1SBWA

Crystal structure of mung bean inhibitor lysine active fragment complex with bovine beta-trypsin at 1.8a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mung bean inhibitor lysine active fragment complex with bovine beta-trypsin at 1.8A resolution.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (BETA-TRYPSIN)
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sbwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sbwA02
1C1SA 1F0UA 2ZZUH 3UWIA 2ANYA 3SV6A 5HGGA 3AAVA 4A7IB 2OINA 5DKMA 2XCNA 2SGQE 1SFQB 1SVPA 4I32A 5DP7A 1W7GH 2A45B 4JZIA 1UTLM 1G3DA 1MMJN 3JZ2B 1TGCA 3SUEA 8ESTE 2UUYA 3VXFH 3AASA 1ESAA 2GZ7A 1ELEE 2C3SA 4U30A 1O2YA 4YLQH 1EOJA 3SNBA 1K1LA 3UNQA 3MNSA 1BBRK 2AIPA 1K2I1 1K1PA 1PJPA 1EB1H 2YNBA 4CHAB 3P70B 6GCHG 1NRPH 2UWOA 1DANH 1LKBA 1T7CA 4NG9H 3HGNA 1UK4A 3MO9A 2GDEH 3EGKH 4MPXA 2GCHF 5EG4A 3ATWA 4ABHA 4UFFH 2TBSA 1YLCA 3FAOA 2AMPA 1ZR0A 1TNJA 2WUBA 2R0LA 1VITH 4KTSA 1AVXA 1NFYA 2WUCA 1AFQB 2J9NA 5FX6A 3SU2A 4R0IA 3UTUH 4FUGA 1S6FA 2ANKH 1KLTA 1FY1A 1HAGE 1D6WA 5HM2A 3RXGA 1H9HE 5JBBS 1SLUB 3WY8A 1B5GH 1QQUA 2QXIA 4B75A 2TPIZ 1PPCE 2Z94A 1O2TA 4DG4A 1MTNB 2NU0E 2QYIA 2CF9H 1C4U2 3BTFE 3LH1A 5ETXA 4I7YH 1RS0A 5G4BA 1C9TA 1OP8A 3P6ZB 1ZPZA 2WINI 2HRVA 4THNH 1E36B 1GI5A 1O3OA 2VH6A 5L6NH 2R2MB 1IOEA 1MU6B 2OC7A 4Y10E 3C1KA 1EPTB 3QUMP 3SJKA 2BD8A 4LXBH 1VZQH 7KMEH 1KDQB 8GCHG 2AERH 1EP6A 2B9LA 2FI5E 1O2GH 2A7JA 4B76A 1P3CA 4IW4E 3LPRA 3O8RA 1IAUA 4AG1A 2O8WA 1KY9A 2RG3A 3BIVH 1PYTC 1V2ST 3MU5A 2O8LA 4YZUA 1XUJA 1O5GH 2ZTYA 1P10A 5F8ZA 1BJUA 1KDQA 3L33A 1GCDA 3M5MA 3PWCA 3UNSA 4GHTA 3LC3A 2BX3A 3I29A 3MNXA 1OP0A 2QN5T 2AS9A 1GWAA 3UOPA 3A7YA 2BY6X 4NA7A 2HNTF 2G8TA 1Y3WA 2CHAB 4OS2A 1UCYE 1FXYA 4E7RG 1KXDA 4H6SB 4INKA 1DUAA 1H9IE 1S85A 3SJOA 3NCLA 4A92A 4FUJA 1AE8H 1BTWA 4NIYA 5I25A 3MH7A 1FPCH 3ZZDA 4ABEA 5TJXA 1GBJA 1Z6JH 1BCUH 2M5TA 3TITA 1O3BA 2GMTB 3ZVAA 3PLPA 4AFQA 4IBLH 1QRZA 5FX5A 6LPRA 3OYPA 2EI8A 3SU3A 3U1IB 2ZCHP 4IN2A 5EXLA 4JK6A 2ZG0H 1GJ8B 1QL7A 3RXJA 4Q7ZA 1O5DH 2GVFA 2H1UA 1F92A 5B6OA 2BQ7B 1C1VH 4TWWA 3M61U 1AKSA 1DPOA 2FWWA 3KCGH 4WWYA 2VH0A 1O3AA 4Q80A 1TNHA 1BITA 1WBGB 1ZOMA 2Z3DA 1C2DA 2F9NA 3BF6H 3SI4H 5C20A 1SGPE 3TVJB 4TPIZ 3ZZBA 3H7TA 2AIQA 4B2CA 1TPAE 3VB3A 1AI8H 4ZKNU 4H4FA 4X6PA 3KQCA 1YPMH 1TE0A 2WYGA 3VXEH 1NM6A 3CP7A 3V12A 1THSH 1P09A 3BTME 3BIUH 3SGBE 3BEIB 4NSVA 1YLDA 3GY4A 1FY3A 2BZAA 1G3CA 2XRCA 3EA7A 4U2WA 1LHGH 5AFZH 1HAHH 2DE9A 1MTVA 3PO1B 4AFUA 2PGBB 4WY3A 4IC6A 3S69A 1OSSA 1OWEA 3VGCB 1YPJH 2FOMB 2EI7A 4FVDA 4GUXA 4AGKA 5F6MA 1YBWA 2XBYA 3P92A 1DLKB 5C2ZA 2XNIA 3RXEA 1IHTH 3V0XA 1GJ9B 5E2PA 1LPZB 2ZA5A 4ABFA 7ESTE 1OWIA 4CR5A 1IHSH 2W7UA 5EOKA 2OC8A 5GJ4B 8GCHF 1YCPM 1NRRH 1C1MA 2QXJA 3UR6A 4ZHMU 1P0SH 2A31A 3U8OH 2BD7A 1SGYE 2OCVB 5DP9A 2PHBA 2ZU2A 1PPEE 1ACBE 5HYOA 2ZTXA 3HK3B 2ZIQH 1K9OE 1G9IE 1BJVA 1RGQA 2B5TB 1ZHPA 4YTAA 3ATMA 1UVUH 3ZZ8A 1T8LA 5DP6A 1CBWB 3SJIA 2DE8A 2RA3A 1KXBA 1EATA 1EAXA 2FEQH 1V2KT 4WXIA 2BVSH 1C5YB 1EJAA 2ZHQH 4HTCH 3RU4T 1WCZA 2G4TA 3BTTE 3T5FH 1O5EH 1ETSH 4JYTA 1P2KA 3KIDU 3F9GA 2XYAA 2F83A 2ODYB 2AGGX 3RM2H 1DWDH 1G36A 1TMUH 3A7ZA 1IQNA 1O2SA 3VB6A 3SW2B 2Q1JA 1LKAA 4X2VA 1RJXB 3GY7A 2BTCE 2WPJS 2G4UA 1RTLA 3LC5A 3RC6A 1O2ZA 4X2WA 1SMFE 3RXKA 2XTTB 1QBVH 3KQEA 5K7RA 5GXPA 1N6YA 2W3IA 1GMHG 4KKDA 4R8TB 2FLRH 1F5KU 3RXOA 5DO4H 1A5GH 1BUIA 2FIRH 1THRH 3TJVA 1AZZA 2CJIA 3A7XA 2ZDKA 1FONA 2FOCA 3CS7A 1HDTH 1UJ1A 3M35A 4CBOA 2VIQA 4YM9A 1Y8TA 1PPGE 3R0FA 4A1TA 1C5XB 4FU8A 1HAIH 1EX3A 4OS1A 4ABDA 1VCPA 1HJAB 2BD3A 3T2NA 4A6LA 2ZFQH 4X1SU 1F0SA 6CHAC 1OWJA 3W94A 1H9LB 1CT2E 1LHFH 4HFPB 1EOLA 1UO6A 5EPYA 1ELAA 1ZMLA 1RRKA 2Z9IA 3LGTA 3VPKA 2B8OH 4JZDH 1NU9A 1HB0B 1BMMH 3RXAA 1GBFA 2J92A 4ZUHA 2Y7XA 1PPBH 3A7WA 3O8DA 1OWHA 5JBCS 1O2LA 2PUXB 1TOCB 1CQQA 2P8OB 1A5IA 4A1VA 3GY6A 1AN1E 2V6NA 4MPVA 3MYWA 4TY7A 3QZQA 2FM2A 3VB7A 4X8SH 1ARCA 1C5PA 4OGYA 1EAUA 4X2YA 3L3TA 2FOBA 4DW2U 1EAWA 4I8GA 1VITF 3QZRA 3TLOA 1DWBH 3SNEA 3MI4A 2P93A 1BHXB 3RXHA 1HUTH 4OS4A 2QY0B 1C2IA 4JZEH 4QT8C 4B74A 4WXVA 2Y5FA 1EB2A 1V2TT 2BDIA 4UD9H 1KIGH 3E6PH 5LH8A 1S81A 1DVAH 5LGOA 1YF4A 1ARBA 3SJ8A 3EE0B 1UTOA 1KTTB 1PYTD 1P2QA 4NA9H 3SN8A 3UQOA 2FI4E 1TYNA 2NWNA 3STJA 1BB0B 4SGBE 4E05H 2Z7FE 3SQHE 1N1LA 1O3DA 3S9BA 5JBTA 1GJCB 1CO7E 2GCTC 3SOSA 2UWPA 1YKTA 2JKHA 1M9UA 1TPPA 2HWLB 3TGIE 3B8JA 4U01A 1TGNA 3AVZA 5L2ZH 4UE7H 3F9HA 2VIDA 3SNDA 3VGCC 4ESTE 2C4FH 3A8AA 3I77A 1PPFE 3DFJA 3PTNA 4BNRA 1DXWA 3SORA 1MBMA 2ZU5A 3M7UA 3DA9B 1ZLRA 2PKAA 3RXDA 4FU9A 1NPMA 3GY2A 3S9AA 2XBVA 1A4WH 4Y6DA 3SNCA 1GI1A 1GMHF 5EW1H 1GCTC 1Q31A 4I8KA 1D3DB 2ZGJA 2V0BA 1HAOH 4B2AA 1Y3XA 4BAMB 5A8ZA 2FYQA 1CGIE 1BOQA 3A8CA 1SGTA 2O8UA 2C8YB 1AHTH 4HGCA 2RDLA 3GCHC 4CH8B 4ZHAA 4DGJA 4IGDA 1S84A 1O3JA 5DK1A 4B71A 2Y6TA 1SOTA 3E16B 4DVAU 2SFAA 1IQFA 1GGDB 3H7OA 3RP2A 4ISHH 1EZXC 1WUNH 3FVFB 3SV9A 5T3HA 1UTJA 3MWIU 1J17T 3Q3KA 1Q2WA 1HV7A 1T8OA 2XCFA 1MKXK 1XUFA 1KXAA 4X1PU 5ABWA 1FNIA 4GCHF 1BHXF 2K1QA 1O2XA 5FHTA 1ZTKA 3U69H 4ABIA 1T8NA 2ZGHA 1C2FA 1TMTH 1A7SA 1O5AB 4DT7B 5C5NA 4FUHA 1FV9A 1GBKA 2QCYA 5GCHG 5AF9H 1GJBB 2H6MA 2PFEA 1GBAA 2VWMA 1Y3YA 2ZFSA 1F5LA 1W3CA 1IQJA 1DWEH 5DG6A 3HKIB 4LZ4B 1FUJA 2OC0A 4NA8A 2TGDA 1GI9B 2FODA 2ZPQA 1UTNA 1ANDA 1UCYH 1VCQA 3TJNA 1RTKA 2A0QB 7LPRA 5A09A 2BD5A 2BX4A 3NPSA 1QB6A 2ZDVH 3P8NA 4GAWA 3A80A 3RXRA 4NIVA 3BSQA 4FVBA 1DS2E 1D3QB 3U1JB 2OXSA 4GVUA 2SGFE 3MO3A 3O8BA 1Q3XA 3RMLH 3KL6A 3SV7A 1OS8A 1P2MA 1L1JA 1YM0A 1ELBA 1W13U 2I6QA 2V35A 3NXPA 3SI3H 3PV4A 4YO9A 3GY8A 3BG4B 5EQSA 1GBDA 2O8TA 1GHAG 1YP9A 2BOHB 1XKAC 1NTPA 1NFWA 3T26A 1XMNB 4INHA 1YGCH 1KLJH 1O38A 2OBOA 2ODQA 1GI7B 1XM1A 3E0NB 2G00A 1HJAC 5BPEA 2QF3A 1FMGA 1O2VA 3T25A 5LPRA 4TY6A 1DE7H 2TGAA 3V3MA 1GPZA 3MMGA 1Z8GA 1ANCA 1DXPA 1HAVA 4ISOA 3TGKE 2Z9GA 3LGUA 5EXMA 1SLVB 1JOUB 2BQWB 1CA0C 2OLGA 2Z3CA 2GD4B 1SOZA 1K1IA 5AFYH 1L1GA 1QB1A 1C5LH 2D2DA 3MH6A 1C5WB 3TH3H 1A3BH 1AB9B 2BLVA 1MQ5A 3BTKE 2ZQ1A 5E0GA 1A0LA 3Q77A 3TNTA 5C3NA 3SNAA 1MBQA 1XUKA 4AZ2B 2A5AA 1GBCA 3BTGE 1JWTA 1QCPA 3RUOA 3O8CA 3LGVA 3PM3A 2A32A 3Q00A 3EDXB 1ZSJA 1MTWA 3A88A 1YC0A 4NIWA 1GDUA 2P8OC 4OGXA 3SU5A 3JZ1B 3P17H 3SHCH 3M3TA 2FX6A 2VWNA 3RXLA 3T28A 1FIZA 2HNTC 1TPSA 4F49A 1Y5BT 1JIRA 4OS5A 5EQQA 3SGQE 3SU0A 5A2MH 1O5FH 3VB5A 5T6DA 1ZTLA 3A83A 5EPNA 1QL9A 4U32A 2GMTC 4O03A 2ZGXH 4HI3A 4Z0KA 1O3KA 2LPRA 2XC5A 3EQ0H 3MOCA 2KAIA 2GX4A 2F9BH 1L2EA 3OX7U 3S0NA 1C5MD 2TRMA 1RTFB 3HATH 2CMYA 2FS8A 3VB4A 5FXLA 1L4ZA 4BXSA 1ABIH 2ZECA 1C5UA 1HGTH 1TGBA 3RXPA 2DUCA 5GPIB 2THFB 3IITA 1AO5A 3SU4A 1DM4B 4GLYA 1C5QA 4X8VH 5A8XA 4AG2A 1DFPA 2BDAA 1O2JA 2C8ZB 1QRXA 2FZZA 1O33A 1SFIA 3F9FA 3URDA 5DP4A 2G51A 2BMGB 1SGCA 1INCA 3RMMH 4O3TA 3U98H 7GCHF 1GJ5H 5FPSA 1XX9A 2A2XH 4UFGH 3FP6E 3B23B 3GYMA 3RDZA 5A0CA 3A7VA 1J15A 1O3MA 1MTUA 1GHZA 1UVOA 1WYKA 1YPKH 1GDNA 3B9FH 2ZEBA 4I8JA 1E37B 1FAXA 1HYLA 1QNJA 3ZZ5A 4BXWA 5AVDA 2H9EH 1V3XA 1VGCC 4X6NA 4ZROA 3A7TA 1OX1A 1GHAF 3MU1A 2H9TH 1BTHH 2BZ6H 3LJJA 3U8TH 1L1NA 1ZJKA 1ELVA 2A2QH 2GGVB 1GG6C 2W26A 2ZQ2A 1P2OA 1J16A 3LH3A 4CHAC 3UPEA 3E8LA 1Y3VA 4X1NU 2XBWA 4XDEA 1XKBC 2BDBA 3S9CA 2FOGA 1FPHH 1OP2A 4J2YB 3LKWA 1ELTA 1RD3B 1O3HA 1WTGH 1GBLA 2SGAA 2WPLS 4BTIB 1EP5A 3QO6A 1P03A 3TJOA 1EPTC 3ZVGA 1GBEA 2ASUB 4X1RU 1ELDE 2BDCA 1FDPA 2FESH 2BD2A 3UQVA 1H8IH 1MTNC 1UHBB 3KF2A 2J94A 3FFGA 1SC8U 4K60A 4KELA 4Q7YA 1HXFH 2BLQA 1GI6A 1SR5C 1O2QA 4HZHA 1K1NA 5EXNA 2BM2A 2V3HH 1EZUC 3A89A 4H6TA 2FOEA 2OBQA 3F1SB 4TPYA 4DURA 4GSOA 5DP5A 2ZFRH 1PQAA 3SGAE 1P2JA 4H42U 1CGHA 4IMZA 2VU8E 1AFQC 1BTUA 1AWHB 1C2HA 4FUBA 5J4QA 1HAYB 1NO9H 4MG3A 1YYY1 1TLDA 1GVZA 3M36A 3PROA 1ETTH 5FBEA 1C1NA 1MKXH 5A0BA 1NS3A 3LIWA 2D8WA 5K0HA 2VIPA 4OS7A 3T27A 4CBNA 2FDAA 5FPYA 1DT2A 1J9CH 1S0RA 4ZKRU 4RSPA 2R9PA 3PMJA 4ZKSU 1DOJA 1JBUH 1G3EA 2XBXA 4X6OA 3SZNA 3Q76A 2BYAX 3UWJH 3EA9A 2QGRA 3E90B 3T29A 4AORA 2QV1A 3QGJA 1P9UA 4AFSA 1LQDB 4AN7A 1JRTA 5SGAE 1UK3A 2HGTH 1OYQA 2VWOA 1CGJE 1V2MT 2PV9B 5H4IB 3MO6A 3SV8A 2A7HA 1NESE 1D3PB 2A7CA 3F68H 3ZVFA 3E91A 2OC1A 4MNXA 3R3GB 1MKWH 3QGNB 5BRRE 1S82A 5CHAB 1BMNH 4UEHH 2NU3E 2P3UB 2GDDA 1OWKA 1AFEH 1HLTH 1C5ZB 1AD8H 1LDTT 1P57B 3ZZAA 2WPMS 1A2CH 3TH4H 1BTZA 3TK6A 1LO6A 1W11U 1C4V2 4RKOB 1BTPA 4YLUA 4BTUB 4IN1A 2XXLA 1ZRBA 4D7FA 1SQTA 1O3FA 1QRWA 3SQEE 3E0PB 3ZVCA 1BMAA 3BN9A 2BDHA 1F5RA 4MNVA 1QTFA 4XBDA 3HKJB 1EAIA 1HPGA 4AX9H 2JH6D 1OWDA 3TK9A 1AB9C 1V2PT 2Z9JA 5FBIA 1E34B 5AHGH 1A0HB 9ESTA 4DIIH 1ZPCA 2PTNA 4O9VA 1O36A 1WV7H 3QTVH 1C1PA 1QGFA 1VCWA 3GCOA 1HJ8A 2SGDE 3P8FA 1QURH 1E0FD 3NK8A 1RIWB 3UREA 4MPWA 1C5OH 4B1TA 1GL1A 4O97A 4ABGA 1GBIA 4ISLA 1HJ9A 1YPGH 1TPOA 3S7HB 1A3EH 2BOKA 2QA9E 3VFEA 3M5LA 5IDKA 3GOVB 2NU1E 2HPPH 3LT3A 4CREA 4AYVB 1ZSKA 1UCYK 1MCTA 1PQ5A 1DSTA 2Z9LA 5C1YA 4MTBA 1DITH 4JZFH 1BTXA 2FTLE 2PW8H 1AU8A 4NWKA 1XXFA 1LHDH 1H1BA 3ZZ9A 4ISIH 2QXHA 2VVVA 3UR9A 3QTOH 4K5ZA 2Y81A 3BG4C 4ABBA 3NZIA 1DWCH 2ZFTA 3ATLA 1O2MA 3L6PA 1GBMA 3F9EA 4RKJB 3EYDA 1HAPH 2B7DH 3KEEA 3BTQE 1BRBE 1PFXC 2ZP0H 1N6XA 1AVWA 3CENA 4YT6H 2A4RA 5DP8A 1QFKH 3ITIA 2AGEX 1GHWH 5JPMH 1HIAB 1O3CA 1TFXA 3E3TA 4Y79A 5A8YA 3P8GA 1BT7A 2HPQH 4JYVH 1Y5AT 4ASHA 1QR3E 2P95A 3RXBA 1CA0B 3TK5A 1C1TA 1TQ7B 2F9PA 1S6HA 3EA8A 5LPEA 3GY5A 1SLXB 3GYLB 4LZ1H 1YPHE 2VJ1A 3P95A 5T6FA 2ANWA 1NRNH 1THPB 4K69A 1LCYA 1SGDE 3LU9B 1O35A 4VGCB 1CVWH 1OPHB 2Q6FA 2O8MA 4XBBA 2C93B 1GHYH 1AUTC 1O3IA 2OTVA 3BEUA 1XUHA 1XVMA 1A5HA 1V2WT 1W12U 2ESTE 2PKSB 3A84A 3KGPA 1O2RA 1C1QA 2VWLA 4IC5A 1O3PB 1YCPK 4NCYA 1OXGA 1EPTA 1HFDA 1QL8A 3GCHB 4TWYA 4DCDA 2A5KA 3LGIA 4JCNA 4I8HA 4XFQA 4AB8A 2J4IA 2Y5HA 2Q6DA 5GDSH 4UFDH 1HIAA 1TONA 1SB1H 3OU0A 1SI5H 1O34A 3CS0A 3TGJE 4JYUH 2G5NA 1A61H 1BQYA 1O0DH 2BDYA 3PLKA 2ZU1A 2C8XB 2ZCKP 1W0ZU 1ZSLA 3SUFA 1TNKA 1ID5H 3M7TA 2EEKA 4Y7AA 5EQRA 1TNLA 1TNIA 2VGCC 1SGQE 2QAAA 1NFXA 2O9QA 2ZHFH 5EU8A 1VJ9U 1G30B 4MVNA 1C2MA 5GIBA 3BG8A 2H5CA 3A87A 7GCHG 3ATKA 5E8EH 3ZV8A 3SO3A 1GBHA 1NZQH 1WTHD 4K1SA 1CBWC 2BDGA 1TX8A 1Z6EA 1AGJA 4DY7B 4ZAEA 2PSXA 3BV9B 5JB9S 3RXCA 1V2UT 3GDUA 1ZHRA 2FP7B 2ZHDA 1GJ4H 2PLXA 2FO9A 1NC6A 4Y8ZA 1B0EA 2C90B 1C9PA 3FZZA 5CHAC 2EA3A 1W10U 2ZC9H 2VNTA 1EASA 2IOTA 1SGNE 2EC9H 2YOLA 3DUXH 1DUEA 1XXDA 3PTBA 1L0ZA 4E06H 1V2QT 4K3JA 1TBQH 6GCHF 1FQ3A 3DHKH 3QLPH 1F0TA 2WYJA 3A81A 1UMAH 3U8RH 2IPHA 2VVCA 1Z1IA 3DFLA 1O2IA 3RC4A 1H4WA 1TABE 2CN0H 1YCPH 1C5VA 4K1EA 1IQLA 1T4VH 3SUGA 3M7QA 1C5TA 3M37A 3ODDA 3Q3XA 1P01A 5JBAS 2FX4A 2WV4A 1QJ7B 4X8TH 4MDSA 3S7KB 3D23A 1Y5UT 3UNRA 3RU4D 2YNAA 4I33A 3RXQA 3RXMA 1TNGA 1DY8A 2ZDAH 1P8VC 1SQAA 3GDSA 1ZPBA 3TNSA 1ZHMA 1ESTA 2BXTH 1SSXA 2HALA 1K1MA 2ZHWH 3QN7A 1O2KA 2CGAA 9LPRA 1FN6A 2BY5X 3QX5H 1XVOA 1MCVA 2OQUA 4AYYB 1KXCA 1UVPA 3RXFA 1CT4E 4UDWH 1C5NH 1GJAB 3GY3A 3ODFA 3GISB 3ESTA 1ELFA 4XBCA 2PKSC 3RLWH 2TGTA 4PROA 1V2RT 4B2BA 1OKXA 1SLWB 2CV3A 1O3EA 4X8UH 3RMNH 4K8YA 1KXEA 4NFFA 5CE1A 4GPGA 2BY8X 1O2UA 4D9RA 4OS6A 3QWCH 5E2OA 3DT0H 3SHAH 2A4QA 1O2PA 2GT7A 5FPTA 1JXPA 1N8OB 1EXFA 1RFNA 3A86A 4BTTB 3MH5A 2Y80A 5L30H 1TA6A 4WF8A 1RIWC 3ZV9A 3MTYA 4GCHG 1W7XH 2STAE 4BAHB 2NU2E 1GHBF 1KLIH 4WMDA 1D4PB 2PKAB 1GMDG 2ZO3H 1VGCB 2BVRH 3SU6A 2A4OA 4XE4A 1A1RA 2R0KA 4FU7A 4Y0ZE 4JZ1A 1AE5A 2VINA 5GCHF 1LHCH 1SGIB 2F91A 2VGCB 5F8TA 1GL0E 1QHRB 4NFEA 1P02A 1AQ7A 1SBWA 1LPKB 3E1XB 4Y0YE 4Y8XA 5HXFA 2W3KA 2G5VA 1FY4A 3DD2H 2JH5D 2WPHS 4YOJA 1SGFG 3PB1E 2XWBI 1QB9A 1K1OA 1MH0A 1Z7KA 1P04A 2TIOA 1Z1JA 2TGPZ 2A5IA 4LOYH 1SL3A 3UUZA 1F7ZA 1TBZH 1SGEE 1SGRE 4I31A 1TRNA 2SGEE 3UOUA 1HNEE 4WVPE 4LK4A 1T4UH 4NZQA 4XOJA 3D49H 1C5RA 2ZDLA 1NU7B 3VEQB 3ENSB 1KXFA 2ULLA 1FY8E 1LVOA 1Y59T 1P3EA 2UUKB 2FTMA 2ANMH 4J1YA 1C2KA 2PGQB 4KTCA 1ZTJA 2BQ6B 1O2WA 1ESBA 4YOIA 1CU1A 4K2YA 3PMHB 5E0JA 4E7NA 3ZVBA 1AZ8A 3OTJE 2XWAA 1CHOF 1SGFA 1C1OA 1MAYA 1C2JA 1V6DA 3GCTF 1ZZZA 1GHXH 5F8XA 4ZXYH 3HK6B 1AY6H 1LHEH 4ZMAH 4ABAA 1O37A 3MNCA 4FUCA 2GTBA 2IN2A 2ZHEH 2JETC 1BRAA 1W0YH 2FI3E 1EZSC 2F9VA 1L4DA 4Y8YA 3BTDE 4WMFA 4CRGA 2H5DA 4WH6A 1TMBH 1CHGA 4KGAA 2BLOA 2LNCA 2J38A 1A46H 1Z71A 2UWLA 1FLEE 3H5CB 4JMYA 2BD9A 2FOAA 5FCRA 1A0JA 4DJZB 2BVXH 3V13A 2F9UA 3LONA 1ZJDA 1QA7A 3Q3YA 1MQ6A 2PR3A 2A4GA 1W14U 2ZPRA 1QA0A 5JYIA 1C1UH 1MD7A 1O31A 1HAZB 1V2LT 3ZYEA 5FAHA 1S0QA 1O32A 2GZ8A 3GICB 2OUAA 1AVGH 1IQEA 1BIOA 1UTMA 2ZFPH 2FOFA 2HVXA 2PUQH 1KTSB 1D9IA 5L2YH 1FAKH 5EODA 3FP8E 4MPUA 1P06A 2ZDMA 5EGMA 2SNWA 1MKWK 1IQKA 2ZGBH 3GDVA 1C2EA 1ZMNA 1BZXE 2GV7A 1BTYA 4M7GA 1UVTH 2CHAC 8LPRA 3K65B 2QIQA 2V3OH 5C1XA 2QXGA 1NY22 1QIXB 2ZWLH 1ZGIA 1E38B 8KME2 1O2OA 2UUFB 3LDXH 3PLBA 1T31A 3D65E 2WV5A 2Y82A 2P3TB 1JIMA 1P2NA 1O2NA 3BTHE 2BHGA 2XC4A 1J8AA 2QF0A 3BEFB 1S5SA 2KAIB 3HPTB 1GCTB 1LVBA 3RMOH 1P9SA 2GV6A 2Z6BD 1BRUP 4NWLA 1EKBB 1NN6A 1O5BB 4BOHA 1GMCG 1V2NT 1ANEA 1HAXB 1TOMH 2FLBH 4I8LA 2AYWA 1TALA 2OD3B 5GWZA 1D3TB 1EJNA 2VIWA 3ZZ3A 5T6GA 4Y7BA 4SGAE 4Y76A 2P16A 3MH4A 1Z8RA 1DSUA 1G2MA 6ESTA 3LJOA 1UHBA 1LPGB 2ZTZA 4ABJA 1EQ9A 3K6ZA 1ZMJA 1AWFH 1DLEA 3OY5U 2ZPSA 1CHOG 2GT8A 1EUFA 3RLYH 3FP7E 3FANA 3A8BA 1S83A 3GCTG 1UTKA 1MTSA 1YPEH 4INLA 1TGSZ 2JH0D 4DIHH 2GCHG 4D9QA 1FI8A 4A1XA 1O3NA 1O3GA 4BAOB 2ILNA 2P59A 1MZAA 3PO1C 2JETB 2OQ5A 3K2UA 1TRMA 1ETRH 2BLWA 2BD4A 2ZCLP 3GCNA 2Q6GA 4IMQA 1TX6A 2ZDNA 3LGWA 4AB9A 3TU7H 3AW1A 1FJSA 1WQSA 3ZZ6A 1VITG 2EI6A 3TH2H 1TWXB 5I46H 1SHYA 3M5NA 4MQAA 1LQEA 4WJG2 1WOFA 4AFZA 3SJ9A 2FXRA 2AH4X 4Y11E 3RXTA 1C2LA 1LTOA 1TRYA 1BDAA 5TCCA 1WQVH 4D76A 2XW9A 4D7GA 2ALVA 4FUEA 4ZHLU 2W5EA 4CH2B 5C5OA 4RN6A 1O30A 2A1DB 1K1JA 2GKVE 1B0FA 1VJAU 4UONA 1VR1H 2F9OA 1HRTH 3NWUA 3ZZ7A 1K22H 3UY9A 4BANB 1N8OC 1Z8IB 1OYTH 3M5OA 2ZFFH 2NU4E 1ELGA 2SGPE 2VB0A 2GP9B 3MU4A 3MU0A 1HCGA 1H8DH 4F4OC 2FPZA 4KTUA 1T8MA 2D26C 3I78A 3KN2A 1LVMA 1P12E 4UFEH 5ESTE 2J34A 5E0HA 1E35B 4CR9A 1CA8B 2ZGCA 5HM9A 1GG6B 1GBTA 1U6QA 1CT0E 3ELAH 4CRBA 1QJ6B 5HMAA 4GHQA 4TYDA 1GI0A 1IQIA 1W8BH 3P8OA 1G32B 5C1UA 1TGTA 3URCA 2I6SA 1K21H 1PQ7A 1GBBA 1AKSB 3AW0A 3OY6U 3G01A 1K28D 1FZZA 5J4SA 1OOKB 3NKKA 1HAVB 1NRSH 4X1QU 2J95A 3RXSA 1KYNA 4MLFB 1IQGA 1UVSH 1ZGVA 2CF8H 1DDJA 2FMJA 3SV2H 5PTPA 4CRCA 1V2VT 4IS5A 1PPZA 4BAKB 2FS9A 2BY7X 4NIXA 5FCKA 3QK1A 1C1WH 3HGPA 3RU4E 1AMHA 4Z6AH 1D6RA 1QJ1B 1JRSA 1O2HA 1TAWA 2J2UA 1HBTH 2PTCE 3RC5A 2WPIS 3SU1A 4CRFA 4NSYA 1GHBG 2AMQA 1DX5M 3KNXA 1GMDF 2ZI2H 1MAXA 4FUIA 3ZVDA 1XUIA 1JMOH 1BBRE 2RA0A 2D1JA 1V2OT 1MZDA 4MNWA 3A82A 4O3UA 2HOBA 3U9AH 4FUFA 2R3YA 1C4Y2 3RM0H 1TX7A 2C8WB 1TQ0B 2RCEA 2PWXA 4YT7H 2AMDA 3K6YA 4CRAA 2Y7ZA 1GMCF 3OSYA 1Z8JB 4X6MA 5A0AE 5CMXH 1P05A 2W7SA 2P3FH 4ZKOU 4MNYA 4ZH8A 3A8DA 4FXGH 5EW2H 3NUMA 4VGCC 4WH8A 2Z9KA 1WAYB 3AAUA 1ZRKA 1IQMA 3FZDA 1X7AC 3BTWE 4YOGA 1SPJA 3RXIA 1BMLA 3MU8A 1GDQA 1T32A 2R2WU 1GVLA 2AFQB 1PQ8A 1F2SE 1QY6A 4Q2KA 1BRCE 3TJUA 2H9HA 2G55A 1C5SA 1GI8B 4DOQA 1QQ4A 1TBRH 2BXUH 1SQOA 3MNBA 3ZZ4A 1CSOE 2BB4A 5IYTA 2STBE 2Y5GA 1WU1A 3TPIZ 5DJ7A 4YESB 2H2ZA 5JB8S 2ZNKH 3F6UH 2VVUA 1CE5A 2ZU3A 1NROH 1MU8B 3PWBA 1LMWB 1DY9A 1TB6H 1P2IA 2AEIH 1SG8B 3KQBA 1G3BA 1YPLH 4XSKU 4AOQA 1IQHA 2BY9X 4ISNA 3PYHA 4WMEA 3A85A 3K9XB 4NGAH 3MFJA 2FOHA 2VIOA 6CHAB 2HLCA 2SNVA 2GCTB 1MD8A 1KSNA 1GI2A 1TIOA 1GJDB 2UUJB 3MHWU 4X2XA 1V2JT 2IJOB 4Y71A 4AGJA 2PSYA 4Q7XA 1SHHB 1FN8A 1QBNA 2VIVA 1AIXH 1QBOA 3C27B 4NZLA 1J14A 1O3LA 1YPHC 5DP3A 5F03A 5DPAA 1ANBA 1BA8B 3UFAA 1EJMA 3ATIA 3D62A 1NRQH 4FUDA 3N7OA 1W2KH 1HXEH 1NT1A 1UTPA 4JK5A 5DGJA 2XC0A 1FIWA 2ALPA 3RXUA 3IG6B 2B0FA 2G81E 4ZXXH 1ELCA 2ZU4A 1UK2A 3BTEE 1LVYA 1C2GA 1ABJH 1NFUA 4BAQB 1GVKB 3W95A 1EZQA 1RXPA 4A5TS 5TCAA 2WPKS 1G37A 1BBRH 1GJ7B 4K1TA 3IWMA 3UIRA 3QDZB 3ZVEA 3T62A 3SBKA 5JDUB 2AGIX 1F0RA 1GI4A 2HNTE 2ZKSA 3RXVA 2Z3EA 1GHVH 2CXVA 5C67A 3SUDA 3ZYDA 1B7XB 4D8NA 2F3CE 1GJ6A 1UTQA 2G52A 1ORFA 3LOXA 3M3SA 1P11E 2GZ9A 3KQDA 1MUEB 3STIA 4KP0A 3EAJA 5LPFA 1DICA 3M3VA 4K8BA 3ZZCA 1AUJA 1G2LA 2R3UA 1FY5A 3LGYA 3V7TA 1O39A 5ESBA 1XUGA 2P94A 3TIUA 1GI3A 2QC2A 1O5CB 1GGDC 4B73A 4CRDA 1TA2A 1Y3UA 4X0WU 1PPHE 3KHVA 2ZF0H 2ODPA 3PMAB 2OP9A 3PMBB 1C1RA 2FYRA 1WSSH 1ZYOA
chains in the Genus database with same CATH superfamily
1C1SA 1F0UA 2ZZUH 3UWIA 2ANYA 3SV6A 5HGGA 3AAVA 4A7IB 2OINA 5DKMA 2XCNA 3F2FA 2SGQE 1SFQB 1SVPA 4I32A 5DP7A 1W7GH 2A45B 4JZIA 1UTLM 1G3DA 1MMJN 3JZ2B 1TGCA 3SUEA 8ESTE 2UUYA 3VXFH 3AASA 1ESAA 2GZ7A 1ELEE 2C3SA 4U30A 1O2YA 4YLQH 1EOJA 3SNBA 1K1LA 3UNQA 3MNSA 1BBRK 2AIPA 1K2I1 1K1PA 1PJPA 1EB1H 2YNBA 4CHAB 3P70B 2RDEA 6GCHG 1NRPH 2UWOA 1DANH 1LKBA 1T7CA 4NG9H 3HGNA 1UK4A 3MO9A 2GDEH 3EGKH 4MPXA 2GCHF 5EG4A 3ATWA 4ABHA 4UFFH 2TBSA 1YLCA 3FAOA 2AMPA 1ZR0A 1TNJA 2R0LA 2WUBA 5EJLA 1VITH 4KTSA 3WWBA 1AVXA 1NFYA 2WUCA 4ACAA 1AFQB 2J9NA 5FX6A 3SU2A 4R0IA 3UTUH 4FUGA 1S6FA 2ANKH 1KLTA 4P00A 1FY1A 1HAGE 1D6WA 5HM2A 3RXGA 1H9HE 5JBBS 1SLUB 3WY8A 1B5GH 3KYFA 1QQUA 2QXIA 4B75A 2TPIZ 1PPCE 2Z94A 1O2TA 2F43B 4DG4A 2J98B 1MTNB 2NU0E 2QYIA 2CF9H 1C4U2 3BTFE 3LH1A 2XOKD 5ETXA 4I7YH 1RS0A 5G4BA 1C9TA 1OP8A 3P6ZB 1ZPZA 2WINI 2HRVA 4THNH 1E36B 1GI5A 1O3OA 2VH6A 5L6NH 2L74A 2R2MB 2KCOA 1IOEA 1MU6B 2OC7A 4Y10E 3C1KA 1EPTB 3QUMP 3SJKA 2BD8A 4LXBH 1VZQH 7KMEH 1KDQB 8GCHG 2AERH 1EP6A 2B9LA 2FI5E 4I86A 1O2GH 2A7JA 4B76A 1P3CA 4IW4E 3LPRA 3O8RA 1IAUA 4AG1A 2O8WA 1KY9A 2RG3A 3BIVH 1PYTC 1V2ST 3ZIAD 3MU5A 2O8LA 4YZUA 1XUJA 1O5GH 2ZTYA 1P10A 1E1QD 5F8ZA 1BJUA 1KDQA 3L33A 1GCDA 3M5MA 3PWCA 3UNSA 4GHTA 3LC3A 2BX3A 3I29A 3MNXA 3F0OA 1OP0A 2QN5T 2AS9A 1GWAA 4XRNA 3UOPA 3A7YA 2BY6X 4NA7A 2HNTF 2G8TA 1Y3WA 2CHAB 4OS2A 1UCYE 1FXYA 1K0HA 4E7RG 1KXDA 4H6SB 4INKA 1DUAA 1H9IE 1S85A 3SJOA 3NCLA 4A92A 4FUJA 1AE8H 1BTWA 4NIYA 5I25A 3MH7A 1FPCH 3ZZDA 1EFRD 4ABEA 5TJXA 1GBJA 1Z6JH 1BCUH 2M5TA 3TITA 1O3BA 2GMTB 3ZVAA 3PLPA 4AFQA 4IBLH 1QRZA 5FX5A 6LPRA 3OYPA 2EI8A 3SU3A 3U1IB 2ZCHP 4IN2A 5EXLA 4JK6A 2ZG0H 1GJ8B 1QL7A 3RXJA 4Q7ZA 1O5DH 2GVFA 2H1UA 1F92A 5B6OA 2BQ7B 1C1VH 4TWWA 3M61U 1AKSA 1DPOA 2FWWA 3KCGH 4WWYA 2VH0A 1O3AA 4Q80A 1TNHA 3AK5A 1BITA 1WBGB 1ZOMA 2Z3DA 1C2DA 2F9NA 3BF6H 3SI4H 5C20A 1SGPE 3TVJB 4TPIZ 3ZZBA 3H7TA 2AIQA 4B2CA 1TPAE 3VB3A 1AI8H 4ZKNU 4H4FA 4X6PA 3KQCA 1YPMH 1TE0A 2WYGA 3VXEH 1NM6A 3CP7A 3V12A 1THSH 1P09A 3BTME 3BIUH 3SGBE 3BEIB 4NSVA 1YLDA 3GY4A 1FY3A 2BZAA 1G3CA 2XRCA 3EA7A 4U2WA 1LHGH 5AFZH 1HAHH 2DE9A 1MTVA 3PO1B 4AFUA 2PGBB 4WY3A 4IC6A 3S69A 1OSSA 1OWEA 3VGCB 1YPJH 2FOMB 2EI7A 4FVDA 4GUXA 4AGKA 5F6MA 1YBWA 2XBYA 3P92A 1DLKB 5C2ZA 2XNIA 3RXEA 1IHTH 3V0XA 1GJ9B 5E2PA 1LPZB 2ZA5A 2XNDD 4ABFA 7ESTE 1H8HD 1OWIA 2IPQX 4CR5A 1IHSH 2W7UA 5EOKA 2OC8A 5GJ4B 8GCHF 2J97A 1YCPM 1NRRH 1C1MA 2QXJA 3UR6A 2JJ1D 4ZHMU 1P0SH 2A31A 3U8OH 2BD7A 1SGYE 4B6FA 2OCVB 5DP9A 2PHBA 2ZU2A 1PPEE 1ACBE 5HYOA 2ZTXA 3HK3B 2ZIQH 1K9OE 1G9IE 1BJVA 1RGQA 2B5TB 1ZHPA 3DSGA 4YTAA 3ATMA 1QZ8A 1UVUH 3ZZ8A 1T8LA 5DP6A 1CBWB 3SJIA 2DE8A 2RA3A 1KXBA 1EATA 1EAXA 2FEQH 1V2KT 4WXIA 2BVSH 1C5YB 1EJAA 2ZHQH 4HTCH 3RU4T 1WCZA 2G4TA 3BTTE 3T5FH 1O5EH 1ETSH 4JYTA 1P2KA 3KIDU 3F9GA 2XYAA 2F83A 2ODYB 2AGGX 3RM2H 1DWDH 1G36A 1TMUH 3A7ZA 1IQNA 1O2SA 3VB6A 3SW2B 2Q1JA 1LKAA 4X2VA 1RJXB 3GY7A 2BTCE 2CK3D 2WPJS 2G4UA 1RTLA 3LC5A 3RC6A 1O2ZA 4X2WA 1SMFE 3RXKA 2XTTB 1QBVH 3KQEA 5K7RA 5GXPA 1N6YA 2W3IA 1GMHG 4KKDA 4R8TB 2FLRH 1F5KU 3RXOA 5DO4H 3OE7D 1A5GH 1BUIA 2FIRH 1THRH 3TJVA 1AZZA 5IK2D 2CJIA 3A7XA 2ZDKA 1FONA 2FOCA 3CS7A 1HDTH 1UJ1A 3M35A 4CBOA 2VIQA 4YM9A 1Y8TA 1PPGE 3R0FA 4A1TA 1C5XB 4FU8A 1HAIH 1EX3A 4OS1A 4ABDA 1VCPA 1HJAB 2YMSD 2BD3A 3T2NA 4A6LA 2ZFQH 4X1SU 1F0SA 6CHAC 1OWJA 3W94A 1H9LB 1CT2E 1LHFH 4HFPB 2W6ID 1EOLA 1UO6A 5EPYA 1ELAA 1YWUA 1ZMLA 1RRKA 2Z9IA 3LGTA 3VPKA 2B8OH 4JZDH 2EQNA 1NU9A 1HB0B 1BMMH 3RXAA 1GBFA 2J92A 4ZUHA 2Y7XA 1WDIA 1PPBH 3A7WA 3WWFA 3O8DA 3VG8A 1OWHA 5JBCS 1O2LA 2PUXB 1TOCB 1CQQA 2P8OB 1A5IA 4A1VA 3GY6A 1AN1E 1OHHD 2V6NA 4MPVA 3MYWA 4TY7A 3QZQA 3UAIC 2FM2A 5KEDA 3VB7A 4X8SH 1ARCA 1C5PA 4OGYA 1EAUA 4X2YA 3L3TA 2FOBA 4DW2U 1EAWA 4I8GA 1VITF 3QZRA 3TLOA 1DWBH 3SNEA 3MI4A 2P93A 1BHXB 3RXHA 1HUTH 4OS4A 2QY0B 2YMSB 1C2IA 4JZEH 4QT8C 4B74A 4WXVA 2Y5FA 1EB2A 1V2TT 2BDIA 4UD9H 1KIGH 3E6PH 5EIYA 5LH8A 1S81A 1DVAH 5LGOA 1YF4A 1ARBA 3KQ5A 3EE0B 3SJ8A 1UTOA 1KTTB 1PYTD 1P2QA 1W0KD 4NA9H 3KYGA 3SN8A 5KGOA 2FI4E 3UQOA 1TYNA 2NWNA 3STJA 1BB0B 4SGBE 4E05H 2Z7FE 3SQHE 1N1LA 1O3DA 3S9BA 5JBTA 1GJCB 1CO7E 2GCTC 2L6OA 3SOSA 2UWPA 1YKTA 2JKHA 1M9UA 5B6LA 1TPPA 2HWLB 3TGIE 3B8JA 3FN8A 4U01A 1TGNA 3AVZA 5L2ZH 4UE7H 3F9HA 2VIDA 3SNDA 3VGCC 4ESTE 2C4FH 3A8AA 3I77A 1PPFE 3DFJA 3PTNA 4BNRA 1DXWA 3SORA 1MBMA 2KR7A 2ZU5A 3M7UA 4F55A 3DA9B 1ZLRA 2PKAA 3RXDA 4FU9A 1NPMA 3GY2A 3S9AA 2XBVA 1A4WH 4Y6DA 3SNCA 1GI1A 1GMHF 5EW1H 1GCTC 1Q31A 4I8KA 5C17A 1D3DB 2ZGJA 2V0BA 1HAOH 4B2AA 1Y3XA 4BAMB 5A8ZA 2FYQA 1CGIE 1BOQA 3A8CA 1SGTA 2O8UA 2C8YB 1AHTH 4HGCA 2RDLA 3GCHC 4CH8B 4ZHAA 4DGJA 4IGDA 1S84A 1O3JA 5DK1A 4B71A 2Y6TA 1SOTA 3E16B 4DVAU 2SFAA 1IQFA 1GGDB 3H7OA 3RP2A 4ISHH 1EZXC 1WUNH 3FVFB 3SV9A 5T3HA 5FL7D 1UTJA 3MQKC 3MWIU 1J17T 3Q3KA 1Q2WA 1HV7A 1T8OA 2XCFA 1MKXK 1XUFA 1KXAA 4X1PU 5ABWA 1FNIA 4GCHF 1BHXF 2K1QA 1O2XA 5FHTA 1ZTKA 3U69H 2JDID 4ABIA 1T8NA 2ZGHA 1C2FA 1TMTH 1A7SA 1W0JD 1O5AB 4DT7B 5C5NA 4FUHA 1FV9A 1GBKA 2QCYA 5GCHG 5AF9H 1GJBB 2H6MA 2PFEA 1GBAA 2VWMA 1Y3YA 2ZFSA 1F5LA 1W3CA 1IQJA 1DWEH 5DG6A 3N7EA 3HKIB 4LZ4B 1FUJA 2OC0A 4ACBA 4NA8A 2TGDA 1GI9B 2FODA 2ZPQA 1UTNA 1ANDA 1UCYH 1VCQA 3TJNA 1RTKA 2A0QB 7LPRA 5A09A 2BD5A 2BX4A 3NPSA 1QB6A 2ZDVH 2PP6A 3P8NA 4GAWA 3A80A 5CDFE 3UB0A 3RXRA 4NIVA 4ZCNA 3BSQA 4FVBA 3SZEA 1DS2E 1D3QB 3U1JB 2OXSA 4GVUA 2SGFE 3F0PA 3MO3A 3O8BA 5DN6D 1Q3XA 3RMLH 3KL6A 3SV7A 1OS8A 1P2MA 1L1JA 1YM0A 1ELBA 1W13U 2I6QA 2V35A 3NXPA 3SI3H 3PV4A 4YO9A 3GY8A 3BG4B 5EQSA 1GBDA 2O8TA 1GHAG 1YP9A 3WW7A 2BOHB 1XKAC 1NTPA 1NFWA 3T26A 1XMNB 4INHA 1YGCH 1KLJH 1O38A 2OBOA 2ODQA 1GI7B 1XM1A 3E0NB 2G00A 1HJAC 5BPEA 2QF3A 1FMGA 1O2VA 3T25A 5LPRA 4TY6A 1DE7H 2TGAA 3V3MA 1GPZA 3MMGA 1Z8GA 1ANCA 1DXPA 1HAVA 4ISOA 3TGKE 2Z9GA 3LGUA 5EXMA 2YMSC 1SLVB 1JOUB 2BQWB 1CA0C 2OLGA 2Z3CA 2GD4B 1SOZA 1K1IA 4FETA 5AFYH 1L1GA 1QB1A 1C5LH 2D2DA 3MH6A 1C5WB 3TH3H 1A3BH 1AB9B 2BLVA 1MQ5A 3BTKE 2ZQ1A 3PRDA 5E0GA 1A0LA 3Q77A 4M9FA 3TNTA 5C3NA 3SNAA 1MBQA 1XUKA 4AZ2B 2A5AA 1GBCA 3BTGE 1JWTA 1QCPA 3RUOA 4F48B 3LGVA 3O8CA 3PM3A 2A32A 3Q00A 3EDXB 1ZSJA 1MTWA 3A88A 1YC0A 4NIWA 1GDUA 2P8OC 4OGXA 3SU5A 3JZ1B 3P17H 3SHCH 3M3TA 3U28C 2FX6A 2VWNA 1S6LA 3RXLA 3T28A 1FIZA 2HNTC 1TPSA 4F49A 1Y5BT 1JIRA 3F3BA 4OS5A 5EQQA 3SGQE 3SU0A 5A2MH 1O5FH 3VB5A 4TT3D 5T6DA 1ZTLA 3A83A 5EPNA 1QL9A 4U32A 2GMTC 4O03A 2ZGXH 4HI3A 4Z0KA 1O3KA 2LPRA 2XC5A 3EQ0H 3MOCA 2KAIA 2GX4A 2F9BH 1L2EA 3OX7U 3S0NA 1C5MD 2TRMA 1RTFB 3HATH 2CMYA 2FS8A 2QE7D 5FXLA 1L4ZA 3VB4A 4BXSA 1ABIH 2ZECA 1C5UA 1HGTH 1TGBA 3RXPA 2DUCA 5GPIB 2THFB 3FKSD 3IITA 1AO5A 3SU4A 1DM4B 4GLYA 1C5QA 4X8VH 5A8XA 4AG2A 1DFPA 2BDAA 1O2JA 2C8ZB 1QRXA 2FZZA 1O33A 1SFIA 3F9FA 3URDA 5DP4A 2G51A 2BMGB 1SGCA 3F2GA 1INCA 3RMMH 4O3TA 3U98H 7GCHF 1GJ5H 3OAAD 5FPSA 1XX9A 2A2XH 4UFGH 3FP6E 3B23B 3GYMA 3RDZA 5A0CA 3A7VA 1J15A 1O3MA 1MTUA 1GHZA 1UVOA 1WYKA 1YPKH 1GDNA 3B9FH 2ZEBA 4I8JA 1E37B 1FAXA 1HYLA 1QNJA 3ZZ5A 4BXWA 5AVDA 2H9EH 1V3XA 1VGCC 4X6NA 4ZROA 3A7TA 1OX1A 1GHAF 3MU1A 2H9TH 1BTHH 2BZ6H 4DT4A 3LJJA 3U8TH 1L1NA 1ZJKA 1ELVA 2A2QH 3PRBA 2GGVB 1GG6C 2W26A 2ZQ2A 1P2OA 1J16A 3LH3A 4CHAC 3UPEA 3E8LA 1Y3VA 4X1NU 2XBWA 4XDEA 1XKBC 2BDBA 2WSSD 3S9CA 2FOGA 1FPHH 1OP2A 4J2YB 3LKWA 1ELTA 1RD3B 1O3HA 1WTGH 1GBLA 2SGAA 2WPLS 4BTIB 1EP5A 3QO6A 1P03A 3TJOA 1EPTC 3ZVGA 1GBEA 2ASUB 4X1RU 1ELDE 2BDCA 1FDPA 2FESH 2BD2A 3UQVA 1H8IH 1MTNC 1UHBB 3KF2A 2J94A 3FFGA 1SC8U 4K60A 4KELA 4Q7YA 1HXFH 2BLQA 1GI6A 1H8ED 1SR5C 1O2QA 4HZHA 1K1NA 5EXNA 2BM2A 2V3HH 1EZUC 3A89A 4H6TA 2FOEA 2OBQA 3F1SB 4TPYA 4DURA 4GSOA 5DP5A 2ZFRH 1PQAA 2KX4A 3SGAE 1P2JA 4H42U 1CGHA 4IMZA 2VU8E 1AFQC 1BTUA 1AWHB 1C2HA 4FUBA 5J4QA 1HAYB 1NO9H 4MG3A 1YYY1 1TLDA 1GVZA 3M36A 3PROA 3GS9A 1ETTH 5FBEA 1C1NA 1MKXH 5A0BA 1NS3A 3LIWA 2D8WA 5K0HA 2VIPA 4OS7A 5DSFA 3T27A 4CBNA 2FDAA 3H09A 1KMHB 5FPYA 1DT2A 1COWD 1J9CH 2KFWA 1S0RA 4ZKRU 4XD7D 4RSPA 2R9PA 3PMJA 4ZKSU 1DOJA 1JBUH 1G3EA 2XBXA 4X6OA 3SZNA 3Q76A 2BYAX 3UWJH 3EA9A 2QGRA 3E90B 3T29A 4AORA 2QV1A 3QGJA 1P9UA 4AFSA 1LQDB 4AN7A 1JRTA 5SGAE 1UK3A 2HGTH 1OYQA 2VWOA 1CGJE 1V2MT 2PV9B 5H4IB 3MO6A 3SV8A 2A7HA 1NESE 1D3PB 2A7CA 3F68H 3ZVFA 3E91A 2OC1A 4MNXA 3R3GB 1MKWH 3QGNB 5BRRE 1UW7A 1S82A 5CHAB 1BMNH 4UEHH 2NU3E 2P3UB 2GDDA 1OWKA 1AFEH 1HLTH 4FOUC 1C5ZB 1AD8H 1LDTT 1P57B 3ZZAA 2WPMS 1A2CH 3TH4H 1BTZA 5T1VA 2V7QD 3TK6A 1LO6A 1W11U 1C4V2 4RKOB 1BTPA 4YLUA 4BTUB 4IN1A 2XXLA 1ZRBA 4D7FA 1SQTA 1O3FA 1QRWA 3SQEE 3E0PB 3ZVCA 1BMAA 3BN9A 2BDHA 1F5RA 3N7DA 4MNVA 1QTFA 4XBDA 3HKJB 1EAIA 1HPGA 4AX9H 2JH6D 1OWDA 3TK9A 1AB9C 1V2PT 2Z9JA 5FBIA 1E34B 5AHGH 1A0HB 9ESTA 1WXRA 1ZPCA 2PTNA 4DIIH 4O9VA 1O36A 4P02A 1WV7H 3QTVH 1C1PA 1QGFA 1VCWA 3GCOA 1HJ8A 2SGDE 3P8FA 1QURH 1E0FD 3NK8A 1RIWB 4Q63A 3UREA 4B6EA 4MPWA 1C5OH 4B1TA 2GJGA 1GL1A 2AHME 4O97A 4ABGA 1GBIA 4ISLA 1HJ9A 1YPGH 1TPOA 3S7HB 1A3EH 2BOKA 2QA9E 3VFEA 3M5LA 5IDKA 3GOVB 2NU1E 2HPPH 3LT3A 4CREA 2HVYB 4AYVB 1ZSKA 1UCYK 1MCTA 1PQ5A 1DSTA 2Z9LA 5C1YA 4MTBA 1DITH 4JZFH 2KCPA 1BTXA 2FTLE 2PW8H 1AU8A 4NWKA 1XXFA 1LHDH 1H1BA 3ZZ9A 4ISIH 2QXHA 2VVVA 3UR9A 3QTOH 4K5ZA 2Y81A 3BG4C 4ABBA 3NZIA 1DWCH 2ZFTA 3ATLA 1O2MA 3L6PA 1GBMA 3F9EA 4RKJB 3EYDA 1HAPH 2B7DH 3KEEA 3BTQE 1BRBE 1PFXC 2ZP0H 1N6XA 1AVWA 3CENA 4YT6H 2A4RA 3OTPA 5DP8A 1QFKH 3ITIA 5KECA 2AGEX 1GHWH 5JPMH 2WV9A 1HIAB 1O3CA 1TFXA 3E3TA 2KM0A 4Y79A 5A8YA 3P8GA 1BT7A 2HPQH 4JYVH 1Y5AT 4ASHA 1QR3E 3SYJA 4RT0A 2P95A 3RXBA 1CA0B 3TK5A 1C1TA 1TQ7B 2F9PA 1S6HA 3EA8A 5LPEA 3GY5A 1SLXB 3OEED 3GYLB 4LZ1H 1YPHE 2VJ1A 3P95A 5T6FA 2ANWA 1NRNH 1THPB 4K69A 1LCYA 1SGDE 3LU9B 1O35A 4VGCB 1CVWH 1OPHB 2Q6FA 2O8MA 4XBBA 2C93B 1GHYH 1AUTC 1O3IA 2OTVA 3BEUA 1XUHA 1XVMA 1A5HA 1V2WT 1W12U 2ESTE 2PKSB 3A84A 3KGPA 1O2RA 1C1QA 2VWLA 4IC5A 1O3PB 1YCPK 4NCYA 1OXGA 1EPTA 1HFDA 1QL8A 3GCHB 4TWYA 4DCDA 2A5KA 3LGIA 4JCNA 4I8HA 4XFQA 4AB8A 2J4IA 2Y5HA 2Q6DA 5GDSH 4UFDH 1HIAA 1TONA 1SB1H 3OU0A 1SI5H 1O34A 3CS0A 3TGJE 4JYUH 2G5NA 1A61H 1BQYA 1O0DH 2BDYA 3PLKA 5EJ1A 2ZU1A 2C8XB 2ZCKP 1W0ZU 1ZSLA 3SUFA 1TNKA 1ID5H 3M7TA 2EEKA 4Y7AA 5EQRA 1TNLA 1TNIA 2VGCC 1SGQE 2QAAA 1NFXA 2O9QA 2ZHFH 5EU8A 1VJ9U 1G30B 4MVNA 1C2MA 5GIBA 3BG8A 2H5CA 3A87A 7GCHG 3ATKA 5E8EH 3ZV8A 3SO3A 1GBHA 2KCYA 1NZQH 1WTHD 4K1SA 4OM9A 1CBWC 2BDGA 1TX8A 1Z6EA 1AGJA 4DY7B 4ZAEA 2PSXA 4HG6A 3BV9B 5JB9S 3RXCA 1V2UT 3GDUA 1ZHRA 2FP7B 2ZHDA 1GJ4H 2PLXA 2FO9A 1NC6A 4Y8ZA 1B0EA 2C90B 1C9PA 3FZZA 5CHAC 2EA3A 1W10U 2ZC9H 2VNTA 1EASA 5C0UA 2IOTA 1SGNE 2EC9H 2YOLA 3DUXH 1DUEA 1XXDA 1E1RD 3PTBA 1L0ZA 4E06H 1V2QT 4K3JA 1TBQH 6GCHF 1FQ3A 3DHKH 3QLPH 1F0TA 2WYJA 3A81A 1UMAH 3U8RH 2IPHA 2VVCA 1Z1IA 3DFLA 1O2IA 3RC4A 1H4WA 1TABE 2CN0H 1YCPH 1C5VA 4K1EA 1IQLA 1T4VH 3SUGA 3M7QA 1C5TA 3M37A 3ODDA 3Q3XA 1P01A 5JBAS 2FX4A 2WV4A 1QJ7B 4X8TH 4MDSA 3S7KB 3D23A 1Y5UT 3UNRA 3RU4D 2YNAA 4I33A 3RXQA 3RXMA 1TNGA 1DY8A 2ZDAH 1P8VC 1SQAA 3GDSA 1ZPBA 3TNSA 1ZHMA 1ESTA 2BXTH 1SSXA 2HALA 1K1MA 2ZHWH 3QN7A 1O2KA 2CGAA 9LPRA 1FN6A 1YY3A 2BY5X 3QX5H 1XVOA 1MCVA 2OQUA 4AYYB 1KXCA 1UVPA 3RXFA 1CT4E 4UDWH 1C5NH 1GJAB 3GY3A 1NBMD 3ODFA 3GISB 3ESTA 1ELFA 4XBCA 2PKSC 3RLWH 2TGTA 4PROA 2J98A 1V2RT 4B2BA 1OKXA 1SLWB 2WPDD 2CV3A 1O3EA 4ASUD 5CHBA 4X8UH 3RMNH 4K8YA 2M2AA 1KXEA 4NFFA 5CE1A 4GPGA 2BY8X 1O2UA 4D9RA 4OS6A 3QWCH 5E2OA 4AC9A 3DT0H 3SHAH 2A4QA 1O2PA 1BMFD 2GT7A 5FPTA 1JXPA 1N8OB 1EXFA 1RFNA 3A86A 4BTTB 3MH5A 2Y80A 5L30H 1TA6A 4WF8A 1RIWC 3ZV9A 3MTYA 4GCHG 1W7XH 2STAE 4BAHB 2NU2E 1GHBF 1KLIH 4TSFD 4WMDA 1D4PB 2PKAB 1GMDG 2ZO3H 3DCLA 1VGCB 2BVRH 1SQRA 3OEHD 4Q4LA 3SU6A 2A4OA 4XE4A 1A1RA 3EE7A 2R0KA 4FU7A 4Y0ZE 4JZ1A 1AE5A 2VINA 5GCHF 1LHCH 1SGIB 2F91A 3N99A 2VGCB 5F8TA 1GL0E 1QHRB 2JJ2D 4NFEA 1P02A 1AQ7A 1SBWA 1LPKB 3E1XB 4Y0YE 4Y8XA 5HXFA 2W3KA 2G5VA 3F2HA 4RT1A 3W1EA 1FY4A 3DD2H 2JH5D 2WPHS 4YOJA 1SGFG 3PB1E 2XWBI 1QB9A 1K1OA 1MH0A 1Z7KA 1P04A 2TIOA 1Z1JA 2TGPZ 2A5IA 4LOYH 1SL3A 3UUZA 1F7ZA 1TBZH 1SGEE 1SGRE 4I31A 1TRNA 2SGEE 3UOUA 1HNEE 4WVPE 4LK4A 1T4UH 4NZQA 4XOJA 3D49H 1C5RA 2ZDLA 1NU7B 3VEQB 3ENSB 1KXFA 2ULLA 1FY8E 1LVOA 1Y59T 1P3EA 2UUKB 2JIZD 2FTMA 2ANMH 4J1YA 1C2KA 2PGQB 4KTCA 1ZTJA 2BQ6B 1O2WA 1ESBA 4YOIA 2OK5A 1CU1A 4K2YA 3PMHB 5E0JA 4E7NA 3ZVBA 1AZ8A 3OTJE 2XWAA 1CHOF 1SGFA 1C1OA 1MAYA 1C2JA 1V6DA 3GCTF 1ZZZA 1GHXH 5F8XA 4ZXYH 3HK6B 1AY6H 1LHEH 4ZMAH 4ABAA 1O37A 3MNCA 4FUCA 2GTBA 2IN2A 2ZHEH 2JETC 1BRAA 1W0YH 2FI3E 1EZSC 2F9VA 1L4DA 4Y8YA 3BTDE 4WMFA 4CRGA 2H5DA 4WH6A 1TMBH 1CHGA 4KGAA 2BLOA 2LNCA 2J38A 2LP6A 1A46H 1Z71A 2UWLA 1FLEE 3H5CB 4JMYA 2BD9A 2FOAA 5FCRA 1A0JA 4DJZB 2BVXH 3V13A 2F9UA 2KZ4A 2LELA 3LONA 1ZJDA 1QA7A 4Z1MD 3Q3YA 1MQ6A 2PR3A 2A4GA 1W14U 2ZPRA 1QA0A 5JYIA 1C1UH 1MD7A 1O31A 1HAZB 1V2LT 3ZYEA 5FAHA 1S0QA 1O32A 2GZ8A 3GICB 2OUAA 1AVGH 1IQEA 1BIOA 1UTMA 2ZFPH 2FOFA 2HVXA 2PUQH 1KTSB 1D9IA 5L2YH 1FAKH 5EODA 3FP8E 4MPUA 1P06A 2ZDMA 5EGMA 2SNWA 1MKWK 1IQKA 2ZGBH 3GDVA 1C2EA 1ZMNA 1BZXE 2GV7A 1BTYA 4M7GA 1UVTH 2CHAC 8LPRA 3K65B 2QIQA 2V3OH 5C1XA 2QXGA 1NY22 1YLNA 1QIXB 2ZWLH 1ZGIA 1E38B 3PV2A 8KME2 1O2OA 2UUFB 3LDXH 2QF4A 3PLBA 1T31A 4RI0A 3D65E 2WV5A 2Y82A 2P3TB 1JIMA 1P2NA 1O2NA 3BTHE 2BHGA 2XC4A 1J8AA 2QF0A 3BEFB 1S5SA 3FO8D 2KAIB 3HPTB 1GCTB 1LVBA 3RMOH 1P9SA 2GV6A 2Z6BD 1BRUP 4NWLA 1EKBB 1NN6A 1O5BB 4BOHA 1GMCG 1V2NT 1ANEA 1HAXB 1TOMH 2FLBH 4I8LA 2AYWA 1TALA 2OD3B 5GWZA 1D3TB 1EJNA 2VIWA 3ZZ3A 5T6GA 4Y7BA 4SGAE 4Y76A 2P16A 3MH4A 1Z8RA 1DSUA 1G2MA 2VBCA 6ESTA 2WHXA 3LJOA 1UHBA 1LPGB 2ZTZA 4ABJA 1EQ9A 3K6ZA 1SKYE 1ZMJA 1AWFH 1DLEA 3OY5U 2ZPSA 1CHOG 2GT8A 1EUFA 3RLYH 3FP7E 3FANA 3A8BA 1S83A 3GCTG 1UTKA 1MTSA 1YPEH 4INLA 1TGSZ 2F4LA 2JH0D 4DIHH 2GCHG 4D9QA 1FI8A 4A1XA 1O3NA 1O3GA 4BAOB 5HIYA 2ILNA 3DSOA 2P59A 2QF5A 1MZAA 3PO1C 2JETB 2OQ5A 3K2UA 1TRMA 1ETRH 2BLWA 2BD4A 2ZCLP 3GCNA 2Q6GA 4IMQA 1TX6A 2ZDNA 3LGWA 4AB9A 3OFND 3TU7H 3AW1A 1FJSA 1WQSA 3ZZ6A 1VITG 2EI6A 3TH2H 1TWXB 5I46H 1SHYA 3M5NA 4MQAA 1LQEA 4WJG2 1WOFA 4AFZA 3SJ9A 2FXRA 2AH4X 4Y11E 3RXTA 1C2LA 1LTOA 1TRYA 1BDAA 5TCCA 1WQVH 4D76A 2XW9A 4D7GA 1E79D 2ALVA 4FUEA 4ZHLU 2W5EA 4CH2B 5C5OA 5EJZA 2V3MA 4RN6A 1O30A 2A1DB 1K1JA 2GKVE 1B0FA 1VJAU 4UONA 1VR1H 2F9OA 1HRTH 3NWUA 3ZZ7A 1K22H 3UY9A 4BANB 1N8OC 1Z8IB 1OYTH 3M5OA 2ZFFH 2NU4E 1ELGA 2SGPE 2VB0A 2GP9B 3MU4A 3MU0A 1HCGA 1H8DH 4F4OC 1VKYA 2FPZA 4KTUA 1T8MA 2D26C 3I78A 5GNDA 3KN2A 1LVMA 1P12E 4UFEH 5ESTE 2J34A 5E0HA 1E35B 4CR9A 1CA8B 2ZGCA 5HM9A 1GG6B 1GBTA 1U6QA 1CT0E 3ELAH 4CRBA 1QJ6B 5HIZA 5HMAA 4GHQA 4TYDA 1GI0A 1IQIA 1W8BH 3P8OA 1G32B 5C1UA 1TGTA 3URCA 2I6SA 1K21H 1PQ7A 1GBBA 1AKSB 3AW0A 3OY6U 3G01A 1K28D 1FZZA 5J4SA 1OOKB 3NKKA 1HAVB 1NRSH 4X1QU 2J95A 3RXSA 1KYNA 4MLFB 1IQGA 1UVSH 1ZGVA 2CF8H 1DDJA 2FMJA 3SV2H 5PTPA 4CRCA 1V2VT 3PV5A 4IS5A 1PPZA 4BAKB 2FS9A 2BY7X 4NIXA 5FCKA 3QK1A 1C1WH 3HGPA 3RU4E 1AMHA 4Z6AH 1D6RA 1QJ1B 1JRSA 1O2HA 1TAWA 2J2UA 1HBTH 2EY4C 2PTCE 3RC5A 2WPIS 3SU1A 5C0TA 4CRFA 4NSYA 1GHBG 2AMQA 1DX5M 3KNXA 1GMDF 2ZI2H 1MAXA 4FUIA 3ZVDA 1XUIA 1JMOH 1BBRE 2RA0A 2D1JA 1V2OT 1MZDA 4MNWA 3A82A 4O3UA 2HOBA 3U9AH 4FUFA 2R3YA 1C4Y2 3RM0H 1TX7A 2C8WB 1TQ0B 2RCEA 2PWXA 4YT7H 2AMDA 3K6YA 4CRAA 2Y7ZA 1GMCF 3OSYA 1Z8JB 5F53A 4X6MA 5A0AE 5CMXH 1P05A 2W7SA 2P3FH 4ZKOU 4MNYA 4ZH8A 3A8DA 3NRLA 4FXGH 5EW2H 3NUMA 4VGCC 4WH8A 2Z9KA 1WAYB 3AAUA 1ZRKA 1IQMA 2W6JD 3FZDA 1X7AC 3BTWE 4YOGA 1SPJA 3RXIA 3FOAA 1BMLA 3MU8A 1GDQA 1T32A 2R2WU 1GVLA 2AFQB 1PQ8A 1F2SE 1QY6A 5C94A 4Q2KA 1BRCE 3TJUA 2H9HA 2G55A 1C5SA 1GI8B 4DOQA 1QQ4A 1TBRH 2BXUH 1SQOA 2KCAA 3MNBA 3ZZ4A 1CSOE 2BB4A 5IYTA 2STBE 1WU1A 2Y5GA 3TPIZ 5DJ7A 4YESB 2H2ZA 5JB8S 2ZNKH 3F6UH 2VVUA 1CE5A 2ZU3A 1NROH 1MU8B 3PWBA 1LMWB 1DY9A 1TB6H 1P2IA 2AEIH 2IJD1 1SG8B 3KQBA 1FX0B 1G3BA 1YPLH 4XSKU 4AOQA 1IQHA 2BY9X 4ISNA 3PYHA 4WMEA 3A85A 3K9XB 4NGAH 3MFJA 2K8IA 2FOHA 2VIOA 6CHAB 2HLCA 2SNVA 2GCTB 1MD8A 2K0QA 1KSNA 1GI2A 1TIOA 1GJDB 2UUJB 3MHWU 4X2XA 1V2JT 2IJOB 4Y71A 4AGJA 4YXWD 2PSYA 2WZQA 4Q7XA 1SHHB 1FN8A 1QBNA 2VIVA 1AIXH 1QBOA 3C27B 4NZLA 1MABB 1J14A 1O3LA 1YPHC 5DP3A 5F03A 5DPAA 1ANBA 1BA8B 2HLDD 3UFAA 1EJMA 3ATIA 3D62A 1NBME 1NRQH 4FUDA 3CNRA 3N7OA 1W2KH 1HXEH 1NT1A 1UTPA 4JK5A 5DGJA 2XC0A 1FIWA 2ALPA 3RXUA 3IG6B 2B0FA 2G81E 4ZXXH 1ELCA 2ZU4A 1UK2A 3BTEE 1LVYA 1C2GA 1ABJH 1NFUA 4BAQB 1GVKB 3W95A 1EZQA 1RXPA 4A5TS 5TCAA 2WPKS 1G37A 1BBRH 1GJ7B 4K1TA 3IWMA 3UIRA 3QDZB 3ZVEA 3T62A 2J5UA 3SBKA 5JDUB 2AGIX 1F0RA 1GI4A 2HNTE 3DSPA 2ZKSA 3RXVA 2Z3EA 1GHVH 2CXVA 5C67A 3SUDA 3ZYDA 1B7XB 4D8NA 2F3CE 1GJ6A 1UTQA 2G52A 1ORFA 3LOXA 3M3SA 1P11E 2GZ9A 5HKKD 3KQDA 1MUEB 3STIA 4KP0A 3EAJA 5LPFA 1DICA 3M3VA 4K8BA 3ZZCA 1AUJA 1G2LA 2R3UA 1FY5A 3LGYA 3V7TA 1O39A 5ESBA 1XUGA 2P94A 3TIUA 1GI3A 2QC2A 1O5CB 1GGDC 4B73A 4CRDA 1TA2A 1Y3UA 4X0WU 1PPHE 2RFKC 3KHVA 2ZF0H 2ODPA 3PMAB 2OP9A 3PMBB 1C1RA 2FYRA 1WSSH 1ZYOA
chains in the Genus database with same CATH topology
1C1SA 1F0UA 2ZZUH 3UWIA 2ANYA 3SV6A 5HGGA 3AAVA 4A7IB 2OINA 5DKMA 2XCNA 2SGQE 1SFQB 1SVPA 4I32A 5DP7A 1W7GH 2A45B 4JZIA 1UTLM 1G3DA 1MMJN 3JZ2B 1TGCA 3SUEA 8ESTE 2UUYA 3VXFH 3AASA 1ESAA 2GZ7A 1ELEE 2C3SA 4U30A 1O2YA 4YLQH 1EOJA 3SNBA 1K1LA 3UNQA 3MNSA 1BBRK 2AIPA 1K2I1 1K1PA 1PJPA 1EB1H 2YNBA 4CHAB 3P70B 6GCHG 1NRPH 2UWOA 1DANH 1LKBA 1T7CA 4NG9H 3HGNA 1UK4A 3MO9A 2GDEH 3EGKH 4MPXA 2GCHF 5EG4A 3ATWA 4ABHA 4UFFH 2TBSA 1YLCA 3FAOA 2AMPA 1ZR0A 1TNJA 2WUBA 2R0LA 1VITH 4KTSA 1AVXA 1NFYA 2WUCA 1AFQB 2J9NA 5FX6A 3SU2A 4R0IA 3UTUH 4FUGA 1S6FA 2ANKH 1KLTA 1FY1A 1HAGE 1D6WA 5HM2A 3RXGA 1H9HE 5JBBS 1SLUB 3WY8A 1B5GH 1QQUA 2QXIA 4B75A 2TPIZ 1PPCE 2Z94A 1O2TA 4DG4A 1MTNB 2NU0E 2QYIA 2CF9H 1C4U2 3BTFE 3LH1A 5ETXA 4I7YH 1RS0A 5G4BA 1C9TA 1OP8A 3P6ZB 1ZPZA 2WINI 2HRVA 4THNH 1E36B 1GI5A 1O3OA 2VH6A 5L6NH 2R2MB 1IOEA 1MU6B 2OC7A 4Y10E 3C1KA 1EPTB 3QUMP 3SJKA 2BD8A 4LXBH 1VZQH 7KMEH 1KDQB 8GCHG 2AERH 1EP6A 2B9LA 2FI5E 1O2GH 2A7JA 4B76A 1P3CA 4IW4E 3LPRA 3O8RA 1IAUA 4AG1A 2O8WA 1KY9A 2RG3A 3BIVH 1PYTC 1V2ST 3MU5A 2O8LA 4YZUA 1XUJA 1O5GH 2ZTYA 1P10A 5F8ZA 1BJUA 1KDQA 3L33A 1GCDA 3M5MA 3PWCA 3UNSA 4GHTA 3LC3A 2BX3A 3I29A 3MNXA 1OP0A 2QN5T 2AS9A 1GWAA 3UOPA 3A7YA 2BY6X 4NA7A 2HNTF 2G8TA 1Y3WA 2CHAB 4OS2A 1UCYE 1FXYA 4E7RG 1KXDA 4H6SB 4INKA 1DUAA 1H9IE 1S85A 3SJOA 3NCLA 4A92A 4FUJA 1AE8H 1BTWA 4NIYA 5I25A 3MH7A 1FPCH 3ZZDA 4ABEA 5TJXA 1GBJA 1Z6JH 1BCUH 2M5TA 3TITA 1O3BA 2GMTB 3ZVAA 3PLPA 4AFQA 4IBLH 1QRZA 5FX5A 6LPRA 3OYPA 2EI8A 3SU3A 3U1IB 2ZCHP 4IN2A 5EXLA 4JK6A 2ZG0H 1GJ8B 1QL7A 3RXJA 4Q7ZA 1O5DH 2GVFA 2H1UA 1F92A 5B6OA 2BQ7B 1C1VH 4TWWA 3M61U 1AKSA 1DPOA 2FWWA 3KCGH 4WWYA 2VH0A 1O3AA 4Q80A 1TNHA 1BITA 1WBGB 1ZOMA 2Z3DA 1C2DA 2F9NA 3BF6H 3SI4H 5C20A 1SGPE 3TVJB 4TPIZ 3ZZBA 3H7TA 2AIQA 4B2CA 1TPAE 3VB3A 1AI8H 4ZKNU 4H4FA 4X6PA 3KQCA 1YPMH 1TE0A 2WYGA 3VXEH 1NM6A 3CP7A 3V12A 1THSH 1P09A 3BTME 3BIUH 3SGBE 3BEIB 4NSVA 1YLDA 3GY4A 1FY3A 2BZAA 1G3CA 2XRCA 3EA7A 4U2WA 1LHGH 5AFZH 1HAHH 2DE9A 1MTVA 3PO1B 4AFUA 2PGBB 4WY3A 4IC6A 3S69A 1OSSA 1OWEA 3VGCB 1YPJH 2FOMB 2EI7A 4FVDA 4GUXA 4AGKA 5F6MA 1YBWA 2XBYA 3P92A 1DLKB 5C2ZA 2XNIA 3RXEA 1IHTH 3V0XA 1GJ9B 5E2PA 1LPZB 2ZA5A 4ABFA 7ESTE 1OWIA 4CR5A 1IHSH 2W7UA 5EOKA 2OC8A 5GJ4B 8GCHF 1YCPM 1NRRH 1C1MA 2QXJA 3UR6A 4ZHMU 1P0SH 2A31A 3U8OH 2BD7A 1SGYE 2OCVB 5DP9A 2PHBA 2ZU2A 1PPEE 1ACBE 5HYOA 2ZTXA 3HK3B 2ZIQH 1K9OE 1G9IE 1BJVA 1RGQA 2B5TB 1ZHPA 4YTAA 3ATMA 1UVUH 3ZZ8A 1T8LA 5DP6A 1CBWB 3SJIA 2DE8A 2RA3A 1KXBA 1EATA 1EAXA 2FEQH 1V2KT 4WXIA 2BVSH 1C5YB 1EJAA 2ZHQH 4HTCH 3RU4T 1WCZA 2G4TA 3BTTE 3T5FH 1O5EH 1ETSH 4JYTA 1P2KA 3KIDU 3F9GA 2XYAA 2F83A 2ODYB 2AGGX 3RM2H 1DWDH 1G36A 1TMUH 3A7ZA 1IQNA 1O2SA 3VB6A 3SW2B 2Q1JA 1LKAA 4X2VA 1RJXB 3GY7A 2BTCE 2WPJS 2G4UA 1RTLA 3LC5A 3RC6A 1O2ZA 4X2WA 1SMFE 3RXKA 2XTTB 1QBVH 3KQEA 5K7RA 5GXPA 1N6YA 2W3IA 1GMHG 4KKDA 4R8TB 2FLRH 1F5KU 3RXOA 5DO4H 1A5GH 1BUIA 2FIRH 1THRH 3TJVA 1AZZA 2CJIA 3A7XA 2ZDKA 1FONA 2FOCA 3CS7A 1HDTH 1UJ1A 3M35A 4CBOA 2VIQA 4YM9A 1Y8TA 1PPGE 3R0FA 4A1TA 1C5XB 4FU8A 1HAIH 1EX3A 4OS1A 4ABDA 1VCPA 1HJAB 2BD3A 3T2NA 4A6LA 2ZFQH 4X1SU 1F0SA 6CHAC 1OWJA 3W94A 1H9LB 1CT2E 1LHFH 4HFPB 1EOLA 1UO6A 5EPYA 1ELAA 1ZMLA 1RRKA 2Z9IA 3LGTA 3VPKA 2B8OH 4JZDH 1NU9A 1HB0B 1BMMH 3RXAA 1GBFA 2J92A 4ZUHA 2Y7XA 1PPBH 3A7WA 3O8DA 1OWHA 5JBCS 1O2LA 2PUXB 1TOCB 1CQQA 2P8OB 1A5IA 4A1VA 3GY6A 1AN1E 2V6NA 4MPVA 3MYWA 4TY7A 3QZQA 2FM2A 3VB7A 4X8SH 1ARCA 1C5PA 4OGYA 1EAUA 4X2YA 3L3TA 2FOBA 4DW2U 1EAWA 4I8GA 1VITF 3QZRA 3TLOA 1DWBH 3SNEA 3MI4A 2P93A 1BHXB 3RXHA 1HUTH 4OS4A 2QY0B 1C2IA 4JZEH 4QT8C 4B74A 4WXVA 2Y5FA 1EB2A 1V2TT 2BDIA 4UD9H 1KIGH 3E6PH 5LH8A 1S81A 1DVAH 5LGOA 1YF4A 1ARBA 3SJ8A 3EE0B 1UTOA 1KTTB 1PYTD 1P2QA 4NA9H 3SN8A 3UQOA 2FI4E 1TYNA 2NWNA 3STJA 1BB0B 4SGBE 4E05H 2Z7FE 3SQHE 1N1LA 1O3DA 3S9BA 5JBTA 1GJCB 1CO7E 2GCTC 3SOSA 2UWPA 1YKTA 2JKHA 1M9UA 1TPPA 2HWLB 3TGIE 3B8JA 4U01A 1TGNA 3AVZA 5L2ZH 4UE7H 3F9HA 2VIDA 3SNDA 3VGCC 4ESTE 2C4FH 3A8AA 3I77A 1PPFE 3DFJA 3PTNA 4BNRA 1DXWA 3SORA 1MBMA 2ZU5A 3M7UA 3DA9B 1ZLRA 2PKAA 3RXDA 4FU9A 1NPMA 3GY2A 3S9AA 2XBVA 1A4WH 4Y6DA 3SNCA 1GI1A 1GMHF 5EW1H 1GCTC 1Q31A 4I8KA 1D3DB 2ZGJA 2V0BA 1HAOH 4B2AA 1Y3XA 4BAMB 5A8ZA 2FYQA 1CGIE 1BOQA 3A8CA 1SGTA 2O8UA 2C8YB 1AHTH 4HGCA 2RDLA 3GCHC 4CH8B 4ZHAA 4DGJA 4IGDA 1S84A 1O3JA 5DK1A 4B71A 2Y6TA 1SOTA 3E16B 4DVAU 2SFAA 1IQFA 1GGDB 3H7OA 3RP2A 4ISHH 1EZXC 1WUNH 3FVFB 3SV9A 5T3HA 1UTJA 3MWIU 1J17T 3Q3KA 1Q2WA 1HV7A 1T8OA 2XCFA 1MKXK 1XUFA 1KXAA 4X1PU 5ABWA 1FNIA 4GCHF 1BHXF 2K1QA 1O2XA 5FHTA 1ZTKA 3U69H 4ABIA 1T8NA 2ZGHA 1C2FA 1TMTH 1A7SA 1O5AB 4DT7B 5C5NA 4FUHA 1FV9A 1GBKA 2QCYA 5GCHG 5AF9H 1GJBB 2H6MA 2PFEA 1GBAA 2VWMA 1Y3YA 2ZFSA 1F5LA 1W3CA 1IQJA 1DWEH 5DG6A 3HKIB 4LZ4B 1FUJA 2OC0A 4NA8A 2TGDA 1GI9B 2FODA 2ZPQA 1UTNA 1ANDA 1UCYH 1VCQA 3TJNA 1RTKA 2A0QB 7LPRA 5A09A 2BD5A 2BX4A 3NPSA 1QB6A 2ZDVH 3P8NA 4GAWA 3A80A 3RXRA 4NIVA 3BSQA 4FVBA 1DS2E 1D3QB 3U1JB 2OXSA 4GVUA 2SGFE 3MO3A 3O8BA 1Q3XA 3RMLH 3KL6A 3SV7A 1OS8A 1P2MA 1L1JA 1YM0A 1ELBA 1W13U 2I6QA 2V35A 3NXPA 3SI3H 3PV4A 4YO9A 3GY8A 3BG4B 5EQSA 1GBDA 2O8TA 1GHAG 1YP9A 2BOHB 1XKAC 1NTPA 1NFWA 3T26A 1XMNB 4INHA 1YGCH 1KLJH 1O38A 2OBOA 2ODQA 1GI7B 1XM1A 3E0NB 2G00A 1HJAC 5BPEA 2QF3A 1FMGA 1O2VA 3T25A 5LPRA 4TY6A 1DE7H 2TGAA 3V3MA 1GPZA 3MMGA 1Z8GA 1ANCA 1DXPA 1HAVA 4ISOA 3TGKE 2Z9GA 3LGUA 5EXMA 1SLVB 1JOUB 2BQWB 1CA0C 2OLGA 2Z3CA 2GD4B 1SOZA 1K1IA 5AFYH 1L1GA 1QB1A 1C5LH 2D2DA 3MH6A 1C5WB 3TH3H 1A3BH 1AB9B 2BLVA 1MQ5A 3BTKE 2ZQ1A 5E0GA 1A0LA 3Q77A 3TNTA 5C3NA 3SNAA 1MBQA 1XUKA 4AZ2B 2A5AA 1GBCA 3BTGE 1JWTA 1QCPA 3RUOA 3O8CA 3LGVA 3PM3A 2A32A 3Q00A 3EDXB 1ZSJA 1MTWA 3A88A 1YC0A 4NIWA 1GDUA 2P8OC 4OGXA 3SU5A 3JZ1B 3P17H 3SHCH 3M3TA 2FX6A 2VWNA 3RXLA 3T28A 1FIZA 2HNTC 1TPSA 4F49A 1Y5BT 1JIRA 4OS5A 5EQQA 3SGQE 3SU0A 5A2MH 1O5FH 3VB5A 5T6DA 1ZTLA 3A83A 5EPNA 1QL9A 4U32A 2GMTC 4O03A 2ZGXH 4HI3A 4Z0KA 1O3KA 2LPRA 2XC5A 3EQ0H 3MOCA 2KAIA 2GX4A 2F9BH 1L2EA 3OX7U 3S0NA 1C5MD 2TRMA 1RTFB 3HATH 2CMYA 2FS8A 3VB4A 5FXLA 1L4ZA 4BXSA 1ABIH 2ZECA 1C5UA 1HGTH 1TGBA 3RXPA 2DUCA 5GPIB 2THFB 3IITA 1AO5A 3SU4A 1DM4B 4GLYA 1C5QA 4X8VH 5A8XA 4AG2A 1DFPA 2BDAA 1O2JA 2C8ZB 1QRXA 2FZZA 1O33A 1SFIA 3F9FA 3URDA 5DP4A 2G51A 2BMGB 1SGCA 1INCA 3RMMH 4O3TA 3U98H 7GCHF 1GJ5H 5FPSA 1XX9A 2A2XH 4UFGH 3FP6E 3B23B 3GYMA 3RDZA 5A0CA 3A7VA 1J15A 1O3MA 1MTUA 1GHZA 1UVOA 1WYKA 1YPKH 1GDNA 3B9FH 2ZEBA 4I8JA 1E37B 1FAXA 1HYLA 1QNJA 3ZZ5A 4BXWA 5AVDA 2H9EH 1V3XA 1VGCC 4X6NA 4ZROA 3A7TA 1OX1A 1GHAF 3MU1A 2H9TH 1BTHH 2BZ6H 3LJJA 3U8TH 1L1NA 1ZJKA 1ELVA 2A2QH 2GGVB 1GG6C 2W26A 2ZQ2A 1P2OA 1J16A 3LH3A 4CHAC 3UPEA 3E8LA 1Y3VA 4X1NU 2XBWA 4XDEA 1XKBC 2BDBA 3S9CA 2FOGA 1FPHH 1OP2A 4J2YB 3LKWA 1ELTA 1RD3B 1O3HA 1WTGH 1GBLA 2SGAA 2WPLS 4BTIB 1EP5A 3QO6A 1P03A 3TJOA 1EPTC 3ZVGA 1GBEA 2ASUB 4X1RU 1ELDE 2BDCA 1FDPA 2FESH 2BD2A 3UQVA 1H8IH 1MTNC 1UHBB 3KF2A 2J94A 3FFGA 1SC8U 4K60A 4KELA 4Q7YA 1HXFH 2BLQA 1GI6A 1SR5C 1O2QA 4HZHA 1K1NA 5EXNA 2BM2A 2V3HH 1EZUC 3A89A 4H6TA 2FOEA 2OBQA 3F1SB 4TPYA 4DURA 4GSOA 5DP5A 2ZFRH 1PQAA 3SGAE 1P2JA 4H42U 1CGHA 4IMZA 2VU8E 1AFQC 1BTUA 1AWHB 1C2HA 4FUBA 5J4QA 1HAYB 1NO9H 4MG3A 1YYY1 1TLDA 1GVZA 3M36A 3PROA 1ETTH 5FBEA 1C1NA 1MKXH 5A0BA 1NS3A 3LIWA 2D8WA 5K0HA 2VIPA 4OS7A 3T27A 4CBNA 2FDAA 5FPYA 1DT2A 1J9CH 1S0RA 4ZKRU 4RSPA 2R9PA 3PMJA 4ZKSU 1DOJA 1JBUH 1G3EA 2XBXA 4X6OA 3SZNA 3Q76A 2BYAX 3UWJH 3EA9A 2QGRA 3E90B 3T29A 4AORA 2QV1A 3QGJA 1P9UA 4AFSA 1LQDB 4AN7A 1JRTA 5SGAE 1UK3A 2HGTH 1OYQA 2VWOA 1CGJE 1V2MT 2PV9B 5H4IB 3MO6A 3SV8A 2A7HA 1NESE 1D3PB 2A7CA 3F68H 3ZVFA 3E91A 2OC1A 4MNXA 3R3GB 1MKWH 3QGNB 5BRRE 1S82A 5CHAB 1BMNH 4UEHH 2NU3E 2P3UB 2GDDA 1OWKA 1AFEH 1HLTH 1C5ZB 1AD8H 1LDTT 1P57B 3ZZAA 2WPMS 1A2CH 3TH4H 1BTZA 3TK6A 1LO6A 1W11U 1C4V2 4RKOB 1BTPA 4YLUA 4BTUB 4IN1A 2XXLA 1ZRBA 4D7FA 1SQTA 1O3FA 1QRWA 3SQEE 3E0PB 3ZVCA 1BMAA 3BN9A 2BDHA 1F5RA 4MNVA 1QTFA 4XBDA 3HKJB 1EAIA 1HPGA 4AX9H 2JH6D 1OWDA 3TK9A 1AB9C 1V2PT