1SC1A

Crystal structure of an active-site ligand-free form of the human caspase-1 c285a mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
167
Chain Sequence
GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 44
structure length 167
sequence length 167
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sc1A00
1QTNA 4EHAA 4QU9A 4EJFA 1IBCA 2CDRA 4QUJA 1SHJA 3V4LA 4HQRA 4QUIA 4FGUA 4ZVUA 3DEKA 3V4OA 3D6MA 4JR0A 4N5DA 4NBKA 2C2MA 3R7BA 3R7SA 2CJYA 4NOMA 3R7NA 4NOLA 2AR9A 5I9BA 3P45A 1K88A 1RHQA 4D3YA 4JJ8A 4LSZA 3V6MA 2H65A 3K7EA 4HQ0A 3NR2A 4N6OA 2QLJA 4ZVRA 2H4WA 3S70A 4D3ZA 1CP3A 3QNWA 3PCXA 1BMQA 1GFWA 3H0EA 1NW9B 4JR2A 4FEAA 3GJQA 1F1JA 4JQYA 1SC4A 2XYHA 1K86A 5IANA 3D6FA 4DCPA 2QL9A 2CNKA 5LU8A 1RWWA 1QX3A 1SC3A 3GJSA 1RWVA 2WDPA 2P2CA 4I1PA 1RWMA 4AWBA 2NN3C 4QU5A 4ZVTA 4AWAA 4EHHA 3IBCA 3EDQA 3IBFA 4QULA 4PRYA 5I9TA 5IARA 3NKFA 5K20A 4EHDA 1NMEA 2QLFA 1RHKA 5IBPA 5IBRA 1PAUA 2J32A 4NOKA 2CNOA 1RHJA 2XYGA 3PD1A 3H13A 2HBYA 2J31A 3R5KA 3DEJA 3R5JA 4QUEA 1I51A 4M9RA 3H11A 1RWPA 1PYOA 5LUBA 1JXQA 1RE1A 2C2OA 4FDLA 2CJXA 4JB8A 2H54A 5JFTA 4HVAA 2QLBA 1ICEA 3EDRA 5IAGA 2H5JA 3V6LA 2Y1LA 1NMQA 3E4CA 5IABA 3DEIA 4EHLA 4JQZA 5IASA 3ITNA 3R6LA 3GJTA 1RWKA 4QUHA 4AW9A 1M72A 2J30A 1QDUA 4IEFB 4QTYA 4PS1A 2HBRA 2XZDA 1RHRA 4PS0A 1RWXA 1CVRA 1KMCA 3D6HA 4QU8A 4N7MA 4EHNA 4JJ7A 3OD5A 5LU9A 4JJEA 4ZVPA 3V55A 3KJQA 4N6NA 2Y0BA 3KJNA 5LUAA 4EHFA 1SC1A 3RJMA 4PRZA 3P4UA 2H5IA 3H11B 5IAJA 4DCOA 2QL5A 3H1PA 4N6GA 1RHUA 3BIJA 3NS7A 4QUDA 4FXOA 4ZVSA 5IBCA 1RWNA 2HBZA 3DEHA 3PD0A 2HBQA 3KJFA 4NOJA 1F9EA 4IYRA 5IC6A 2H51A 1GQFA 4I1RA 4NBNA 4QUGA 4QTXA 1I4OA 2CNNA 3GJRA 1SHLA 3R6GA 2CNLA 4QUBA 2C2KA 5H0IA 2QL7A 2H4YA 2C1EA 2K7ZA 2H48A 4QU0A 3UO8B 2FP3A 1NMSA 3UOAB 1RWOA 4EHKA 3S8EA 2XYPA 5IAEA 4JR1A 1I4EB 4QUAA 5IC4A 5IAKA 1RHMA 2FQQA 2FUNB 2J33A 2XZTA 4NBLA 4ZVQA 3SIPA 2DKOA 1I3OA 3V3KA 4ZVOA 3SIRA 4D3XA 4DCJA 4N7JA 2C2ZA
chains in the Genus database with same CATH superfamily
2YW2A 4BZZA 1PZEA 5IHPA 1LNSA 3KX2A 4BN5A 4EKDA 3NXSA 3UHFA 2O1SA 1F2UA 1YIDA 3DKRA 1RPAA 4BQIA 4Z2AA 3U0VA 4DJJA 3ZQJA 5CM9C 2Y1FA 4FFNA 1BRTA 3JARB 5K0JA 4OXIA 4U7TB 1N5MA 1EWVA 1TQ4A 3H9CA 2XWSA 2GMWA 3IJEB 5G0VA 4WK0B 3BHJA 1PS8A 4IG9A 2WJ6A 4BO3A 3RFTA 2FLVA 3UBTA 1MZPA 4IDDA 4A15A 2NSLA 3CF4A 3D8SA 1NQAO 2NXWA 3SM3A 4WI1A 1L5MA 5CFQA 3I4FA 4AXXA 3RBXA 2SHKA 2EYUA 1AK9A 1A3CA 1FMTA 3LHSA 4NBUA 3UYLA 3ZQ4A 2H4JA 3EYAA 3JSXA 4EGFA 4EUEA 3U4AA 2FH5B 3DEYX 3ANMA 5JFOA 2KBFA 4U4AA 1Y6FA 3T3IA 1W8DA 3NH9A 3VDNB 1XD8A 3BCUA 1M2OB 1KO4A 1G9SA 2C2YA 3GO4A 1EA5A 4MUXA 2PU7A 3A1TA 4B44A 4CUJA 4PIMA 2RB5A 3JYOA 4LW8A 2JKZA 3ZWVA 3HHPA 5BVGA 5ADHA 1JDSA 3L7JA 2L17A 4AK9A 2WIJA 1Q5PA 4QXRA 3ET4A 5TXGA 4FQ8A 1DAIA 1KDVA 5D86A 4ZEMA 4PPNA 3CX6A 5BQ3A 1G16A 3MMSA 4ROSA 4UM9B 5B36A 1UBOS 3I28A 5JWHA 2E7ZA 3L8DA 4YB8A 3L8HA 3L8EA 4YJ2A 4MS1B 3KR9A 1W2GA 2JATA 4OHKA 4YFYA 3UB3A 3KETA 3WV4A 4X1KA 2XA2A 4L9RA 2IELA 2VRCA 1E20A 3I9FA 4RV9A 1KVUA 1DAHA 1UBMS 1SB9A 3D7KA 4RMNA 4OUDB 5DP1A 2ZBUA 1GUDA 1SIOA 3DKIA 4JHXA 2GM4A 4KXUA 1GA1A 4V3BA 2G1PA 3FOAA 2Z2JA 4HNGA 4CIYA 1XEWX 1BEUB 1FYFA 3ANLA 4ICIA 3PXAA 3W05A 3D3EA 3SK0A 3BF7A 1OUMA 1ZC3A 1XROA 5J1TB 4HTFB 5CLFA 4G4JA 4D0SA 5DYGA 5BW5A 3F5SA 3M5WA 1QVWA 5EIXA 1N2OA 1J06A 2JC3A 4RANA 1ML4A 4D9HA 1J9EA 1H2EA 4F7WA 3KZXA 5KSPA 2Z1DA 4LNUA 1OWNA 1O89A 4A2CA 4QTXA 5H70A 3S68A 2YXNA 4RA6B 3W5AA 1B14A 2Q3JA 4P9NA 3W77A 3AZPA 1SEPA 1TFRA 1YE8A 3COJA 1NBME 1V7ZA 3CUWA 2B4YA 4F56A 1LRJA 5AJTA 3RS8A 2HXSA 5EWMA 2NAPA 4TXJA 1ULSA 4PC7A 1RRCA 4UFNA 1A7UA 2QYHA 1M6YA 3NHRA 2CBZA 2W2MA 2E4AA 4F0JA 3RKSA 3OCUA 4ESOA 1TU3A 2QDKA 3ZQ6A 5EMHA 3UWSA 2A0WA 3MGGA 4PZUA 5A02A 2ZTVA 4A92A 3BZBA 3CLSD 2GBLC 4LTDA 2VXOA 4MV8A 4PYJA 1UDBA 1T5DX 1GA6A 5D3KA 4RHCA 4X54A 3S1SA 3KOYA 3C6ZA 4IEEA 3AM1A 4JU8A 2R5FA 3L0SA 2ACVA 3TRHA 3E48A 3ZK7A 5L95A 4XM0A 1XXHB 2JJQA 2Z6VA 4U3JA 3U9TA 4AROA 4BLUA 1TEZA 1NM5C 2J9RA 1I3CA 2NUAA 2VH1A 4L4YA 3RODA 5AVTA 2BFPA 1BHQ1 3U16A 4C0WA 1XDSA 4WOJA 5J2UB 1UMBA 5EHNA 5BSVA 1N5KA 3GG2A 4KWTA 4F4IA 2UXCB 4RZUA 5GAJA 3R0JA 3S7ZA 2DQYA 2D59A 3KKNA 1D2MA 3D8UA 3D59A 4NTZA 4UTPA 1EXVA 1MRNA 3QEBZ 2FFJA 3ZWBA 2ERXA 4IRMA 2RGWA 1Z0SA 4D8VA 2G07A 2XUZA 1GGMA 5CU7A 1RHKA 1QDLB 3UUGA 1UP7A 2K4MA 1BHSA 2WWIA 3STTA 3HI6A 5CB8A 1W5TA 2A0XA 4BFYA 3Q7RA 4MQEB 2NZUG 3CZAA 1I3MA 2OK8A 2WF9A 3X44A 1EHCA 5BW4A 3DKVA 2C5GA 2WKQA 3QH4A 1FDWA 3OU6A 4HLDA 1PSDA 4ZAZA 4E07A 3LUHA 2O1WA 1M34B 2G08A 3CUVA 1EFPB 1ZXXA 2WEKA 2ODBA 4I6EA 4PHHA 4XDYA 1JQBA 2VZ0A 4M1ZA 4J49A 3HWWA 3GB9A 3Q9UA 4E94A 3HY6A 3L4JA 4B7UA 4MR7A 1SUIA 5ICMA 3TW4A 2AL7A 3KKEA 3MS4A 1X7XA 2DWPA 4ZAVA 3FIUA 3NONA 3GNQA 5CIWA 4I3FA 4BEBA 1RXYA 4GPEA 3RSCA 3ZNOA 1K68A 3LSYA 2YFHA 5CXXA 3G23A 2JKVA 2XDWA 4TV8F 3WYFA 4MWDA 5CDUA 2O6LA 3RBVA 1L4BA 1C9YA 3HKDA 1RFGE 4UTNA 3FOWA 4AQDA 4BCDA 2BDTA 1SOAA 1EUQA 2Y3IA 3MUNA 4Y9UA 5CVUA 1SD1A 5ESWA 4BRUA 1Z08A 3A6EA 1W59A 4X45A 3H7AA 1SVOA 5IVIA 3UJBA 3ZVKA 2DKNA 1JFRA 3ZHBA 3A9UA 1JG3A 3G5AA 5IJZA 1EP1B 3B1YA 1JKMA 2OCYC 3B85A 4FK8A 3OE1A 4UPEA 1TEHA 2DH5A 5THQA 3JZDA 4C4YA 3TLAA 4KQKA 5AFSA 5GOTA 1O54A 2BTQB 2YJGA 4V0OA 1YJCA 3C74A 4ZQBA 2QG4A 2PL9A 2BHLA 4Y6QA 4M4SA 4ENRA 2PH7A 4BMDA 2BAGA 4J16C 4QYTA 4EG7A 5FAKA 3KQNA 1LRKA 2Q3DA 5C8VA 5BSFA 1BE6A 1MC4A 1OHHA 2L18A 4BNXA 1KZ9A 1YR3A 2XKKA 4F4DA 2ZU6A 4ZKEA 5IDXA 3LUKA 3EFHA 1VE5A 3WK6A 3N74A 2O0HA 2E4YA 2ORIA 2QT9A 4FGUA 1Z12A 4RTLA 2O1EA 1SELA 2NXCA 2DULA 4G1EB 4QDJA 4YQZA 4QHSA 5K8VA 3LTNC 5KVSA 3R7SA 2NTYC 1W4LA 1KYQA 1N6LA 2BFMA 4XVUA 2XITA 4FW8A 4LBVA 5AD1A 4MW7A 2NO7A 1FTGA 4J16A 1JZTA 2DFVA 4N8EA 1ISIA 3DTTA 3K7EA 2SCUB 3FBGA 3LM8A 3T9DA 3TFOA 1VMIA 5A62A 4M36A 3WK4A 1FFHA 1DINA 1W4BA 2X5NA 3H5NA 3V1LA 2CHUA 4K6OA 4ZEVA 3W8DA 1RXSA 1RBZA 5JFGA 1VMAA 1P9LA 4OH7A 4OHWA 5FXMA 2VJQA 3D4BA 4UAUA 4Z9FA 5JO0A 3ETLA 5CJ2A 1S3FA 2C9DA 3OZAA 3TBHA 4BV3A 2OCIA 3U40A 4XYGA 2HRDA 4R1OA 1P9NA 3O94A 2LKCA 4U5XA 4AY4A 2M6SA 3A7EA 2FUEA 4IHJF 1M6WA 5CM2Z 1EXNA 1OYWA 3EZNA 4NJEB 1XRLA 3VU3A 5KWJA 1SHZA 3DNPA 1E6EA 1YBHA 5CA1B 2G8NA 2YRFA 5DNDA 5DN6D 3ETNA 2VJLA 2Y1GA 4NULA 1L4KA 5KTSA 1V8PA 4A8HA 3B9QA 2OC9A 5LYJA 1NOJA 3BH0A 1U04A 5B2FA 1HBJA 5D1NA 3NPMA 3NHWA 5M5BA 2HGZA 2REQB 3AV0B 3CMMA 3I0NA 1D2EA 1JWAB 4NYIR 3SY8A 3QOWA 4HH1A 4E7PA 1FVHA 1RM4A 3EGOA 3H11A 5CT8A 2V8OA 3AOGA 2YQ5A 3A3YA 3AEUA 1SKBA 3I76A 3LC1O 4HVAA 4J3JA 2WWTA 1Q21A 3CLUC 1OPXA 4AN4A 1U2EA 2HADA 3NASA 5TE9A 4C89A 3NHPA 4UDXX 3PFBA 1IM8A 4JLUA 4ARVA 2NMVA 4E5DA 2D8MA 2JD2A 3T5MA 2OM6A 2GBGA 4FEYA 4LZPA 3N6RA 1X74A 4QGBA 2PV0A 1L7OA 4X85A 1I30A 2ZI9A 2PR2A 2X42A 3V55A 1MBZA 3IAS6 2XWBF 2C99A 4RZXA 5ER9A 2G71A 3K92A 4GSKA 1DCFA 1T10A 4P4UA 2JI9A 4OP3A 2MJLA 4XQGA 4N01A 2WAMA 4WZAE 4PYIA 4LVNA 4WMLA 3SZRA 5KHLB 5B30A 3LWNA 3N5CA 4DCOA 3MA0A 3KP1A 4OB6A 3KB1A 3PNVA 2C4TA 3TH5A 1CSEE 2X4DA 3ORQA 4DJTA 2O0KA 4B3IA 1NRWA 1YHZA 3NV7A 3ZK9A 3OQIA 4F91B 4OLBA 2PUFA 1GTMA 3DQPA 2PTGA 3HBAA 4HSEA 1MR3F 4HNAB 5GV8A 6ABPA 1N5RA 3IOEA 1YOVB 2AEFA 2RHCA 4HCJA 4OBBA 2YWCA 2WJVA 1V35A 4W9RA 3DMYA 3LU1A 1XZBA 2CXXA 3NKVA 1XZKA 3LYHA 5CB4B 3MQ4A 3C45A 4RYDA 4B7CA 2BE7A 1NBAA 3BMQB 4RO0A 2QRNA 4IXMA 4IOJA 4BLPA 1QJ4A 1NF3A 3KOOA 3HN7A 1P3JA 3L9XA 2XMBA 3BUSA 3TLYA 1X1TA 3OPYA 1D9XA 3E22A 5GVRA 4DM7A 5AHWA 3RVMA 4ER3A 2FZVA 1F8FA 4W5OA 5ALHA 1JNYA 3Q0EA 1AA6A 2AZDA 1P1BA 4UMFA 2IQIA 1SVKA 4OI0A 2WPNA 3DCIA 5BUCA 2Z2KA 4WKGA 5L7TA 5EJ8A 2GERA 1FIUA 3B6IA 4DEVA 3WB0A 3IE2A 3E2MA 1ODKA 3QUAA 4LI0A 1MTZA 3OQPA 3NIWA 4GKJB 2QUIA 1P1CA 3AFHA 3WQBA 4CKCA 1V45E 2V7VA 4KYUA 1AQJA 1LF5A 2IHUA 2W6CX 4DWJA 4NFLA 4O29A 2AN3A 5EP2A 5A71A 3VYTB 4OL0A 1HZJA 5IKEA 2GPYA 5GZ1A 1W0JD 2VOEA 1E66A 1H6DA 2FEOA 1A76A 1LTHR 2Z56A 1R9MA 1RP7A 5ILQA 4D8XA 4BFSA 2POCA 3WTBA 4NE9A 5ALFA 1Q2UA 2EBUA 2PT9A 3U3MA 5JTTA 1GSAA 2G1KA 4RXTA 2C7PA 4RA6A 1MABB 2XJ4A 4FMDB 1OFTA 2FFRA 2N46A 5GGXA 2JGLA 4AL4A 3LHKA 5EWLB 1ACMA 1YRAA 1HLFA 2OCLA 1DU4A 3RF7A 1NBOA 4ZANA 2IBTA 3O6VA 4QARA 2Q3BA 3EY4A 4GI2A 3WB2A 3SMVA 4CEJB 2HREA 2R6CA 3ETEA 5F51A 1Y9ZA 1U3WA 4GECA 4M87A 1QZTA 1W94A 3HNRA 2IS6A 4GOND 1HT3A 2C7GA 2DUMA 5JDCA 3PFGA 1GG2A 3AF5A 1DP4A 1G7TA 4PC1A 4FEGA 1JR6A 3QX7A 3HCWA 5IWCA 4YIHA 1JXQA 3HYRA 4CTMA 1ICEA 4EO7A 4KXWA 2C5HA 2C5EA 4KOAA 4LDAA 3STWA 1GTRA 5MHTA 3CZPA 1SQGA 3ZJVA 2E4ZA 4WK6A 3NHLA 2FFHA 4UDNA 3PC2A 2AE1A 1XD2B 1YRWA 4R8KA 3FZNA 2PLWA 1DC5A 4AJ9A 1DWUA 3L7AA 2J3KA 5J2TF 3QEJA 4R4JA 4P81A 4GICA 5IH7A 5ARCA 3WLSA 621PA 3AZOA 3GJ5A 1US8A 1WCYA 2R6HA 3LQYA 3PSAA 1YVRA 1B41A 3WIDA 2ACWA 2M98A 4H1VA 4RPCA 3NRCA 4HH4A 4UZSA 3IVCA 5IHXA 2OG1A 4BN4A 2G63A 4OV6B 1S8NA 3UKJA 3WBJA 4DBZA 4GEGA 1AS2A 2O48X 1FFDA 1KK1A 1M1NA 1Z5ZA 1CRWG 1QLJA 4HQLA 4ZMSA 2XUJA 3VNVA 3AJ8A 1ZY2A 5IN5A 3P4XA 3AHCA 4MKZA 4MMXB 1EXDA 1PJQA 3ZNPA 4S12A 2Y0PA 5DGCA 1X13A 2QXUA 3G88A 2FPRA 1TW2A 1JKIA 2WTNA 1O96B 2DR2A 1CY4A 1MOZA 1IZ8A 2D2XA 3KQPA 4JJAA 5JPDA 1KIFA 1V71A 5DYTA 5JCZA 1DIOB 1EX9A 2DKFA 4WLOA 4EA6A 5E1BA 1FU4A 4YCBA 1R5OA 3GC6A 4BJ3A 2IPNA 2WHQA 1GPAA 2CMFA 2QQGA 5SICE 1G2PA 3COPA 1RPNA 1EVZA 2LPMA 1NVVR 4ZU6X 2QRLA 2VDWA 1TD1A 1G42A 3ELBA 5JAUA 4K7JA 2HSZA 4UEOA 4L50A 2WTEA 2BF4A 2BLNA 4K05A 3CVVA 3OCYA 5JJKA 1P5HA 2C8JA 2ZS8A 2Z5FA 4W5HA 3G6KA 4O8CA 3TUZC 2OXTA 3UEOA 5IYZB 3P2MA 1PT7A 2VJYA 3IVXA 5B58T 4CCAA 1L5LA 1FSZA 4S2UA 1JHRA 4TXMA 2WUVA 3W9BA 1U28C 3CZRA 2QN1A 1VCHA 2OILA 3ZTYA 4MO2A 3PQFA 3PUVA 4HRYA 1GP2A 3M9LA 1CEYA 4QFMA 1VP9A 1NI4A 3GX1A 2VP2A 4AD8A 1DO8A 2QV0A 4TM8A 5A5DA 2XLCA 4N48A 3IRUA 4GUDA 3S2FA 2HXYA 3RRZA 4IH9A 3N8KA 1NF2A 2G82A 2ZVQX 4WECA 3KLMX 3OZEA 2RHJA 1OXTA 2MSEB 3NALA 3K32A 2GNAA 3F47A 4HG2A 4ZJUA 1ZONA 1WR8A 2WYOA 1L5KA 5CB4A 1ZK1A 5FBRB 1RXVA 3O8LA 3SR0A 1MD9A 4FEEA 4PG7A 2RGAA 3NIDB 3OCCA 4IFTA 1IL0A 1ACJA 1QMPA 4GT1A 2GZ2A 4YBZA 1UM8A 2BHNA 1SVMA 2QKYA 4F5WA 2CNOA 2RHWA 3IIJA 4KQXA 2FMFA 4LJRA 3FLEA 1JDUA 3IE0A 2O2IA 4D9FA 4YV2A 1AKTA 2DT5A 1IY9A 2GCGA 4N5HX 1E79D 1Z7GA 1U0GA 1U4OA 5HCIA 3A6DA 5LUBA 1PLLA 3HBLA 2H17A 4EFDA 3EBPA 3GLFB 1E9EA 2GSWA 4K6CA 5H83A 1NMQA 4QYMA 2OVBA 5AVSA 5IABA 2IDMA 3Q11A 1T3HA 2QQ0A 5JCJA 1RBMA 1SD2A 1FNCA 1JT9A 3OZRA 4KMOA 4UNNA 2PKQP 2QXTA 4ZZIA 3SBDA 2W83A 1ZI9A 1CY1A 4J4HA 3V00A 3ZE7A 4CQMB 4DLAA 1NDHA 5FH9A 3EE6A 1PJCA 1QH8B 3PDUA 4URXR 2XKAA 4FS3A 4Y1RB 3QGMA 4LRQA 1CF2O 1CT9A 1S02A 4QJ3A 1RI1A 1EK5A 1UT5A 3NHKA 1UJ5A 2A7QA 4ITUA 1MO2A 2ATEA 2ECOA 1EX6A 4N3NA 5ITSA 1R50A 4DMHA 4MJ7A 1LTQA 2B98A 4CI0B 2YUIA 5TLSA 1TT5A 2JFZA 5HUJA 5EKUA 5GM1A 2C9BA 1YZHA 1FA9A 4PBTA 1Z22A 4Q05A 2ZIXA 4YXWA 5IT0A 5TB5A 1Y37A 2UYYA 2C5SA 4PN7A 1CR1A 4XSVA 3MJVA 3SKXA 4J4TA 1CY6A 4NU8X 2NW6A 4RF4A 1H2FA 5DLPA 5KYUA 3UAWA 4DM3A 1OA1A 1WDMA 4L9SA 3O7WA 1BD3A 5DHUA 3EQ7A 2PUVA 4ATNA 4LDQA 1KF0A 7AT1A 3IE1A 2UYGA 2WDZA 1JHVA 1J0AA 2ZJ6A 3GVHA 2OAQ1 3H8SA 4LYFA 4ZAWA 4BNDB 4OYHA 3V8BA 1CDDA 1LJ8A 2VUSA 3FYUA 1PD0A 1T9DA 4FNMA 4CU2A 1QQTA 4M9XA 3V2UA 1YONA 1D2RA 3OJOA 3EJ6A 3UH1A 3VYSB 2W71A 3HVHA 3LLVA 3VPDA 1JNXX 3HXTA 5TJHA 4AP6A 5IUNC 2WFAA 3MN1A 3BF8A 4IQ0A 1E1CA 2DHEA 2QMEA 3OZBA 5EJIA 1R0LA 3MFQA 4ZO8A 1DKUA 2YNMD 5EFZA 1LTKA 3KZNA 2O8FB 2ZSKA 1VKOA 1YU6A 4EJSC 1RU3A 3F96A 2QUJA 2YVKA 2DP4E 2PS1A 3G9TA 3ADKA 1ZN8A 2VBFA 3BFJA 3ESRA 2GJKA 4HFRA 5I8PA 1DE0A 3JRWA 4ENQA 1I6MA 4Q4AB 1WUKS 4BMCA 3K9QO 1REQB 2OB2A 3ZDYB 3TFQA 5FYQA 2QM0A 2CJPA 1Y4UA 3MB5A 3QEKA 8OHMA 3IQXA 3PRHA 3HYSA 5AJYA 3SSNA 1F60A 3HE3A 3PHGA 3WOHA 2HLDA 4XM2A 4OLFA 3MTIA 1U1FA 3CRRA 1PK8A 3CEJA 4MYHA 1GZHB 3ZDCA 1RTTA 3LVFO 4R51A 4MULA 4Q93A 4R1TA 4RACA 5GWXA 2ODNA 2CB0A 2H31A 1U2GC 2UVQA 3E3LA 4KAFA 5BUSA 1O9BA 3WBFA 1V1RA 2Z83A 7GPBA 1IXYA 3FIJA 5AI0A 1WIWA 1Z6QA 3HKCA 3TTUA 4OM7A 2ONZA 3WAKA 1WB5A 4MQFA 4E33A 2XYRA 3MTGA 1ONSA 4LJLA 1UPXA 4P34A 1QIIA 2BONA 4BX0A 3I92A 3O4HA 1U0JA 3S2YA 1NDUA 4OY3A 4WXRA 1GUBA 3RTAA 1NTOA 5IASA 3IAHA 3TSZA 1B15A 1MX5A 2ZCUA 4FHZA 2OBMA 4G9EA 4IEFB 3PP8A 4FOOA 1CERA 2R6JA 3Q10A 2JLQA 3M5PA 3QVGB 3SOPA 1CUAA 1NXOA 3G8CA 3AEXA 1CQIB 4TWJA 3QF4A 4TVSA 3SX0A 2XD9A 1SUAA 3ZWNA 4HLNA 4AECA 1QBGA 2WMYA 4GX2A 4EX6A 5FUXA 4EYQA 4JMPA 4MP8A 4RJTA 4OFZA 5JS8A 4EKEA 3WSTA 3IEXA 3FF4A 1PTKA 1VL5A 5BVGB 10MHA 2O3QA 4RD0A 3SXJA 3T34A 4F93B 5M7EA 1N77A 1S2GA 4FUTA 1AS3A 3GJYA 1PJ8A 4KN6A 5J5VA 3VBEA 1A04A 2F6RA 2QI9C 4YUZA 4KO1S 2VWPA 4UUOA 1I4WA 4HUJA 4XYEA 1RXUA 2WKWA 3BSYA 2WZCA 4HRVA 1U65A 2C77A 3DYIA 4WKNA 2FR1A 4OH1A 3AOEA 2XNDD 3EXIA 1YAHA 4FMBB 4R9VA 3WJ7A 4BGDA 5IN4A 2UUOA 1TK2A 4Q37A 1XTVA 3GLIA 2FZWA 2CE2X 4QXOA 5AJUA 4R0MA 4OP2A 3MLBA 4ND4A 3BKWA 3T7KA 3TMAA 1ZVVA 4C2AA 4HWSA 3F90A 4R2LA 4X6UA 1IM5A 1MQAA 4B31A 3T5AA 3ABRB 1QCDA 1WDKA 5CA0F 3U5TA 1BKDR 4H6WA 5BVHB 1R6VA 1FZTA 5BXYA 1N2EA 3WB1A 5KINB 1EX7A 1G4HA 1O8CA 1IHPA 3BTOA 1C3XA 5HFNA 3W5SA 1KXJA 1J5EB 4G8CA 3AERA 1L5NA 4RKFA 1JN0A 4GOMD 1W6UA 3ZD7A 4F85A 1UM9A 3O1LA 4RXUA 1VJ0A 1Z38A 4IDOA 1A69A 2BM1A 2JDID 1XQXA 2F43B 4NCXA 1IUKA 3SF8A 4AJ1A 4DV4B 2JVIA 3R4VA 3NVAA 3DXYA 3K70B 2Z30A 3C6XA 2ZJBA 3QIAA 5FF9A 2P6RA 1EEHA 1GGHA 3OZFA 3RJ9A 2I2BA 5EZYF 4DMLA 3LC0A 1JEYA 1NYRA 1E5DA 2OWEA 3BGOS 3GRKA 1YS2X 3PVZA 2UYHA 3SVTA 2R68A 1DJLA 3E3OA 4N76A 3LPDA 1NE2A 1N1MA 5E2IA 1T15A 1WDLA 3TJZA 2DR3A 4IKOA 5KQGA 2J46A 4M1KA 4ZXFA 5H7XA 1YZTA 4JJIA 3Q3HA 1ISMA 3WSVA 4QT4A 3SVLA 3DQZA 3VTFA 1W29A 1XMQB 4RL4A 3EB9A 1YQDA 2ZEJA 3QYJA 1JV2B 4FNGA 4LQDA 2H4FA 1NYLA 2MIIA 4J94A 1NL3A 1IBSA 1WF3A 4OJKA 4UUAA 5AW8A 2VKTA 1Q50A 3CGWA 4P3NA 4ZCQA 1HDOA 1QV9A 4Z8XA 1XA0A 2E9SA 5ESXA 1IY0A 4IIFA 3W1VA 3LRPA 3HVIA 4B73A 2PKEA 5HR5A 1Z35A 2PZJA 2MSDB 3CPHA 1XQ6A 2R79A 1CK4A 3N2ZB 4EDFA 3OOEA 4J7UA 5E4JA 3MBIA 3G2QA 3NYRA 2B6NA 2R25B 3NTLA 3Q2OA 3W7VA 2E5WA 2XIJA 3E35A 1X8XA 1XP5A 1M72A 1QK5A 4K8RB 4K9KA 4GVXA 5EN4A 4X0EA 3ZDQA 2QN8A 1RQ7A 1WVGA 3IAUA 1YV9A 4QBKA 4KXNA 2HLPA 4LCEA 2B61A 5CVVA 5KOIA 4RVDA 4QU8A 5ENZA 1AN0A 2LRHA 4ONEA 2F1RA 2GZ3A 4TLCA 4X1KB 4BAZA 2BP7A 2NV2B 13PKA 2QUZA 3FPLA 2ZATA 4DXDA 4DMUB 1AUPA 1NJSA 1YDFA 4UJ3A 3WIEA 3EUEA 1HXHA 3F4BA 3PNOA 4EHFA 4QBIA 4RCYA 3PR1A 4PX2A 2B4RO 4ZT6A 2XTNA 3AR9A 5AM0A 2OFOA 2W8BA 2XT6A 5E1MA 4BWGA 2H7XA 3ZZMA 1RBYA 4HNQA 1ZMOA 2BN4A 4G8BA 3BQNB 1Q1ZA 1DB3A 3KTAB 3LWZA 1P2VA 5IUKC 1J9ZA 1U6IA 5CCXA 2WHYA 1A1VA 2Q8QA 2Q1WA 2OHFA 2W37A 1OI3A 5D5QA 4MARA 1A9XA 4KR3A 3EW9A 1TU0A 3EZ2A 5FT9A 4PLGA 3W04A 1CUEA 1E3JA 4JLVA 4Q3NA 2DERA 4Z86A 2BJWA 5DNAA 1XTIA 1EMDA 2R48A 2HX1A 2Y1EA 2C8KA 3AKCA 5FUQA 5B1IA 3OKCA 3FSRA 3QPWA 4H7DA 1OC2A 3GJ4A 4UHCA 1QP4A 1Y9DA 2IYRA 5FPKA 4B71A 5JYDA 4IZIA 4RMHA 4PVCA 4US1R 3ZUGA 1KSGA 1LX6A 3C14C 3VYWA 1EWTA 2PEYA 4F11A 1KZYC 1L3CA 4F5EA 5HWSA 5NULA 3AXTA 4FHCA 3JASB 2E82A 1A2BA 3PEVA 1A5TA 1CUXA 3PA8A 1YC2A 4DV0B 5EHIA 3L6RA 2X5OA 4J90A 5GY7A 2ZRPA 3PHLA 4Q01A 4XCQA 4M60A 2IUUA 1Q0LA 1G8MA 4RV4A 3RWOA 1AV6A 2GM5A 5K8UA 4BLSA 4OGLA 1JR4A 3IHKA 2OAEA 1PGOA 4IM7A 4ML3A 3GFOA 4EGJA 4L0CA 5KDDA 4FFBA 1ZOSA 4DQUA 2WI8A 5K0NA 3NKLA 3H9BA 1LDMA 1ZUNB 2GPTA 4IFEA 1P2UA 3DV2A 3H5AA 4NV1A 1ADBA 1RM0A 5AJVB 2DLCX 5EIWA 1IXSB 3UTCA 4AMGA 1LNZA 3CEPB 2FTKE 3ZCUA 4C0XA 4X7PA 1ZMXA 1Z7EA 2SKEA 4PAOA 3VR6H 4C1BA 3NOXA 2P6OA 5GONB 1UMDA 4IKEA 5A3QA 1ZHFA 4O1HA 5C8YF 4NF2A 1MAWA 1HH4A 5C35A 4JKIA 5JOQA 2Q2VA 1O5IA 1SG9A 2VCEA 1BWRA 1W0JA 3KPWA 2WUDA 1GNSA 1I2BA 4NMLA 2GVZC 4R54A 2KBEA 3PXUA 1J09A 2IEIA 4DJAA 4ZJYA 5K3AA 3L07A 3PNSA 2O7QA 3VI4B 3A1VA 3F1LA 3HDGA 3L0YA 3N2IA 2X4GA 1JJIA 1WMDA 3KKKA 3R5TA 4FMCF 2YHUA 3PHIA 1G18A 4Q4JA 1M54A 1Z0KA 2CXHA 4H1WA 3KWLA 2XJ9A 2VWHA 2R87A 2C2HA 3B70A 1B23P 1IDOA 1KI7A 4IFBA 4FBGA 4M9RA 3BDIA 1X86B 3RQSA 5KMGA 2G76A 1Z5WA 2EJCA 3HL4A 4TMVA 3UT6A 2B82A 3GL9A 4AYXA 1J5XA 5JD6A 5JXIA 3C7AA 1Z73A 3DE5X 3GWZA 2Z98A 5KOJA 3GLGE 3CA8A 1NYQA 2FDCA 2BHTA 1W4AA 2HJ9A 3IEIA 3HB9A 1VMDA 1IWOA 2WQZA 1XVAA 2JAQA 3MPOA 2ODWA 1E1YA 3PUZA 4RENA 3UAOA 1QWSA 4ZOLB 4X94A 3U4QB 3W8EA 1CNMA 3AW9A 3PBKA 1B0ZA 1CVRA 1R0XA 1SA0B 2C1ZA 4H7EA 3FVQA 3TJRA 2D1SA 4ZRDA 4Z4FA 1PT9A 1QO0A 4LHWA 1QCCA 3WGHA 1DAPA 5BWNA 2HV8A 2P0YA 4I19A 1FF9A 1P9OA 1ZA2A 5DV9A 3LUPA 4HKTA 4QOHA 5U9CA 3CH6A 2HYDA 1KEZA 3WGVA 5LDDC 1FXUA 3HUUA 2HWXA 2HSEA 1VJRA 4BU0A 1D1PA 4REMA 2WINI 4U2GA 5HYVA 1VKHA 5KYTA 3DL0A 3PFNA 1H5NA 5G1OA 2BSQA 1YTUA 4FFPA 4RCZA 4F38A 4XGNA 4GWLA 2NYUA 2A0YA 1CFZA 3BCHA 4L8VA 4WNAA 5CDFE 5HKBA 3U1BA 4NBTA 3FNGA 1I7SB 3D1JA 5FLEX 3N2GA 2ZBFA 1UC8A 4GI7A 1Z2EA 2VK4A 1HTBA 4MITA 3STUA 2ZAGA 3I2FA 3VC3A 2H1RA 4NI5A 4XD2A 3HXQA 2CUTA 3PEEA 2HPZA 1IB0A 1K7FB 3GJ7A 3D3KA 8LDHA 5J4HA 1SVWA 4HAOA 2JI8A 4GGPA 4ZAFA 4HX2A 4ZU3A 1ABFA 4ZCTA 3EOBI 3TL6A 3T41A 1N6HA 4OP1A 4UVHA 2E37A 1TB4A 1X7DA 2B4KA 5LOVA 4XDHA 1WF6A 3O4FA 2Z57A 1OA0A 5LP6B 3GCXA 2HB6A 5DW3A 1GPJA 1XYGA 1EGMB 2HQSA 2R60A 1KYZA 4ARUA 5HIMA 4HN2A 1WUJS 5C37A 3GLTA 3PIIA 1PLKA 2CVOA 4QXAA 3RABA 1Z2OX 5IMBA 3IIMA 3OOYA 4HLQB 1KDTA 2O3SA 1BIFA 4YCAA 1WUTA 3SBEA 3ZY2A 2EG5A 1AB6A 2BFOA 2QEQA 3GYGA 3AM4A 2C9MA 2Q2WA 2RGCA 5JNTA 4KR6A 3G0DA 4HDKA 1H85A 3NWBA 1FJGB 1XHEA 2YN2A 1JAHA 3EXIB 3VDQA 3G9QA 3WHKA 1SRQA 1L7VC 2CK3D 4RVCA 4I1OA 2IZ0A 3T3PB 5GINE 4ARBA 2ZUVA 4EATA 3MJHA 2H18A 5LQRA 2DGDA 4C6HA 3FBTA 2JS7A 4O4HF 4WCVA 1G21A 4Z5XA 2O8CA 4ER7A 1SU6A 1EFDN 2A92A 2UZ3A 1BAPA 4G4GA 1N9KA 3PGKA 5JZBA 1XCPA 3AIOA 3OJFA 4I55A 1RSZA 2ADOA 4XUCA 2R8RA 2IWRA 4ARZA 1NA5A 2V1XA 3GEGA 2FSFA 5JXJA 1HNXB 1VHQA 2ASEA 4CKEA 2BEJA 5A5FA 1IZYA 1RTKA 2L42A 1L3BA 1DEXA 4PGGA 3EF0A 1EUDA 2V0NA 3MMXA 3ICVA 3JQ7B 1ZSVA 3QV1A 4JNKA 4OXQA 1P1HA 1NVDA 2PKCA 3DBLB 2VAWA 2YQZA 2VJDA 4YJFA 4CIBA 4H1TA 2OPBA 1ISRA 5IAGA 2GZ1A 3PQ5A 4LI3X 1TYDE 3AHGA 2QVGA 2YNMC 1C7ZA 3I9JA 2PT7A 1CW2B 1I6KA 3II6X 4YA6A 3K9GA 4HEHA 3PNYA 1JTFA 2P5TB 4UM5A 1YL5A 5EWJA 4CYMA 4UMDA 2KE5A 1XF9A 4XR4A 1R2QA 2PG3A 5C4GB 1E4YA 4YT5A 1ZL2A 1YR1A 2PH1A 2R4QA 2HY7A 3WFIA 5F77A 1CZHA 2RARA 3D7RA 4GFDA 1MVOA 2XXAA 1VRVA 2PUAA 1S3IA 2EX4A 4MO9A 3CWZA 3FY4A 4YAFA 1BWQA 4QOIA 4TTVA 4A26A 3JTMA 2V7UA 1DQYA 4BVFA 5AVYA 2ZI4A 5K3FB 2EEZA 3GUHA 4HGZA 1H2XA 4FZRA 2VH5R 5AXAA 3FDFA 1ZMTA 2GX6A 4CMAA 2D5IA 4CEJA 1C3LA 2R8YA 4IH4A 2DUJA 2UZ1B 4N6GA 2J3DA 1U8XX 2FSGA 4B45A 4CKEB 1JU9A 4X71A 1O0SA 1DC4A 2VL7A 2WIAA 4F5YA 1F14A 3G5UA 3GHYA 4CUKA 2MCFA 4F5ZA 3K0SA 1T6BY 3JWEA 2XUKA 4N7RA 5HDBB 1ODJA 2J3JA 3D54D 3G2PA 5JATA 3EEOA 1P1KA 4IY1A 1T3ZA 2RKBA 5K01A 4NHOA 3EHEA 3EXG2 1ETUA 5HF9A 4ND6A 2R6DA 1ZN2A 1M6VB 4KPGA 3IPYA 1JDVA 1G5QA 2RGRA 3BJRA 1H2AS 3CV3A 4HTAA 4KB5A 4LJKA 2V6MA 3F7MA 2Y9MB 3BPSA 3QBTA 4TSKA 2D4HA 2P4EA 4YCDA 1FFAA 4R68A 1T36B 4EPTA 1G17A 3TXAA 1KMQA 1YL6A 4QRIA 3KOWA 2XE4A 4R7TA 2FCRA 2OV4A 2XMGA 3A9CA 3DKPA 1Y4SA 1MENA 1CG6A 3FWHA 4NECA 2FZ5A 3S2UA 1TJ4A 5F1PA 3HXMA 2CXTA 2DU8A 4TKVA 1Y1LA 2V74B 3AQIA 2QB5A 4OKIA 2FSSA 4ZXPA 3EEQA 3HTXA 3AUJB 5LQJA 2YXBA 9LDBA 1V5IA 3OAAA 4UNRA 1N75A 1LQ2A 1M76A 1SVLA 1VGRA 4FDTA 1FFBA 1LBSA 4NNOA 3RYTC 3I1FA 5EJ4A 3OOHA 4HQ0A 2Z3VA 3U61B 3AERB 3RRJA 3U7HB 3EN0A 4MVJH 4M83A 1II9A 5IT9A 2C3UA 3MJ4A 3FR8A 4NU6A 1G5HA 1T5BA 1QJCA 2B1JA 3PLNA 4NZNA 3BREA 4X9XA 4HFJA 1HQDA 2VRNA 2NGRA 4Q9NA 2JIMA 4EI2A 3D9QX 5IANA 2X22A 3BFVA 2ZR7A 3NHYA 1XTTA 1MX9A 3BMOA 3G2JA 3R9XA 4J6EA 4ESHA 5FTJA 1DWOA 5L4NA 1TT5B 1E3DA 3U0BA 3H4TA 5F2NA 3GA5A 1K2WA 3IUNA 1W4ZA 2OQIA 1UZAA 3RUEA 3FRHA 3QY9A 2O5RA 1JH8A 1T0JB 1XGKA 3PYMA 4MRVA 4YFVA 4ZDWA 2I7TA 1D6SA 2CFOA 3G1WA 3GBPA 3PF9A 4YRCA 5IW8A 3QEOA 4X24A 5SZJA 1KZ7B 2Y1OA 3H2HA 3DPSA 3MQFA 3ZHUA 4D99A 1IN1A 1ZKMA 2C07A 3B2NA 4M9SA 3GMTA 4WCFB 4Y2YA 1KEUA 2CUZA 3CISA 3HGMA 3L7NA 4HGYA 5ARDA 5K6AC 1C4WA 1K63A 2EL7A 2FMUA 2P9BA 1OZFA 3FFTA 3L8CA 3JALA 4FQ7A 4CMIB 3SC2A 2G9UA 1KEKA 2Y05A 4CCSA 1U8ZA 3CUUA 1GZ3A 3HZRA 3SN6A 4EUHA 1PJ3A 4EY7A 2H5JA 2PWAA 2GILA 2AEEA 4U7JA 5CM8B 4F6CA 3FPHA 2D2VA 4JP3A 5K6AA 4CTOA 3RUDA 4JCOA 4ZOBA 2Z58A 3NYWA 2BLLA 3B2EA 1QAOA 3DBOB 3TINA 1HUQA 1V5WA 2BGTA 4G36A 1TO1E 4D4GA 3A3NA 3T4EA 5LD2B 1ZM4A 4ZOLA 2YWGA 2ZUBA 3CVYA 3DFMA 2FB9A 5BR8B 3U37A 2XZPA 1LFAA 2QPLA 4MRMB 1UKCA 3IUYA 3GVIA 3KKOA 1XLTA 1XMXA 2EX0A 2AC4A 4FVTA 3WDKA 3JSAA 1EVIA 4Z51A 4MQFB 3GPCA 3UJPA 4ZYUA 2XMCA 4PM4A 4P22A 4OGFA 4XEUA 5IC6A 3MXOA 3CVXA 1ULZA 5HG0A 1N9ZA 1D09A 5CG2A 1Z68A 1Z4NA 5B1HA 1IQ0A 1VE3A 1XALA 5JXWA 4QHYA 1YZGA 1TECE 3W6ZA 4DIDA 5BN1A 4ZGGA 5MDHA 4YO8A 4XWKA 2YWEA 2E6UX 3NFYA 3O8QA 4QDOA 2W2KB 2V4UA 1OXXK 1UKEA 5H5JA 1DADA 3N8GA 4E2WA 5JHGB 3PEFA 2PH5A 4TUYB 3GFVA 3KV3O 1NZDA 4FC6A 4JR1A 3TNFA 1W2WB 3UC9A 3V8EA 1RI5A 2P8JA 1QE0A 3FWYA 2QBYB 1Z36A 2C9ZA 3CH5A 4M0LA 1BS1A 1CZKA 2PGDA 2SCUA 3BBLA 3CUSA 3R3UA 4TLBA 3ERCA 3A27A 4DSZA 5AW3A 4GMDA 3THXB 4MYRA 2X9VA 4Y2XA 3EVZA 4XOIA 4R69A 4LF6B 4H3KB 2AOXA 3G0OA 1E9DA 3CKLA 5FL7A 1MG5A 2CZQA 4TVBA 3SHVA 1DKRA 2GETA 3VPFA 3WFZA 2EKBA 4U7GA 1P1JA 4EY5A 4AF6A 2HGSA 1UEXC 4XOUA 4FHGA 1XLWA 2GK6A 4GDFA 5A3SA 3FXAA 4RE6A 4CNBA 1Z0ZA 2OBLA 1SR8A 4UKDA 1DAEA 2J4DA 4J07A 3A3KA 4FX2A 4BMSA 3WRYA 4F3NA 1XZJA 5BOSA 3PD7A 3N59A 1TPYA 4ZOQI 5I6DA 5K3OA 4BGVA 1MO5A 4TQGA 5F5NA 2PE5A 1YDGA 1F0YA 1HL3A 1AG9A 5I7FA 1NR5A 5EPEA 1OH8A 8AT1A 3IIKA 5JVDA 3GG9A 4MVJM 3V1YA 2NU7B 2C3YA 5HJ2A 4OX9Y 4YRDA 1L4NA 1Y3BE 3UANA 4TLLB 2YYAA 3L6UA 4XKJA 4EOGA 5C8ZA 2FPKA 2PJDA 4UHEA 3DWGA 3EAQA 1BVYF 3UOGA 2DZDA 4BL5A 1V43A 3LT1A 5HS6A 1UQTA 1GUYA 1CVIA 1P6XA 1DUVG 4YQYA 3FUCA 3AKDA 1PJBA 4JXKA 5IKXA 5DM2A 2ATCA 1WL8A 3DHVA 1UBSB 5L3QB 1PEDA 3NZEA 3FVTA 1X80B 4RKRA 3RAGA 4CM3A 2X8LA 5LKAA 1VKRA 1G8HA 3A9SA 4Q3LA 5KTMA 1RKVA 3K5WA 2VPXA 3ZY6A 4DMKA 3NP9A 1CUFA 3F7OA 4P86A 3E4DA 4YLGA 1OAOC 2QLBA 5H9WA 1MAUA 1HDEA 2QXYA 2BRUA 2AJDA 1XT6A 4ZT2A 2XT9A 4EBBA 2FDRA 3C1AA 1P7CA 1DG9A 1YNOA 3MAGA 3SI7A 3VJLA 1TCBA 1GILA 3R8CA 3FOEC 3R3WA 1RADA 2DSNA 3GZ4A 3FI9A 3LH5A 4RD2A 1Q84A 2WAYA 2XCSB 2CFTA 4EIWA 3RV3A 2WT4A 1E9VA 2ZBDA 3WKAA 4F21A 4O08A 4WBNF 1F12A 3HBMA 3IQEA 2RGXA 2X8JB 2HD4A 4RV5A 3ZXUB 4EI8A 4ZN6A 4G26A 2OVFA 2PKRA 2GGSA 4BQPA 1EBUA 2WSLA 3U19A 4NG4A 1KC1A 1J20A 1X94A 2J87A 5FV4A 4RLFA 2FJUA 3ORYA 4WZZA 2VR1A 3AGPA 4I4TB 3ONFA 121PA 2ACEA 3PD0A 5COQA 3QU5A 2C4UA 3CPEA 2RCYA 4N0DA 3KQHA 3EVFA 1N36B 3DOFA 2GBIA 1DC6A 1RXIA 1W85B 1GAWA 2NSDA 4CGYA 3OIYA 3I64A 2ZJ8A 3A36A 2GZAA 2NU9B 4N41A 1K4MA 2Q5EA 3ZZTA 4R1NA 4P38A 5HKOA 1VIAA 1YB4A 4KYIB 3UENA 4NYJR 4RD3A 3KHUA 4D4HA 5IZCA 4DLLA 2N9UA 3WHIA 5G3YA 4DLUA 3LOUA 1KI6A 2TSYB 1VDZA 5GZ6A 4HZIA 2OZLA 4DEXA 1V8OA 5J2TA 4JDUA 2P67A 1VHWA 1QAMA 1E2HA 3WRYC 3M6LA 1SMKA 2CLKB 2HOQA 4KDRA 2VPZA 1H9BA 2RD2A 5D00A 4H27A 3BMNA 4JBXA 4LRUA 1H23A 1NPTO 3QW4B 4QUJA 4YTEA 3NBQA 1CIPA 3QPVA 2RJNA 1K8RA 1TAQA 3NBMA 5K8TA 3GAZA 1SKQA 2JCBA 4D8TA 2QAIA 3DUWA 2M1XA 1CS0B 1Z7BA 3ILHA 1E2LA 3MIZA 4ZP1A 2GKSA 1K1EA 2F9MA 4JYCA 2IYEA 4FDAA 1TC2A 5A05A 3QLVC 2IHVA 4ACBA 3EG9A 4NYJQ 3D2BA 3LI2A 4WY8A 4W7IA 3NXKA 1O4WA 3HEBA 4JBYA 1ZXBA 3AEKB 3V32A 5IZCC 3RYIB 1F2TB 4JI8B 2XXJA 3I9V1 3EY9A 3V1UA 2JFGA 2Y6VA 4KIFA 3ZV5A 2E48A 2JIDA 1I2DA 1YVPA 1GADO 1V16B 2GN4A 5G1PA 4PSDA 1CU1A 4RF3A 4Y2UA 3NRJA 1PQWA 4HNAA 2DYKA 4IWXA 2C0CA 2J48A 4UE2A 2F3TA 1C3EA 1CVLA 1ZCZA 2JAPA 2NT4A 3MAAC 1E0AA 2RHDA 1ZYUA 1EEXB 1FLAA 3L8FA 4QTZA 1R6XA 2VYQA 2NTVA 3OIVA 1XZHA 2A0KA 3JD2A 3NPAA 4RNDB 2JW5A 1XKQA 3IHTA 4YPFA 2NO0A 5CA0B 3L79A 3E05A 1BN7A 4CETA 1GRCA 5FD8A 3GNTA 2MSNA 2VHEA 3Q2IA 4BTEA 4LJ4A 4QGAA 4E30A 4NAUA 4K46A 1GZ6A 3NOQA 1U3DA 2Q4OA 3TLGA 1C2TA 3AF1A 1NW7A 2XGJA 3PI6A 1X0XA 3PXDA 5CTJA 4YR9A 2X0JA 1NBWB 4F8EA 2XUDA 1TZJA 4WOKA 3IBTA 4Y7DA 4W9NA 5LMNB 1RI2A 4Q4LA 4C3UA 3D0KA 3A4YA 3TZKA 4EKNB 2OCGA 5AK0A 1GZ5A 2FU5C 3FUTA 5K6RA 3FTFA 3MWGA 4LK3A 4UD2A 4DGSA 3LT5A 1NUSA 3F3MA 3COVA 2Z5GA 1ZGJA 4FU0A 4GWGA 4Z3DA 4GEKA 5T6BA 1J2EA 1EUDB 1JU3A 2BFBB 2PO5A 4LXXA 1GQRA 1GFIA 2HRZA 3ADOA 3LQ4A 4O0MA 1FNDA 4P7JA 4ZZ2A 4CV2A 3QU2A 4FIZA 5AKYA 4F4UA 2WF5A 5AUOB 1E0DA 2CGEA 1JQJC 1OT5A 3MPUA 4K88A 4L72A 3RC3A 3LP8A 3DCJA 3RJMA 2J67A 2ZYTX 4D9KA 2ZSEA 1I7QB 4EKIA 2I1QA 1BDBA 1E7RA 3CU5A 4KBFA 4XIGS 4ZHQF 4IQFA 2ZRNA 4KGVA 4TM7A 1GNVA 1ID1A 2ZDGA 1H0RA 2PR7A 3IUEA 4CE6A 1UJBA 1HPLA 3ST7A 1URPA 4BIMA 1Y63A 5F3RA 1H3EA 4X1IB 4RFSA 4BGEA 1L6RA 2NU6A 3VHLB 4DEYA 1G7SA 4XI9A 3BFXA 3RU2A 4NIMA 2ZANA 5ITZB 5HZMA 3A58B 3RJZA 3O0TA 1G3RA 4GBJA 3GLRA 1VIYA 1ZJYA 4YJGA 3SIXA 3A7DA 1LXCA 4XFJA 1RKQA 2D2FA 1F2DA 2PLFA 1YR9A 2WRZA 1REQA 3QFTA 1TF5A 4OHFA 2HWWA 3L0OA 4BTLA 4EHJA 1V6CA 1P7VA 2ZWIA 3B1WA 4TTSA 1LWNA 4NPHA 2HDWA 2ISCA 1KY3A 3AEKA 3SXPA 2V7BA 2Z8ZA 3B5IA 5ALDA 3GRYA 1EGHA 4Z7QB 2UZAA 2A1TS 2HQRA 1FQWA 2K2QB 3KKQA 1BVHA 1J8QA 3IV9A 4F3YA 4MCAA 3MIIA 4YWJA 4JYAB 1E1CB 3VNBA 1OLSA 4DLSA 1JSCA 3KJXA 2GJSA 3P45A 3PQDA 3EZGA 4PFQA 5D6OA 4KGZA 3V9PA 3UUFA 1E9FA 4ZK2A 3C48A 1MEEA 4MGZR 5K0TA 5CH5A 3COSA 3NT5A 3LJKA 4J8PA 1Z34A 4XLLA 4HYTA 1BH6A 2JCSA 2E2WA 4YP5A 2OCKA 1XCOA 1BA3A 1H2BA 1PFYA 3FMOB 4QOEA 2HRQA 2ZR8A 3LDAA 3LFTA 1FK8A 1FP6A 1QK3A 3ZJTA 3KR1A 4HI0E 3RW9A 1EH5A 3JYHA 2C3PA 1J23A 3N2EA 4FE4A 5CK5A 1J2RA 2QYTA 5A4IS 2Q07A 3E3NA 1TL7C 3O21A 2GT1A 4WASA 2D0OB 2XOEA 3AUXA 3DVSX 3MFYA 5G1NA 2W2VA 1KO7A 5T8KA 1U5CA 2VK2A 3HG7A 4S24A 4PLTA 4H16A 4F4HA 4KFSA 2TMDA 1YS7A 5BPFA 3G2HA 3OM8A 1U9ZA 1KZ4A 3FPKA 5BPHA 5EJ7A 5GV7A 2A1UB 2WWYA 3ZD8A 1TYCA 3ZNNA 3OQIB 3W5CA 2GF9A 1GWNA 1PW5A 1WEKA 2H5EA 2WJ3A 3R5KA 4FW9A 3G02A 2FZCA 4Q1DA 5FL7D 3OQ1A 1L8AA 4KQJA 4X41A 3VVLA 4A82A 1R0KA 3HB0A 2ZYGA 3GD5A 4RESA 4EECA 3RYFB 4JOBA 2AH5A 1SH7A 2VBIA 3KDAA 5JLAA 1Q12A 1ZUWA 4NE7A 5A5VA 4W9NC 3K94A 3WWDA 1FLDA 4IVPA 3PPWA 1RRPA 1QH8A 4RM3A 4S35A 2WYWA 1Y1KE 3HPRA 3OOJA 2YMPA 4ASUA 1LSOA 4G0VA 1ND6A 1T91A 1JVSA 2P27A 3LECA 3AVOA 4JLJA 1C41A 2I1VB 1O5OA 2XTMA 4ZWNA 4MHTA 4HDRA 4WVLA 2Y9PB 3BGSA 5TQ0B 2UU9B 3PFWO 3DBHA 3CONA 4AO8A 4LK2A 3DVAB 3TG2A 1QUFA 1HEUA 2ZRFA 2XKJE 2YXPX 1YB1A 1VE1A 3ENZA 4LVUA 5LXTB 3KSAC 1ILWA 1MJHA 4R6WA 4BMXA 1BX0A 3DPIA 4LX0A 2CL6X 1R4NA 2DT8A 4K9LA 2O19A 4TTJA 3K8QA 3OA2A 5A9TA 2PRYA 2R00C 4RTJA 5E8JA 3IERA 2WM9B 3A14A 3NC0C 3UTDA 5SZKB 2XR1A 2I62A 2BMFA 5BN3A 1EDBA 3DCNA 2XQKA 3DW3X 4UNSA 3OHPA 2B83A 4O4LA 1N3LA 4KKXB 3C3YA 4DCVA 2RH9B 3BCSA 3Q4GA 1I2AA 4Q9IA 3N70A 3ZCPA 3WGUA 2O8EB 2V7QA 3JQFC 4YALA 5IZ4A 1UAYA 1X7YA 3D7SA 4BTVA 1NJ8A 2ONYA 4RK5A 3H6HA 3PRKE 3CJRA 1KAEA 2BDUA 3HNOA 2FVXA 2Q28A 1RYDA 2XUOA 3H5TA 3I2IA 1RIIA 3ZU4A 2IU3A 3GQVA 2WJAA 1MV5A 5K99A 1BU8A 3AL2A 1K2VN 3ENKA 4OM8A 5AHKA 2E49A 1J2YA 3V4LA 1HDYA 1M1YB 4OQPA 1NG9A 1KDYA 3E03A 2EP8A 5A7HA 4BQOA 4F6RB 5FTKA 5SYMA 1T8TA 1TLFA 1G0NA 1NM5A 4XAQA 4WN3A 2O2JA 2VDJA 5IYZA 3F97A 1EBFA 4LZZA 5EP1A 1U28A 2O5EA 5IS2A 4NFYA 4IGEA 3EFBA 4I9FA 4B9AA 3UUEA 2OV3A 2J3QA 2PAAA 3H97A 1LY1A 1XZ8A 4Z7OB 5MN5A 2C3OA 1IWPB 4C4TA 1ICIA 1TAHA 3OHSX 5DTQA 2ZR0A 1Y89A 3OEHA 3UJ6A 4OI4A 3PQCA 2Q3LA 3T35A 4ZTUB 2ZB2A 3WGMA 4MWSA 1QE3A 1W34A 1BCSA 2G70A 4FEAA 1TTPB 1E99A 4PO8A 1S1CA 3EPKA 3W1EA 4UQLA 1NBIA 2ZB4A 3ZCXA 1RR6A 3NIGB 1NU6A 2PX4A 4FSDA 2QBYA 4JIMA 2GO1A 2DBRA 2GD0A 2AX3A 4HF7A 1MV8A 1YS9A 3F4LA 4WKOA 4ZVVA 4DLVA 5HIAA 1E59A 1RWMA 3DHNA 1Z5VA 4O59O 1QGOA 1UBKS 2ZG6A 1T4BA 3DVQX 1HNWB 2IQ5A 1WMSA 4MAFA 5DI3B 4FUQA 2BL4A 2GBFA 3E58A 3G17A 4D97A 5FBVB 4MYDA 3RI3A 3DDCA 4KIGA 4LHXA 3L6DA 2RHMA 4L0DA 1CUWA 1EXWA 1P7YA 2JH8A 1RCUA 1XQYA 2WNIA 4E5SA 1ST3A 2DUNA 2JZOA 2RK4A 2XXAB 5B1DA 4OVKA 2VTEA 3QX8A 1F0KA 4RKWA 1GPNA 4U8HA 5DWQA 1U90A 1ZCBA 1J97A 1KFKB 1UDWA 3AIIA 4WT7A 5AVOA 1ZK0A 1CUZA 4ZV9A 1YFLA 2NXJA 2OZKA 1TIBA 3PS9A 4RS4A 1D0SA 3F73A 1SVNA 4LGMA 4EHLA 2BT4A 2NACA 4BVHA 3R6LA 7YASA 2XD4A 3S55A 4RLHA 3U62A 1P72A 1WD7A 2HT1A 2JI6A 4DCUA 3EUAA 1NNEA 1O6GA 1L7XA 4LECA 3MRVA 1RHRA 4QA9A 2BEVA 1AURA 5EZYB 4CIWA 1I7DA 2DQ4A 4YJHB 5BW8A 2BW0A 2OV2A 1B8OA 1THGA 1EA7A 3D5TA 1XDZA 2VTKA 3M6FA 2ES4A 4I8XA 5LUAA 1TPZA 2ZB8A 4MTCA 3KAJA 1I24A 4RZ2A 1A9QA 1WQ1R 5CH3A 1TQDA 3WNQA 4N3BA 4GH5A 5D51S 4E03A 1U8AA 1T2AA 3BBPA 2E6KA 4CL8A 2DQZA 1I4OA 1SRRA 1JIIA 3D6UA 3LA6A 4EF4A 4Y9RA 5LPNA 1W8IA 2H2WA 5EMLA 1C9KA 3WISA 4NCJA 2CBGA 4MI6A 1Z88A 2JHCA 4JLPA 3O8DA 3Q3EA 3FJYA 3GLQA 4CL3A 1KMHA 4CM8B 1EE2A 1YZLA 2ON6A 3ZZUA 1LRLA 1MLDA 1RHMA 4Y9SA 3TLMA 3NATA 1N2CA 1VHLA 3HB5X 2X1VA 4ZVOA 3KL2A 4X6XA 3TB4A 3IOMA 2F3UA 3SR3A 1RLJA 2VTDA 5IVKA 5LC1A 3LL7A 5JDIC 3VR5D 3UATA 4H0FA 1KWKA 4N65A 3ETJA 5DVZA 1YI1A 2FP4A 3BL6A 5JW6A 4BKOA 3L7CA 5LP6A 3VDRA 3VU1A 1TF2A 3VSCA 5GADl 4Z3KA 1QH9A 2BUAA 1A1SA 2XRMA 2FZ4A 4GKAA 5EIOA 5IF9A 2ZSHA 1QQ7A 3IQWA 3KWFA 3QNUA 1I5OA 4MGKR 5DNVA 2OB1A 5DBHX 3ITDA 5KZMB 4QOJA 5DM1A 4EB6B 2G09A 2YR0A 1RJWA 2D7CA 3F8TA 4IF6A 4BXOB 4NZYA 1M1UA 2YC4C 2YBDA 2XDYA 4WK4B 1B00A 1GQYA 1YJXA 3LKBA 3T5DA 3ZE6A 4AG6A 5AW2A 1GNQA 2CN1A 3A05A 3A9RA 3QWBA 4HEA6 2HR1A 1VLZA 4LIPD 4NV3A 2WU0A 5F7JA 4E70A 5IKMA 5ALGA 1SU4A 1QX3A 1S2OA 3A6FA 5DK6A 1HC7A 4A2WA 3INRA 2L19A 1IOWA 5JBQA 3I12A 1TKAA 2DLDA 3OTGA 1LX7A 1XRPA 3TIIA 4UMVA 5DX8A 4CDRA 4YWHA 3X1WA 4O2RA 3T5CA 3DBVO 2PWBA 4MUAA 1A98A 2G3YA 4QBFA 3RHSA 1Z0AA 3JR7A 3AEZA 3PE6A 3I39X 4JI1B 2WSSD 3LT0A 2B8TA 2DFLA 1E1QA 1R9NA 1RYYA 2BMWA 4UEKA 1DRUA 3I53A 1FFSA 1H6AA 1NQXA 4EMTA 4C0AC 4MR9A 4OJNA 2ZXFA 2CFCA 2CJXA 1OZHA 2WSMA 1G2QA 4ALKA 3CY6A 1AGRA 4LGCA 2RJ3A 1QFXA 5T5QA 1I33A 2WPDD 1MOPA 1W9MA 3LE8A 3RKUA 2IU0A 2HSWA 3DO8A 4RQTA 3RKRA 4KFCA 3IEVA 4I3GA 1LDNA 3CM0A 2AG6A 3OPQA 4NG5A 3A6JA 3H5LA 1PWEA 2YXEA 2IYLD 2P69A 5KNCA 2VF2A 3UMBA 5E9AA 5AW9A 1EK2A 4OTZA 3G1TA 3OIDA 2EJVA 5BR1A 2YYSA 3NNDA 4TL8A 2FZKA 5EKSA 3FWNA 4OHOA 1XBTA 5ALVA 3VU9B 4R1PA 3QFSA 2J3LA 2EKPA 2B9EA 2G06A 2GAFA 4QD3A 5L3ZA 3SCZA 4N9WA 2AJLI 1WDTA 4U6SA 1SWVA 3FGZA 1NP6A 1ZJ6A 2ZJ2A 3BFPA 3H11B 4PZDA 2R5WA 2VAPA 4PYRA 3A70A 3AUFA 4UHKA 4V2UA 5JS1A 3TRKA 3KQSA 4D80A 4WXMA 2VH2A 1VLVA 2PNJA 3GRUA 3IBSA 5MF6A 3OTOB 1E2BA 1KYTA 4CVNA 1TVMA 1H2WA 4KE9A 1KJJA 2ZK7A 3JV7A 3ZZ1A 2E3JA 1D9ZA 2C2KA 1TTQB 1T26A 2CUNA 3ILXA 4GR4A 1UP6A 2BF7A 2KB0A 2H48A 3EVDA 3RS7A 4Q03A 2OWDA 5DOZA 3QG5A 4H15A 1YJQA 1K66A 3IFSA 5JT1A 1FJHA 3A1FA 1OGJA 5JCOC 1G8SA 3BTUA 3W3ZB 4LN1A 1J8MF 1U5BA 1G6HA 2DBVO 3E8XA 3L8GA 2CXOA 4HNHA 4LYYA 3B6EA 4N82A 4WGGA 1V5GA 5TPWB 3FJOA 3UVEA 4BMOB 4ZHQA 2OECA 3F78A 3VPSA 1MJGM 4UUMA 3D5QA 2JLAA 4KCGA 4ED9A 1RKBA 1PQ4A 2H52A 2YHIB 4P7KA 3FPBA 1BKSB 4MHSA 3ZCTA 4BKQA 3KWMA 2C8LA 4HPJB 3BG5A 1MEJA 4NOLA 2YJ5A 4KYTA 3DMDA 5P21A 4BFCA 3W8RA 5C1DA 4JB0A 2NYVA 3FSGD 4K86A 4YP7A 4E11A 1E64A 1MW9X 4GQBA 1K08A 2UVPA 2GXSA 4Q47A 1KVQA 1QIFA 5HNKA 3S8MA 1A2KC 1JDBB 4PZEA 1AKVA 1KC3A 2P9JA 4B4OA 2WTUA 5H8WA 5THKA 1SHTX 3IP7A 3QHQA 1ZPDA 2E4VA 2QMUA 1T2NA 3FN4A 1GPUA 3LCRA 1WZIA 5LU8A 5LQMA 1FPQA 1M0WA 2PJUA 3PF8A 4TUYA 3RNOA 5EXXA 5K0ZA 4INAA 1VL8A 3P9IA 1K5HA 2B7LA 4XD7A 4DSAA 4JB3A 1C4OA 2PZBA 1E98A 3V33A 1NV9A 4I5GA 5C7LO 3I8XA 4O2BA 1MB2A 2XNJA 1BOOA 1ULUA 2Z1NA 3O8QB 3PDIA 4MMYB 1LLUA 4C2UA 3SSAA 1N57A 1UWCA 2JLYA 4DMFA 2D0DA 1KSHA 8MHTA 2QMYA 2YV5A 2I6UA 4BDTA 1TQHA 4KVGA 1NJGA 3BKXA 3DFIA 4LVCA 4FOSA 5LLSA 4F6LA 1VE7A 4MZXA 2XCQA 4AZ0B 2IHZA 4DPLA 3RUFA 1X39A 5LP6F 3H9QA 4M37A 1D4OA 1J0EA 2JJ1D 3TQTA 4JK3A 3T1YB 2A8YA 2Y92A 2D00A 4PFJA 4K87A 3TQOA 4E51A 1ZD3A 2WVGA 3I34X 2IUYA 4ZAGA 1AKWA 1DQZA 2B20A 3G0CA 1SA0A 1ANKA 4ND7A 3CBGA 4QREA 1H4VB 2AOWA 1A7AA 1J1IA 1E6CA 2REBA 3KKZA 4UUNA 3EXHA 3PUXA 5DIZA 4MIYA 1UH5A 4EG6A 4ZA2A 1M7BA 5C7IO 1JYFA 2BFNA 3F98A 2R4TA 1L3IA 4YP0A 4CODB 3DDZX 1OBVA 2CL5A 4KPEC 2FMTA 1SXJC 2C54A 3FWKA 3JD0A 4XYBA 5FUVA 1HRDA 3UQYS 3L46A 5B2ZA 4LC9A 2MR5A 4UMEA 1PR3A 1ZNYA 3HZHA 2AQIA 2GJAA 2IXBA 2WP0A 3DEZA 3BSWA 4PRZA 4WLNA 4R3UC 2E5LB 4HLUA 3PDCA 3W8FA 2X2PA 1VPDA 2WABA 3FOBA 5D6NA 5JD5A 4JI0B 1W4CA 3DSRA 2I8AA 4JI4B 4ZCRA 3KSBC 1O08A 3AHHA 3REOA 2X23A 5K3CA 2P6MA 2XODA 3OH8A 4KXLA 4PGAA 1U2DC 2WJGA 1WW2A 2QMZA 1K3FA 1K98A 3MAJA 3RUAA 3VKVA 1A9OA 4II7A 1LPOA 3GCZA 1YVDA 1JPVA 1NXPA 2C4MA 4GAEA 4E5UA 4DV5B 3R77A 2G1JA 4AJ2A 1GU0A 3R9IA 5E2BA 2ZBRA 3KJHA 5DCYA 1FTYA 1P91A 1V95A 3DNMA 3R9XB 3MERA 1E4EB 3GZTB 1JHAA 3DWEX 1DQNA 4NATA 5FL3A 1G64A 4CWAA 5C7YA 1RC8A 4NAVA 3RGWS 2J0EA 2W6PA 5IKPA 3AKEA 3D3JA 5JZSA 1Q0SA 1CTQA 3OEED 1GL9B 1KEWA 4KK4A 4OJQA 4P82A 5FEMA 1TTTA 3EZYA 3QA9A 1OLUB 3CZCA 4HAIA 2V7PA 4P58A 3U56A 4MNTA 2DPXA 3D6MA 1XL0A 3HFRA 4PLCA 4FT4A 3UKOA 4EZIA 3OKPA 3EOZA 4QQNA 2FDXA 3R6DA 4LRWA 4UQOA 2FGKA 3MCTA 3HYCA 3LBIA 3PQEA 3UYKA 3K09C 4JEIA 4DR1B 5DYIA 4JODA 1OFUX 4XQCA 1OGIA 1COWA 1ZBQA 4X8OA 5ALIA 4CKBB 4LQLA 2RI6A 5KNCD 4I50B 4D4JA 1PYGA 2JKYA 1YVUA 4KXFB 4P54A 5A7FA 4K9MA 2CLDX 5DHQA 1C7RA 1Q6YA 3OF3A 4JT4A 3SD7A 4FSXA 5JTUA 2W6IA 3ITKA 1RWVA 1G8PA 3Q7IA 3T9AA 2JGFA 2RGNA 3EF3A 3TZEA 1Q3TA 2Q0HA 2JI7A 3KPVA 4O3FA 1Y5IA 4D43A 3GUZA 1X7ZA 2QP3A 4D3DA 2WJJA 3A31A 5YASA 5BN5B 3G89A 4HYEA 1DAOA 2ZWVA 2JGEA 4GKVA 3M6MD 4DSTA 3ONNA 1LA2A 4JUIA 3QFRA 3JVEA 1VQ1A 3ZDAA 3AVWA 3T9EA 1N2ZA 2VAMA 1J33A 1FFEA 1OBOA 3SZUA 3V4PB 2VDPB 3LXUX 3FCUB 1FFWA 2F9FA 5I51A 3AVVA 2OK7A 1Y0BA 3R3SA 4HXYA 2QN3A 2IV2X 3T3GA 5HOQA 3KUDA 2V7GA 1OH7A 1GD1O 5TS2A 2JFPA 2PHZA 2R8BA 2QJOA 3E4CA 5B4UA 3LPCA 2VJCA 3R2JA 1B7GO 1T0IA 4OUDA 4LV6A 3RRFA 4YNBA 1OKKA 2QPTA 1VYVA 4GI5A 4B09A 1W0KA 3DP9A 4PZ9A 3TSWA 3H2SA 4NZZA 4L4SA 4RIIA 1KDPA 5G53C 3UA3A 1IEWA 3A2MA 2WVJA 2UV8A 3T5GA 4ZI7B 3EFOA 4GPD1 1IN5A 4D82A 4KJXA 2NYRA 3MW8A 1G8FA 3GLHA 1HWYA 3L06A 3WWEA 5FYDA 3WIVA 2G5GX 2VTBA 4CQJA 1YBMA 1UFKA 1IUOA 2Z6AA 2ZSFA 3CW8X 2JCVA 3KLPX 1JHDA 4QEZA 3VC1A 2PBZA 4MVJP 1XKTA 1ZWKA 4RKEA 1J1UA 1MDBA 2G7ZA 1BZYA 1U9JA 4IWNA 5DYWA 5IC5A 2XW6A 5K8LA 1UFQA 2ILVA 3HACA 2COKA 1W5SA 4DIBA 4E4YA 2OXCA 4N3CA 3E6AA 3GMDA 4DC0A 3JU3A 1IJEA 2FETA 3PUHA 4MWCA 5JISA 5AKXA 1MN6A 2ZYIA 2QRPA 2GPWA 5IU6A 3HVJA 1XU4A 4DA8A 4MI3A 4ZOLF 1UBUS 2C5BA 3WHLA 4BQRA 2RAPA 3AETB 1IHYA 1KS2A 5LR6A 2CYCA 4Z3OA 5FNVA 4AO6A 3C5VA 5I5GA 5B64A 4WWHA 4AY2A 2QX9A 3ROTA 1AY0A 3HUTA 1A8QA 1YD7A 4IIJA 4IDPA 5D7BA 3SZ3A 5C52B 4L3WA 2XVAA 4QNNA 2EFHB 1M2VB 2AN5A 3AHDA 3SXUB 1CY7A 4JBNA 5A3JA 1CJSA 2D1QA 3ZDZB 3U49A 4F4JA 3ETCA 1UANA 1ZM9A 2V65A 4IIDA 3H5WA 3JW8A 2AR9A 2DHDA 3RROA 1JQAA 4AX4A 3E81A 1JDJA 3FPGA 1O95D 3REFA 3LBYA 1F2VA 3D6JA 5KU7A 1E7QA 1Q19A 2YV1A 1K6IA 1Y3CE 3VV3A 1H5UA 3M6IA 3LT4A 2ATIA 2FEKA 2IXGA 3AR4A 1L9KA 5EFOA 4RJ2A 4IMIB 5BVHA 3ELUA 3ISTA 5KCMA 3R7FA 2ZYDA 5HM6A 3L5KA 1UPBA 4L9AA 1FDVA 2C8VA 2FPSA 2P9FA 5T4EA 4A0SA 4DIOA 1CNFA 2XRFA 5K4AA 5BQPA 1M8PA 4OF4A 1L7RA 4DA9A 5A4JA 5CDTA 4KX5A 2VJMB 1NW6A 4WOCA 3JQAD 3UGQA 2FSHA 1QONA 3R0ZA 4DRYA 3I1YA 3IMGA 1SU8A 3IPXA 3OPNA 3OU2A 1HYEA 4KXYA 4M7PA 4XLZA 2G5CA 4KQ1A 1I7PA 1N3BA 3UMJA 1I36A 4CG3A 3G2NA 2NG1A 3RVOA 2QRVA 1CXZA 4KNVA 1Y8QA 4RLSA 3TDKA 1EE1A 2ZOSA 1EJBA 4LRTB 3M3DA 4PBRA 3PPIA 3FHTA 1VE6A 3B3GA 3WP0A 3PJRA 1A5AB 5A6VA 1KRWA 1GGKA 1GQOA 3LHDA 4DUGD 3UQZA 1RWPA 3OP4A 2C03A 1TUGA 2Z9BA 2QX6A 2RAUA 3IKJA 4Y6SA 1N6KA 1RLIA 5CBPA 1X7WB 2O7SA 2VT7A 3GJ3A 4DWVA 4U9IS 2JANA 4MS4B 1CRQA 3T8YA 5IT4A 3HY4A 5EZYA 4N0QA 4D4KA 1RQXA 3GPBA 1Q74A 2IH5A 1Q7EA 1V39A 3VTAA 2KW5A 2ZLBA 2ZB3A 3GCWA 4J7AA 4NJOA 4R0VA 4G86A 4XR9A 3O5AA 1TMGE 1YIAA 3AR6A 5H82A 1M5TA 2Q6IA 4ZEWA 3S5JA 3CG0A 3DUFB 2P9QA 4C05A 3L6CA 1T1GA 2NU8A 1PNRA 3UCEA 3KJQA 3WNCA 3FCXA 3FPEA 1GZVA 4CM4B 3IVAA 1QHNA 3EAFA 4C0KA 1IZ7A 1SOUA 1XG5A 3OTHA 4IUYA 4RKYA 4X60A 4KO4S 3VKGA 1P4AA 3SSOA 1Z07A 3LUFA 3RBZA 4YRRA 5G0SA 5TVKA 5CLGA 1MJFA 4Z54A 5HZHA 1UOOA 3K6KA 3QPCA 3QVTA 2R1TB 3K31A 3DFZA 3DHWC 5HEKA 3KJGA 3KEOA 2QTGA 4Y2SA 4XVCA 4H7IA 3W79A 2CNWD 3C15C 2PMKA 1LH0A 3HDQA 5ENDA 3PYXA 3D0RA 3MTQA 4KLRA 4DBLC 5EHXA 5HIKA 4IRXA 4YACA 2FPMA 4KPYA 4W1QA 2G28A 2GPSA 3DULA 3VU0A 4B4WA 4DMRA 4CG2A 4EGAA 3G7UA 2DHCA 3D8NA 1TE2A 3CKYA 3L04A 4GG1A 3LY5A 1HYGA 3F6RA 3SBXA 1Y7IA 2XUAA 3HB7A 3SLGA 3WLTA 4L08A 1OV4A 2CD7A 1X1RA 1BCSB 4RD6A 5FBQB 3IEMA 3VRHA 4MUEA 4E14A 1Q0TA 2DOKA 4HB0A 2GRAA 3QKUA 1J2TA 1QRAA 3RTDA 1DOAA 2EXXA 3CO5A 5AOBA 5JANA 3EDYA 2Y6UA 4ZT5A 3QP9A 3TBFA 2PFSA 4DLPA 5I3ZA 2ODQA 2LW7A 3ZY3A 4L6AA 1SUCA 3GFFA 2NUTA 3H16A 2O54A 3RIHA 1E9BA 1L6IA 3R7LA 1DBVO 1I0LA 3OJLA 1LEHA 4K9DA 1YKGA 3C5CA 4JSYA 2ORWA 3NB0A 3QU9A 4DR5B 4QJBA 1QU3A 2BTQA 3VHQA 2TMKA 4HWGA 4EDHA 1U9IC 1YS1X 4P4GA 1VPTA 2XYVA 2G77B 2C29D 3QLUC 4TTRA 3TNJA 2QTTA 4FR5A 2R0QC 1CJVC 1JWLA 1X7YB 3ZZNA 3LG2A 5T57A 4I1PA 1H69A 3HCFA 2EQ5A 5FOSA 1YACA 1H2YA 4C7VA 4PC2A 5EP3A 1R12A 1YTLA 2W2LA 3DOIA 1UZMA 1GCUA 1M34E 3H8WA 4PYOA 2UAGA 4PZ0A 4E32A 3KUKA 2C78A 5AH0A 2D62A 2Q5OA 3ABSB 1IHXA 1TJNA 2C5FA 1RP1A 4I55F 4JB2A 4WFIA 3EVNA 1LK7A 1WHTB 2IHKA 2O2ZA 1LV7A 3LAWA 3QHPA 4PPGA 4B6JA 1HFKA 1DXYA 1N8KA 1WRBA 2HBYA 2RGEA 2EW2A 3LCVB 4BLVA 4PLYA 3MMZA 4XIYA 4N1AA 3FW1A 3HKDB 1J99A 1XELA 3SFVA 4CIAA 3ZY5A 2QMHA 3H75A 4BECA 4R83A 2HMTA 5U1PA 2PSFA 1UWVA 3GZNA 5B3AA 1JSXA 3F6EX 3QV2A 2R47A 3OMLA 2ZI5A 1KOFA 1A82A 3I05A 3HGQA 1N9GA 1BD4A 4JC8A 1ODTC 1WPQA 5I4BA 3GPLA 3GGDA 5ALJA 3BXFA 1E1LA 5JWRA 3EPLA 3IULA 4R7ZA 5ESDA 4W1PA 5TGZA 1X87A 5CVJA 5DIFA 1JUDA 3OJCA 2QNIA 4I1IA 1KI1A 1R8SA 1SCUB 5FBKA 1VG9B 1PW7A 5JY1A 3AY7A 2ZJAA 1S96A 3HDYA 5EE3A 1U6KA 3LQ1A 4U2EA 3ONEA 3ECCA 1SJ9A 3NP7A 4RPGA 2OOSA 4UD6A 3GLFA 1HFJA 1LLQA 4GMHA 1ORDA 3FLBA 4D6PA 1XZIA 3SYMA 3C97A 2Y66A 2JLWA 3BB3A 1MRZA 3LBHA 4U2DA 4TXHA 5JJBA 1DJQA 1UT8A 3L7DA 5SZHB 3ZPXA 4DSUA 4KVAA 3M2PA 1Q22A 2PY6A 2FSVC 3BC1A 3P8ZA 2D3TA 1UC5B 4NNJA 1GXSA 2P35A 2V6FA 1N1DA 3QYAA 3GELA 4X1YB 5EINA 3KT0A 3S28A 4B85A 2DBZA 2I8LA 2QSYA 5CH8A 5JCOA 4A73A 5KTRA 1IVSA 1KU6A 2BGNA 2IU6A 1TO2E 4TL9A 1WCIA 4C0SA 3NUZA 3SZMA 1R0SA 2AZTA 3EMBA 3L1JA 4JP2A 5KWVA 4JX8A 1AC5A 1N2BA 2J7KA 3BAFA 3L0DA 1V2HE 3GRPA 4K9PA 2DE0X 3ZWDA 3ZHTA 2ZW9A 4D3XA 3KB8A 4M38A 3D31A 3RB8A 2ZR9A 5DYYA 3PPYA 3N2NA 5AI6A 2H08A 4XB1A 1E2QA 5HCNA 5E7MA 421PA 2VQEB 4ZDJA 4WBNB 4MV0A 2Q1YA 1CULC 2QTZA 1L7EA 4RVHA 3RE1A 1X0VA 2OAP1 4TKUA 4FM9A 1MC8A 1NKSA 3ICQB 2P11A 1FNNA 5BSMA 5HUQA 2Y1CA 3WFJA 1KDZA 4HQKA 1GZSA 3DEFA 4AP9A 3NBFA 1KQ3A 1YDWA 2X8WA 3H4MA 2A5GA 4OYYA 4OLAA 2DBYA 4HQFA 1PZHA 2WTAA 4Y2RA 1UM9B 4KUEA 4ID9A 5B37A 1H1LB 1KDRA 1MDFA 3FTNA 3QVSA 1IRIA 3HZZA 3UOWA 1ZGHA 1PCXA 4OBEA 4BBJA 4EVSA 2WAOA 2J6HA 3H99A 4U9UA 1ZAYA 1NURA 2Z43A 4C4XA 4M1EA 1V9LA 4WRRA 1YWGO 2ZVPX 1XRRA 3M4JA 4E46A 1RPTA 1R00A 2W6QA 1KI6B 1CB0A 3PJFA 4YMSA 1OB2A 2O23A 5FNZA 2BM8A 2B7BA 2O2XA 3PHHA 3GHHA 3SZOA 3ER8A 1IY1A 1YR7A 4Q3AA 1NXXA 1CB7A 2RFLA 2QI9F 1KMHB 4E5VA 3S3TA 4FX5A 3G0IA 2P2ZA 1KSJA 1PJ4A 1FDTA 1QPBA 3P94A 2E1RA 4I1YA 1AZSC 5DKFA 1SPXA 5E3JA 3T1TA 4EG3A 3GDOA 4D5EA 1YA4A 3OJ0A 1YK0A 3ASYA 4LGVA 4EUSA 3U7FB 1W7AA 4C03A 1LWOA 3FNHA 3EQ9A 3LQRA 2P1DA 3EISA 4QICA 5EKXA 2FQWA 4K26A 5JSKA 5DM4A 2ZRGA 1WOMA 1ONBA 2ZZKA 2XQJA 3BX1A 3S2EA 3U09A 4WEOA 2B5WA 3LX8A 4JB8A 4CN9A 3K2IA 5T6MA 1J4AA 5FBWB 2EVWX 2IE8A 1A71A 4C5BA 1XCBA 1HEIA 2NOAA 2XUHA 1EJ0A 4NU0A 4AJIA 4EEXA 2PU5A 1S89A 3QZUA 4U2KA 2O07A 3GJ0A 1FP4A 1KJNA 1PN3A 2GLTA 2J0UB 4KLAA 5HW0A 3QPBA 1QC5A 3QX9A 2CLSA 1GARA 3LDFA 1V37A 1T9KA 1V3VA 3T0IA 3KUCA 2BTOA 3PRYA 5I7AA 5LDHA 4S1OA 2HN9A 4KAAA 4K9SA 3KE8A 1ORTA 2XHEA 3N8NA 4D2IA 1M2EA 3L82B 1FFCA 2J9GA 3ME5A 5DNUA 3D02A 4E6PA 2D13A 2EW8A 1SIWA 1HTWA 3CZ5A 1PI3A 2PPVA 2P41A 1G8AA 4RL6A 3ZWMA 1CJCA 5C1OA 1QFYA 1G20A 3V46A 1H2HA 1Q0RA 3G0GA 2MSWA 1DEOA 1GNLA 3HO6A 3EBLA 3OSUA 2I4NA 4LMBA 5ERYA 4ETMA 1OSNA 2FYTA 1BDHA 3G2MA 1XTZA 4Q9KA 5JD4A 1C7QA 5AJWA 1ZZGA 1I2CA 2OFPA 2WM2A 4C0QC 2DY1A 3E27A 4BJHB 2WMNB 3NANA 2FP3A 3QK7A 4TZ0A 3NQ41 2FW7A 3P32A 4KQEA 4CKBA 3WOVA 3AWDA 2E4XA 2IYFA 4JBHA 4LMPA 1E58A 5EEGA 3ROZA 1I3NA 2IZOA 3P26A 3E1KA 1Z2PX 5U4QA 1V0JA 3TLKA 4NNPA 4HRAA 1HT1E 3L92A 2YY5A 2LDBA 4Q4AA 5DWVA 1T4GA 1SVSA 4ISCA 2YFKA 3B1XA 3U3RA 4DUYB 1XPOA 3DLBA 1SOWA 1G6OA 2FR0A 4XIJA 3E3AA 1JLRA 2Q3CA 2OFXA 2QLNA 3EH2A 4L16A 4RVOA 4KPFC 1XV5A 1O94C 3TN7A 3UJHA 3UWKA 2ZKLA 1X1BA 1KTVA 1MW8X 3VO9A 1NG1A 1NQUA 4AJHA 4YCCA 3E7PA 4CLXA 3QU7A 3WKEA 3HZOA 1SZDA 3I8OA 3DHEA 1QG0A 1M73E 2VA9A 4Q19A 4KO8A 4RK7A 4WLUA 3HJUA 2EFDB 2JZCA 4DADA 4M8IA 1G1AA 3DE0X 4MWGA 1T24A 4BO9A 1XWWA 2TECE 4HEJA 1CUUA 2A9PA 4OGWA 4DV2B 4I6GA 4TYWA 4GLJA 1KK0A 3AI3A 3BGWA 2WIKA 4A0RA 2CLHB 3DDHA 2NX2A 3W4JA 2BGRA 3I73A 4ZVLA 3GFBA 2X0IA 3TXXA 1HA3A 4ENUA 2PYZA 4KREA 4JUCA 5C5DA 3GJSA 3K35A 4XQ0A 3UB4A 4PR3A 4HNTA 1AMNA 2VUIB 4N0MA 3DDOA 4OQEA 1YQXA 2JPDA 5I48A 2FMHA 4DANA 2WD9A 2I1LA 4MSUA 3IBCA 3KSUA 3EDQA 5E3HA 5KTPA 4FZVA 4P3YA 3RTCA 2GCIA 4RJKA 4YAEA 2IPLA 5LLDA 3G2LA 5A06A 3K0HA 1TYBE 2WJ4A 2AJCA 2KLBA 3ZIDA 5TIIA 3M0EA 3TCKA 2JJ8A 3IJ5A 1E69A 4CM4A 4BHTA 4WNCA 3GN2A 1A4IA 1EQAA 1MMFB 3FVWA 1I51A 3GK3A 2FPOA 1JR3D 1QG4A 1TEVA 3EGVA 3MF4A 3A0RB 2ET6A 1P5JA 1EFKA 2ZJ3A 3BD7A 3ITEA 5KNBH 3F6SA 4PZCA 4CFSA 2Q49A 4P3XA 1JP7A 5K5EA 3L93A 4CEHB 4Y1RA 5BORA 2RK3A 2FEMA 3DVAA 1O95C 4OFWA 2LIPA 4D0LB 5JQGA 4A7PA 3P52A 4FDUA 4WL0A 3N0RA 3GLGB 4J9UE 3M7IA 3ZXSA 2ECKA 3KQMA 4CF5A 5DGXA 1D5CA 2HF9A 2XNSA 4OQFA 4KQ2A 2QM3A 4OYLA 4Y67A 3CNLA 2QMQA 4AO7A 4B3TB 5KREA 2BMJA 4RD1A 3ACCA