B 1H73A 1F3VA 2CJBA 2ZBIA 2OEJA 3OR2B 1HBOB 1U6ZA 2RHQB 1BUXA 3NMAA 2DNHA 4OX7A 2W7AA 3JAMU 4DFJA 3HFVA 2F8EX 4LFAJ 5IWAJ 4C3KA 1S9GB 1U4BA 3OUYA 3BYPA 5U47A 2GQCA 3NAHA 3HVTA 4UF4A 2AKWB 3N01A 1U2CA 5IV3A 4ES2A 2IBOA 1TELA 4NMXA 4RUBA 4X4PA 3ITHA 1HNVA 1WDTA 3HVAA 5CAAA 3GV7B 3CE8A 1HW8A 4H4KA 2R7WA 1XR7A 4LQ9A 2VASA 3G6XA 1NO8A 2WAQD 1VCTA 2RUGA 4BLGA 2ASJA 4DLGA 4DR2F 2QG9B 1C2PA 2BM0A 2AV5A 1MU2A 2QGFB 5K8OA 4CYUB 2NUUG 4OX9J 2CQPA 4O3SA 4JI8F 2NXEA 2MLZA 1L5UA 2GHPA 4IFVA 1IKWB 2UXCJ 1C0UA 1HW9A 2GVZB 4N41A 4F3MA 4NL5A 2BQRA 1B0VA 4HT7A 1RDRA 2P9EA 2OMLA 1J5OA 4KPCA 4X64J 4CH0S 2RAQA 3IBFB 4WU3A 4ECXA 3KLIB 2M2BA 1N33J 1S77D 4CH1A 1QAJA 1Y7PA 2BDPA 4XAKA 4URQU 3CCTA 1PYSB 1KQFB 2ZBRA 3PKMA 3GJTB 5F8IA 3GSDA 2Y3YA 4P75A 1M1GA 3THPA 1RXOB 4EBDA 3DHXA 3EX7B 5HVGA 1T9VA 4IDKA 3PZPA 3NGUA 3FRZA 4B9NA 5HJYA 2HSEB 2XY5A 4NOHA 4HDHA 3T1HJ 3LANA 4IQXA 4QPXA 2UU9F 1ZM4A 1KNZA 4KHRA 4LRDA 2W9CB 4RW6B 2WW4A 2QYCA 3KLFA 2WSCC 3V5RA 3VAJA 4P6QA 4ZVSB 3Q86A 1N56A 1R89A 1T9YA 3JS9A 3M6UA 3CCVS 3J7YI 1UCNA 2ATLA 1KEKA 5LMNF 2PEBA 3DLBA 1R8AA 2HHXA 2V9KA 2L41A 1VI7A 2F9JA 1DZ5A 1PSDA 2OEKA 2MQNA 2VA3A 4QIFA 2CJAA 2NXUA 2MXYA 1YJVA 3UCUP 1N32J 2PFDA 5LJ5Y 3H5YA 3G6ES 2GVDA 3SV3A 4KGMA 3PRDA 1VC5A 4TN2A 2A6MA 2W1BA 2DEIA 3BDEA 1F5BA 3NCQA 3BQ0A 2Z58B 5D0HA 1IQTA 3LGMA 2YKOA 3NLCA 3MEGB 2BBEA 3IAM9 4LRFA 2KT3A 1FXDA 1GEHA 3ILOA 4M5DA 2L9NA 3PM9A 1TR0A 3IXQA 2Z0GA 3IMQJ 3CCMS 2R8JA 5L39A 3PYGA 4OYIA 1RHUB 2APOA 2WRMA 3F41A 1GAOA 4Z37A 3BO2A 2JFDA 2XNRA 4U9RA 4F0MA 3HHLD 4LJMA 2FB0A 1JLQA 5CHCB 1FVQA 2XULA 1PILA 4RNFA 4Y0FA 2JNJA 3MM9A 1TFYA 2B8PA 2ATCB 3BSOA 4DDFA 2CFXA 4NCAA 4FXDA 1OS5A 4YUDA 3OUYB 2HVIA 2VG5B 2P9GA 2RKIA 1HLWA 3NS7B 1KHVA 2V0NA 4EYIB 5K5MA 1HHSA 4R0EA 2ZZMA 7AT1B 4K5SA 3NBPA 1W2BR 5DDQC 2HMIB 1YG0A 1PJ6A 1IWGA 3SSQA 1TKZA 1OMSA 3BV8A 5D6GA 5ETKA 3CDEA 2N4DA 3J81U 2DR9A 2R7VA 2YVSA 2VHGA 1U1QA 2ZNZA 2XTJP 4DR7F 2ERRA 1C1BB 1SBRA 1U25A 4L3KA 2J6SA 1KQGB 3R1LA 4TYBA 2HS0A 2UVVA 4JI7F 4M8LA 1HA1A 4X4UA 4IYQA 3R7NB 1NB7A 2HAFA 1XNQJ 4AL5A 1VR6A 4CLLA 4DSEA 1UWAA 3ELHA 4IFVB 2AJ4A 2G0CA 8ATCB 1DURA 1C0UB 2MDAA 2R7XA 1S79A 2FLPA 1FJ7A 2UXDF 3HF5A 3EDRB 1I6JA 2FLLA 4OX6A 2A2CA 2DYAA 4EWTA 2BE7D 4LF4J 3H5SA 1J5OB 4IUFA 1X9MA 4FF2A 1H74A 4ALZA 1PC5A 4OJ1A 4WE1A 3KLEB 1OIAA 5CD4H 4OYOA 1FDBA 2G2ZA 2BV3A 2KRRA 1SQEA 5KFNA 3M8ZA 4DR6F 5EWEA 4ITSA 2V9WA 5DJBA 4DSJA 1VQPS 2FC8A 5C7PA 4LMZA 1UPMB 3L4BC 3VGSA 4F4XA 2MZTA 4PPZA 4MK8A 1WKKA 3CCJS 3SCLE 4JBCA 3E01A 2ZH9A 3BGOP 2EFQA 1X4FA 5BR8F 1RAAB 5KFWA 3G82B 4ED2A 2HG4A 1FRLA 5ETLA 3QGGA 1IR2A 4TY9A 4ZVRB 4MYTA 2CZ4A 5GAHI 2HIYA 1HHTP 2VFRA 2DIUA 2MYFA 4DPYA 2HHVA 3V4MA 5KFQA 1SKRA 2KI2A 2AMCB 2IDEA 3RBZA 2UZAA 4IG3A 2R7SA 5HQMA 2E5LF 1RSCA 1E6YB 4WF9Q 4USWA 1VQ9S 1FT8A 4YR3A 1SIZA 4B9LA 2B9YA 4DBQA 1S1WA 2IRYA 1YJ9S 3TANA 4QCLA 2R8IA 2ZVIA 1NKBA 1AROP 4B3TF 4CLSA 1Q8BA 4KKOB 2BJ7A 1QTMA 3D1OA 1T03A 1A0OB 5EDWA 3QJJA 1D0EA 3JTNA 2BABA 4WFXA 3K59A 2XHCA 4FNIA 4LR9A 1F2GA 1M5SA 1HIYA 4YB5A 1NPKA 5L9NA 3EVWA 1F5CA 5C24A 1U48A 4DR2J 1CEZA 4ETZA 1FNXH 3PVXA 2F63A 4C8KA 2FLNA 3M8WA 4YY3F 3CJTA 2KG0A 4P10A 4PWWA 1JKHA 4JI8J 4B3RJ 2MEWA 2EC0A 1HKAA 2WVCA 2BR0A 4Y2CA 3KDNA 3Q8QB 2VBYA 3FZ2A 3MM9B 3VTIA 4WJBA 1S1UA 4PG6A 4IRDA 3FSIA 3NNHA 1XQIA 2MKHA 4C98A 1PCAA 3PO5A 3PW7A 2J7KA 1S1VB 3QWUA 2RKIB 4AQYF 1U09A 1FDDA 1TK0A 2HAIA 3CJ0A 2GMLA 3RGIA 2AGQA 1B99A 4O44B 3AY0A 4KSEB 1NK4A 4FF4A 3A3NB 3NBPB 3DLKA 4TQSA 2RQ4A 1FNMA 4FYXB 3JQMA 2IIHA 5KFHA 3TNVA 1D8YA 2DNLA 3RAQA 5J1PA 5EX3A 4HH0A 2NREA 2FZCB 4A8KA 3G6YA 4ZVHA 4C7QA 1TMMA 4RUAA 1RT6A 3EDQB 4USJC 2UU9J 1MNEA 3Q0AA 3OXLA 2LU2A 3W5XA 4KE5A 1SL1A 1JX4A 3PEHA 5T7LB 2YQ0A 5AJ3F 3GWCA 1Y5LB 4P2MA 1LKZA 2JJ4D 1PKUA 4URGA 1S1XA 1JJCB 4LRBA 2GX8A 1O8BA 2HHSA 4CLKA 2VFVA 5LMNJ 2K3IA 3PR4A 2VONA 2ZEJA 2KXNB 4IFYA 3HZEA 3QFHA 3POTA 3FGVA 1LWXA 2R4FA 5LL6d 2NUHA 1EP4B 2GC8A 1VBKA 3M1VA 2KJWA 4OJGA 4ED8A 2E29A 4F4ZA 3KG1A 3QAUA 1YTYA 1UVIA 4K4TA 4W90B 3CULA 1PJ5A 2VQFF 5B09A 3KLHA 1RTDA 2DNNA 5A2QY 4DSFA 2X7IA 4DX7A 1RHRB 2EW9A 1KFDA 1N6QA 1S1TB 4TYAA 2LDYA 3N4WA 4ED4A 1B7YB 2WOMA 3PX0A 2ADCA 2K1RA 4W98A 2QL9B 1LWCA 4N8NA 2D3O1 3PEJA 2KO1A 4HHHA 2RS2A 3CW2C 3PKYA 3K5LA 2UV8A 1HBNA 3DOMB 4M5MA 3IM9A 4G1IA 4HKQA 3KJNB 1JLAA 1S0NA 2C2ZB 4K4WA 1FE4A 1WG5A 4M5JA 5KFEA 1FKAF 1R8PA 3I5AA 4OZJA 1S76D 1G7CB 2V8PA 3DRSB 2NLWA 2MKSA 3RR7A 4BC7A 2FY8A 4IG3B 1WG4A 2HZCA 1EAYC 5C42A 2GW8A 3AAWB 3EE3A 5IQ6A 1YSJA 4FPIA 5HMYA 1AB8A 2WSFC 3LP1A 2LEPA 3RRKA 3CIZA 4XTTA 3OJUA 2HHWA 2J5AA 2OPSA 3NG8A 1VISA 2M5YA 5HVHA 1JXLA 2KT5A 2YH0A 3G71S 4K4ZA 4JI5F 4R5PA 1DTQA 2XMTA 2YPYA 3H2UB 2B0GA 2XS5A 2E9RX 1WC3A 2LKZA 1S5ZA 3MOJB 1TQLA 4IH5A 1OO0B 3GFXA 2UP1A 2LEBA 3VVUA 4GC6A 4MYUA 4I4BA 3HDSA 1SPBP 3G8TA 1PO6A 1RACB 4OZ3A 1FESA 2LQ5A 5HLFB 5KFAA 2V8VA 3DGPA 3FMBA 4X62F 4JI7J 5EWFA 3GTYX 5EWGA 5ITHA 4NYZA 3RB4A 3T9NA 2ADBA 4OHWA 4LRAA 3UR3C 2HRUA 2XB2D 2P6TA 2ZBQA 1M0SA 3HHKA 3W62A 1KFSA 2MGZB 3T1YF 3OFFA 5GAEU 3NMRA 3IM8A 2UXDJ 1YBUA 4LBHA 1LQ9A 5FLXY 3BQ2A 1WF0A 5A0YA 4ES3A 2V8DA 1GXLA 5DO2A 3CD7A 2MSTA 4EBEA 4FBUA 1EQMA 2XMUA 1ZPWX 4LR8A 1D9FA 4HHUA 4A8MP 1ACMB 2IHR1 3C2PA 2PMHA 4CTAA 2I1RA 1PBUA 5JJBA 3R7SB 4RNNA 4ZVFA 3HHEA 3R5BA 4E98A 2YY3A 3ISNC 3HJFA 2DR5A 4Y2AA 3NCPA 4CO2A 5HN0A 1C4AA 2FD2A 2WVBA 4DR6J 3DLKB 3DRRA 1YZ7A 1KLNA 1Y3KA 5D3GA 3BF4A 2W2QP 1DJ0A 1TVRA 3CJ2A 3OQ2A 3CJKB 2QA4S 2ZWOA 2RJZA 1XNRF 4QWDA 4DR4F 1KBRA 5B0EA 1S7IA 4DPOA 2V4JB 1P9QC 5BR8J 2J0SD 4ZA1A 4J9OA 3QIDA 2P8IA 1NK9A 4QWBA 4DI6A 1U1KA 4P2XA 3JSBA 2LA4A 2HNZB 1S1XB 1S6QA 3PXGa 2C2OB 4M5IA 5F0UA 1N5VA 3MDFA 1IKVA 2MMYA 2E5LJ 3I9ZA 2YWFA 2C22A 4OV6A 5F41A 2ZH1A 4KYZA 2JLEA 2HK2A 2CPFA 3TZZA 2CQ1A 5DM6Q 4DV2F 2DCLA 3KWMA 2I2YA 1VHFA 5KT4A 3JTOA 3TUZC 3EPIA 4O3NA 4B3TJ 1RAJA 1REVB 3M1VB 2HLUA 1WWHA 5CZVA 1BC6A 3C16A 3L09A 3SYZA 1AFIA 1RAFB 3K8WA 5MLCV 1KVIA 2QLBB 2CWKA 2VKZG 2IYGA 4ECZA 1NCLA 4PPDA 2H5JB 4C11A 4FF1A 1XEZA 5E3PA 1SKWA 1FD2A 3DKDA 3EGWB 2OPQA 3MM7B 4B9TA 3W9JA 3LP0A 2RVJA 2K1RB 1R6VA 2HK3A 2JHEA 4EZ9A 5IC4B 1UP1A 1WG1A 1LWCB 3CPWR 3EGVA 3MECB 2FVSA 4UY8T 2J0WA 1HBNB 2ZBCA 3MUVP 2YWHA 1JLAB 1VOMA 4MTPA 3VGTA 2AIRB 2XZDB 4Y2MA 1O6XA 2G1DA 1Q78A 2V8GA 4KGXB 2YWGA 1JK9B 1DLOB 2B6AB 2DR8A 1RHKB 2AGPA 5C42B 2KXFA 4OYXA 1DQAA 2GHWA 1SI9A 1FERA 4NXNF 2HBRB 2MKJA 4Q44A 5KAKA 2AJQA 3LP1B 3TA2A 4J91A 2RRAA 1VFJA 3B4MA 5IS2A 3JAMY 1HNIA 4UUXA 4AQYJ 2RDIA 3Q8SB 1HL6A 3TVZA 2YWKA 4LRCA 2DGSA 1M1HA 3MURP 1DTQB 2MJUA 1PYOB 4WP3A 1SJFA 1IBLF 3SCJE 4FP9A 1VQ5S 2KT2A 4RNOA 1RWMB 4F3QA 2G0IA 4ZPWR 2ASDA 3DRPA 3OVAA 1GFWB 4NLVA 3QO9B 5CH7B 1L3SA 4CWBA 4YOEA 2HURA 3GCXP 4LSZB 5AJ3J 4UZBA 3CDWA 3DGPB 1CQMA 2GIFA 2YQ3A 4DXLA 4P7VA 3KMQA 3JSYA 1QUPA 1IJEB 4YB6A 3HZGA 3HK2A 4RW4A 3ISZA 4U7UK 3R5DA 2W4CA 3HCXA 4DL5A 2VFTA 2HVHA 2Z56B 2IA6A 5KFJA 2VJUA 4CNYA 3NL0A 4JI1F 2QTWA 1REGX 1APSA 3Q2TC 3IWXA 4NWBA 1WTBA 2GV1A 3R3TA 5KFBA 1H38A 3FMWA 5J2QA 3KJVA 2YKNA 4IOBA 1KONA 3NRBA 5GMKa 2XCAA 1B0PA 1UW4A 3OW2R 1TKXB 2JEGA 2L3MA 4J9NA 3ZTSA 2HWTA 3FBEA 3GFYA 3UDCA 1LWFB 3NS5A 3H8YA 1Q82T 3MZIA 3NY0A 2CQIA 4OZ1A 2X1BA 2VOPA 2DH7A 1TVRB 3I4PA 3N6NA 2CQGA 4OZNA 2R7OA 3ZXWA 1FFWB 4PYDA 4YFUA 2YX1A 4PG5A 3HP6A 2R2RA 1JMTA 1NM2A 4U7UD 3WBZA 2F3JA 1NSQA 3KOAA 3IAS9 4TKTA 1J5EF 4FYYB 2EG2A 1S6QB 1UJ5A 1PBAA 2FJWA 3QGHA 4R25A 4DF8A 4TVAB 3TRGA 2EFGA 4J9PA 3MMBA 4ZVGA 3N6MA 5A6PA 4I56A 3W2WB 1MMNA 5AXLA 3KLGA 1UETA 2HHPA 3OPKA 2NYIA 4PQUA 4QBUA 3E2EA 1ZBTA 3CXCR 1WSVA 4BCAA 3RU0A 3FKBA 4K4UA 1SVDA 1WC1A 1U49A 3H4BA 4B3OA 2KFZA 4JI5J 2JWNA 1BD6A 5AXKA 2Y0BB 4WXOA 2DNRA 2MHNA 4IRCA 2AQ4A 1HMVB 1H7WA 3D7SB 3AJDA 4CLUA 4LFCF 3CGIA 4I68A 1T05A 3JSRA 4X84A 4ZOSA 2OPQB 2ALZA 4DN9A 1L3KA 2ZH3A 1HQEB 3ULHA 2VD3A 1UZHA 1HNWF 4NLQA 1S59A 3UDEA 4XDDA 3ZNJ1 1W25A 3M9MB 1UFWA 1HWKA 3ZZUA 2XWYA 4F8RA 1YBTA 3QSIA 3RRHA 1DQ8A 1VGYA 2MQOA 1FJGF 1X8DA 2JX2A 3GV8B 2GMHA 2CIMA 3SI8A 3BGUA 3T1YJ 4IKAA 1FFSB 2D9PA 2VG7A 4KFBA 3OFGA 2VBZA 1RE1B 1KQKA 3TUJC 2W01A 3GONA 2XZWA 1B7FA 4FDFA 3AA8A 4TNOA 3DLEA 1RCOB 1LW0A 1LNQA 1T94A 4KT0C 4OYWA 4HL9A 4GKJF 3CD6S 2MJNA 3GIJA 2XSJB 3MGJA 5KG7A 1AZSA 1HNIB 2IJFA 1N4LA 1JJHA 3MTJA 5J2NA 1VIOA 1WC5A 1VQNS 3EJMA 2C3YA 4PQAA 3GJQB 1ZM9A 3GJSB 3MR2A 4C3MA 1SC3B 3T5JA 4A46A 3OD2A 3ET6B 1RP5A 2YNHA 1CJKA 3DXSX 3JYTA 1KVJA 5GMEA 3DRPB 3NKYA 4PWDA 1JLGA 4NZ0A 2ZHOA 1RGVA 2I0XA 3J81Y 2I5JA 1UA0A 1YJRA 5KFVA 1Q53A 1I94F 3PYEA 4CLTA 2KHDA 2ALYB 1TAQA 3HSGA 4XDCA 3UD5A 2B5JB 2MZ1A 2B9WA 5A8RA 4RW4B 3O44A 1U6FA 1G3OA 1T11A 3RJMB 1U1LA 1HFEL 3G86A 2N7CA 3U1NA 4ED1A 5K14A 1JLBB 9RUBA 2U1AA 2XBPA 5B0AA 1FNOA 2YKNB 3TEHB 4DV2J 1U8SA 1AXQA 4B17A 2JEJA 4Q8EA 2Q1LA 4WKYA 3BGRA 1N5YA 1XBWA 2HIQA 2BE9B 4CLFA 3O5TB 1ZETA 1VLYA 4O4GB 3CC7S 1WORA 2AYMA 4QIWD 4MK7A 3ENWA 1RUSA 3UDLA 1MMDA 1HWUA 1B4SA 2P9CA 4QOTA 4JI3F 2PD1A 2A6OA 3G9CA 4L73A 2HHQA 2ZITA 3I31A 3QLHB 3BM7A 4B08A 1J27A 1SC6A 2GGPB 3BPDA 1TK8A 2HZAA 5KFRA 3LF0A 2IYIA 3Q8UA 5T14A 5H9EJ 4NRTA 4ZP9A 4DL4A 3A13A 2KDOA 1OQ6A 1RTJA 3UQSA 3A1YG 3NCRA 5LMUJ 1AFJA 1ZTWA 3IC1A 1P27B 1M5PC 4IG0A 2EKYA 2GO9A 3MMBB 1TKDA 3IP0A 1WEYA 2DHHA 2OTJS 4E2FB 3ZZYA 3IN5A 4HDGA 2XWXA 2R7UA 1OY9A 1TKTB 2GHVC 4XPEA 3Q2SC 1FTRA 3VHQA 2JRSA 2OTLS 3IG1A 2DXDA 2NPIA 2NQPA 4A8QA 1VJQA 5DG7A 3GFHA 1JIHA 2BJ1A 2IFXA 2BJ8A 1IBLJ 1RZMA 3K57A 3BH6B 3N28A 1KHWA 4OYBA 1SV5A 1T05B 4IOCQ 1ZAWA 4NMLA 1YI2S 3ZZZA 2LXUA 3M2VA 2LLZA 4J37A 2ZHBA 2DH9A 3UVJA 2HQFA 4OYZA 5CABA 4RW7A 4NYOA 3MCMA 3M2RB 4Q2LA 2DGXA 3CB4A 4USVA 3I0SB 3D54A 4OI0A 1WI8A 2BACA 5KFPA 3B54A 1FKOB 4QU7A 4A8XA 1R7IA 4JI1J 2IM1A 4IOAQ 3K5PA 1IBCB 1WOPA 3CO0P 3DLEB 3QZ7A 1XERA 3EICA 1NMEB 5J2MB 1CULA 4HH1A 1AZSB 2GCFA 5HJXA 4N8OA 2FHJA 5J2NB 3HULA 2ROGA 4FS1A 3M9NB 2AU0A 3ETMA 1GMWA 1YJUA 1VQ7S 3D3BJ 1X5TA 5EX0A 1B64A 3DCAA 4Y6IA 3MM6A 1CS4A 2PC6A 4I2QA 3UDVA 3JYTB 4L74A 3O1LA 3UE2A 2PIIA 1U1PA 4GC7A 1SJQA 4PWDB 3HO1A 1JLGB 3T5LA 1U2FA 4C2MA 2MKYA 4KO0B 1V5IB 4OHVA 2L48A 1M90T 3TAMB 1J5EJ 2W9BA 3P49B 3MD3A 3PV8A 3PIPQ 3TA0A 2YNFA 4ED6A 3MM8A 5K20B 3HM9A 3V81B 1C0TB 3G96A 3T3FA 4F26A 2QL7B 3CC2S 3ZO7A 5HROA 2PN6A 1J2VA 1UWBA 4USTA 2KRBA 3L3CA 5DGAA 4RKUC 3H2VE 2V5HG 3K17A 3TJ9A 3QYYA 2IY5B 2MZRA 5HI7A 3MI7X 1KKHA 2V8HA 5LM7E 3B78A 2E9ZA 4RW9A 3R97A 3LOUA 3SCKE 2IVMA 1UVKA 3CCZA 4HTIA 2CQ3A 2BQUA 2NZ4A 4LFCJ 2BVZA 4B9SA 3GFZA 2VA2A 2O1PA 3WQPA 3J80U 2MLYA 1R0BG 4RBUA 4KHMA 4MKVA 2GZOA 1XMQF 4PYAA 3R2CJ 1X0FA 4E8UA 3CNQP 4EUVA 5HBMA 1T0TV 4WXWA 2NSBA 4XK8C 3DHWC 3TQ1A 1HNWJ 3Q23A 3HKWA 1M5VC 3J7A1 2Y1IA 2XMJA 3R5AA 4GMKA 3W61A 3AD9C 1RLDA 2J8SA 1WACA 3VR1A 1GTHA 2M3DA 4LF7F 1RTJB 3SCIE 3LTOA 1MW7A 2V4QA 1FJGJ 2HKEA 1P9YA 5JVGQ 1EHWA 4Q2MA 1NU4A 4NRUA 3PRBA 2MQPA 3QRRA 3LP2A 2NYHA 4KPYA 4CDIA 4RW8A 1LFPA 4J90A 3KK1B 3F44A 3SDEB 2XI2A 5F8HA 4XPCA 2JLGA 1HNXJ 1MN7A 3O2IA 4DSKA 3WX8A 5HMWA 4OI6A 1F9EB 4FYWB 3NS6A 2HGMA 1U0HB 1WF1A 2QL5B 1V3RA 3SIPB 4ED3A 1D1UA 2CQDA 4FS2A 3WZ0A 2ZM6F 4KV8A 2JEFA 4KY3A 1NUEA 4H54A 2DHAA 4ZJOA 1TTHB 1K0TA 3KLVA 3LALA 3OSPA 1AUDA 5KFMA 1HD0A 2AEJA 2E1AA 3OTCA 2PMZD 3UVJB 1SB6A 1NSPA 4DS5A 4DCOB 2F8MA 4JV0A 1TL3B 2WBMA 3ENQA 1EETB 2R9LA 1NZAA 3DXBA 2FHOB 2FHKA 2C42A 1I94J 2K06A 4OI3A 3UD3P 2DT9A 3PW2A 2E1PA 2HQIA 4DPTA 2IC3A 2PI4A 4A8YA 2R7TA 5A2QU 1KC8T 1OY6A 2AX1A 3MHYA 4C4WA 4LF2A 3W1YC 3PW0A 3G2XA 1CULB 4OZ5A 4NLOA 2I6WA 2A10A 1FJEB 3FQLA 2Q66A 2JH3A 4OYMA 2FC9A 4OI2A 5DQHA 3R1HA 2ZFHA 1N36F 1ZZNA 4USHA 4C0OC 4ETXA 1S0MA 5D4NA 3PHEA 2LECA 4B3MF 3BR9A 3HPOA 3RAMA 1U0SA 4DV3F 1F2HA 3MM6B 4DV5F 3KYLA 4JI3J 4N77A 1PIEA 3OLBA 3RW7A 1URRA 5KFYA 1JWWA 3VWSA 1FHTA 4J7CA 1YJWS 4ICLB 2DO4A 3S01A 4TXSA 3TZYA 2IAJA 1ZPVA 3DC2A 1N88A 1F9FA 1RAGB 2EFPA 5FDLB 3RTVA 3LW5C 4TQRA 3SXLA 3F56A 3CCUS 3DM2A 1LOUA 1G4CA 3DDIA 2HYIB 2KFYA 3MM8B 1IM4A 2CPIA 2K2PA 3CJ5A 1Q0NA 3KK2A 4OJHA 2PA8D 3T41A 2RF2A 5CD4A 4ZDNA 2WB4A 2Q3PA 3UI3A 1V5VA 4QYRA 3VGVA 5DG8A 3GYXB 3I0RA 1T9UA 1WUUA 4RW9B 1WOOA 2ZBPA 4K8RA 1OYDA 3KG0A 4CNZA 2PGCA 1RTIA 1JJ4A 4LF6F 2RRNA 2XYGB 3GSIA 2V94A 4R0JA 1CBKA 3V6DB 4ILLA 3RB0A 3VCDA 5HP1A 1D3WA 2V2ZA 1RA6A 3X1LB 3ZTRA 4YR2A 4F0KA 2FZGB 5L1LA 4DZDA 3R8YA 3HHLB 1XC9A 5ETMA 3DMJB 4IQMA 2V6AA 2GIRA 1DARA 2UV8G 7FDRA 4ID5A 2DD8S 2YNIB 4ZITA 3EGZA 1BQMB 1BQNA 2A2DA 3THVA 2DRBA 5F3ZA 3QMQA 2X51A 2WBRA 4ELVA 2EFVA 5KFUA 2Y1RI 3CSKA 2J6UA 1VHIA 5RUBA 1FRJA 4EO8A 1N5TA 4RW8B 4ZCMA 1A9NB 2AYGA 2QLWA 4B3SJ 3QT6A 2IVFB 1BWEA 3NGKA 2AEMA 5FIIA 3W66A 4RR5A 2DY1A 2EK6A 5BYRA 2V34A 1KP6A 5G4DA 1E6VA 4ED5A 4DL2A 4UQTA 2YKMB 2DPJA 2QMWA 5DS7A 3V4IB 2OPPA 3SQGA 2PDAA 4K50A 3NNAA 3ADAC 4EGLA 1RTHA 3MM5A 5SUHA 1RWXB 2E5GA 3OTOF 2Y9HA 2W2PP 4KV8B 2KYZA 1PYTA 3A8JA 4NCBA 1KSPA 2BJEA 4M95A 5GADI 2YNGA 4C8YA 1FRXA 4QWCA 4YDXA 4JI2F 2QLXA 3C15B 1NJIT 5D4LA 1R31A 5CYQB 2UUWA 3RG6A 2OLWA 2UUCF 4H4OA 2CYYA 2UVWA 4KGKA 4J9QA 2ZH8A 2UXBJ 3DRXA 4OZ2A 1GTEA 1Z2LA 1U45A 2C3MA 4WFZA 4LBIA 1MN9A 3RBXA 5DZ7A 2HEKA 2DH8A 2EBGA 1VC0A 4ZLJA 5D0GA 1FRHA 2BE2B 1NPRA 1X4EA 4RBVA 5CXTA 1FKPA 1RHQB 1HPZA 5IFMA 3PJWA 4YHHF 3HVWA 3GYGA 1HWIA 2OPRA 4K4VA 5ETSA 2HPUA 4DUTA 4DV4F 1VQMS 1P6TA 1BQXA 5A8KA 1RT3B 3DLGB 5DQIA 1GMUA 3H20A 2JC1A 4ZHRB 4ZCKA 3G87A 1XMQJ 2OUGA 2HGNA 4O3OA 5DG9A 1KQSR 2K8GA 3FEZA 2BKNA 4BWMA 2DNKA 2H4YB 3HJVA 2N3OA 1VRUA 1H98A 3DM2B 2E9TA 2R42A 5J1EB 3C14B 1W7WA 2GAHC 3LO3A 1UFLA 3TAPA 3KK2B
chains in the Genus database with same CATH topology
4KBIA 2VPXB 4OMFG 4DQRA 2RU9A 4FNHA 1YRXA 3PXGa 2I9SA 3CO9A 3T5HA 4AXJA 1FRKA 4OX9F 4ZP7A 3CCLS 4Y65A 4WYWA 4ECRA 3FEYB 5FD1A 5F0UA 1RT5A 1Y9OA 1N5VA 3MDFA 1IKVA 2MMYA 4NCGB 1WNEA 2EG1A 4W92B 1R8BA 2E1MC 2PEHA 3I9ZA 4OIXA 3VALA 2ZOMA 2YWFA 2D9OA 2H5EA 5I42A 1KN6A 1K0VA 1U1NA 5KT2A 2MPUA 2C22A 2FJVA 2J8AA 3OHBA 2M7SA 4WFAQ 2UUAF 3N5BA 1KD1T 1S6PB 3GIIA 2IBKA 2FJAB 5F41A 2ZH1A 3PO4A 3VZIA 2OO4A 2VBXA 3MR6A 2XS2A 2UXCF 4C9DA 3I32A 2D3ZA 2JLEA 3VAGA 2CPFA 3TR5A 2GNKA 2CQ1A 5DM6Q 1U1OA 4OI4A 1M5KC 4DV2F 1KLMB 5K9FA 2DCLA 2LXFA 3GE9A 1KOHA 3M30B 1CQNA 3KWMA 2ZNYA 3WX4A 2I2YA 1VHFA 5KT4A 4K4XA 1T3NA 4C8OA 5CYQA 3CJ4A 3M32A 3JTOA 4Q8FA 3TUZC 3EPIA 2G13A 4K59A 2ILZA 4RNHA 4O3NA 1RAJA 1RK8A 2AP6A 2MHEA 1REVB 4X64F 1NNDA 3M1VB 2ASLA 5AE1A 2HLUA 1WWHA 5CZVA 3ZZRA 5K8NA 2DR7A 3RB6A 2FIUA 3MMCB 3KK3B 3OR1A 3LWLA 1WEZA 4NLGA 1N33F 2W4PA 1LW2A 1BC6A 2ACYA 2GQQA 3L09A 3DYAA 4YEAA 4BC9A 4G1QA 3K8VA 4X65F 2RILA 5HP1B 3SYZA 2FVCA 5H1SV 1AFIA 3K8WA 2XC9A 5HLFA 1LWEA 4R8UB 2AGOA 2OP5A 5F9NA 1RA7A 5MLCV 1KVIA 2QA2A 1L3VA 3CC4S 1U7LA 2DHGA 3U7JA 1GH8A 2VKZG 3JSMB 3W3SA 2QIFA 2AW0A 2IYGA 3NP5A 1X4CA 4ECZA 2DO0A 2BYCA 2ZDOA 5J2QB 3KJVB 4DG1A 4PPDA 4C11A 4I7FB 3EYZA 4FF1A 1XEZA 2QT7A 4QYZJ 2ZD1B 5E3PA 1SKWA 1FD2A 3V2UC 3EGWB 4LUBA 2VOOA 2KXHA 2OPQA 3MM7B 4OJ3A 1NKCA 4DFPA 4B9TA 4DQQA 4OQJA 4X4NA 3LP0A 2RVJA 2XG8A 3D2WA 3QGPA 1IR0A 3MMAB 5I3QA 2FPHX 2K1RB 2JLFA 4NLSA 2JHEA 1HBMA 4A48A 4EZ9A 1UP1A 1WG1A 2MGZA 1LWCB 2WTFA 3DLLQ 2DCUB 3CPWR 3M8PA 1X0PA 5KFTA 4KR0B 3OXGA 1JLFB 3MECB 2B9XA 2FVSA 4UY8T 5GAGI 1XMBA 2J0WA 1HBNB 2ZBCA 4O23A 5EUHA 5EN1A 1CPZA 5AE2A 4ES1A 2BRKA 3GR1A 3N5FA 3MUVP 1UAWA 2YWHA 3MAHA 4PXCA 1IKYB 1JLAB 1VOMA 1WF2A 3AB2B 2O3DA 3TA1A 3MEEA 4MTPA 2R7QA 3CCSS 3QJPA 4J9LA 4DLEA 2J9DE 5DLGA 4LFBF 4ID8A 2BE2A 5GAGU 4YP3A 3Q24A 3M8QB 3FZBA 4Y2MA 1T3OA 2G1DA 1D9AA 2M0GB 5KFKA 1Q78A 2IM2A 4WYLA 2CZVC 2V8GA 3C3LA 2YWGA 1JK9B 2MKIA 1DLOB 3GIMA 2B6AB 1NJWA 2DR8A 1DQ9A 1XWLA 2ZDPA 1M5OC 2AGPA 4X4QA 4J9MA 4DF4A 1JLCA 2CDQA 2HWHA 5C42B 1RT3A 2KXFA 4I6WA 3DLGA 3ICLA 3MOZA 5D77A 1DQAA 1X4HA 4QR0A 4ZHRA 2GHWA 3KNGA 1SI9A 1FERA 4NXNF 2MKJA 4Q44A 4DV1F 3IWNC 5KAKA 1RQ0A 2FHJD 2AJQA 4CQ1A 3LP1B 2KZMA 3TA2A 4AYBD 1G2EA 4AL7A 2J9EA 3V6HA 3I82A 3FDSA 2RRAA 4I6YA 4NLPA 1VFJA 3B4MA 3CJKA 1RT7B 4PXEA 5IS2A 1RTHB 2X1AA 4ED0A 4B9MA 1UKUA 3JAMY 3EXYA 5L9XA 4HI1A 1HNIA 4UUXA 3K5OA 2DRAA 2RDIA 4BBYA 1TL5A 2HHHF 4EU0A 1HL6A 3Q8SB 4QU6A 1S9GA 3TVZA 1T95A 3FVYA 3CCQS 5JVHQ 1ZH5A 2YWKA 2G4BA 1LXNA 2V4JA 2DGSA 2YKPA 3MUMP 3AA9A 5L38A 5EHHA 3MURP 1DTQB 2MJUA 4YB7A 1G1XA 2KU7A 1N32F 5J1EA 2ZH5A 3LPYA 1SJFA 1PC4A 3SCJE 4FP9A 1IBLF 2F9DA 2C3UA 2KT2A 1VQ5S 3MEKA 1TP7A 4MFBB 4ZPCA 4HI2A 2AJ0A 2YNGB 5I3PA 4RNOA 2ZH4A 5F9LA 1LK7A 3IRXB 2N3LA 3KLGB 2HNZA 2HVZA 4Q43A 4DWIA 1C1CB 4TU8A 2AF6A 2KB2A 4F3QA 4PQUB 4YMEA 3BDPA 1HWJA 2ZH2A 1S7HA 5L1JA 4ZPWR 3OTBA 2ASDA 3DRPA 3D28A 4A8FA 2M70A 3OVAA 2BW2A 2HNDB 3H5UA 2VC0A 4NCGA 2VKRA 2OKQA 4NLVA 2LYVA 2DJWA 3QO9B 2QZ8A 3CVKA 4WFNQ 4B3OB 1N0UA 3PDNA 5CH7B 2PT0A 3T5KA 1S97A 2EK1A 1L3SA 4ZCIA 3MPVA 1R0AA 4YOEA 4TLQA 1S6PA 2W8LA 1HNZF 3MAQA 3CDWA 3KTQA 1HI0P 2LVWA 1KLMA 1CQMA 1TZ0A 4H4KC 1DBDA 1FK9B 2YQ3A 2ZOGA 4LSLA 5IM0B 2XGPA 1RYSA 4U7CA 2DGVA 2RDJA 4P7VA 2NR0A 3KMQA 3JSYA 4KQZA 4MMOA 2JZ5A 3OVBA 1QUPA 1S6UA 2VV5A 4USIA 5E7OB 1IJEB 4YB6A 2FVPA 4H4MB 3HZGA 3PW4A 3H59A 3BSCA 1REVA 3HK2A 1QY7A 4RW4A 4TY8B 1N54B 1VBXA 1QLNA 3BS9A 3ISZA 3KK3A 1DTTA 4U7UK 4DV0F 2JVRA 3R5DA 2W4CA 3GB0A 5C25B 1ZOTA 4DL5A 1S10A 1U2RA 2VFTA 3I6PA 2HVHA 3M6VA 3T19A 4NA2A 2AYEA 2O66A 2VPZB 2IA6A 4TLRA 1R6YA 5KFJA 1NH8A 1RISA 2L08A 5KFGA 4F4KA 1F5AA 4CNYA 4ECYA 4JI1F 3NL0A 4NLDA 3ETOA 3RYLA 1APSA 1IKWA 2J6TA 3Q2TC 4WFYA 3QIPA 3IWXA 3MPWA 4DL0C 3JSMA 4NWBA 4Q7AA 1WTBA 2GV1A 3R3TA 5BYSA 5KFBA 1JLEB 2RH3A 5T41A 1H38A 3FMWA 1TL4A 5J2QA 3KJVA 2IJNA 2YKNA 4IOBA 3W2VA 2O5DA 2Y0SD 3EZ5A 1KONA 2WSEC 3MMJA 4HT5A 2ZD1A 1QVGR 3MM7A 3NRBA 5GMKa 2W8KA 2IMOA 4LQ3A 2DB1A 4JI0F 1B0PA 2XCAA 4LF5F 3MMAA 2Z2LA 1O5JA 3X3UA 1UW4A 3OW2R 3M8RA 1TKXB 4OHZA 2JEGA 3NNCA 2L3MA 4J9NA 3KLIA 1YHQS 2DBBA 2HWTA 1XMOF 2A3JA 3GFYA 3OFEA 5CCLA 3MECA 1GX6A 3UDCA 1LWFB 3NS5A 3H8YA 3RZAA 2VG7B 4Q0BA 4KFBB 1Q82T 1FTCA 5D4OA 3DI6B 3MZIA 1NK5A 3TARA 3AJ1A 1IKYA 3G8SA 3M05A 4MIAA 4CO0A 1RKIA 2CKWA 1Y4ZB 2CQIA 4OZ1A 5DETA 1VBYA 4OHXA 2QA1A 1KR4A 3GG1A 3IR7B 4DL3A 2DGUA 4WIIA 1LW0B 3UWTA 2X1BA 4EYHB 3S6EA 2XS7A 2VOPA 2DH7A 3AQPA 4OZLA 4RBTA 2L9WA 5IT4A 1SJ1A 1TV6B 3TX8A 1TVRB 3I4PA 3VAKA 1T8EA 3OLAA 3N6NA 2JEIA 2QMXA 4GO5X 4NLUA 2CQGA 2IRUA 3Q8PB 4OZ0A 3KHGA 3K5MA 4OZNA 1DLOA 2QSWA 4CO3A 1DAXA 2B6AA 3AH6A 3LAMA 3HX9A 3DN9A 5KG2A 5L1IA 5KFIA 3SSSA 2R7OA 1KOOA 3JTPA 4DHVA 4YFUA 2RNEA 2YX1A 4PG5A 3HP6A 4FPRA 4GO7X 4P7TA 3HVTB 3DU5A 3VF0B 2RT3A 4I2PB 2R2RA 4ECUA 3N0VA 2MY8A 2XEXA 4ZMMA 4N5SA 1JMTA 3KHLA 2EFNA 1Y5IB 3D0GE 4RWWA 2EVZA 3WBZA 2F3JA 4DUZF 1JJ2R 3KOAA 3IAS9 5CA5A 4TKTA 1J5EF 3MEDB 5I3UB 1WHVA 5EGYA 4RW6A 2YNHB 5E3RA 4ZPAA 2EG2A 4ZP8A 1S6QB 1UJ5A 3VQTA 3ITHB 3N6LA 1HNVB 3QGHA 2FJWA 5KOWA 1RT7A 4R25A 4DF8A 1XN9A 4DFMA 3D1QA 1VQLS 1RT5B 2BZ2A 2VG6A 3BR8A 4PR6A 3TRGA 4J9RA 1XTZA 3HMJG 2X3GA 2MZQA 2M88A 4AL6A 3O6QA 2EFGA 1XNQF 4F67A 4J9PA 5I42B 2LQ9A 2FVQA 2GJ2A 2XMKA 2Y1JA 3KFWX 3M2UA 1Q81T 3IBWA 1ROFA 3AQOA 3MMBA 4ZVGA 3N6MA 1WHWA 1YITS 5A6PA 2Q79A 3TP2A 4I56A 5CZXA 3W2WB 4MFBA 1MMNA 2I5JB 3IRWP 1F60B 3R5CA 3BSAA 2COLA 5AXLA 3IRXA 4QJVA 3KLGA 4WZMA 4DR1F 3ZZTA 4NA1A 3OV7A 2BXJA 4NLWA 1TFWA 3OL7A 3MR5A 1UETA 4RZRA 2HHPA 3OPKA 2NYIA 4PQUA 4QBUA 2YX4A 4ZLPA 3UW1A 2DVIA 1ZBTA 3E2EA 1JNZB 3H25A 3CXCR 1VK8A 3M32B 4Y00A 3I9V9 4LIRA 5KT5A 2KN4A 1ZTTA 1QM9A 1MU2B 1OPIA 4BCAA 3RU0A 2HNDA 3U1LA 5A8RB 5HO4A 4LF4F 2W9AA 4X4VA 1R43A 3QO9A 4K4UA 3CTRA 1DFDA 2VL1A 3MPYA 2MQMA 1RI7A 4J9KA 5KFSA 3H4BA 1U49A 4B3OA 1LW2B 2BUNA 2KFZA 2CJ9A 3DYAB 2XLJA 1FD8A 2JWNA 4G1QB 3SSRA 1BD6A 2OSRA 5AXKA 1NRKA 1WI6A 4F4WA 3G8QA 4WXOA 1LWEB 2DNRA 5K14B 2IM3A 2MHNA 4Y2KA 3GIKA 2AQ4A 4IRCA 1HMVB 1H7WA 2F40A 5LSRA 4QW9A 1VQYA 4LFCF 1IXKA 3V6JA 2QEXS 1FK9A 3ZFVA 3GQCA 3FFIB 5IM0A 2KM8C 3CGIA 2M9KA 4I68A 5KT3A 4C8ZA 2ZE2B 3QJLA 3RW6A 3DOKA 2FY1A 4O0IA 1T05A 4DS4A 2LMIA 3CCES 3JSRA 4X84A 4A4JA 5HL7Q 4ZOSA 2PA3A 2OPQB 2ALZA 4DN9A 5B0GA 3KG4A 2DNZA 1L3KA 5DDRC 4TY8A 2ZH3A 3LUYA 1HQEB 3ZZOA 1X9SA 3BGRB 3MEGA 4KAIA 1N5YB 1HBMB 1KS2A 2LCWA 3ULHA 4CT8A 3SFUA 3SEOA 1SH0A 2VD3A 3M8PB 4OI1A 1H2UX 1QUVA 4K4SA 5F8GA 1HNWF 3HXMA 4NLQA 5IT9Y 3D0HE 4AE5A 3HHNB 3RRGA 5G0RB 3P5TL 2DK2A 2AWZA 1Q79A 3BGFA 4XDDA 4LT6A 4F4YA 1W25A 3M9MB 4XO0A 1U6BA 1JLEA 3MFIA 1S9FA 1UFWA 3MEEB 3MCSA 3NAIA 1HWKA 5JXSA 4UQGA 3KNAA 1CVJA 1UJ4A 2SXLA 3GILA 3ZZUA 1RKJA 2XWYA 4F8RA 3K58A 1WTFA 4F25A 3C46A 2AJ1A 3DLJA 4XIUA 4X66F 3RRHA 1DQ8A 1VGYA 5K8MA 2MQOA 3M9OB 5A8WA 4C97A 3UCZP 1FJGF 2J7WA 5E33A 1TKXA 1X8DA 2RMLA 2JX2A 5THWA 3GV8B 2GMHA 3BREA 2J0QD 4PG7A 4IDKB 5LJ3Y 4ECSA 1CC8A 1XR5A 4MK9A 2MZSA 2CIMA 5A6WA 1LWFA 1JLCB 3WDOA 1VIXA 3SI8A 3BGUA 3MD1A 4IKAA 2D9PA 2DGTA 2VG7A 4FZVA 4KFBA 3ZZ0A 1S9EA 3OFGA 2PO4A 3BZQA 1LV5A 2XCPA 2VBZA 3BJYA 3D1HA 3E8OA 4M1KA 1KQKA 1I1GA 5KFCA 2CJBA 2ZBIA 3TUJC 2XZWA 3IO1A 1B7FA 1KTVA 1FEEA 3AA8A 3IR5B 4TNOA 3MXHP 2YX7A 3DLEA 3OR2B 3TAQA 1HBOB 1LW0A 1U6ZA 2CRLA 3I87A 2VODA 1T94A 3BB5A 1OWXA 1NEEA 4KT0C 2DGWA 3NMAA 3DRYA 1Q8IA 3PX6A 4HL9A 4GKJF 2DNHA 1TV6A 3KLFB 3CD6S 2MJNA 3GIJA 4OX7A 3OSNA 2XSJB 3MGJA 3I96A 5KG7A 4X4TA 2W7AA 2CJQA 3L7OA 1HNIB 2IJFA 4DFJA 1BLUA 4NPOA 1JJHA 2F8EX 1N4LA 4C3KA 2XSFA 3MTJA 1S9GB 1U4BA 3OUYA 2RQMA 2MKKA 5J2NA 1FRMA 1VIOA 1P1LA 5U47A 2GQCA 1VQNS 2CQCA 2C3YA 4PQAA 1IBMF 3NAHA 3HVTA 4IG0B 1ZM9A 1IN0A 3MR2A 4C3MA 4WKRA 3N01A 3J7ZT 1YVFA 3T5JA 4A46A 4ES2A 1IKXA 2IBOA 1VQ6S 4LSNA 1RP5A 2YNHA 4X4PA 4Q45A 3ITHA 2VZ9A 1HNVA 4KTQA 3DXSX 4HLBA 1X5OA 1VQ8S 3HVAA 3JYTA 2ZJPQ 1KVJA 4JI6F 2ILYA 3GV7B 3CE8A 1VBZA 3I55S 2WHOA 5J2PA 2YKAA 3DRPB 3NKYA 4WK3A 1HW8A 3RB3A 4H4KA 5B08A 2DNOA 4RWXA 2R7WA 4PWDA 1XR7A 4LQ9A 3LGNA 2KM8B 2VASA 3G6XA 1NO8A 2BANA 3IG1B 2M8DB 1RT2A 1JLGA 4NZ0A 2ZHOA 4DSIA 1RGVA 1YIJS 2WAQD 2RUGA 4OLPA 1UMJA 3TUIC 4HYKA 2I0XA 5D8HB 1R0AB 2D1CA 3GZ7A 1UVNA 3J81Y 3W2WA 2I5JA 1UA0A 3VAIA 1YJRA 4X4RA 1LK5A 1X4GA 4DQIA 3CD5A 3KHHA 3CF5Q 2ASJA 4DLGA 1BY9A 3J7Z5 4DR2F 5KFVA 4LSLB 1Q53A 1I94F 1C2PA 1SV5B 2OAUA 2KHDA 4K0KF 1N34F 1TAQA 1SJ3P 2BM0A 2OD4A 1FRIA 2AV5A 4ZPTR 1MU2A 4XDCA 2LDIA 2B5JB 2MZ1A 2B9WA 5A8RA 5K8OA 2NUUG 4RW4B 3O44A 1U6FA 2CQPA 3D5MA 1G3OA 2E5IA 3M2VB 4DMZA 4V19X 1DTTB 1U1LA 1HFEL 3G86A 3PIOQ 4O3SA 2N7CA 2OIHA 2F7VA 3U1NA 4JI8F 2D74B 3MR3A 4ED1A 5D78A 1L5UA 2GHPA 5K14A 1JLBB 1HMVA 4RW7B 4X4SA