1SC1A

Crystal structure of an active-site ligand-free form of the human caspase-1 c285a mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
167
Chain Sequence
GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 44
structure length 167
sequence length 167
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sc1A00
1SC1A 5JFTA 1RHQA 3H0EA 3ITNA 4JJ8A 3S70A 4EHKA 4DCPA 4ZVOA 1RWNA 3PD0A 5IABA 1I4EB 1SC3A 5I9BA 3NKFA 4NBLA 5H0IA 4ZVRA 1RHMA 3DEIA 1F9EA 2CNKA 4ZVQA 1CVRA 2HBZA 4NBNA 5IBRA 4EHAA 4NBKA 3P45A 5IBPA 4EHNA 1QX3A 2Y1LA 2QL5A 2C2MA 2CNOA 2QL9A 2FQQA 4N6NA 2CNLA 1PYOA 4AWBA 1RHKA 2FP3A 3BIJA 4QULA 3V6MA 5IBCA 4D3YA 2CDRA 4IYRA 2AR9A 2DKOA 5I9TA 2H54A 3DEHA 1RWVA 4M9RA 1CP3A 3R5KA 3R6GA 4N6GA 1RWWA 4QUHA 4D3XA 5IC4A 2H51A 4N6OA 1RHUA 2H48A 1SHLA 1RE1A 4DCJA 2C1EA 4PS1A 1JXQA 3V55A 3PD1A 3EDRA 4PRYA 4DCOA 1IBCA 4D3ZA 1PAUA 3R5JA 2XZTA 3NS7A 3H11A 1K86A 4PS0A 4FEAA 4JR1A 4ZVTA 3V4LA 1SC4A 5LU8A 2C2OA 2HBYA 2XYGA 4EHHA 1KMCA 3D6HA 3DEKA 2QLJA 5IARA 1RHRA 3R6LA 4ZVSA 4PRZA 2H4YA 2CNNA 1GQFA 3R7NA 3IBCA 1F1JA 2FUNB 4ZVUA 3UOAB 3S8EA 2P2CA 2Y0BA 3KJNA 1QTNA 3GJSA 1RWPA 4EHLA 3IBFA 4AW9A 2CJYA 1RWMA 1NW9B 3DEJA 4QUEA 4NOLA 5IC6A 4HQRA 2H65A 1M72A 4N7JA 4NOJA 4JQYA 5IAJA 3GJRA 3R7BA 2C2ZA 3SIRA 3V3KA 4FGUA 1GFWA 1SHJA 4JB8A 5LUBA 5IAEA 2K7ZA 3NR2A 5LUAA 1NMQA 2XYHA 3GJTA 4QUJA 4N7MA 4QUIA 3D6FA 4QTXA 2J30A 2HBQA 3D6MA 5K20A 1NMSA 4QTYA 2H5JA 3K7EA 3KJQA 4AWAA 1RHJA 4EJFA 2NN3C 4QUBA 3SIPA 2C2KA 2QL7A 1NMEA 1ICEA 2H4WA 4FDLA 4HQ0A 2CJXA 4ZVPA 3V6LA 4NOMA 2HBRA 2QLBA 2J31A 2H5IA 4QUDA 1I51A 4EHFA 3P4UA 1RWOA 3H11B 3GJQA 3E4CA 4HVAA 1I4OA 1I3OA 4QU8A 1QDUA 2QLFA 4QUGA 3UO8B 4JR0A 4QU0A 3V4OA 4IEFB 2WDPA 4I1RA 4QU5A 5IAKA 3R7SA 4EHDA 2XYPA 5IANA 1RWKA 3H1PA 3KJFA 5IASA 3QNWA 4QU9A 4LSZA 1RWXA 4JJEA 4JR2A 3RJMA 2J32A 5LU9A 4QUAA 4FXOA 4N5DA 3H13A 3PCXA 2XZDA 4NOKA 4I1PA 1K88A 1BMQA 3EDQA 3OD5A 5IAGA 4JJ7A 2J33A 4JQZA
chains in the Genus database with same CATH superfamily
2JAXA 5LYJF 3VPCA 1PQWA 3PGLA 3ROMA 2GM9A 4HADA 1L4EA 2AHOA 1T2EA 4IHJA 3LVRE 4ZYZA 2G6TA 1VPDA 2FSPA 2Q1XA 4IH1A 3V9AA 1YZVA 2EZ8A 4RDIA 2W6CX 1UKBA 3ZUPA 3X43A 2IUTA 1YMVA 1YQQA 2EL7A 2YJTD 3ABSB 2AK2A 3O1LA 5FCDA 4KO1S 2C03A 4FNOA 1XNJA 3HB7A 5C0OE 3AINA 1T0IA 4F4HA 4WGFA 2AN1A 1NBIA 2OEPA 3JYPA 1O0BA 3RRZA 1EIWA 4FDAA 3WB1A 2E18A 4JC4A 1OFIA 1OAOA 1QH8B 2IKSA 3DHEA 3OQIB 4N0PA 4YS6A 5TS3A 1TUGA 4HHEA 2AR9A 1YHNA 2WU1A 2Q0SA 2DG2A 1RWVA 3K1JA 1JEQB 1UODA 3WMFA 2XGJA 1N6RA 4MR8A 2ZSIA 4MW9A 3TG8A 2D8AA 3LF1A 1ONSA 2FWIA 3QLVA 1VCOA 3OPYB 4AMBA 4G23A 4GI1A 3VPAA 3NJ8A 3CT4A 4PC2A 3D5EA 3PUJA 2VHTA 4M7OA 5KNDH 3JD4A 1BG6A 3BSSA 3OEEA 1M0WA 4P4UA 1IXKA 1LA2A 3K0EA 4WESA 4U6SA 3CIFA 4OGWA 4TKVB 4UHBA 2VSNA 4JJKA 1EX7A 2D2VA 2JNWA 3H7IA 4HSEA 3Q3EA 4KV9A 4TV9B 4FZRA 5HYVA 3DA8A 4NBUA 2JFYA 2EU8A 5DYWA 5E38A 3KOXA 1PQYA 4TLAA 1XAGA 4EHLA 1CULC 1TVCA 2A30A 2J3EA 3EXIA 2Y6VA 3DV0A 5G0SA 1MJHA 3ZWAA 3MERA 2HRCA 9MHTA 3HEMA 1DAGA 4U9HS 1Z26A 5DVZA 3R74A 2AMFA 2QZJA 4H16A 2PMEA 2A1UB 3RBAA 3AU9A 1LPSA 3RC9A 5BSGA 5HM6A 4NBTA 4BLTA 4CL2A 4PSUA 2DFDA 4PIPA 5CLIA 1U7OA 5A2GA 4D9NA 3IBSA 1RXCA 4OXXA 3NHAA 3UM9A 4JJFA 4B45A 4NCJA 1C3EA 2QENA 3OTIA 4KQHA 4GX2A 5K8VA 4PFJA 1E9RA 1MW9X 1P5RA 2B35A 1FTGA 2BWJA 3PFBA 4MJXA 5TVKA 4R40A 2HX1A 3GB9A 4BB9A 5CBPA 4MVJF 2XMCA 3LX8A 2EC5A 4D45A 1GU7A 1Z2CA 2WSLA 3JQBC 4X9XA 4HQOA 4GYYA 1JU9A 5BN3B 4IX1A 1N5RA 2ATVA 3U6KA 4PFKA 2VF5X 4V1CI 2VNKA 3NCHA 3T3HA 2R00A 3JQEA 2AG5A 2JFWA 5C51B 2EFDB 1M6YA 1Q57A 1RWOA 2GMWA 1I33A 3H5NA 3KL4A 4ID9A 4OK5A 3VHQA 3A6GA 1ISPA 3I52A 4OQLA 1FS5A 1QCCA 5JNTA 3KPJA 5FUWA 2IDJA 1CHDA 1PWEA 4HX5A 3GP3A 4MIEA 4INAA 5IEJA 3K8OE 1KQGA 2H1SA 3RS8A 4ZAXA 5BW6B 3PQ6A 2DFTA 1Q7CA 2ZRCA 3DP7A 3PTLA 1GNLA 3AU8A 1LX6A 1E4EA 4H08A 3TZBA 3BRQA 3ORHA 4DEYA 4EOGA 5I9IA 3FYUC 3SVLA 1EFRA 3C5HA 3EK2A 4LBWA 2BKLA 1U3GA 2B4AA 3U2QA 5K6TA 2PMBA 3OFSA 1E64A 2R8BA 1TW3A 5EJ9A 3K9WA 4U02A 3ZDQA 3PHHA 3Q9UA 2FH5B 2FJPA 2FRXA 2VDWB 4ATNA 3H9QA 1ZLYA 4MW4A 2IXTA 1Y6RA 2HMUA 2WVAA 2X2OA 3OCWA 4YV2A 4TROA 3SMVA 3I01M 1TYEB 2R1VA 2HRBA 3D02A 3OPYI 3O4GA 4WN9A 2FWAA 1I4DD 4ZAVA 4XASA 4D8XA 1Q0QA 1KSJA 1TQ6A 4B32A 1ZM4A 1KHTA 3KFVA 4X90A 1RIIA 5E8RA 2B99A 1PGOA 3L4EA 3QE4A 3U13A 3KALA 4E1VA 5JCOC 3BD9A 2ZTVA 5TPZD 1W46A 1Y8RB 1SVWA 3BL5A 3LDAA 4QDXA 1NV8A 3UV6A 4DRXA 2FHPA 3OICA 5JMPA 4B0OA 2W98A 4BU1A 5G3ZA 3R0ZA 3QZUA 4ND7A 4RPGA 1U0NA 4UNRA 1YRQA 3LCCA 1HLGA 2PTGA 4OL0A 4AZVA 2PPLA 1Z5ZA 5DW3A 1KYWA 1VDZA 4RF4A 5EQJB 3HRHA 3RU2A 4V0SA 5KVSA 2IEAA 4WN3A 5DCLA 4WXYB 2O7NA 4TMFA 1OFTA 4HLDA 1CEXA 3RYHA 3SKXA 2ZJ8A 3KLBA 3RAEC 4TGLA 5J59A 5JSFA 5CPBA 3CRQA 1UBLS 4KR2A 2WAXA 4M1KA 1DBIA 2BF7A 2GNPA 1G60A 1KOJA 1O94A 1VBMA 2B4RO 2GYWA 4S2EA 2RH9B 2W6NA 2PRKA 3HJNA 4KFRA 2FPIA 4DM7A 4WZAE 4PANA 1CZNA 1M66A 4JIGA 3PFCA 2IY8A 1LJLA 3N74A 1C9JA 2X9GA 2CLKB 3I2JA 3LVFO 4D57A 3QG5A 5T8KA 3UV3A 4H3SA 4C29A 4TZ0A 1E4EB 1PQPA 2R62A 3E4DA 4G65A 5LQDA 2H2IA 1WW3A 2PGOA 2DRIA 4JIMA 3G0BA 3OE5A 1PL8A 2ZSHA 1XTVA 2JBWA 5TDHA 3ULKA 1OWPA 4ZVLA 2A4MA 1WW2A 3GJ6A 2PUAA 3T9AA 2VSOA 2HYDA 2D0OB 3LLVA 4U6QA 4HAXA 4JI8B 1AX9A 3O8BA 1JDBB 2HMSA 3OJWA 4GX0A 5ESDA 3OM8A 4LXIA 3IEPA 2HRZA 3PGVA 4Q3CA 1N2JA 1DE0A 3O31A 5AJWA 2ZSAA 4TLMB 4KWEA 2XUAA 3F71A 5ILOA 1ULBA 3ISJA 5CHEA 3GCZA 1NVEA 3QJGA 5ICEA 3B51X 2EDCA 3ZY5A 2B94A 3AFIA 2ZTLA 3CLTD 2IYFA 1GRCA 2DPLA 2O7VA 2XT6A 1OWLA 2H31A 4BMXA 2O8VA 1E6CA 4WXPA 4RCZA 2OA0A 3DZKA 4EJSC 4BV3A 4IV8A 1IQ0A 1K97A 5GINE 4ZJPA 1KKLA 2O2IA 2X3UA 4DVGA 2H2AA 4CW7A 2Q0QA 3IE0A 4LEIA 4UBMA 1KS2A 4CM4B 5FOTA 5KAPA 1E2EA 2VK1A 4POOA 1MTZA 4GFDA 5DMXA 1KSHA 1PR0A 3QOWA 4JLAA 4OB8A 2C2BA 2ORVA 1GXSA 1TAQA 3FZYA 3G0GA 4FHEA 1OLXA 3TX6A 4D26A 1QGOA 3U4MA 3T5MA 2BL4A 5BNZA 1S0UA 1AGPA 3U4DA 3IR6A 3DFUA 4WK4B 3FOZA 4AZ3B 2D1QA 4ADSG 2ZSBA 5IM4F 4ENWA 3H1AA 4CHGA 3WYFA 1UC4B 2VAPA 3YASA 2DWCA 3ZX5A 2YXPX 1MB4A 2QXYA 1Q3HA 3W7BA 2ZG6A 4FONA 4ETMA 4MV6A 3ZWDA 2WAOA 2IHNA 1JEQA 3PD7A 4A4DA 1XPRA 1IG3A 4MHOA 1E9AA 1R8JA 4J0KA 2HSWA 3ZCUA 1YQEA 3G7NA 3L0YA 2FPPA 3ZS8A 3LBIA 3E61A 3KV1A 3KV3O 2D5IA 2VJKA 5GJWC 1ECLA 4WKCA 1WUKS 1ISJA 4KXNA 5AVSA 2WJ3A 4M46A 4EGCB 3QRWA 4JBYA 4JC0A 2F64A 4B31A 2DSTA 2HNKA 1BFDA 4P08A 2J7PA 3TXAA 2KX7A 4JJ4A 3CUVA 5C3MA 2JIZD 2JJ2A 2WFAA 4KO2S 4YIHA 3A06A 5CU7A 1OAOC 1B3RA 2HCBA 3VZCA 4KQWA 1W581 1KAQA 3ML1A 4MB0A 4OFBA 4MGHA 3V55A 4C2AA 4GVXA 5SYNA 4C3OB 1HT1E 5FWDA 5A2QA 4WA7A 4PYOA 3QXHA 5CB4F 1FDIA 1U9JA 2NLOA 4WBNB 4JL5A 4Q9JA 1GAQA 3D6HA 2IYZA 1C7JA 5EMMA 3N8KA 4LIPD 821PA 3GJ5A 3LGXA 2CMFA 2BGGA 5JFGA 2OBBA 1GUYA 2PSDA 1NOJA 4DWWA 2C1XA 3HCNA 3P27A 2I6SA 1Q83A 2CJPA 1CDOA 2RAFA 4L7VA 3Q8XB 1KORA 2RIPA 3DE5X 4ZI2A 1TTQB 4WKNA 1T25A 2A0KA 3FPSA 4ZC8A 4DNXA 1UOOA 1J8MF 1U3FA 5KNLA 4CLEA 1W47A 2RI6A 1P75A 1NUAA 5E4JA 3SF8A 4BXOB 2GJ4A 4XPIA 4WESB 4R9NA 1T10A 3EXG2 2BI8A 2ZSJA 1G16A 1T8YA 1SHJA 4E6EA 5BV7A 4JQCA 4X8LA 4YGYA 4B7UA 2RGEA 1MW8X 3LP5A 1A5TA 4J1QA 1NNEA 1XLUA 4UHFA 2OG2A 3DAYA 3G5UA 5JO9A 4PZUA 4KDCA 4JWKA 3T7JA 1M2VB 1YL6A 1ULHA 2Y68A 3C7KA 3KFXA 3AJAA 1YZYA 2OBXA 1MT0A 2OD7A 1DEOA 3OE4A 4R3NA 1YRBA 1GSOA 1E5LA 2EOAA 2FUEA 4A82A 1VMDA 4B9EA 4EA8A 5ALZA 3AVWA 9ABPA 1N1DA 4BO1A 4N0MA 2PZFA 3EXFA 3GFTA 3NRCA 2HMAA 4FTWA 5TVGA 1E3LA 4AP9A 2F48A 2ZS8A 1CPYA 3MB8A 4YJ3B 4HAVA 1GNRA 1PJ8A 2ZITA 2AQHA 4P81A 5AW8A 3HYLA 5LP1A 1BCSA 2YL2A 2C5AA 3VPFA 1N0HA 3JVDA 2DKFA 4Q3AA 1DAFA 2PH1A 3CW2A 4JUAA 1TK3A 1U3DA 3LDUA 2ST1A 3F2IA 5IASA 4MK4A 1G18A 4G5QA 1WUHS 4UHHA 2X22A 4JR2A 5JVDF 3GLFA 4BAZA 1WDLA 2IEDA 4OHWA 3BSFA 2GHTA 3FOCA 5JAZA 4LPSA 3ZQJA 3WC4A 1XZMA 1R16A 1F06A 3ED5A 1L1FA 5MDHA 3AR3A 1LSOA 2HWKA 5HPYB 1FP4A 1VHTA 1H85A 3C5EA 2YVUA 1A7KA 2QUZA 3W7VA 1PUIA 4FMDF 3ORRA 5EKSA 1VMKA 4ZA2A 2Q9CA 2OHFA 4ZIRA 1T6YA 1Z15A 2RGYA 1MOPA 6ABPA 3OWHA 5G4LA 1AKNA 4DLZA 3T7EA 3PWTA 3D3WB 4QFCA 2V7VA 2ZRGA 3RFTA 4A03A 1C7RA 4EHAA 5BNWA 3THXA 3TRJA 2C3MA 1IIBA 4MV0A 5GONF 3USZA 1Z25A 2VWQA 3VU9B 3Q3VA 3Q3IA 1C1XA 3KWFA 3N0TA 4QPPA 5HQJA 3NHYA 1A4UA 1PWZA 4H0FA 4I19A 4M7PA 3EEYA 2Z09A 4RV4A 5IF9A 2CD7A 2LXNA 1QQ6A 2P0YA 4FDTA 4R81A 5EJFA 2CFOA 4YT5A 1QG6A 1WX1A 2Q5LA 3LYLA 1EQAA 4QUKA 4M88A 2QVGA 2B0JA 1NF9A 2C0CA 1F4VA 1WM1A 2VUHB 4OEHA 1T3LA 1Y6JA 5EZYA 3FETA 2O8BB 3RQSA 4E2ZA 2NXCA 3CLSC 3HB1A 4RK6A 4IX9A 2O8CB 1SBIA 3I01A 4XW2A 2FYTA 2Z3VA 1Y8CA 1IBKB 2A7QA 3RLFA 5CA0F 2F1JA 4KQKA 5FULA 2RGRA 5KTNA 1QLHA 4AC9A 3AIMA 1BWPA 4U7TB 3BFVA 5GJVC 4IUCS 1M67A 3B5IA 3EFOA 3Q6NA 4HJRA 1DJQA 1GV0A 1P2FA 1EP9A 1TMKA 4MUIA 3D4PA 3P2EA 3TIXB 4F45A 3ZHSA 3N2IA 1W93A 1RI1A 3LPMA 1MQ9A 1FLAA 3OMXA 4F0JA 3V4RA 1NZFA 1SQ6A 1K63A 2ZS9A 1M72A 1G8SA 2QLTA 4JQYA 5GWXA 4QLBA 1FSPA 3M1YA 2O5VA 2E2WA 1DBSA 3KS9A 2DEUA 5LIPA 3R0VA 4BAGA 4TTAA 4E2WA 4CIYA 1X77A 4DB2A 2AMVA 4FWTA 2C7BA 2RHDA 4N8DA 2BGTA 1LQ2A 1NWHA 2BUCA 1QOZA 2O4CA 1BHQ1 2H1CA 3CX6A 1K5HA 3BL8A 3GLQA 2VJDA 2F3TA 3KYCA 4GUAA 1NYQA 1SKYE 1P2BA 1WCWA 1YTLA 1GQRA 3Q88A 4KC0A 4L4UA 4Q66C 1C3VA 5TSDA 4KAXA 4X3PA 3RC7A 4H1UA 4TMVA 3WWYA 3VR5D 1QVRA 2G80A 3LBYA 2B4TO 3L8GA 2UYHA 3V6LA 1D2HA 4GRDA 5JXWA 2JJ2D 4RM3A 3HBNA 3I8OA 4TMTA 4PCAA 4PPQA 4AQDA 3VJMA 4WXHA 2ENUA 3PGXA 2FJ0A 3IR5A 4M4SA 3CZPA 5FEUA 1SKAA 1U4NA 1XCBA 3HZZA 5DNUA 1DAMA 1U65A 5BSEA 2H2FA 1A8HA 1XNGA 1Z33A 3GOQA 4I9UA 1U3WA 5KAMA 1MJFA 1NVFA 1EVJA 1KJNA 3FYSA 3BHJA 2JZNA 5DRYA 2GQ0A 3IKVA 3CN7A 3VR5H 4JP1A 4PYJA 2FLVA 2NTNA 2ODBA 2A6PA 5JCJA 4ZEOA 1JF8A 1P7CA 4WI1A 4AFNA 3ZKAA 4HGRA 3AI7A 2VWGA 3RTAA 3S6JA 1ZJWA 1N2CE 2FF5A 3ZHVA 4UM8B 5A0FA 2Q5HA 3WYCA 1PG0A 4ERXA 4UUNA 5HZGA 2UV8A 1MR3F 2FR0A 2HXYA 4JLVA 4MLDA 4S1TA 5D51S 1SELA 1GKYA 5D84A 4EG5A 1XAJA 5F9MA 5BSMA 2DPGA 1DKPA 4D81A 1EE1A 3BFKA 3VYUB 3TFOA 3RAFC 3A10A 1FTNA 2NU8B 3L9XA 4GLBA 3B3GA 1P9RA 4EF6A 1OYOA 5G0WA 4DIEA 3PJFA 3OCCA 3AR5A 2CWWA 1VBNA 3FPAA 2UDPA 2ZR0A 3W2GA 1FDOA 4AF7A 1D4ZA 1FNBA 3OCUA 2BEUA 1Z5UA 2GXUA 4BLPA 1JNXX 3WTBA 1PDWA 1YMUA 3UMSA 1FP6A 5BN1A 2XOEA 5EHZA 4EI2A 3ZGZA 1B8OA 4RD4A 3SYTA 4MAFA 1WQ1R 3LCUA 1G38A 3X1MA 4OP2A 3JZFA 3R5KA 1V96A 1YZFA 4RMHA 3VDXA 1ODLA 1N0IA 4CLDA 3TCKA 1UBHS 3HCOA 5LKRA 3EIHA 1IZYA 2X4LA 3VU1A 3CNQS 5JI3E 2B4YA 4YV1A 1QC5A 1FDRA 2PXCA 3KJIA 4YRTA 3IUBA 3UEOA 5DASA 5GM2A 1U28A 3KE8A 3CG4A 4E5MA 2Q3EA 1K8RA 1O7JA 2H92A 3AF3A 2Z8YA 4B74A 4WA8A 3UHFA 4CMAA 5IH3A 2UZIR 1AMOA 1ZU4A 1JH9A 3FLBA 3N58A 3M6FA 2JGMA 2VHVA 3B9BA 3I9FA 4OHKA 4X1IB 4JGIA 3PKIA 3UMVA 4AUMA 1JIXA 4PBRA 5CVVA 3TRKA 4Q4CA 4HG2A 2FZVA 3G9UA 1ORDA 3L7NA 1CG6A 3E22A 4BX3A 3OESA 1UDXA 2Y0PA 4MVCA 5DHAA 4W1QA 6ADHA 4JX8A 4MWZA 4UM7A 1E2LA 1KA9H 2IQIA 1K4MA 3WIDA 2QNRA 2QQEA 4ES6A 3QX9A 5IJWA 3IP8A 1N5DA 2V4ZA 4OFWA 1XJ0A 3DKIA 1T5IA 3H4IA 4GS5A 2CXHA 1EA7A 1UDAA 4ARIA 1IBRA 2X4DA 3AJDA 4GX1A 5EIHA 4D5EA 5LDDC 1SOVA 1F1BA 3LL7A 1T5DX 2C88A 2GO1A 1NE7A 3B3QA 1A97A 1NLFA 4RHEA 4ZREA 5FHRA 1MC1A 1XUOA 4OI1A 5EIFA 3QWFA 2ADOA 4Q4HA 5EI5A 2BBTA 3TM5A 3BUSA 3GGJA 2HU7A 2OQVA 2AQ8A 3USES 4CIXA 2CF5A 3MWJA 4NMLA 1DTWA 3FMFA 3NHPA 5EN4A 4IHJB 2VT2A 1F14A 1MC5A 1YBFA 3GZTB 1FRZA 3FWHA 1DARA 1GAWA 1GGVA 2R65A 2VP2A 3OA0A 5ER6A 2RGNA 3BF8A 4AKHA 2VJAA 4XE5A 2A9RA 2WE8A 2Q5FA 3D3NA 4P3KA 4Z9XA 3RBZA 2Q1UA 3RJMA 2VP3A 3ZWWA 1T1EA 1PT6A 1ZJYA 1LPPA 1KVSA 1SWWA 3MSCA 1JIIA 3UJ3X 1TAUA 1ZJ5A 4CKBB 1E5XA 2C84A 4MHSA 4YP1A 2E4ZA 3K8ZA 4AY4A 1GPAA 2X4GA 4EZBA 3NH6A 1VPTA 4P5EA 2J6HA 4ZU3A 4COOA 3UBTA 3H9BA 4RHUA 4WNAB 3CMCO 2BM0A 3PXXA 4FX2A 4PGFA 4TSFA 5AR1A 1KSFX 5FL7A 3ESBA 3SS8A 5COQA 3EFEA 3QE9Y 4QARA 1B6TA 2YR0A 1AGNA 3GLUA 3GFPA 1SY7A 1PEKE 5DM4A 5FKJA 5SICE 1GPBA 5C2JB 5KWSA 5YASA 4M3NA 2GUWA 1ZVKA 1UBEA 1YI8A 2Q0HA 2ZRDA 4JMPA 1OHHA 4PX3A 5T4EA 1NASA 1BSVA 2Z6VA 3IEIA 2N3ZA 4JJ6A 4CMEC 2ECFA 2WD7B 4JDUA 3MWDA 2D2XA 1CIJA 2GOYA 4XTCS 3GJ0A 1JSCA 3ZWCA 3I6ZA 3OF2A 1DWUA 1T5BA 2LDBA 2OV8A 3KLOA 4UUPA 3QPCA 1PYOA 3O74A 2VPPA 4D8VA 4AICA 3OLXA 5IJZA 5BSUA 1HL3A 3GRPA 3JSXA 3TMYA 4FUQA 4D3YA 4QOHA 1F0NA 5AI6A 5E6SB 3KUCA 3N76A 2X5OA 2H08A 4AG3A 4INJA 3RVBA 4E4YA 2B25A 2GXSA 1NHGA 4KUEA 4XKJA 3ZCTA 3R8FA 1EX6A 2IX9A 4NBWA 5HKKD 2OKGA 1YR1A 1M2JA 2UVPB 3G82C 2WHXA 1EB8A 2XZTA 3PVCA 2TYSB 4PHHA 2XCTB 3HSKA 4AECA 1JFLA 2GKGA 4KXFB 4TL6A 1XZQA 3OUZA 1DC8A 3OPVA 3HN7A 4LZLA 3WMEA 3KQPA 2IS6A 1M5TA 1PJLA 1IUNA 4N8SA 5CA0A 2JIPA 4LHSA 4KFTA 4RLFA 4EX6A 3K1TA 4Q3OA 2WTNA 3DBVO 3T1QA 2A3RA 2HLDA 1TFRA 4Q4AB 4XXHA 3L18A 3S1SA 3DW3X 3FGOA 4TYYA 4QFBA 2OY0A 4BGUA 5A7FA 1L5MA 1KMHA 1A98A 4WXEA 1BMFD 1OX6A 1GGKA 2NXEA 1R5JA 2PANA 2P9FA 3RSHA 4HZUB 3D2BA 5F3WB 3H9JA 1MAVA 4CTMA 2BKVA 2CDAA 3B38A 1G1MA 1YZUA 2J5QA 2CBZA 3HV2A 1L9KA 2YOHA 3DBRA 3QF4A 4IG4A 1V8BA 2WUVA 4TWRA 2XEXA 4Q9IA 4O4IB 1W5EA 4H60A 4LY9A 1BHO1 2Q28A 4FBMA 1DTSA 4DJ5X 3CQ9A 3OT5A 4J43A 3TLCA 2NTVA 1B42A 4DJJA 1L5LA 1MDFA 1I9GA 1V16A 2I7VA 4XJTA 3KK0A 4RFVA 3WOVA 1NMXA 1TE2A 2P9EA 2PS3A 2R6FA 3MYYA 4EUSA 3GNLA 2VT3A 2ZDHA 1PTJA 3B6MA 1L2TA 3OLQA 3S44A 1KZYC 1T6BY 3WB0A 2JANA 1GG9A 2O0HA 4FZ5A 4TLEA 5L3ZA 3AM1A 1XA4A 3LXMA 3QG1A 2CHQA 2VZLA 4C5BA 5C34B 1EJ0A 1Z8FA 2PRYA 1OZFA 1I4OA 5E2AA 2DZDA 1QDUA 4ARZB 3E9NA 2OGUA 2JFXA 1AK2A 3DZDA 3NHLA 5GPBA 3ZWYA 2DF8A 4OYLA 2RBKA 4R8KA 4DBLC 2YN2A 5EVJA 3ZEIA 2Q3CA 5F23A 2C57A 2P4HX 4LC1A 5KVAA 1CYEA 2ZRAA 4LISA 1HFKA 1HT2E 1XZKA 2Q5IA 3CH5A 3CNNA 3IQFA 3NHUA 3WNDA 4D44A 1EESA 3LC2O 2I6GA 1DJOA 2ETVA 4YNBA 2QI9F 3WLRA 4MEAA 2OR3A 1BGXT 2ZAOA 4OI2A 4PHFA 4NOKA 4FMDB 4LNUB 4P82A 2OXTA 1ESNA 1SRQA 2FB9A 4LVNA 1FDVA 3UKJA 2BGUA 5D7NA 4AZ0A 4TZ6A 1GZUA 1D09A 1SEVA 4EHKA 5KQRA 3BTSA 5TEWA 1E0KA 3BHIA 3NTXA 4ZVOA 5JFOA 4JC8A 3KNZA 4H6VA 1NM5A 5HX7A 1X0VA 1HE8B 4ZTBA 3HKCB 4ZV7A 1EVLA 3C3BA 5MN4A 1NA5A 5HFNA 3LUFA 3EUAA 3QBEA 5HOEA 1GTL1 1YI0A 3OHPA 1M3SA 2XTMA 4PBSA 2DHEA 2H4XA 4GR9A 4B40A 3REQB 4KMOA 4KSYA 3A6KA 5IEBA 3UN1A 4RIEA 5CD1A 1VLJA 4I1IA 1BJRE 4MARA 4BNKA 3IMEA 2WSSA 4CDRA 3VUFA 4CKCB 1KAEA 2BPOA 1CR4A 1OTYA 1LH0A 1R3UA 4KX5A 4NPCA 4MEJA 3AM3A 3L7BA 5ALGA 1FP1D 4RVNA 2Q4EA 4F4IA 4N3BA 1ABBA 1TTTA 1V7PC 1XDUA 2WT9A 1GQ2A 1G21A 1E63A 1OWNA 3LRPA 4JXJA 4XSVA 3C4QA 3IIMA 3QI2A 4JQOA 3ZE6A 1XCGB 5LD2B 3STVA 1KJQA 3TW8B 1CY8A 3A1VA 5EHGA 1T2UA 3HS3A 3VR2A 3L0CA 1LVHA 2DFVA 3P2IA 3F96A 3NT2A 3PITA 4LI3X 2LWIA 4QASA 3BBPA 4D9HA 4U5XA 5LU8A 3COZA 4WOKA 1G55A 5IT4A 4YR7A 2CY0A 2PRIA 1G9SA 2WIBA 2PVCA 4D74A 4E21A 5E3JA 5KSOA 1KC1A 3K73O 2GF9A 2P77A 4NDAA 2POCA 4GSYA 1UPAA 5DGIA 3WLLA 3LT2A 4X8HA 4CMIB 5ILGA 4GE0A 3RYFA 5JDIC 5LNK1 2WQ7A 2BW0A 1LV8A 3IKTA 1XPJA 1ZOOA 4GP6A 4L73A 3RK1A 1PIWA 2E6KA 2BRUC 2WWWA 3IP9A 1ZSYA 4FD2A 4LE2A 5IF3A 2HUPA 2PPVA 5TT1A 4BMVA 3IEXA 5KOYA 1U9CA 2EP8A 1K2VN 4QREA 2B92A 3UCEA 3LYAA 2CUNA 4HXYA 1CCWA 3DH0A 5BVHB 1SVLA 3GFGA 2XUDA 3SIXA 4N3NA 5CM2Z 3AHEA 3G8BA 5FD8A 5BURA 5MN6A 1QHYA 3HJGA 3DOIA 4KNVA 3TTXA 3FWNA 3DYIA 4IDOA 3RNLA 4U0KA 1MV5A 4ALJA 3A27A 1TO1E 2H5EA 1C3LA 3CBGA 4IG9A 3I5YA 3R9KA 3ZVRA 3L82B 1HXHA 1KO7A 3DOOA 2M1XA 2ORYA 1A2QA 4HAZA 3QBDA 3ZXUB 2HV9A 3IQZA 3PI6A 3DOHA 4YT4A 1P61B 2F9FA 8ABPA 4QHSA 4W82A 4EI8A 1F7VA 4IKEA 2ZR7A 5ER9A 3WLJA 2V6MA 3ZNQA 1S3SA 4PPYA 4G3XA 1Q95A 4KBGA 5BQ5A 3RBVA 3CVWA 1DKLA 1PUJA 1SXJB 3EMVA 4HFRA 3SZUA 4G01B 2HT1A 1A2OA 5GM1A 4UE3S 1J21A 2CVHA 2X15A 4B6GA 3V80A 2IHTA 2OMKA 4YV7A 2AX4A 4MQ6A 2XCUA 4NP6A 1A9RA 4KQ6A 4F9TA 5JNLA 5TMEA 2KI5A 4QKQA 1HDOA 4E3WA 5BV8A 2M6SA 2JLXA 1OZHA 2AFIB 1F0PA 1X2BA 3KQTA 3L8YA 3O26A 1SURA 2ZR9A 2V7UA 4JUCA 4KEAA 4GC9A 4OY3A 3SQOA 4BCDA 3R77A 1CVIA 4ZT7A 2PFSA 5BNIA 3MJFA 3KQOA 4GPZA 2H8KA 2C4TA 1GN8A 1T1GA 4XD2A 4D46A 4XEHA 3E8MA 3SKYA 1REQA 4C0QC 1L4HA 1M2WA 2AS0A 4FYJA 1RAHA 1P7WA 5AOVA 4J3FA 3T7IA 1RMTA 1IOZA 1Y4SA 1YCGA 5AHKA 4MWSA 4OJTA 5CCBA 3IUJA 1HQYE 3P8ZA 4HMOA 4L6AA 1CK4A 2ZXEA 4I66A 3T4XA 6AT1A 3RVRA 3LUPA 2AXEA 3OCVA 1N6NA 4Q01A 3WFIA 4ESOA 4R0MA 2DLNA 4ZZ2A 4KR0A 4AD8A 2ZBVA 1THMA 1X7XB 1Z6XA 1NX6A 2QL5A 2WUDA 4NH0A 5DMHA 4Z9AA 1GZ3A 1PJTA 3B2QA 4I3FA 3HM9A 2XNCA 5LBTA 4DW8A 4ENTA 1X1QA 4P32A 2QN7A 4C2TA 5CYFA 2BHRA 3REFA 3ROQA 3SNKA 2R8EA 4DA0A 4EJ6A 4AX8A 4TKVA 3OZAA 1QFJA 5IH7A 2ZSUA 1OTHA 4OMFG 1B1CA 3QNUA 3H4TA 5FOXA 1ZUHA 2YW2A 2NO5A 1Z74A 1HKUA 1U9ZA 3IDSA 3K94A 2JCBA 1XYYA 4TZKA 2ZT8A 3HRIA 3IJEB 1ODSA 2NWQA 4ZOEA 3KLPX 2XV1A 1DCTA 1W88A 3UJCA 3U5TA 3NS7A 4Y2GA 4QXPA 3O75A 1L5GB 1OXTA 1KVQA 5CFNA 3ST7A 2VT7A 3WNBA 4PSVA 2WG2A 4ACAA 2G7MC 5AW7A 5B5SA 4QHYA 5HE9A 4LZOA 2NSYA 5J2TB 1QZZA 1CUXA 4ZVUA 5K3BA 5CB6A 4PZYA 1XTQA 3CINA 4O4HA 1KQ3A 1X7ZB 2BFFA 2VPQA 4PXAA 4PZZA 4YHBA 5JNWA 2D3TA 1A7AA 3BXXA 4HPXB 1UFKA 4NMHA 4E03A 4YQFA 3JAKA 1M76A 3VTKA 3CURA 1II8A 1GZ4A 3EBOA 2BFEB 5IAJA 3DAFA 3D4IA 4AMVA 2P79A 4FJ0A 2JH3A 3LTEA 1KYYA 3NDJA 2H9AA 4GWGA 1J0EA 1UKYA 4JUFA 1AVTA 5B1EA 1M6HA 4RZHA 3RHFA 3HB0A 3LOQA 1HLDA 4G4SO 3ZR4B 2Z08A 3MUNA 1V5FA 5TPWA 1ZVMA 3DHVA 2Z57A 2F1RA 2AN3A 1ST3A 5REQA 3DLHA 1CWUA 2V5VA 5D1NA 4LZWA 1E0AA 2DGDA 2NUTA 4BATA 4GAEA 4EO7A 2Z5GA 5JXJA 4YROA 4UHEA 4CN8A 4DQLA 4P35A 1AQLA 5C4MA 1GADO 3D7LA 3MOGA 3RK4A 2PBZA 2PL5A 4HKTA 4O0MA 1IEQA 1H0HA 5FQOA 1R9JA 1ZH2A 3DHNA 4D96A 2Y99A 3LCMA 4UZSA 3SC4A 1WCIB 3ZDBA 1SZJG 1ID8A 2OCPA 3QGMA 3ENZA 1GU1A 1UKEA 3BJRA 3EZ2A 4LYAA 4XWTA 2W2LA 5ARDA 1RBZA 2B4QA 5HQTA 2JRLA 2R1UA 1TB4A 1T3GA 1C50A 3JU3A 3MCAA 1V4VA 2GLUA 2X6RA 2ONKA 3GLVA 4GOOD 4UEOA 4G0XA 4UDOA 4RDXA 4IP0A 1N8TA 1QGAA 1V5IA 2BD0A 2I1WA 4DG9A 1OZGA 1QWSA 5EIBD 3GT0A 3JCZA 5JCXA 5G1PA 3UH1A 1UBSB 2J9FB 3WJ2A 2VQ3A 3KZCA 2RHRA 4L8YA 1C5KA 1JBQA 2B30A 1RKXA 3OIDA 4BJHB 2C8LA 3KCNA 2BN4A 3SEQA 1QYWA 2IYQA 2ZCVA 1TI7A 2ZAIA 2ZU0C 2ASEA 3E2MA 3I6YA 1XP8A 2I9PA 3W2IA 4BTLA 1VKNA 1BKYA 3ANSA 4JU8A 3U3JA 2O0LA 3M4JA 3EAFA 1RC0A 5LA6F 1GVNB 1NONA 1VTKA 2HU5A 2GCEA 4JSYA 2Z5FA 3QU2A 1A9OA 3HLTA 1Y1TA 1Z4MA 3N39C 3TLKA 2B9VA 1D3AA 2AMJA 1RI3A 2YFQA 1TUIA 5TQ2B 3L7AA 3I6MA 5F1OA 1NOIA 2FP3A 2FPXA 3DM5A 4M0KA 3UHAA 5IJ0A 2GASA 2NADA 1DIAA 3JQCA 1FMFA 2YHUA 4YVFA 2HF2A 3B6KA 4F7DA 1MKYA 2A94A 2ZULA 4F8EA 3P2KA 4EBFA 2JL1A 4PXYA 1USWA 5ECYA 1D8TA 3O83A 4AJIA 3PS9A 1IHYA 1NUHA 3KR2A 4CMEA 1I3LA 1U0BB 1G3MA 5DYNA 5EWJA 4ARAA 4G25A 3ZCRA 5JCZA 2ACWA 4JLBA 4NIMA 2QGZA 4DV3B 5B1HA 1YE8A 3E5HA 3PUIA 1GOTA 3WRYA 3S2SA 2C98A 3EVAA 1Z4IA 4CQMD 1A96A 4Q1AA 1RZ3A 4ITVA 4EITA 2PKQP 1QHHA 2BMJA 2Q6LA 5DWVA 1ZGJA 1I0ZA 1MAUA 4K3UA 4AO7A 4C0BA 3WO0A 2FWJA 4O8CA 4RL6A 2OOKA 1V47A 2OZLA 3PQ5A 4GBJA 1DWOA 1JYFA 4K88A 4PN7A 1XDDA 3DOJA 5DULA 3QWHA 4R9UC 3FHOA 1OB2A 3QE3A 4DSZA 1ODKA 3OKFA 1CUYA 1L1QA 3ITDA 3WLOA 2FN9A 5ALYA 5KWJA 2MSEB 3LXXA 4AJ2A 3A1EA 1JJ7A 2YYZA 3NWPA 3MAJA 4Y2RA 1J2RA 3WHLA 1ZNXA 1JFRA 1DG3A 1QF7A 1L5RA 1E79A 1IK4A 4ZXPA 1ES9A 3VHXA 3AM5A 5FA6A 3U31A 1Y0BA 4C6TB 3U9TA 1V48A 4PM4A 4PZDA 5IJ0B 2JFQA 1V6SA 5EIOA 2D62A 4YJGB 1K7FB 4KE8A 2RHBA 2WE7A 4LJKA 1D1SA 4QTYA 1FSFA 5JBIA 2HZ7A 1VLVA 5M29A 1NQTA 1B93A 1LRLA 1XVUA 3G23A 3W5SA 5FO0A 1KP2A 2OG1A 4RY8A 4U2CA 3EXHB 1WXXA 3PXCX 4QGAA 3O0TA 3COJA 4JBLA 2HBRA 2ZQYA 5AP9A 5TC4A 3DVLA 1ZWLA 1R66A 2YZKA 2ZPUA 3I1FA 4IFEA 1X8KA 4GMHA 2G5PA 2J0EA 3G8AA 5AJYA 4BBZA 3IKLA 4MUHA 2O8BA 2W42A 4Y2SA 4L0CA 1KPGA 1QLWA 1KVRA 4E2YA 4MVJE 1OYWA 5F7XA 1MZPA 3G0DA 4ZRMA 5CLFA 2W5UA 4KN5A 2XDAA 3O8RA 1W48A 2Q6IA 3ZGLA 2WQ6A 1U7DA 2C2HA 2A9FA 3UWKA 2QVBA 3QEMA 4KDFA 3NPMA 4HX9A 1R8SA 4JZYA 1XTKA 3DMNA 1HDZA 2P4EA 1C1XB 4MKFA 3HVKA 4JJ7A 4PLYA 1C7EA 3O3CA 3DTVB 3UK2A 4D9EA 2ZB8A 4DYDA 1XNQB 3ZHRA 4DV2B 4BUJA 1AHNA 2X9VA 1SBYA 1BGVA 3GVIA 4OP1A 1BS9A 3EVZA 5EXSA 5AVZA 1KH1A 2VCYA 4OGFA 1EWQA 4CT4B 1CUJA 3NKFA 4GMDA 3PUXA 2BBSA 4TQUS 2R1TA 1DCKA 5L40A 4DQXA 1NW3A 5I7AA 5TF0A 4YDHB 3MD9A 1T13A 1X7YB 3VR4H 5HUHA 3ZCPA 5TLSA 4B3TB 3T3NA 4EPVA 4KO8A 3K4QA 4M8SA 4HGQA 4P0PB 3EGOA 1SUFA 1EBUA 1T9BA 2NXNA 2FWNA 5C8VA 4Z6KA 5FADA 2RHWA 1TCVA 4IF6A 4LGYA 5C5EA 3ENQA 4YXWD 3JVEA 1BD3A 2G0NA 2ERYA 2NO9A 3FTNA 3GUUA 5FYQA 3AQ4A 5TQ2A 3W5HA 1ZFNA 4F2DA 5L6LB 4D7AA 1NNLA 3A1UA 5L4SA 4B5KA 1D6SA 2G63A 4NZOA 2QP9X 1HL7A 4L16A 4A1FA 4CCWA 1UDWA 2G9VA 3PQCA 4A92A 3OTQA 4NC9A 3P0HA 4CGYA 3QSYA 4DXHA 1CQIB 2XVAA 2OCKA 1C0LA 1CZRA 4PN3A 4OXQA 4IUYA 3IILA 4QE3A 4R3UC 1DXHA 2QMHA 4IMIB 4IJQA 4JP8A 2LTAA 1TRKA 5AHRA 4E5VA 3CCFA 3BWYA 4OHMA 3DEJA 4KQ2A 1V11A 4J0EA 1XU4A 3OG9A 3PHJA 1HDIA 1OXKB 1EFKA 3A2MA 3TJRA 1JSRA 2BIFA 2P11A 2YYYA 2DT5A 3N0VA 4HDRA 1IVSA 2QRGA 3IJ5A 3VPSA 3OQNA 5EQTA 3EZNA 3SQDA 4TRMA 1ECJA 2C92A 3RK0A 5T8KC 4K5QA 1E92A 2YMPA 3I58A 3CWZA 3IBGA 3LKVA 1CY2A 3Q15C 1G9XA 1G20A 1RZUA 1L1EA 1IN8A 1W8IA 4H7KA 4OV6B 4Z5XA 5JC8A 1GTRA 2DERA 4TTSA 2O2GA 1ZN7A 1Q16A 1EUDB 2XA2A 3FXAA 3PRJA 4Q3NA 4CODB 1X3LA 2R4UA 4DIFA 1NJ1A 2XAAA 5TQJA 1NFFA 1SG6A 4BU0A 1CJTC 4D4LA 3UWMA 3TCNA 4CKWB 1R7RA 2YWXA 3LFTA 1RXEA 2Z4TA 2D2FA 2C8VA 4LZPA 1JEEA 3QIAA 3STHA 3U4QB 1KDZA 3AY6A 2HM7A 2C97A 2J59A 3DPSA 5AW2A 4H31A 3TMKA 2NV6A 4XB6B 3PEEA 2ZR8A 4OQXA 3MLBA 3KB8A 5B58C 5CHYA 4JQSA 1MD9A 3D6VA 4M1MA 4WOJA 2Y1FA 4J29A 3SR4A 4FNGA 3UK0A 3WHKA 3ZY4A 4AS3A 5FORA 3IL2A 3GLFE 1HH4A 2AN4A 3EH2A 1IB6A 1VIVA 1R6VA 2C7PA 1VCMA 3BX1A 1LDMA 1US8A 2MWMA 3X1KA 2YY7A 2Q1TA 3DQZA 1MPXA 1C1HA 3TZQA 3C3YA 2QPAA 5A6VA 3VKGA 3DL4A 4Q3EA 4U7HA 3LOPA 5K3CA 3NJ4A 4KVZA 2DLDA 4LBVA 5SY9A 5KOHB 1AUPA 2MMGA 2OM6A 2X2PA 1G8HA 3A31A 4P4NA 4CL3A 2DKNA 3CR8A 2HMVA 2W90A 2OK8A 4ZYUA 3VMMA 1UM9A 3U7QA 1UK6A 5BWCA 1N8SA 1MJ5A 3A8TA 3E22B 2JI4A 4LE1A 2YWFA 4L76A 1ZD5A 1K66A 2A0WA 4BB6A 3DDWA 1NL3A 3I04A 2I4OA 2NVOA 4K9QA 3H8WA 1KXJA 1OJLA 2ZIZA 3IGFA 5CLQA 3HWX1 4WGGA 4QXAA 1Z88A 2W2LD 4QGGA 4EYKA 3QF7A 3UPUA 1KY4A 1QU3A 3VKWA 1RBQA 5ALQA 4AJEA 1BTOA 1DLJA 1G5IA 4Q82A 4YCNA 1V8DA 2NM0A 3FNGA 3N07A 4BWGA 1HOTA 4GI3A 4GMFA 4QIHA 4J1TC 5CG2A 4A91A 2JAQA 4UM5A 5IDXA 1GRRA 3FNIA 3KCQA 4OKIA 4A5OA 4YRPA 1MCZA 1E60A 1HTBA 1VM6A 4P34A 2P3LA 1DXYA 1QH1B 3OF3A 2HIMA 4NESA 5EP2A 2PWPA 4ER5A 3TVTA 1JB9A 3LDHA 5CUQA 2Z6UA 1NV9A 1WXWA 2EW8A 1V39A 1XQWA 2XJ4A 3INTA 4FFRA 5E4TA 4F1KA 5ADUS 3PENA 3BYZA 1DIRA 2HPAA 2IZ7A 1N4DA 1RVDA 3ACBA 3F9IA 3K16A 4NU5A 2OV1A 1Q12A 4Y1RA 5H70A 1LV7A 2JFZA 3ZH9B 3ZW8A 3ICEA 3K32A 3DMTA 5C3UA 3IP7A 3CUKA 1ACLA 2RB4A 4GPAA 3UB4A 3GRCA 1FQOA 2VP6A 1LY1A 2Z2ZA 4WH0A 4BFTA 3FTEA 4OQQA 3B36A 2PUHA 3KEGA 3C3PA 1CUWA 1L3BA 3GA7A 4TLBA 3RKUA 4ETIA 3OTOB 2FDXA 4DB4A 1P19A 1DEXA 4EA9A 2CXRA 4PCUA 5MGNA 1XDSA 3C3KA 2JEOA 4RIHA 1N78A 1KSGA 4BBPA 3GD7A 3VOTA 5BUSA 1NPYA 1NR5A 3KPVA 4B09A 4EH1A 4FE3A 1CW2B 4XPZA 5EIEA 1FRFS 1N6OA 5GONA 3OSUA 2ID4A 3ZKWA 3VISA 3K0CA 3W77A 3FAKA 4E1AA 1XHFA 3A36A 1VP3A 4BCCA 4FLFA 3HJCA 1RT9A 2XNSA 4O2AF 1KMNA 4I1SA 4ZO9A 2OAGA 2DBQA 2CHGA 3K7EA 2PBFA 4TS9A 3EVEA 5LWQA 4G5OA 3X1WA 4GGPA 3CNLA 4XIIA 5SZJA 3X1XA 5BPHA 1ILEA 3WRVA 3ZD8A 2GKOA 2PUVA 2ZI3A 3EUEA 4MW7A 1SHUX 5HIIA 3JASB 4FEYA 2ZYAA 3E9YA 2I78A 1RFLA 5JS2A 3K15A 5HMMA 1NTRA 1C29B 2BR5A 1RWQA 3C3DA 1VJGA 4FHCA 1BN6A 2VPWA 4S0XA 1EXDA 2JGIA 5F1KA 4BX9A 1T1JA 5HSGA 1GDHA 3CVJA 2WFZA 1E7WA 3CX4A 4NFHA 4IDQA 3DM9B 4RTRA 2JGFA 3EGXA 4KFCA 1DKNA 5GV8A 3ME5A 1LEHA 1K92A 2VYQA 4CM5A 4LQ4A 2X0NA 5U9CA 5F9HA 2HCJB 4BBJA 3KJGA 4NK5A 1I2ZA 3PQ2A 1ENOA 4EQZA 3DDZX 1YR2A 4JLKA 5JFTA 4BMPB 2HA5A 4CI9A 2GZMA 1SPBS 1D7AA 2W4IA 4A0RA 1A2BA 4QFMA 3HNRA 1L6RA 1EAYA 3NIDB 5JS7A 4DM3A 2XXAB 3BFXA 3HO8A 1P7ZA 3EGDA 5CT9A 1K27A 2WAYA 5ISMA 2GSDA 1TM2A 1NP7A 1Z45A 1KQNA 3E8SA 4RTNA 1HNXB 1GTJ1 4QDOA 3HUEA 1TCAA 3DS8A 4XX0A 4BPRA 1R0XA 3LUKA 4B47A 1UT6A 3D0OA 3CR3C 5ANRB 4GHWA 3X2EA 5KNDD 3ESCA 2OCXA 5TJ9A 2VWHA 4ZV9A 4V0QA 4OA8A 5H4GA 1XMPA 1AS0A 2VYNA 4WSOA 4WFJA 4A15A 3ZHYA 3D8TA 3FR7A 2C2XA 2WVGA 4Q7MB 4RFLA 1D4FA 3IP3A 3KSAC 2CB0A 3TF5A 1V6AA 2GAIA 1HE4A 2Q6VA 1M2KA 2OQRA 3C85A 2R25B 1RQ2A 1J6UA 2B37A 1GA4A 2WIFA 1JBKA 3UT6A 1VJ1A 2AX3A 3Q2IA 2EG5A 4WOPA 1NVVR 2CYAA 1SCKA 1PF7E 1SUCA 5G53C 1JHXA 3WLFA 4PRKA 3A26A 3AIKA 2PT5A 5EP4A 3KYDB 4B0PA 3OVMA 2PKYX 2ILVA 1OH7A 4ZKEA 4B3GA 5AI8A 3E9EA 3BEOA 2A78A 1XZAA 2GPAA 2FRVA 4WFIA 1XD8A 3IBFA 4N9WA 3HCFA 5A4DA 3VU9A 3BMNB 3W79A 2OFFA 2BTOA 2XRFA 4MRRA 1XTZA 3WZ2A 4BO9A 4E1BA 3OPMA 3SQXA 4MWTA 2PV7A 1WO8A 2OHXA 2VHCA 3P7MA 4U3JB 1A9QA 1J49A 2D0PB 2R7KA 1QWOA 4ED9A 3L8HA 1K8XB 2AJLI 1TF2A 4PCLA 3QTBA 3BORA 1XP5A 1SIWA 1OX4B 2Q5JA 1RRFA 2NU7A 3D2AA 3D2LA 4J9VA 4X6UA 5KB3A 4LXXA 1EDZA 1P2VA 1IG0A 1GNVA 1IJFA 4IIBA 4CG2A 4G26A 4UAJA 4KDRA 1N1MA 3H2IA 4KLNA 4DTIA 1IEXA 4JT4A 2YXEA 2FX2A 4BGDA 3GEBA 3WGOA 5IUNC 1ODCA 3E81A 3EZGA 3R3JA 4MB2A 5E95A 4D4HA 4B4UA 3PDIB 1R8YA 1XDBA 3F1LA 4ZYWA 3BHNA 1CUZA 3IRUA 5IWAB 3H7AA 1QG4A 2RK6A 1YC2A 2PZAA 1H6BA 1G20E 3M6UA 4I4TA 1BWSA 2PD3A 3E4CA 4MOWA 1VRVA 1BVYF 1DBPA 1PSZA 2EBUA 3UOGA 4DNFA 4PO8A 1N7HA 3HU5A 1ESDA 4MVJI 3ZG6A 5IANA 4Y30A 2XE8A 2W71A 2Y76A 3BXEA 3IS3A 3LA6A 5JD3A 1YQ9A 2I2XB 2QAJA 4BFLA 3M1IA 1NRXA 2ZATA 3SN6A 1CNMA 1SKQA 1NG9A 2FEPA 1G6KA 1K3TA 4DGSA 3SZLA 1YR8A 4IVRA 4OOFA 5J5AA 2E87A 2FI1A 3KU4A 1IXSB 1U11A 1YCHA 2V5AA 3BTVA 1GSHA 3NDIA 1YO6A 1RPZA 1FW6A 2LCIA 3DJYA 4X8OA 1RAAA 4DV1B 1YL5A 2HA3A 3O8OB 1PL7A 3AZPA 4UXJA 4BRUA 1L9XA 3NKLA 4G0VA 5MN5A 3W9UA 3H17A 2J9GA 3NU1A 2VC2B 2GTHA 4C89A 2GHIA 4GOXA 5LBIA 4EA7A 3A6ZA 1IAVA 3MXTA 2FP4A 3U4GA 6LDHA 1GRQA 4DV0B 4X1KB 4FN4A 3N5CA 3HE3A 3D5QA 5LOVB 1IQRA 3H5LA 3VAZA 1AKTA 1A9TA 1R0ZA 3FCSB 4Q03A 4B6EA 3DV9A 2DY1A 2IIBA 2WABA 3LKDA 3V7YA 1PNTA 4CN9A 3DDSA 5E6SA 3GP5A 4D3SA 3HLKA 4NU6A 2FZ5A 3T3PB 3N6XA 4HNAB 4G2TA 1XPOA 5E9JA 3FLAA 4Z3DA 2A14A 4XI9A 4JYAB 3FPHA 2DXIA 3E8XA 1EU1A 2HHAA 5ES4B 5FO1A 2WTEA 4H1HA 1RLIA 3FHTA 3VYSB 3C48A 5I7UA 3FPCA 1PS8A 2JHPA 2Q4RA 1S8OA 4WBNA 1TOAA 5JSQA 4R7GA 2OL4A 3WIUA 2QI9C 3O4IA 5G2OA 2DWPA 4Q05A 1CX9B 4MV7A 4TL9A 3I39X 4YMIA 3D59A 1XWIA 3LDGA 5HBRA 2PN1A 3LPAA 5C5CA 3AXTA 2QL6A 5EZQA 2IBSA 1XVTA 2J9RA 3ZDFA 5EGSA 4IIJB 1GO2A 1XRRA 5NULA 1ZRNA 2IIVA 4CQMB 2GPJA 3CF4A 4GQIA 2GBFA 5ERGB 3O9MA 2H1OA 3STUA 4M55A 4BO8A 1IWPB 2PQ2A 2UVQA 4BRWA 5K7SA 4OGGA 3O95A 1RYHA 3OQVA 2G4VA 3H87A 5LDHA 4YLYA 3HMQA 1ZITA 4F93B 2G28A 1X42A 3PHBE 1FX0A 1OI4A 3TYXA 2IHJA 1NW5A 1TECE 1B2RA 4ZICA 1DJPA 4Q16A 2H57A 1T34A 4PNPA 3O4RA 1A8UA 5AKYA 5KQLA 1E59A 1V4BA 1QFSA 2W2KA 1JNYA 3DPUA 4JB8A 5CLHA 1HYGA 2JD2A 3CF0A 3S55A 5CB8A 1F4LA 4O25A 4ENRA 2PZEA 3CZAA 3LT1A 1JLLB 4MUFA 2JJYA 4YMHA 4YP0A 4AULA 2OUKA 1MABA 3ODGA 3OEHD 1DTWB 3LY9A 5E3HA 1QYXA 1YQGA 1CY6A 1WP9A 2QMZA 3ZXSA 1Q1GA 3O82A 1U8EA 4O1MA 4A23A 1F8FA 1M8FA 3V33A 1FZQA 1EGVB 5ICMA 1RLTA 4QUBA 4RTKA 4NS1A 1ZIXA 2BFDA 2ZUDA 4M49A 4F1WA 3H5VA 3T1HB 4PQFA 1RVV1 3AOEC 3OUUA 4HNGA 2DM6A 3R3ZA 4IWYA 1BE0A 1PLKA 2A4KA 5JMWA 1AZTA 1SQ5A 5HZKA 1JR6A 2ERCA 2B2CA 4LBYA 3GA5A 3QQ5A 1QQ5A 1JPJA 1Z73A 3PXUA 2HY7A 1PDVA 2IY9A 2C7OA 3HPQA 2BCEA 3ONVA 1D07A 2JW5A 2J46A 1X3SA 1FDSA 2BFAA 2HSJA 2Q8NA 4RIIA 1BOOA 4QG3A 5EJ8A 4I6JA 1DIOB 3I92A 3BZWA 5FBQB 4AO6A 2BEVB 1O97D 1EHIA 1WXEA 3BXPA 3ZEAA 1KNXA 4PLGA 3C1UA 1H3NA 4ZOLA 3SS9X 1LUAA 1T24A 4PVCA 3OUTA 1CT9A 1TJ5A 4FEGA 3V1NA 1WSBA 4EKGA 5BWBA 3RTCA 3ELBA 4K86A 3TW6A 1DX4A 3S70A 1GR1A 3OA2A 4G0YA 3ONDA 4UEWA 1UM8A 4L15A 4J0IA 3DW1X 5G02A 4BIMA 3PLNA 3AT1A 3DCIA 4Q4JB 1K7EB 4BNFA 1RYBA 3G6KA 4R2JA 3DEIA 3H5OA 1A5SB 2O3RA 3C5CA 3PDWA 1DNPA 2PGDA 4HN9A 1WMDA 5ERYA 2CSXA 1PW7A 1QG0A 5HVNA 1ZH6A 2A0XA 1L3IA 3BD6A 3HC7A 3L4BC 1P1FA 2VZ9A 4WY2A 1ACJA 2E6UX 1SXHA 2I3BA 3PFFA 4RFSB 3T5TA 3ZDXB 1FFCA 3EMKA 2FG5A 3OI7A 2D1SA 4XD7A 4CHTA 721PA 3A2NA 1J8YF 2CMKA 3O4JA 4RTPA 1USIA 1N8KA 3AJ8A 4CXMA 3NCTA 4ZDJA 2YWEA 1Z2DA 5ADWA 1A9YA 1KR5A 3QA3E 4B2YA 3IJRA 5K09A 2AFVA 3Q9LA 3QXCA 4F3TA 3BWBA 5A04A 1FXWF 2QVXX 6NULA 4KPEC 1S9DA 5GOZA 2CFIA 3QYJA 4XVRA 1Z4PX 4ZC1A 3VTAA 3AR9A 4L5JA 4IGAA 2P4QA 4AG6A 1UAAA 3ETLA 1JLSA 3OAAA 3MXOA 5CT6A 3RYHB 1W44A 4YYZA 3GI1A 1XRSB 2NQ8A 2RMKA 1XG5A 3G5LA 1RHRA 4YLGA 4L0MA 5F5NA 5GGXA 2V5UA 1EEXB 2DBVO 3BJEA 1C8KA 5IFLA 5JJ5A 4YP6A 1EM8A 1A9XB 2V7QD 1BXKA 2X5KO 3D8NA 1OI3A 3QMWA 3I28A 5DWQA 2GLTA 5IVKA 4HOYA 3BD7A 1UBRS 2GBGA 2JRCA 1ZC4A 5IC6A 3RVLA 4AF8A 3UENA 4JS0A 3RADC 3INGA 4ZOAA 1NFRA 2AKYA 2FZ4A 3KPWA 3HYNA 1YC5A 3PE4A 4W9MC 1TZ2A 1A76A 5IM4A 3KSMA 2AE1A 3IAEA 1G8YA 4PPNA 3IDQA 3FSGA 4M0DA 4O4LA 5AHOA 2JHGA 3E1KA 4UTVA 1A1SA 1JA1A 4MIYA 3FD8A 2DH6A 2LD4A 1VIYA 3A70A 4F7WA 3RYIB 1GAEO 2JVIA 5IHPA 4KVFA 1SGWA 2E3JA 1JW9B 2DQKA 2V8OA 5P8WA 3U1BA 2IZ0A 1PV1A 3FUTA 5AVJA 3BQMB 4W5JA 1FYVA 1J2YA 1AGXA 1JA9A 3IHLA 5AHWA 1JQ3A 4GEKA 4IHKA 5EP1A 2BEVA 2GESA 1ZLXA 4IVPA 2OCBA 1QE0A 1RS0A 3ZYZA 4E4TA 5AOAA 2O4UX 1MNQA 1FQKA 2ACVA 3ZQUA 5DFAA 1G98A 3BIOA 1N0WA 5DXAA 5BR8B 2A92A 2KBEA 3C8ZA 1KERA 1MB0A 2X19A 3HDGA 4QYWA 2ACKA 5I4CA 2HN9A 1ZHOA 5F9FA 4LYFA 3O1HB 3ZV3A 1S8FA 4MWEA 2PUWA 5C37A 2PKCA 1NC3A 5IJ9B 4HEA1 3OF5A 1B6SA 3OD1A 1LTKA 1V5EA 3IAHA 4XDGA 3RSFA 1U28C 4W63A 1FFBA 3LYUA 3TDNA 2CJWA 1L5WA 1THZA 3QPWA 5LZ2A 1EFVA 1Q15A 5K05A 4H17A 2HB6A 2J48A 5K4AA 1L4NA 3B7PA 2Y4NA 3BMCA 2ZJ0A 1JU4A 4REMA 2FR1A 3HVRA 2NZVG 2XE7A 4OSPA 3DBOB 3E1SA 2I6FA 1TZJA 1AMUA 3WADA 4Y2JA 2DE0X 1XT6A 2KLBA 2PD6A 1GPNA 2QPTA 3RUAA 5A5FA 1KEPA 2GEKA 4QWWA 5L95A 4LRWA 1E9FA 1KOFA 4O8ZA 3UPTA 2A5YB 4AN4A 4J76A 4FW8A 1TJPB 4UASA 1I1HA 2R2AA 3TFWA 1NXSA 5KNBH 2GJ8A 2HA2A 4ZVQA 3UGTA 5EAIA 4M83A 4NBNA 2GILA 5IJXA 5DGHA 5EJ2A 5IBCA 2RGBA 1N2CA 1WB6A 3WV4A 4ALMA 2FQQA 1JZQA 1YBVA 2YY5A 4ZMSA 3L5KA 1FIUA 3KP1A 1N7JA 3S2YA 3T0FA 3VXKA 3U0BA 3V4FA 2CMDA 3N2KB 3K0SA 3F5MA 3FPKA 4MRSA 5JPDA 2C2WA 4AJ1A 2Q2NA 2QP4A 4QZVA 1MG5A 4GMGA 1O2DA 1RHUA 2FF7A 1BROA 1MENA 1J07A 1OVGA 2AR0A 3KEQA 2H4ZA 4ZEWA 3IEVA 4YMWA 2FCRA 4AQ7A 3FZQA 1FP7A 2HDHA 1OXVA 3HXKA 1EUZA 5HOQA 4ZPXA 4A8PA 3AQIA 1A72A 1IZ0A 1Z2AA 3CTMA 3QOYA 1QZXA 4G1BA 4L07A 4Q02A 4GZMA 1W5SA 2ZJOA 2HLDD 4S1OA 3ZZ1A 4WKPA 4B8YA 1NPTO 1KI6A 1I1QB 1E9CA 1Y9AA 1RPJA 3EMDA 6REQA 4QUEA 2FSVA 1PJSA 2HRRA 4WLFA 5CT8A 2K87A 2VQSA 2Y77A 1ORWA 2Q07A 3AEKB 1TQ4A 1ZWKA 1YB7A 2JLAA 2R5NA 3L77A 4QYXA 1XI2A 1J00A 3CKLA 3IHTA 3RARA 1V3VA 2LV8A 1SM4A 1CKEA 3GT7A 4L4YA 1UMCA 3L2OB 1E96A 1H2YA 3TKYA 4X7BA 3A9WA 1E69A 3Q8WA 1IL0A 4XZ3A 2XRZA 3NR2A 1RMQA 4CMKA 1WMFA 3FGZA 4WAUA 3GCWA 1X80B 3MQ4A 3ROEA 1ZA2A 2H3HA 1EYZA 1UP7A 3D6FA 4BX8A 3UC5A 4XRGA 2KPOA 4HL6A 1T2AA 1V6CA 4NNOA 2WT8A 3DEZA 3E3MA 1NI3A 3FWKA 4RK4A 4EFMA 2WJAA 4KSCA 1MVNA 1PWXA 3EPHA 1WHTA 4UJ3A 2IEBA 1UFVA 2Q9UA 3OP1A 4YRLA 1MIHA 1RKUA 4MJ7A 2Q46A 5KTMA 3IB6A 5CIYA 2G1JA 5FT9A 1KMIY 3HP7A 1YGPA 3L6OO 2ZAYA 1H9AA 3TTVA 5BVGA 3QELA 4FGWA 2NZ8A 3LNTA 4NYMR 3C4JA 2WHPA 4GPEA 3KQYA 4GIBA 3L6CA 3G2JA 4OFXA 2GBPA 3CLKA 3ZQ4A 2QTRA 1V7ZA 2P35A 2ZFUA 3OEED 1JEOA 1J2TA 1N6PA 2FSVC 2O2EA 4UE6A 4YX9A 2O8FA 3J81k 3SLGA 2FSGA 1E2HA 1VG1A 4EW1A 2ZU6A 4IRMA 3I4LA 3SXUA 3T38A 4LDZA 1COWD 2IC5A 5SZHB 4HS4A 1P0QA 3N86A 3OJFA 3RUHA 1FPMA 2XVYA 2WKSA 1D5CA 3G1UA 2YUTA 3OJ0A 2VUIB 3HCEA 1SC1A 3KYBA 4JEMA 4M8LA 3JYOA 3FYUA 3FPGA 3K9QO 5LNK6 4Z99A 4J6FA 3QHAA 3DVAB 4JSTA 5AW3A 4K6OA 1OX4A 4P4LA 2ZSKA 1RHMA 2ZWOA 4XOUA 4DXAA 2WHRA 4EMTA 3E7DA 2C9MA 4WT7A 4PAMA 1MO6A 1P31A 1VL0A 2B5VA 2P9GA 3PA6A 4CV2A 1G2OA 4G1MB 1TJNA 1QV9A 4QOSA 1PKXA 1QX3A 1FFHA 3AEZA 3VNQA 1SULA 4E32A 1TO6A 3C74A 1OKKA 3DDUA 4HDNA 3H84A 1Y1RA 1X7HA 3EOBI 4WVFA 3C45A 4YCBA 3GVCA 4LHZA 4ZYYA 4R01A 1NJ2A 1V37A 3KYDA 1U04A 3BCUA 4RABA 2VQ6A 2IP1A 1F6DA 1KNQA 3AP2A 4WDRA 1YONA 3PQ7A 1RACA 1SAYA 3BAFA 4AP5A 4CG0A 4DCJA 2PUGA 1IQPA 4FXPA 2IH5A 3S5JA 5PGMA 3EA0A 4EG0A 3RTDA 5AYVA 1I1OA 1I9CA 4IEEA 1FMTA 1SUIA 2FLWA 3HDVA 3DE3X 4GI7A 5AUQA 1JPVA 2BGJA 4YAOA 4OK3A 3NEPX 1JS1X 1YK0A 5AMXA 1ITZA 3C14C 3ONEA 5EUMA 1PCXA 2KQUA 2NXWA 5LQMA 3JQFC 2VHEA 4KLRA 1DT5A 1TMOA 3DUFA 1IJKA 4FC7A 4ZI7F 3HKDA 2OFXA 3QVGB 1L3CA 5I9NA 1NW6A 5HS4A 3QKSB 3R3YA 3RVOA 1VYHA 5LQKA 3VJRA 5LYJA 1P80A 2C2ZA 1DC6A 1FXUA 3TSWA 4X5OA 4JJGA 3U4AA 3ILHA 1VSTA 3QKUA 1HLFA 3DEAA 3FOAA 4I1YA 3MQ2A 3NM4A 2LDXA 3WL4A 4BQIA 6CHYA 2DCMA 3CT6A 4LQLA 2Q2VA 1H8EA 1GR0A 4HZGA 2WFLA 3QVVA 1AXRA 2P2SA 4UVIA 4HNHA 4UBLA 2HDWA 5BN5B 1OXMA 1HSZA 1EQUA 1Q1AA 2XUHA 1W2GA 5FF9A 1YE5A 3ROPA 1FVHA 5JQGB 3ICPA 4K6CA 2YASA 3SHVA 3WJAA 4LMPA 3GVXA 3HJBA 1JQEA 3H75A 4MTLA 1LLQA 3BAZA 3HFJA 4JAVC 4GMKA 1MPTA 4LOHA 5CX1B 2LE0A 2QSZA 3E9DA 1C7FA 2O07A 5D6OA 3GX1A 5LJIA 2JLSA 2CL7X 2P30A 3GGSA 3O1IC 2CXSA 4HAUA 1V43A 4Y67A 2XYQA 4XQ9A 3IPRA 1EDEA 1KE2A 3IDOA 221PA 1KZGB 5I9LA 3AF0A 3H5RA 4MKIA 4RJJA 3D6TB 5FPPA 2IYWA 4CTNA 3HBFA 1XRLA 3KHSA 5FUVA 4C43A 3PT9A 3FKQA 2IFTA 2IIQA 2PZKA 3EWIA 1QYIA 4BRZA 4BNZA 1DELA 1ZGHA 2EQBA 4CU5A 4L72A 4E15A 4ZMRA 2XWQA 5TF4A 3JVUA 3UAZA 5ITVA 3RHSA 3LECA 2ZRMA 1M8GA 2Y1OA 3I1JA 1JL3A 1U2PA 4V0OA 3P9PA 4K1LA 4AJHA 3PC7A 5SY6A 4GP7A 4N7RA 2Y05A 2QQFA 2PT7A 4HYQA 3RFCA 4BGVA 4QBIA 3WK8A 3THYB 1ABFA 3DONA 2N46A 4M2LA 2AH5A 4QEZA 1QYVA 1RKBA 2OZKA 4F91B 5IVPA 1VXRA 3WQQA 4A2PA 1CY4A 1UJBA 4BJ5A 2JGAA 1NQOA 1PK7A 3MC1A 1JLKA 4AY6A 3FRJA 3AR7A 4LA4A 3PFIA 2J0UA 3K9BA 1NKSA 3WX0A 2FFQA 2BBWA 4YMGA 4LF4B 3NALA 1ODFA 1JPNA 1BVUA 3SYNA 3EC1A 5KKAA 3ZWQA 4DCTA 4EF4A 5FH9A 2G83A 3U4CA 5HK9A 1C2YA 2FPMA 3BE8A 2HSZA 4QQKA 2XWJI 2NYRA 3R0QA 2GEUA 2IV7A 2QOEA 2B5OA 3KM0A 1IOLA 1OLOA 4G0ZA 4PGAA 1P9OA 3O8CA 1QCYA 1C1DA 4K9DA 5HR5A 1JR3D 3A04A 4D3ZA 4DREA 16PKA 1V45E 2HF7A 4R1SA 1EJ2A 1RYMA 1T5TA 2GA9A 4M8KA 4C0AC 4UTPA 5BMOA 1UKCA 4JITA 1K0UA 4QYTA 3CC8A 3M3DA 5LMZA 2FUCA 4NX2A 2A8YA 2F2TA 4MR7B 3OIYA 8LDHA 5K5EA 3ADBA 4CCSA 5AKLA 2ECQA 3QYFA 2X0JA 1H3FA 1HI9A 3LY5A 3OT4A 5EKTA 5LXTA 4FYHA 2VRBA 3KSRA 1PJBA 2J1LA 1C1YA 1EP2B 2AZMA 2GN9A 2QX8A 2X3FA 4WZBA 1R4MA 1PZGA 4O4JA 1NJ5A 1MC4A 2QZPA 1OI7A 4YASA 3R7WB 2RE8A 1EXNA 2O2ZA 3JWEA 4MQEA 1UADA 3DT6A 2ZYDA 3QWAA 3UY4A 2C00A 3T3IA 3IVMA 3L6RA 1XZDA 3RYCA 3FNEA 2R48A 1DQNA 2YVLA 2I8AA 1ISMA 1O87A 4MUAA 5D01A 4B33A 4FS3A 1Q44A 4MAAA 2H16A 5BQPA 1KMQA 4D43A 3ZH2A 2E4UA 3AR2A 5J2UA 3FDZA 2VATA 2BP7B 4QBHA 2OWEA 5KO2A 4YCLA 4QYIA 5DIFA 1FFXA 2PSJA 2A5GA 3S1LA 5EIAA 4TWZA 3VAAA 1V25A 1FDUA 3AGPA 3NHBA 3PPIA 4X84A 3AMVA 5FNVB 4ZN6A 5HJ7A 3SC2B 4WV3A 5IFKA 1YK1A 2O8NA 3ZUGA 2RAPA 3GJ7A 4OHOA 2RJNA 4LAFA 2JIRA 3H8VA 3SHOA 1W9MA 2H11A 1ZJ6A 3V97A 4DNOA 1TU0A 3KUKA 1Y48E 4PTLA 1BMTA 4J90A 4KO4S 3GJZA 1SD2A 4M1ZA 5DBFA 3EXEA 4QU5A 4WX2B 3CX3A 5D3MA 4CRWB 3FPEA 3ONFA 5FLYA 5IXYA 1WE2A 1DQPA 3A0UA 4MEBA 1IM5A 3EIEA 3I12A 4P36A 1D4AA 5TARA 2BFBB 1P1JA 2CV0A 4G56A 1FDWA 4I5DA 3R9XA 3GBVA 2I34A 3E05A 1NUPA 1RJ9A 1LDYA 3QHPA 1AC5A 1QOPB 2PRZA 2H1VA 4YAFA 1JT9A 4LC9A 4RVHA 1PZHA 2C9YA 1K6XA 3T3EA 2BEWB 1I3NA 4LJLA 1P2TA 5CA1A 1JHDA 2YV3A 1SVNA 2V7PA 4B76A 5HJ2A 1KH2A 5HDBB 1I4EB 2UZ0A 3EIUA 3JRNA 1C4WA 3RE1A 3K4HA 3EDMA 2VQDA 1NIJA 3L4JA 1JSXA 1IOWA 1EJ6A 1H3EA 5HJEA 2UUAB 5HIKA 4ZP1A 4MB6A 2GNOA 3AKCA 4CU2A 2ABWA 3ZDDA 1E2KA 3PP8A 3QOFA 1Y1QA 3HUDA 1EIZA 2PDAA 3NTLA 3QKIA 4HEHA 4EKEA 4OHBA 2D5LA 5KTYA 4P7FA 1CR0A 3QBJA 4P3PA 4BVLA 3HABA 2VZ0A 1KEVA 1J99A 1K75A 2QRLA 3RIMA 2O0JA 4B3JA 3K6KA 4L78A 3WP1B 4P54A 4JP3A 2GK3A 1T0JB 3NM6B 3O21A 1LS6A 3K09C 1MTOA 1FU4A 3WK6A 5CDUA 1VZ3A 5JH7F 1SIUA 3PZBA 4WY5A 4ZYLA 2FPRA 3ZY2A 4MXDA 3ETNA 1T9GS 1FMJA 3NAMA 4H4EA 4MS4A 4E09A 1NJ8A 1JHVA 1GL7A 2IOFA 2ZP1A 4OB7A 4G37A 1NM5C 3GAAA 3B5EA 5IN5A 4PHTA 3QLJA 1JR3A 3STYA 4ZCTA 5HRCA 2H63A 4MO9A 3QUQA 1R0LA 2IW1A 2H59A 2EGGA 1GQFA 5U4XA 1HBJA 1BMDA 4GL4A 4TWJA 4Y6QA 4ZZ3A 1WTCA 3FROA 3HB5X 4CLRA 4OU5A 3U09A 3JQRA 3HXQA 4L02A 3RDPA 4XGNA 3SAJA 4B4DA 2H1HA 5IUJC 4GL2A 2DR0A 4MMYB 1HNNA 1CEQA 4KJZA 1QZTA 4EPXA 4AZSA 3B1ZA 3N2EA 4PAOA 3LUGA 5JS8A 3B2NA 1UEXC 2XDQB 5L4NA 4R31A 3B7GA 1G5TA 3IUQA 5KSYA 3L8ZA 3QVOA 2QKYA 3AHDA 3FDIA 1ZXXA 4GU5A 3V2IA 4B44A 4BASA 4ARVA 3HA7A 3IAS6 4JKYA 3KKLA 3KWLA 3N2GA 4FLMA 4EAAA 1R9GA 1E1MA 2FGKA 1FYWA 4C0KA 3KAQA 5I7RA 4EG8A 2P68A 4OHYA 4B7AA 3KXKA 4CT0A 1MOSA 1G7CA 3FZNA 4MPJA 4DV7B 4R68A 4I7EA 5AIAA 1JHPA 3L7DA 4L8FA 2GI4A 5BMVA 1LK7A 1MEEA 2WINI 2FE1A 3CLHA 3TQIA 2ZBDA 2Y0EA 1P4HA 4URZR 2WYUA 1WSDA 2P6OA 4KZPA 3AP3A 3DXXA 1P8JA 4O2BF 1GCOA 4OJNA 5BV2P 2IYTA 4WERA 5DIZA 4AK9A 2AG8A 2QQGA 3WYDA 2ZTMA 1THTA 3ILXA 2RAVA 1R6BX 4UOEA 4W9RA 4X92A 4RNDB 2WF6A 2HNAA 2O7RA 2P9TA 3EXHA 3RJZA 3PDHA 4CKEA 1STOA 3L0DA 2D1FA 2Q3HA 2Q29A 3BB1A 2GS9A 3BTOA 2FW0A 1XQ6A 3EYWA 2YVAA 5KYVA 3U3ZA 2Y1XA 3QLVC 1CY1A 4DTCA 4Y0NA 2JLYA 3NVKI 3VKFA 4L08A 2NZWA 3SM3A 2ZYUX 4AXBA 4O5OA 3B1VA 1WQ4A 3KB6A 2QLMA 5IDVA 5ULLA 3JTMA 4GLOA 1T9KA 1GLGA 1HMPA 2NZJA 4OMDA 1BEZA 1EZ4A 3GLKA 4JBNA 1DSSG 1H2AS 1LBIA 1TF5A 4ZCLA 4CV3A 4FPXA 2ZSEA 1MAHA 1PVDA 3CBQA 3QYAA 4NU0A 1NXWA 4BV8A 4BEJA 4CQLA 2WPDD 3DSRA 4NE9A 3DL0A 1RTKA 1CTQA 3T9FA 3LY7A 2GJKA 1V3TA 2AE2A 2R8ZA 1ZUNB 2XLBA 3GT4A 3QSGA 4J1NA 4DDMA 3OZEA 3DDHA 4Y6OA 3H9GA 4FFBA 1IY1A 5JSKA 2H0AA 2P67A 4HQKA 3QLUA 2H4JA 1W34A 3UMRA 3CWCA 4ACBA 1YJAA 4KW7A 2ZYSA 4LSGA 2WWVD 4AU1A 1H1DA 1XSEA 3CTPA 1Y9ZA 3S1AA 5JQWA 2CDCA 3ENWA 4KX3A 4O2BB 4Y9SA 1Q7EA 3PFWO 1W6RA 2ZAGA 1P33A 5KC9A 3MWLA 4IVQA 1WOYA 3BGOS 3PNOA 4TXHA 5COBA 3GLGB 5DX0A 2OAQ1 2A0UA 4AS1A 2NUPB 4P0TA 2XA1A 3H11A 1JX6A 4LSWA 4NARA 2LNDA 3ESDA 1LLUA 1R00A 2M6KA 3SOPA 1D5WA 1ZSNA 5F35A 2RI1A 4EQ6A 3Q2OA 3SEAA 2ID8A 3B5JA 2PGAA 3TQTA 2YH2A 5GZ6A 2VEDA 2VNSA 3AB7A 4CT5A 2EZTA 3I9JA 4HP8A 4A2QA 3A14A 3FCOA 2NOAA 3MBOA 1TEZA 1BCRA 4L85A 5DNDA 1O95A 3ES9A 1R0SA 2RHMA 4BTEA 4N7JA 3UTDA 2AJBA 3QPVA 5HDQA 4MCHA 8ADHA 4WD3A 4ISCA 4GKVA 4GLJA 4UCWA 5AT1A 1K06A 3W3AD 3SQNA 1L5YA 3RWOA 4GM4A 4NULA 1P77A 1NN5A 2XOKD 1BGWA 2OM2A 4JT2A 1VGVA 3ND9A 2RFLA 1I24A 5AKEA 4IJUA 3FVRA 3WL7A 2JA1A 1SBHA 2CXQA 2IF2A 4NFLA 2I67A 4CMBA 1MO3A 4LYJA 4KYUA 3WLQA 4WZZA 1WHSB 3NAGA 1ND5A 4JK3A 4JVMA 4M76B 1ZNYA 5ESXA 4ARBA 4BNGA 2OP1A 4E94A 3BSWA 4JGGA 2POQX 4B48A 2IYAA 2AFHB 1UK9A 3FPBA 1O96A 4LYEA 3ZHCA 2BJHA 1PG5A 2NTJA 5I7FA 3EZYA 3ZE9A 4DIBA 1DRUA 1CF4A 5DE3A 4OYHA 4RDCA 4A10A 1GCGA 1KO5A 1WCV1 1L5HB 1PK9A 1XOIA 2P7HA 3EQ8A 1ZM9A 1LS1A 3COSA 2IDMA 4WCFA 3VOAA 2Y92A 1JHMA 1RCFA 4JI0B 2HL6A 3UMCA 4J16C 4NYIQ 1DZ3A 1TX4B 2WJWA 3PUYA 1P44A 2G0TA 5CNJA 4HDKB 2WIAA 4KWTA 5EXDA 4U7DA 1JDSA 5DCUA 1U0LA 1ABEA 2CKDA 1L7QA 2R79A 1K7CA 4FE7A 4KMMA 3RIHA 4MYRA 4RF3A 4RH0A 3P9SA 3OFND 3QA9A 2OXCA 3EG5A 3ET4A 3K1ZA 3SJUA 4QDTA 2J5KA 3BDAA 1GNTA 3C5WP 2FSUA 4ZTUB 1XFAA 1TUBA 4FIZA 4R71A 3ACCA 2QN2A 5JSZB 1N25A 4YRDA 2X7HA 1ARZA 3JD2A 1T4CB 3F2VA 2O8DB 1HEUA 4HAWA 4EFDA 2GR9A 2IITA 5TPWB 3TIGA 4V1CA 4W9NC 2OUIA 4FWBA 4MVJA 2ZM6B 4BEBA 4LOKA 5C7LO 4H3KB 1TTHA 2VHJA 4B85A 1OT3A 1YRHA 3NEYA 4IQ8A 4KJXA 1KDOA 2GXAA 1TIBA 2EF1A 5KMGB 3L7CA 2BTQA 2IH2A 4ZVNA 5A03A 3Q85A 4FKZA 4L75A 3PG5A 5AI0A 1EUYA 3JARB 4F2GA 3EW9A 1TNDA 5KJEA 1J0CA 5ES3A 4NNJA 5F77A 2F8TA 3HO1A 3VNAA 3TTTA 1Y3HA 4FQ8A 2PUBA 3ISVA 4YJHB 4RZQA 2V3CC 2XNKA 3FDXA 5KVVA 1BYUA 1B2LA 2ADMA 2ATCA 2YW9A 3T4EA 4BN0A 4L5IA 10MHA 1C9DB 4B71A 3NDBB 3D64A 4Y2VA 3GQBB 1OU4A 1Y6QA 4TPKA 7AT1A 3QWIA 4KB5A 4FOTA 1LC3A 3M33A 5TJHA 2RCYA 5L3VA 4EG7A 2O3SA 5E1BA 3PXAA 3OIUA 2NSDA 3VPXA 4AMZA 5THKA 3PV0A 4DMRA 5J4YA 2IOHA 3IAFA 2RBEA 3AG6A 4PTZA 1UAYA 3K5PA 3H9EO 4PXSA 3ZBTA 3KJNA 1NLMA 2MSDB 5DTRA 4GDFA 3LFUA 4GYWA 4DEVA 4W5OA 4II7A 5AVUA 3HJUA 2X8AA 2DJIA 1JDZA 1SZDA 4RNCA 2XB9A 1X8JA 3VBCA 3M5PA 2C8JA 1DOAA 3EAQA 3QVLA 4LV8B 4K0KB 1EK0A 1JTEA 2AMYA 3ZJYA 1Y6GA 1PL6A 2I5PO 2DPMA 4RSGA 2JFNA 5FI1B 3O4HA 3WMXA 1YDWA 3KVYA 4R6WA 5KYUB 5KNBA 1I7DA 5B3AA 1NAIA 1COZA 1RU3A 2DJ5A 2IA5A 2WR8A 3EPRA 3T1VA 1FUUA 3FMOB 3G59A 3I5UA 5ALPA 4C76A 4C04A 4GOKA 1XCMA 1JSZA 4M9ZA 3ZWVA 1HEYA 4JI6B 1RI4A 3DBHA 4YCAA 1QBGA 2G1KA 4D0RA 4DSOA 2CYBA 1G8JA 3D81A 4PR3A 4O0LA 3GQVA 1UBJS 3HSYA 3JD3A 1IRIA 1BE1A 3BDVA 4DANA 4I1VA 5K0JA 3JAWA 1IRXA 3ENVA 4B4OA 1EFCA 3LYHA 4BNYA 3LX5A 3RIEA 4IAOA 3SHQA 5AJHA 3ZK7A 3RVNA 1I4WA 2M9MA 1G2QA 3CV3A 4OBWA 3PLRA 1EGAA 4Y1FA 4HVLA 2GF0A 1EWTA 4Y7CA 2R7LA 4FT4A 4KRGA 3TM4A 2CLSA 6PFKA 3FDZB 5EIBC 3I64A 4P6VF 2PWBA 2A84A 5DX1A 2PYZA 1MA3A 1SHKA 5EYPB 2DHQA 1KK0A 1CUGA 1K5DA 3DFKA 4LHWA 2GCOB 4TQGA 3VM6A 5CURA 3FMPB 1RJGA 3IQWA 3MINB 3ND5A 2OSBA 4XM0A 3SVZA 2J32A 3UPDA 1IULA 4XARA 1JALA 2DUUA 3RS9A 2WILA 4GBMA 2XKBA 4O4LF 3AB8A 2QP3A 1YVUA 1K88A 3PB3A 1R0WA 4O4JB 1YU6A 4PWZA 5IK2D 5AKKA 4DQKA 1GFWA 1P74A 1ZUIA 3ORQA 3S27A 2F1KA 2EW2A 1RQGA 4YYEA 1ZGZA 2V6BA 3HHPA 3R5SA 2A9PA 4OVKA 1T8SA 3VTFA 1AHHA 5KPDA 1BDJA 3MSXA 3MCVA 3LS2A 1COWA 1C41A 2WM8A 5H0IA 3VU0A 1UOPA 1XKXA 2EZ4A 4JY7A 4PINA 1BAPA 4NHEA 4TTRA 5BVHA 4P22A 3T94A 1UDCA 2WF7A 1Q5PA 1UZNA 2HQOA 4CR8A 3IT2A 4MX8A 3IYLW 2PG3A 1OXXK 2BCJQ 3B1FA 4YO7A 3IESA 1H42A 2L69A 4D56A 2UU9B 4LPKA 2O1WA 4NENB 4ON9A 3T3DA 1VKZA 2OHGA 3MEQA 2DTEA 3PC8A 4YPOA 2IUFA 3WBKA 2O0MA 3SGLA 2WFLB 3MFYA 4DLUA 5HXAA 1PGQA 1NF8A 4F5WA 5FWAA 4EPTA 2WA2A 4K2AA 3L0BA 2VIIA 2WUFA 1E3JA 1M6VB 4TWIA 4UW9A 5T41A 3SR0A 4MUEA 3ZDEA 2JLZA 3KVNA 2K2WA 5FWYA 1UEJA 4W7HA 4GPD1 2O6LA 1XR3A 3Q7PA 4R41A 5HGXA 2IVZA 2WM2A 1KGSA 4KG7A 4OX9Y 3GH1A 4UE2A 3TW8A 4BRSA 2GK4A 3SIWA 1NBMD 3EY4A 4QOIA 2W2QA 3RWMB 5U1PA 5EWLA 3F6BX 2XQJA 5NLLA 4KR3A 1P0IA 2PLRA