1SC1A

Crystal structure of an active-site ligand-free form of the human caspase-1 c285a mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
167
Chain Sequence
b'GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta convertase
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 167
sequence length 167
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sc1A00
2J31A 4JJ7A 5IC4A 5JFTA 2C2KA 5IAJA 4N5DA 4QUBA 1F9EA 4N6OA 3V6MA 2WDPA 1QX3A 1RHKA 1RWNA 4ZVRA 2H4WA 3V6LA 2H4YA 4QUEA 3RJMA 3V55A 5IAGA 5LUBA 1IBCA 4DCOA 3IBCA 5IARA 4HVAA 4NOMA 2CJXA 4PS0A 5LU9A 1RWXA 3P4UA 1SC1A 1NMSA 3UO8B 5IBRA 4NOJA 1K88A 4EJFA 1CVRA 2AR9A 4EHLA 3DEKA 3PCXA 3H13A 3V4OA 4QU0A 4QU5A 2C2MA 4ZVQA 2FQQA 3NS7A 2XYHA 3DEIA 3PD1A 4QUHA 3R7NA 4HQ0A 2CNLA 3V4LA 2H5JA 1GQFA 2P2CA 4QUDA 4ZVUA 4EHNA 4ZVPA 1K86A 3DEHA 2H48A 2QL7A 1M72A 4NOKA 3R5JA 1RWPA 1SHJA 1BMQA 2CNOA 3GJTA 3R5KA 2XZTA 4NBLA 4QTYA 4NBNA 1NW9B 4JQYA 4NOLA 4I1PA 1RWMA 2QLFA 2QLJA 1NMQA 4M9RA 1NMEA 3D6HA 1PAUA 4D3ZA 5I9BA 2HBZA 2HBRA 2J30A 3S8EA 1RWKA 4AWBA 2XYPA 4JJ8A 4FDLA 4NBKA 1RHQA 3EDQA 4LSZA 3R6GA 2HBYA 1RHMA 1RWVA 3H11B 4D3YA 4D3XA 4FGUA 4QUJA 1RWWA 2QL5A 3SIPA 4AWAA 5K20A 3OD5A 4DCJA 5IASA 1I4EB 1I51A 2C2OA 4ZVTA 2DKOA 2H54A 4QUAA 1SHLA 4FXOA 1RE1A 4EHAA 1RHRA 5IBCA 2XYGA 5IAKA 4JQZA 2J32A 2K7ZA 3KJQA 4QUIA 4FEAA 1QTNA 3ITNA 3P45A 3DEJA 3GJSA 5H0IA 4EHFA 2FP3A 1CP3A 2QLBA 1ICEA 4JJEA 3SIRA 1PYOA 3V3KA 4EHHA 5LU8A 4JR1A 4ZVSA 2Y0BA 4AW9A 4EHDA 4N7JA 2CDRA 4HQRA 1KMCA 3GJQA 2H51A 4N6GA 4QU9A 4JR2A 4QTXA 2HBQA 3IBFA 3KJFA 3E4CA 3K7EA 4QUGA 2XZDA 1QDUA 4N7MA 3H0EA 3H11A 4PS1A 1I3OA 4QULA 2H5IA 3EDRA 5IAEA 4DCPA 2CNKA 4IYRA 2FUNB 2C1EA 3D6MA 3GJRA 3S70A 1GFWA 1JXQA 5IABA 3UOAB 3PD0A 1RWOA 4JR0A 3KJNA 4QU8A 3R7SA 4PRYA 5IANA 4PRZA 1SC3A 2J33A 1I4OA 5LUAA 3NR2A 4EHKA 4IEFB 5IBPA 2C2ZA 4I1RA 4JB8A 1RHJA 2CJYA 3R6LA 5IC6A 1RHUA 2CNNA 3BIJA 2NN3C 2Y1LA 3H1PA 3NKFA 3R7BA 2H65A 4N6NA 1SC4A 3D6FA 2QL9A 1F1JA 3QNWA 4ZVOA 5I9TA
chains in the Genus database with same CATH superfamily
3W05A 2QGFA 3U4IA 1EX9A 1THGA 1FS5A 2JHFA 3QLUC 4HGRA 4OSEA 4R5HA 1VKHA 4A8TA 4LDRA 1OH5A 4O0MA 3T7TA 1T36B 5IWCA 1NE7A 3F3MA 1F5SA 4P4LA 5HK9A 4HNVA 2OOKA 2HWXA 1BZYA 2FMHA 2SKEA 3QP9A 2V74B 4HEHA 4R8VA 3WQRA 3DPSA 2BEVB 2IF2A 2JBHA 5ISMA 4Y8VA 1JT2A 4D8XA 4FT4A 5LLTA 3A06A 3EG5A 3WYBA 2AR0A 2RHRA 1NQAO 3E9DA 1EX1A 4OUDB 2ZYVX 3MGKA 1II0A 1VM6A 3GLSA 2QRUA 2YJGA 3TLXA 3VHQA 4BDTA 4ESVA 4KDCA 2AB0A 2ZRKA 3M1IA 5EHGA 3RHZA 4YRCA 1GZDA 1UZUA 2P9EA 2WUGA 3FI9A 5LA6F 4DLWA 1IBRA 3HM9A 3WICA 1Z74A 3H8WA 3IURA 5EZYF 5KC9A 4MKGA 2H7CA 2YX1A 4FU0A 4UCFA 4EECA 4BNMA 1DAFA 2RBEA 3OPXA 4EB8A 4W5OA 1C9EA 5TVKA 4FR5A 4U8GA 3NOVA 4PZEA 1T29A 5YASA 3OTQA 2IDKA 1RJ9A 2VL7A 4W9NC 3DE3X 1KMNA 4PX5A 1OB5A 3DLBA 3UENA 3W79A 3FMFA 1E1YA 4JLWA 1B42A 2R65A 2VBGA 1I2CA 3JTEA 3LNTA 3RYFB 1QQTA 1QRUA 5CA1B 3F97A 2PT7A 1Y98A 2ODQA 3CLTC 3LXUX 5HQ3A 5JTUA 3EDQA 2VTBB 5D01A 3KXPA 1X7XB 2UUBB 3KZ1E 1SIBE 4ZEMA 2UU9B 1AJEA 2PWPA 3EFEA 5LJIA 1OTYA 1YE3A 3V4RA 3HKBA 4EI7A 1XNGA 4HN4B 4R8LA 4Z49A 5G0WA 4KHZA 1XMVA 4FGKA 3THYA 1O03A 2OORC 2BAGA 1VQ1A 1O58A 4Q03A 4B6JA 5C4GB 4ZJUA 3AINA 1AC5A 2ZROA 3DFKA 5KJ1A 2PV0A 3OCVA 4IX1A 3I83A 5DNEA 2R8RA 3H04A 3VR5A 4XD7A 4DLKA 5C37A 4X85A 1YZFA 5JJBA 3KVRA 4NEHB 5DXJA 4GOKA 2XTJA 1GLVA 4EG8A 1D6SA 4GS5A 1BA2A 4J8PA 4DA7A 3S2SA 2FB9A 3OT1A 1OLSB 2WJ4A 1YBVA 4N7JA 3OFNA 1ZK0A 4FMDF 5FTNA 3TYXA 4AY6A 5T64A 5JS7A 3NATA 3FTFA 1UZMA 1PGOA 1E2QA 5ALMA 4E3ZA 3IFSA 1KO5A 3U13A 2PX2A 4P93A 4BU1A 4C0HA 1KYZA 4QEKA 4N1AA 5GOTA 1WE2A 1W85A 4F85A 4R2XA 1ESCA 3EQ9A 2YHIB 3OSUA 2JLZA 4PHHA 3KEGA 2V0NA 3QUSA 4EFLA 5CDHA 3IP1A 3C5VA 1AU9A 3CT4A 1L9XA 3K4PA 3GA0A 1ZINA 2Q2OA 3AT1A 4L0MA 4PN7A 3MCVA 1YVRA 2AJ8A 1X42A 2JCXA 2XNKA 2O20A 3MCUA 3U49A 5JS6A 3TL6A 5HEKA 2E5WA 3WHIA 1EWKA 1VJTA 2V4UA 4CJXA 4DC0A 4CQMA 4EITA 4FVTA 1WDTA 3ADKA 3D6NB 4Y6LA 4BJ6A 5BW8A 1GT6A 4DMGA 3EEOA 3CRZA 2QD3A 4COOA 4HFNA 3LBAA 3IT3A 4JVNA 4ZZ3A 3TSOA 2XB4A 3SF0A 1JKJB 3GJ7A 5KAMA 5JAMA 1NI5A 4FYIA 2PBZA 1CUIA 3EY9A 2QQ5A 5FB3A 3VR2D 3H2BA 3I42A 4FMBB 1ZHFA 4G1EB 4HWPA 2HJHA 2BP7A 3IJ5A 3M6VA 3QMMA 4O29A 4AP6A 2FVXA 1K7SN 1B0UA 4EL0A 3H1EA 1U8TA 1C9KA 5JROA 4L5AA 1JLSA 3ZY5A 2VP0A 1VSTA 1PWXA 1SRQA 4NAVA 3UJHA 2CLLB 3BXPA 2O1SA 3CB4A 3OF5A 5AK4A 4TUYA 3CPSA 1C1YA 1E3JA 1P18A 4HD8A 4B4OA 4MHSA 1MC1A 4CN8A 5JRZA 1DU4A 1YS4A 1N34B 2OCDA 3QUTA 3ET5A 1Z45A 1P1HA 5CURA 1Y63A 3TG2A 1P4AA 1GVNB 2QE6A 4HGZA 3A25A 2JLCA 3AEUA 3GLFA 1O97D 3RNOA 1CEEA 2A86A 3AFIA 1EHIA 4GI2A 4EATA 3D0RA 2UXBB 2HHHB 1I3LA 2LP4Y 3GDFA 5T3UA 2WFLA 2POCA 4LKRA 4X90A 5TS2A 1F2TA 1TUBB 3MTQA 4E1BA 2M6RA 5C7LO 4DGQA 4WA7A 2A0XA 2HMSA 3C3CA 2YOFA 3NV9A 4I4TA 3KZNA 2DUUA 3OG9A 1G8PA 1I6MA 3PGXA 4LOHA 4F91B 1TCVA 5AUQA 3RSZA 2C7QA 5CXSA 2BSQA 3OE5A 3C3XA 2YN0A 1H1DA 2QR2A 3A1NA 4QOFA 1Z5UA 2ODTX 4NYMR 4R1MA 1DQRA 2O3TA 2DM6A 3L0ZA 3LPCA 2Z56A 3HXPA 3DFIA 1Z0UA 1CEXA 1XEAA 4LZZA 3S5JA 3URMA 4GGMX 4B7CA 2EIXA 1EA7A 1M1YA 2B1QA 4N0PA 3D6VA 3B3JA 5DYWA 4QOEA 4BKQA 1THZA 2BLLA 1V2GA 4N3GA 5EL0A 1VI6A 2ZAOA 4Q93A 5BVGA 1L4MA 1UAGA 2A1UA 1FMFA 4J9UE 2OGWA 4FFPA 1L7QA 2JVIA 1QE0A 2R48A 3LUBA 1D2HA 3OX2A 4R1NA 2YNMD 2ZJBA 1TK9A 4R4JA 4RETA 5BN4B 3VSDA 4YRAA 1VIAA 1IZ9A 4JI3B 3Q6NA 2C8KA 2DF8A 3QX9A 4DDTA 1T35A 3E9CA 2CD7A 1DBPA 1KEEB 1Q14A 1RDFA 1TM3E 3OTIA 4Q6BA 3QXXA 1NUAA 4RHTA 3H1AA 4EUKA 3IRVA 1GARA 2AI2A 3K7EA 5KVVA 2EYQA 1W93A 3OZ7A 2R3SA 4P6VF 3OQNA 1UDCA 1CBUA 3HDQA 5K05A 1EX6A 4PYOA 5EERA 5AJVB 3ECSA 5EJMA 4JI7B 1WV1A 4PONA 3GLIE 1N2ZA 2O8EB 2WJGA 4I7EA 5HE9A 2PQ2A 2WD9A 3Q3EA 4KV9A 4LE1A 3DVAA 2HA5A 2OHXA 3AHJA 4KN9S 4GP6A 4S35A 4H08A 3GLGB 1PR5A 4NBUA 1MX1A 4EH1A 1TK3A 3NYQA 4B47A 3EEYA 1ZITA 4M1EA 2WI8A 1PJ8A 1JYEA 1E2UA 4QVKA 5K3BA 2AMYA 4YRSA 1JJVA 3IYLW 4PPGA 3O93A 3QF7A 3AV0B 4RK1A 1SHTX 1XDBA 2V6GA 5FFNA 2YJZA 3H6GA 4CG0A 1PR4A 3LX6A 5LMUB 2UKDA 4JXKA 3Q9LA 2JBAB 2J07A 4BE7B 3VZBA 2Q5CA 1I30A 3SI7A 1MC4A 1TAUA 3HNOA 9ATCA 5BNWA 3W5UA 1IONA 4MYSA 2HAEA 1W9MA 2ZIEA 1A5AB 1C8VB 1J21A 1HYEA 3TCKA 4OLAA 4YUAA 5A62A 4RIGA 3IGFA 5BV7A 4AS3A 2BH2A 3WDKA 1HYHA 2QJWA 3TTYA 4TZ6A 2V6JA 1T3TA 4KIFA 4NZ9A 1CVRA 4RK6A 1DIGA 2PMKA 1G41A 1NXVA 3ANLA 3PDHA 4XM1A 4GVXA 3OIUA 5FORA 5IUNC 1R0KA 3LA6A 5HFNA 5IM4A 3TLKA 4G0WA 3MD9A 4KXVA 5K0ZA 3I8SA 1MCZA 2C96A 3CFYA 3R7NA 2I67A 1YRWA 3PE3A 5AI8A 1NKSA 3CLHA 1D2AA 5FOXA 3ZXYA 4UNRA 3DZGA 4Y2TA 4BTEA 1I1NA 1HLFA 2JGLA 1HDEA 3DW1X 5IAKA 4ZHSA 4D45A 2JGKA 3DPIA 5F23A 4DV7B 1PQYA 1FFWA 2QXTA 3GJTA 2ZUUA 3F71A 3PJEA 4NEGA 4Q3OA 4BO6A 1W1WA 2H4XA 4A8JA 4LV6A 1VFNA 1WUIS 2FP4A 1WUTA 2AOTB 1L7DA 2ID8A 4YRTA 4OB7A 3WAGA 4LYHA 4WW0A 1JR2A 1PR2A 3UJBA 4BVKA 1EWRA 4BZWA 3KSBC 1V8ZA 4PPNA 1T6XA 4KDEA 4E2XA 3LYLA 3Q8LA 3C3BA 3IHWA 3LQFA 2Z1MA 1R0YA 2IY9A 2W93A 1U3WA 2BBOA 4ECEA 3Q6IA 5THQA 821PA 3RS7A 3UB3A 3K5HA 1N2CB 2JGFA 3LLMA 3R5SA 2YY5A 1EHYA 2PX3A 3DR3A 1MJFA 2IVZA 4RPCA 3QVXA 2QL5A 1NI3A 1L5YA 1Z8HA 1U6KA 3TPZA 2X13A 4BNUA 3IP9A 1ZWLA 1RLIA 4I1OA 4X61A 2NVUB 5LP1A 3AF0A 1O95A 4GKAA 4FSHA 2Y3IA 2C5SA 2XB8A 3FW1A 3NIWA 1RM0A 1YRHA 2ZLBA 3B7GA 4PNZA 5KYKA 3EHEA 2CY0A 3QPDA 1DT5A 2C58A 2F43B 1B7GO 4QNMA 1S3SA 1YRQA 1H66A 2I55A 2ST1A 2XUKA 1OA0A 1FP4B 1U3VA 2QUBA 3K94A 4M49A 2AMJA 1JXMA 1Y4DE 2D2EA 4EF6A 2C57A 5AW2A 4ZCQA 4LZAA 1DOZA 1PYOA 1XALA 5HILA 4H2DA 3O8LA 5EP4A 1V4BA 1Z75A 3TTVA 3ICEA 1ID8A 1QIMA 1JHZA 2HK7A 3GJQA 2HDHA 2J8ZA 4M1KA 4RTRA 2W4QA 4MLZA 1TVEA 1IUKA 1POXA 3Q7PA 4YCAA 1P1KA 1HTWA 4FFVA 2XKAA 2QB5A 2CNBA 3W4IA 4DWJA 2NSYA 3B2QA 2OD7A 4R3UC 4BKMA 1BFKA 3H5AA 4JELA 4P5EA 3T9DA 3JPYA 1ZRNA 3EQ8A 3R7AA 4F8EA 3NWBA 5EWJB 3VR4H 1P3Y1 2QM0A 1B3BA 3Q9SA 1N57A 4B2LA 5GGXA 2FEWB 4KFUA 1E2GA 4L0QA 3RU3A 3AL2A 4X7RA 4Y1RB 3SJUA 3TRIA 4YDQA 4DV0B 1YBFA 1MG5A 1TKAA 4CIBA 4MJ3A 2Q6VA 2TSYB 2KBFA 4HS9A 1E58A 1UFKA 3I9V6 3K2EA 1KXZA 3D8TA 1XZLA 3K2QA 3LX8A 4KGXA 5HF8A 1KWGA 3U16A 2C0CA 3KK0A 1NXWA 1ZIDA 3M7IA 3PR3A 2XOKA 5TSDA 5KPJA 1KTIA 1QR6A 2OHJA 2WHPA 3GFTA 5FUWA 2GYVA 3VZDA 3GEBA 1PE0A 4M9QA 1KAQA 4DJEC 1Y3HA 4GKVA 4I5FA 1OLUA 1GHTA 4IRUB 1RWNA 3BH6A 3H4VA 3VDNB 5FOQA 2D7CA 2JZOA 1PJAA 4BMPB 4TL7A 2P1RA 1YT5A 5F21A 1LRKA 1NIPA 2JHAA 2VNKA 1HE8B 2EOAA 5AIAA 1BW9A 4B6QA 3UH0A 2F8LA 5LZ7A 3WMGA 4LHXA 3QG5A 4IVNA 1YV9A 4CF7A 5LU9A 2O2IA 3EEFA 4BDSA 3QE4A 3T52A 5AR1A 3WGOA 2P65A 4IIUA 4LY0A 3BG5A 1U0OC 4AZVA 4BFCA 4HVLA 3OCZA 4MKFA 5EKXA 2WTUA 1G7TA 1PL6A 1UPBA 4UXHA 2J9FB 4ZXPA 3U7IA 4PSKA 4CHTA 1SA0A 1IRIA 1G98A 2KJQA 3NB0A 2KX7A 3N28A 2ENUA 3IE0A 5JHHB 3HGMA 3DMDA 1HEYA 2FW6A 3LSTA 2BFFA 3MOIA 2C4NA 4OYLA 1NZDA 3DBRB 3FOCA 1DKNA 1HFWA 5H7XA 3SOZA 4O8ZA 5JXGA 1OH6A 4JLOA 5ALDA 4P4TA 4CFYA 5BN1A 4ZHQA 1N6KA 4TGLA 4O4HA 3RUDA 3L6RA 2ZQ5A 5D2CA 1QV9A 3QOYA 1JFLA 4A1FA 4BZPA 3FKJA 7MDHA 2Z9DA 3TO5A 3CF6R 1KO7A 4M0MA 4D3ZA 5B7NA 4FFBA 4KNYA 2HF2A 2M6SA 3E03A 1NP3A 3GPBA 4TN1A 2WDZA 4PM4A 5LLSA 4DNXA 3KEOA 3BMCA 1QF6A 4IIJB 4M1OA 5AI4A 2HCTA 4F84A 4XQ9A 1CVIA 1OXTA 3JAKA 3L6OO 4JEIA 1U9CA 4L27A 1A8HA 1G21A 1SAYA 3FMVA 3BJZA 3L0OA 4YXWA 1UBUS 5K99A 3LH5A 3STUA 3BIOA 1E32A 4U2EA 1R8SA 1DKPA 5JO9A 3BC1A 2VDNB 2ZSHA 3N05A 4Q1BA 3AVPA 1FU7A 4MZXA 4UBIA 5DV9A 1SUFA 1RXWA 2BLNA 3RARA 3VR3A 5IBCA 2NGRA 1F06A 1G16A 1SKUA 1W5BA 3R1IA 3EGXB 3C3JA 4HQOA 1P7VA 3B5IA 2NMVA 2FSFA 3CONA 3PWKA 5HBRA 4P4NA 5JS8A 1T2FA 1H05A 2VDVE 2OZLB 3A05A 1F4VA 2Z09A 3AERA 3GJSA 4NLLA 4M0PA 4KAXA 5KOHA 3LTNC 2AZXA 2YJNA 1WTAA 2V9PA 1EQUA 4DMRA 2F17A 3B52X 3LUPA 4BCBA 2FPKA 4UJ3A 4FYPA 2FPPB 1SELA 4WNAB 1DWUA 4URHA 3MWJA 3V1KA 3SLKA 2Z5LA 621PA 3QE2A 3K1JA 4AB1A 3IT2A 1E1KA 3AO0B 2WMYA 2XZDA 2ZS8A 3IP5A 1IMJA 3KFVA 4C3UA 5FWNA 5C1DA 2OFXA 4E5MA 3HUDA 4TL9A 2H5IA 4WN9B 3IKLA 3N2KB 4D9EA 1G38A 3FMIA 3QXCA 1ZU5A 4PG4A 4ZRMA 3PD0A 4WACA 3NUGA 2GEDA 3LZ6A 1KK2A 2VHQA 1TOAA 2E4VA 4IX9A 4AAYA 3S2ZA 1VLVA 3EMKA 5DHFA 3V9PA 1KZ6A 1I2DA 3WIVA 4CG2A 5FA8A 4RLSA 3WRXC 5DBOA 3MNFA 4ND2A 5K0GA 4RSMA 1JGTA 3JYHA 3TXYA 3NALA 3DE0X 1IN7A 4D41A 2GEUA 1SK9A 2IX9A 2G6TA 3EFHA 4BVBA 3TM5A 3HU1A 1X2BA 1QWSA 3K31A 4PVDA 2J0VA 1KOJA 2W2XA 5E0KB 5M04A 2O1WA 4GWGA 1R4MA 2N46A 4MIOA 4R1PA 1SXJC 2O54A 3NWOA 1VHQA 4MTCA 2UZIR 1NBIA 2XNHA 3BMOA 3OKCA 3A4YA 3ZJ5A 4AK9A 3E05A 4HZUB 1DDIA 3S81A 4TL8A 5DW0A 4EEZA 4EVSA 1Z06A 4J91A 3CMCO 5H82A 4ARUA 3WK4A 3AHEA 3R24A 1VJCA 1PT8A 4RC9A 5SZHB 3Q5EA 4Y67A 3BGSA 1DXQA 1XZDA 5KWSA 1VSVA 2PM8A 1M34A 2CNLA 3GGCA 5HZGA 1CQJB 2QRLA 2EYUA 3TDKA 1VTKA 1N3YA 3HB7A 3O9ZA 1OFUA 1U2DC 3FF1A 1KPIA 3FDFA 3AR8A 4CL2A 3DZKA 1J33A 2B4TO 5JYBA 3ICQB 2EXXA 3AUJB 1K0UA 3SOPA 3O26A 5DM60 3QJYA 1DIOB 1L6RA 3NAZA 1RC8A 4DCNA 1RLMA 1SU7A 4NAUA 1Z6AA 3P2MA 2I1LA 5D3QA 3EIWA 1GKLA 2WF6A 3DHVA 3LOPA 1Z33A 3QLVA 4YWHA 3JYQA 1T8TA 3PQ2A 2GNPA 1E99A 3T7AA 2FDCA 5AVVA 1U8YA 5K5EA 4PBTA 3EG9B 3WK8A 2YXLA 4KPEC 2BUAA 1WG8A 2P1DA 2GGSA 2YOHA 1HFEL 3G0HA 1GAXA 1QPZA 4C7OB 4GP7A 1XQ1A 3AFHA 3L41A 5HZHA 1PFGA 3MTBA 3GIDA 2FH5B 1BCRA 1Z5PA 4CIVA 3DTVA 3P4XA 1YVEI 3PRKE 5TEWA 1PRYA 5KJFA 1PX0A 4H3SA 4MGHA 4Z54A 4BHTA 3DB1A 1Z7BA 4ENVA 1T34A 3WLPA 3GYBA 5TMEA 3NM4A 4C43A 4DGSA 2P27A 2VI5A 4BLWA 4XWKA 3F96A 2XB2A 5HA5A 5JD6A 4FTWA 2V9ZA 1UKYA 4IKPA 4WFIA 1SVMA 2WSBA 2JAHA 3LRXA 4F4CA 2QYOA 1H5NA 1KYTA 1Z68A 5CDFE 3E84A 2D2XA 3INGA 2MINA 3DE1X 4M0KA 4RY8A 1FLNA 1D6NA 1E8DA 1M2VA 1VXOA 2YWEA 4IJ5A 4UMEA 4DV5B 1OVGA 4EJSA 1RCTE 4BXOB 2R6R1 3E4CA 3PQ8A 1Y1TA 2WKQA 3ZDRA 1V3TA 4EW6A 3VJKA 4PG6A 4L8LA 3AUFA 1JAYA 3C1OA 4KAFA 4ZT3A 3S4YA 4EF4A 2QS9A 4PYIA 4EAQA 4TYYA 1QH1A 1RYZA 3NXSA 4A23A 4BNDA 3ORQA 1T8SA 3ZQ6A 1YVPA 3CEPB 3NTVA 2PVPA 2J0EA 3DHNA 1BHJA 2VT2A 3CEJA 1U7TA 1ML3A 2G77B 2JLQA 3VX3A 2DFDA 3SR0A 3UQYS 3CCCA 3UMYA 3LCUA 4JLMA 4X6UA 3GJ6A 1OBHA 5T67A 2GN0A 2G04A 2B4AA 4NMWA 3ZHCA 3NNNA 4XSGA 4TUYF 2AQ8A 3DQQA 3KWFA 2VRCA 2DAPA 4RO0A 4NCAA 2G80A 5AXBA 1MABB 1XYVA 3RWOA 1PKXA 1SZPA 2FUEA 2HOQA 5CGZA 3QVOA 1IEXA 3H75A 2B5OA 1ZA2A 2IPAB 3IOBA 4LHEA 4M46A 4F86A 1OIVA 1H2RS 2YIJA 3I8XA 4KQFA 1ZU4A 1OBOA 2HHJA 2FHSA 3QWBA 2PUJA 3GEEA 2CE7A 3QXSA 2WU1A 4OO3A 5JCXA 2IS2A 1FFDA 2CN1A 4X92A 3UCFA 1ORIA 2Z6UA 4MVCA 4XM2A 4DDMA 2DWCA 8LDHA 2BFEB 2NZ8A 4LWQA 2LTAA 1AQJA 4I4TF 4TTAA 1K3FA 5GZ1A 2ZRPA 3A04A 3IPYA 3ICCA 5FL7A 4E5KA 7REQB 2GN8A 4D0NA 4NMLA 3NP7A 3A9SA 4K2AA 3AY0A 1JAXA 1TKRA 4C3ZA 1K8XB 4G24A 1SVUA 1XZIA 1JE1A 1K2VN 1QTQA 2OK7A 1KMHB 3VUFA 4HAVA 4RKRA 1Z2PX 5DHAA 4XASA 3ZE8A 3CX8A 4B84A 2JFWA 1DWOA 2W8ZA 1A50B 4UVIA 5GP1A 1MB4A 4AUMA 4CETA 2ZUEA 4M6WB 6Q21A 2YOGA 3QPUA 5ABPA 3A32A 2G5CA 2LV8A 3DT8A 3I0NA 4X54A 4RGYA 4WXMA 5DRYA 3P94A 5AD1A 2O8BB 1FNCA 1SUIA 2AK3A 4N3CA 1SRRA 4JHXA 3X1WA 4BLOA 1TF7A 2O48X 4HZGA 1H0SA 1N2XA 1YTLA 2WJWA 4P31A 3N2LA 1BAPA 1L8XA 2IKSA 2QRNA 3C5HA 5KWVA 4TKUA 3P9CA 4E4RA 1OGIA 4HDSA 2UXCB 3K20A 4QNNA 4F12A 2Z57A 4Z4FA 2HW8A 1JBKA 3IOMA 4D8TA 1CUUA 2EDAA 4OTZA 1JHVA 2AJCA 1IJKA 1K5GA 2AS0A 4IZHA 4P7GA 2A78A 1BYIA 4YASA 4MVJA 3B5EA 3H65A 2MCFA 1Y3BE 3C45A 4LJ5A 3SXPA 4AKGA 2XAAA 5EWLA 1AKVA 3AUKA 5K8JB 3GJYA 1HBJA 1UAYA 3K0HA 3JYNA 1E3WB 2RHWA 1ZJYA 3P9YA 4GZLA 2AXQA 3REQB 4ND6A 2J48A 3TG8A 4QC2A 1QP4A 1WS6A 3EC7A 5LVAA 3G5TA 2OE2A 2VKTA 2ZBGA 2VHTA 1NDHA 2CBXA 3PF9A 3ESZA 4JROA 4GI1A 3IO3A 4JOBA 4Z4EA 3HJHA 3KKOA 4P92A 2Z2KA 3MD0A 3VR6H 1V3QE 2WNSA 3NHPA 4J3FA 4EQ6A 2PSDA 3BSFA 1V1MB 3MQ4A 1ZJ6A 2HLNA 1YMVA 3NR2A 1T8UA 4PC1A 1RIFA 1XYYA 1WHSA 2WA1A 4Y2UA 1UMDA 4Q1FA 1GLNA 4CKEB 2JDID 3E22B 3BQNB 3MVEA 2A14A 2X19A 3GHYA 4Y2JA 2ZJYA 5AQEA 5JD5A 5FJIA 1SCIA 3B5JA 1GRCA 1MPXA 3KKEA 2A84A 3PPWA 4QGGA 2WTNA 4AF7A 3U19A 2A5YB 3B48A 4GOLD 4GZMA 4W1QA 5H5JA 4DNFA 4LF5B 1E1NA 1G7RA 1LSSA 1W34A 4LDNA 5GOZA 5HUHA 5JATA 3EVFA 5C9ZA 3UGTA 5JVDA 3LM8A 5IM4F 4BV9A 4E51A 3UWDA 2IPNA 2X41A 3URKA 3IBTA 3TTXA 4AROA 1H8EA 3OA0A 4ZC8A 1WSWA 4G9BA 4H0CA 5LZ5A 3ZWAA 4DQUA 1IG0A 1Q83A 3AY6A 4HFRA 1FSSA 1IBCA 3CW2A 3MJEA 3HKDB 1KPHA 5DGIA 4DB4A 3S0JA 3HFSA 1M2WA 3E2MA 5JZVA 1FDIA 1WO8A 1N8SA 2LE0A 1Y7TA 4ZQHA 3W6PA 2A67A 3S2IA 1I5RA 2XXJA 3ZHUA 4B6SA 5AKJA 2VHVA 4IIVA 5K3AA 2XVMA 2AEJA 4FQ7A 4RM2A 4UUAA 4GI3A 5JXWA 4JJGA 1GQFA 4N39A 4IOLA 1I9CA 2J3KA 3AM5A 5PGMA 2B7LA 4AY3A 1QV6A 1MTZA 2FZEA 3DJFA 1JPJA 1XTBA 4M7OA 4OYYA 1GQQA 4B43A 5MFPA 2PLRA 1VIMA 1QRSA 3LT1A 3H4MA 4Z51A 2RH5A 1G8AA 5IKOA 2D74A 4HDOB 3GJ5A 4X65B 3OQBA 2QRJA 3MJVA 1JFFB 1SD2A 3BTUA 3O3NB 1C7IA 3BULA 3G9ZA 4WNCA 3P5BA 3BBLA 3I9KA 2O2XA 3TI9A 4DR3B 2FN3A 1DS6A 4LNUB 4AP9A 5B55A 4KGZA 8ABPA 2ZVPX 2LRHA 2IP4A 3IQXA 1ZIXA 3AFGA 1ST2A 4YEDA 2EFDB 3M6IA 2VAVA 4JBHA 4MW2A 4F3CA 2AW3A 3M83A 1Z4MA 1GZ6A 3C3AA 3CNOA 4QYXA 4ZGWA 5B1YA 5K8VA 4N7BA 1YR2A 5FWXB 5K0SA 1J6UA 1Z4OA 4MEJA 2VH2A 2VK8A 4QTUB 4WZBB 5AW9A 2C77A 3HCBA 4NHOA 3SM9A 3TXAA 4CZ2A 2CHGA 2PZGA 2C83A 4CR7A 3KZKA 1OI2A 3RS8A 2X8BA 4NYIQ 4LZJA 4MS4B 1C9NA 5HCUA 1G7SA 5HG0A 1E6KA 1XZCA 2O07A 2XNCA 3MTAA 5CR9A 5ALVA 2CV0A 3USCS 1VI5A 5MN5A 2P11A 2WNIA 3GH1A 1DAOA 1Y1KE 1U0SY 3E3LA 1WBBA 3NYRA 2Y0BA 1FVHA 2HJ9A 4A0RA 1WZ2A 1J90A 1AZTA 3AOEC 2DTXA 1Y3AA 4ALNA 3DV2A 4LXIA 3TL2A 2O52A 4N0DA 2DZDA 3P4YA 4R51A 3H99A 1QU3A 1RZVA 4BFVA 2I4RA 3HCOA 4EB6B 5DZSA 1TFRA 2VJBA 4J75A 1XELA 1JQ5A 4Q3KA 1ZVQA 4UU8A 3J81k 3R6WA 1YA8A 3HDGA 1PNVA 4XEHA 1FDWA 3PC8A 2P5TB 4Q4HA 3U7GA 4RVCA 1DBQA 1BROA 1LKZA 3S70A 5CFRA 3CUWA 3ESAA 1YRYE 1GRVA 2BTQA 3E0QA 1S1CA 2M9MA 2ZIGA 3RJ5A 1E4EB 5AP9A 1ESNA 4H7DA 4MW6A 4ZJZA 2WB2A 2QD5A 2HLPA 2XMQA 2H0AA 1TIKA 4IDOA 1V7ZA 1VG8A 4NG4A 3RS9A 2C4KA 3R6LA 3FPBA 2NADA 4PGGA 5IC6A 2BR3A 2B4YA 4PTLA 2B2CA 3T1NA 1EP3B 1DTEA 2BMJA 1PDOA 1PJTA 1RM3A 3JZDA 4BFSA 4DJDC 3O1JC 3NT4A 2F3RA 4DSOA 3IALA 2VHYA 5HIMA 3CNHA 3KAJA 2ZRAA 1C5KA 5J47A 2GVNA 4CF3A 1FSFA 2GXQA 2IEZA 3KXKA 4I4LA 1L5SA 3JR3A 4KQXA 1QK4A 3FX2A 1QBKC 3AZPA 4FGJA 3UG6A 3T7CA 3PR1A 2ZI7A 1KMMA 1EXVA 2PT6A 3QHQA 5E1OA 1E2DA 2QNBA 1QRRA 3G2NA 3WK6A 3OZIA 1XHEA 1XL0A 4PC2A 5AJZA 4ZHQF 3M1LA 4EJ2A 2BFOA 1QU2A 4O4HF 2Y4OA 4L0CA 4KYTA 4XI9A 4ZZ2A 2AHRA 2WM2A 4AN4A 3I6BA 3L18A 5C5IA 1IDN1 3G02A 1BH2A 1HE5A 2G9VA 1R0BA 1KEKA 1DUIA 1Q17A 3BCUA 1Q11A 3IUJA 3QKUA 4LJAA 4MWBA 4POOA 4BGDA 3B85A 3D5TA 4QU0A 1EDOA 1ZH0A 2XYHA 3F6BX 1VJGA 4CCYA 4J0KA 1UKVY 5FTMA 5EXTA 5EJAA 5HP4A 2WM9B 2FW7A 3MLEA 4XLZA 5E6SA 4ROTA 2N3ZA 2I99A 2PX8A 1YACA 1EFRD 3BD7A 4K87A 5I8WA 4NZYA 2O3SA 3B7PA 1C2YA 3DAHA 1BOOA 5HGXA 1ABEA 4TXMA 1L7EA 3IAFA 1FSPA 4PO1A 3L2OB 4UUOA 3WMWA 4HO1X 3DOEA 5CHYA 5GIPE 1HE2A 2C4TA 4KAAA 3LHDA 3L9XA 521PA 4DHEA 4J03A 1ECLA 3E82A 1YZHA 2OQIA 3SMVA 1E3DA 4EGAA 4NBKA 2DRIA 2G1AA 3WJ1A 4RJ2A 1UFVA 4JUFA 2Q2WA 4QELA 2FPGB 3X2SA 3S8YA 1EINA 1EAMA 2IJGX 1KIFA 1X8JA 3IBYA 2VSOA 4O4JB 5AI6A 2QU7A 1UAAA 4AWAA 2H9AA 5HZKA 3VTZA 1VL5A 1WLYA 4FE7A 1I4EB 4RJKA 5ELLA 2EG9A 4Q34A 3TLJA 4GRDA 4D9CA 4RDXA 5KWEA 1NVDA 2JNWA 5FPQA 4FXOA 3FKSD 4XE5A 1ETUA 4GW3A 2WBLC 4FEGA 4X7PA 2WVJA 2QUJA 2XVYA 3JWHA 1S5PA 2B82A 4YX9A 5A04A 1WUJS 3EIUA 1N2JA 1NUSA 2RSLA 2SCUB 3NKLA 4ALLA 3I0ZA 1E79A 1GGVA 3JRNA 4PLTA 4BNLA 3SX2A 3TQHA 2FZ4A 2XITA 1GGEA 3FYSA 3PPVA 4Q15A 4HDCA 4ZV7A 1FDVA 2Q49A 2BMAA 5H1YA 3SJBA 1T5BA 2I7XA 3HB1A 3JCZA 1T1RA 1ZKMA 3IPLA 2QP9X 3QFCA 4ZDIA 3A10A 2DBVO 3ONNA 3QKWA 5ES4B 4WT7A 4KC0A 1RBMA 4CNQA 2WG0A 1E1MA 1HSOA 2G4LA 2GWHA 3JQBC 5JY6A 3K9CA 1JDZA 3L1KA 3PUYA 3NWPA 3PYXA 5B1DA 4ZOCA 3GAAA 3CVJA 3H0EA 5TS3A 2P2ZA 3D7RA 2P2DA 2VT7A 1L7NA 2B25A 2QG9A 2QN6A 3DFZA 1SCAA 3G59A 3NC4A 2OYRA 3WHLA 1NULA 7MHTA 4X97A 2FZVA 1RYEA 5FUVA 2DQSA 1G2IA 2MYNA 4O2BB 4ZU1X 2IWRA 1YA6A 1P9WA 2IXTA 1CY4A 3GRFA 3KOOA 3WMEA 4CLRA 2CSXA 1BXGA 1I4OA 1U7PA 3V7FA 3LO8A 4D9BA 1ZR4A 1X2EA 1R18A 2X0KA 3TLZA 3CCFA 1V26A 1HPLA 2I2WA 4QJ5A 1JG2A 3SQMA 1GTL1 3RQSA 4DE5A 1LI4A 1OPXA 3WQSB 1VYUA 3FLBA 1G5QA 4CM9D 1J22A 3HXMA 2GAFA 2IPOA 1D7AA 5JANA 4J0HA 5KKCA 2HIMA 1P19A 3PE4A 2PD3A 1DTSA 2DE0X 1LS6A 2O5EA 1L8AA 2Q0QA 1NT4A 3ZJYA 1QIFA 1Z0FA 4RVGA 2FN8A 1N2CE 1ODSA 2ZBEA 4S0ZA 1IM8A 2HIAA 4XVHA 4C2UA 4B71A 1D2RA 1N9GA 1SZCA 2J6BA 3LVRE 1P8JA 1UJ2A 4NCBA 2RKWA 2X6TA 4F5DA 1R6XA 1OWNA 2YIVX 3FUCA 4M9XA 3R0IA 4EMUA 3T4UA 1MH9A 2CXSA 2O05A 3JYOA 1C7EA 1AS0A 1VPVA 4OU5A 3KAKA 3MUEA 1N8TA 2A5LA 2WYWA 3AF4A 2POQX 5A5FA 4FFLA 3RC1A 1Y6JA 2RFLA 3U2QA 1CUHA 2C4UA 2II6A 4G3XA 4ARSA 4CV3A 2ZE8A 4MUMA 4QGSA 4CIYA 1L4KA 5IYZA 1QVAA 2H2WA 5C4MA 2ECOA 2D7JA 5DNVA 3SSAA 2H48A 1EVEA 1M72A 2QL7A 2VUUA 2VJKA 3EUWA 3L5KA 1W36D 4F5ZA 5CITA 1E6WA 2VCHA 2PH3A 4QJBA 1NVGA 2QF7A 5C53B 1UODA 4HLUA 3TVTA 5AW7A 3FLAA 5ALYA 4MVJI 4DLAA 3GAZA 4IGAA 3ZXUB 1VKOA 3PIIA 3KOXA 4AIRA 2JPDA 3T4EA 4EDFA 4PZPA 4I3HA 3ZWWA 4UQLA 4G41A 4FHZA 5JISA 3L4KA 5BSGA 1WMAA 4KRXA 1Z0IA 2GN4A 2XYVA 4GNKA 5HM8A 5MFZA 4JA0A 3RAGA 3LP8A 9GPBA 2BFAA 4WXEA 1Z63A 1VPWA 1OSNA 2NZXA 4H31A 2EQAA 4X63A 1U11A 1FQWA 1L3IA 1NXPA 5B1IA 2WZBA 1IN4A 3NH9A 1DRVA 3ADPA 4GWKA 2HNAA 3K8OE 3HVIA 3ZH2A 2OL4A 2VNAA 1SHZA 1F2UA 2GKSA 4YR7A 3HUUA 5JC8A 1NRWA 3V7WA 2TMKA 1TTTA 2KB0A 2P30A 2A9KA 1OJ7A 4LJ4A 4MWTA 2IU6A 3O2QB 5E2BA 1HG1A 3T3HA 1A0OA 4ZYZA 3NBMA 4QQFA 1U8CB 1XDGA 5JYDA 3OCUA 2Y1FA 1CV2A 1WXDA 2ON6A 3M6AA 2Z6QA 3AF6A 4MITA 1KJIA 2ZAMA 4G0UA 2EP5A 4CKYA 1ZMTA 2EGHA 2VTEA 3QNUA 1JFTA 3RG2A 3U4GA 4I1YA 1H9AA 1MAHA 1ZYUA 4Q9AA 2OZVA 4TLLB 3TN7A 3HPQA 1WCWA 1X77A 2R7NA 3MCZA 1XJ0A 4E5UA 2XMRA 4QRIA 1UDRA 2Y92A 3NHBA 1K98A 4Q4DA 4O25A 5K8LA 2NU7A 1D0SA 4FILA 3BORA 4NHEA 3LX5A 3ROMA 1IXZA 4H7EA 3ABOB 1ZAKA 2YXEA 2OXRA 3ZBUA 4MWSA 3TQRA 4K46A 4BMOB 3IE1A 1YK1A 3WJ2A 3HSKA 3QEBZ 4J9VA 5CVEA 4CKBA 1DHRA 2BKXA 2BGKA 2W2PA 2JHPA 1EVLA 1X80B 5LQKA 1W35A 1PJQA 2OBMA 3KJGA 2QVBA 3T1VA 1WCIB 3EIQA 4RPHA 1TC1A 1KS9A 4LSMA 1U2EA 2B9VA 2Y1CA 3REFA 1PD0A 1W4BA 4F72A 2AWOA 5TQ0B 2FMXA 2CK3A 4CLOA 3KQNA 3QVWA 3FVVA 4EG0A 1RU3A 3RIMA 4N12A 4GMXA 5C7YA 2I8LA 2AUMA 4W7SA 5LA6B 3V6LA 3AETB 3LUAA 5EZYB 1JHYA 1NQUA 3U48A 1YI8A 1OU0A 2XB6A 4D0RA 1TCCA 3FSJX 3I09A 1LLDA 1NV9A 5C81A 1EEXB 3F0TA 5AQ1A 4C6HA 2ZB2A 2GOYA 4BX9A 1APBA 3DWGA 3M0EA 3I1JA 2VATA 4R2KA 3WL6A 2OV4A 3A37A 1OX4B 2BGJA 2EFGA 4MQ4A 3ES9A 2CV2A 5HCNA 4URUR 3TW8A 1GN8A 3L0YA 2ZPAA 2FJPA 3EXIA 2AYXA 4FOPA 5FR2A 3TIVA 5JCJD 2PCJA 2QE7A 4MAFA 4MQLA 5I9IA 2YFQA 3H9UA 3DHWC 1VBKA 5C1PA 2BFBA 3ZDXB 2EW1A 1SHJA 4A6PA 4W1SA 5TF0A 3BRCA 3C3DA 2WP8J 3R3UA 2CLIB 3AH8A 2IXBA 3HXKA 5I7SA 3WWZA 3KKQA 3V2UA 3C97A 1PAUA 1P80A 3AB3A 1WKVA 2BGMA 2PHZA 3TEMA 4Q12A 2PGAA 2VG8A 1MDBA 3OKPA 1R0SA 4N5MA 1NW6A 2BCGY 5EXXA 2JLVA 1QCDA 1T0HB 3KKZA 4IJQA 1XD2B 5BR1A 4QBTA 5KNCA 1HE1C 4MVJF 1YASA 1NYLA 5CFLA 3EPRA 4PSVA 3L0PA 3Q7TA 3AEKA 3IELA 1Q1EA 1IULA 4IWYA 1TTQB 4OH1A 3RVLA 4PC7A 2Y71A 1ILWA 1ZRHA 1C3JA 1DKRA 2D54A 2C3PA 2G25A 2NTNA 1OFIA 3DF7A 4FMDB 3RV3A 3N2ZB 4HAIA 2Q1WA 2V5VA 2V58A 1JNXX 1U8UA 3CPHA 2CHEA 2ZXFA 4V0NA 3WISA 2VHCA 1QG2A 3KV3O 2QTMA 3RFCA 1CP3A 2HCBA 3O4GA 4AS1A 1J4AA 5ALPA 4RA6A 1S4QA 3P2KA 1IPEA 3SC3A 2RHOA 4FEEA 4S1NA 1IBMB 2E9SA 4G56A 4LGMA 1AGNA 3IQFA 2Q5IA 4J29A 2I3ZA 2NYAA 2JK0A 4YV7A 1O5OA 1YUBA 2ZDGA 3AUSA 4YAEA 2ZULA 3CF2A 3TCNA 4GD3Q 1N2OA 1CIPA 4K9DA 1XRQA 4EBFA 4PQEA 2RGEA 1AK9A 1L7RA 2PSSA 1Z8NA 5IAEA 3CJQA 1WETA 2YYSA 2RBGA 5JVDF 5IP5A 1B76A 1TUIA 4C0LA 3FUVA 4H16A 3C8UA 2JFQA 1YBHA 2WQ6A 1ZD1A 1ZD3A 3OWXA 5F4ZA 1TZ2A 3VDRA 2OR3A 1F48A 4AMVA 1FUEA 1VI2A 2RGCA 2O19A 4Z9YA 4D96A 2ZPUA 3GOQA 2X5OA 3OE7D 4E5VA 1OBCA 1HDGO 4QATA 2J85A 2HQOA 3VNSA 1R10A 3ZG6A 4ODIA 4YMSA 5L3QB 3DEYX 2B2XA 2VPXA 1AKEA 1ZH2A 1JHQA 4KQ9A 2HL6A 4WLFA 2JLXA 4M86A 3JARB 4JY7A 1BD4A 5KHOC 1EBUA 3WLTA 2FN9A 1WW8A 3RUHA 5ADWA 1PZFA 2HSGA 1J23A 1V7CA 2ODNA 3L3BA 3MA0A 1MAUA 4NCNA 2Z9CA 1J8MF 2I7VA 3JAWB 4DT1A 5BRJA 5HKLA 1GP2A 2GWRA 2Q4DA 3CTPA 3JQQA 5HIAA 3PBKA 1I4LD 4L78A 4AS2A 4MAAA 4I5EA 3KQQA 2G9NA 4E4YA 3I6IA 3SPXA 5I8PA 1DC3A 2REQB 1V3VA 4J90A 1R0CA 3AHDA 3TWOA 4EJSC 1AZSC 4KTVE 3JQFA 2VHZA 3PNPA 4QFBA 1FXWA 1BS2A 3GLIA 4DMMA 4KR3A 4WA8A 4BNFA 1JDNA 2FZWA 2KLHA 5KU1A 2EW8A 2YC4C 3D9QX 4EO7A 1Z6QA 1KNQA 3CXRA 4DZZA 4ZODA 3FPEA 2P9CA 1S8FA 3NEAA 1KSHA 4P32A 3H5VA 2M32A 2WSMA 3W06A 3I3OA 4M7WA 2C3YA 1KFBB 4KWCA 1MIOA 4FDLA 4MR8B 2YZ2A 4YGYA 3RIXA 2WIBA 3QU7A 4YUWA 4UJ5A 1WKBA 1CUZA 3B9RA 2OFPA 3N8KA 5IU6A 1A7KA 3DMYA 3PXCX 1WB5A 1TU0A 4CMCA 3PUKA 3H9QA 2AXPA 2Q50A 2VNHA 1QH0A 4JP5A 2WM8A 4TLAA 3EGWA 5DRTA 2DXIA 2GCEA 4XGIA 4Y1GA 4JJ4A 4L73A 5KYWA 1NQXA 3C6MA 2A7XA 2QX4A 4B4VA 2R5FA 1VSQA 4C7VA 4UBMA 3BJIC 4RESA 3UGQA 4KH0A 2P9QA 4CDRA 4D56A 2V97A 3K9HA 2AN1A 2CKMA 3EA4A 3R0VA 4R6XA 4XQCA 4YNBA 4CWAA 4ER0A 4V02A 3HRKA 1XD8A 2GBFA 1Y8AA 2Q4TA 1K3UB 3BWVA 1XR3A 4NYIR 4X00A 3TKAA 3R4CA 1M8FA 3IO5A 1TAQA 1H2BA 4Q4AA 4TS3A 3PGVA 1P39A 1RMYA 1ODCA 1WXFA 1AKRA 3ZW9A 2I1QA 4D7AA 5A4AA 2J9XB 2WWFA 1GXSA 4GM1A 4X71A 1WPGA 3K1AA 1TUEA 1LDBA 1U0TA 2CXHA 2H2AA 1FZTA 4LYJA 5BRAA 4B3RB 2W2MA 3HYLA 2BN4A 3OFSA 1KKMA 4ARAA 1U4OA 1WMBA 1YQQA 2ZB8A 1S1MA 3K6SB 2H08A 4G8DA 4U7TB 2R2GA 2AIRA 3C1TA 4LJLA 3ULKA 4A2QA 5IABA 1J0CA 3NTUA 3W2TA 3C48A 1VKNA 2WKPA 4KX5A 3V2IA 4FW9A 5CIYA 1CY1A 2G6BA 2VUSA 3B9PA 2IBSA 4EG5A 1Z3IX 2EGGA 4FKMA 5IAOA 3WLIA 3NHLA 1F51E 1ZMXA 4D8VA 3DMTA 4IQ8A 1RHJA 2DX7A 4J3JA 4LC1A 4WKPA 5AVWA 1RHUA 4H6WA 3DBHB 1JKIA 1EVIA 1FPMA 2NXJA 1BX3A 5DTMA 2BGGA 4L4YA 4NATA 2X5JO 2FUG6 3A2MA 3BAZA 5FL3A 3WKCA 5IT9A 4N76A 3UAZA 4N5DA 5IVPA 1ZL2A 5EE1A 3V8VA 1D8AA 3STYA 4CQNA 1FY2A 4YLGA 4Y9RA 2JI6A 4KWHA 2H1WA 3MHPA 4Q7EA 3ROKA 5ER9A 5IJ9A 3O47A 3LGSA 4XGQA 4HX9A 4XXHA 2DFTA 1TO2E 4Q02A 5AW1A 2BTEA 2L82A 3L6DA 5GVSA 4YQFA 1GGNA 2Q2NA 3CRRA 1C0EA 2JIBA 3KBBA 3LI2A 4W5RA 2WTBA 5GWXA 3ZUGA 3KDSE 1T4CB 3NHKA 5F7XA 3JS5A 4TTVA 3O3OB 3KJEA 4I1IA 5IJZA 4UAJA 1I33A 4OOEA 4Y1FA 3S28A 2YS6A 3G5AA 4E08A 1YS2X 5FHQA 5BMOA 3W3AD 1U5BA 4Y18A 2VT6A 4JJ6A 1KJYA 1K6XA 3BGIA 5JJLA 3KRTA 3T3IA 4HDAA 2ZOSA 4YUZA 1R6UA 2HRQA 3CO5A 2A5FA 4M1WA 4P82A 4UBLA 1R9MA 3V8EA 3LDAA 3C39A 4XCXA 5LBUA 4XEUA 4EI2A 5KDOA 5F98A 2VPPA 3QVGB 4Y2GA 2FPXA 5TE9A 4X1YB 1M10A 1Y3FE 5H3LA 3SC6A 3SJCA 3KQLA 2E48A 1S3IA 2CJFA 2HIGA 2W71A 3FG9A 4MXDA 3HN6A 4NVRA 1IZ8A 4KSCA 1GZSA 2NT3A 3EQZA 4TSFD 4RWZA 1PK8A 2IOFK 2TMYA 5GM2A 3W77A 2QG4A 3T5PA 1JHDA 1WSDA 3IPXA 1J0AA 3U6BA 4KOEC 4NYJR 4ZYTA 4KX3A 1SBZA 3GCZA 4DRXB 4Q6WA 3VYWA 5JRJA 3ZNOA 1WMEA 2ZBQA 5G4KA 2R6AA 3CU5A 3KYJB 4HMOA 2ACKA 4HLNA 4IHJA 1J8FA 4U2KA 4EKEA 2JD0A 2Z0MA 3W4JA 2ACEA 5F5NA 2J41A 4F60A 4NONA 1DARA 2Q5HA 4QUIA 3VAZA 4ZTUB 2D2VA 3B70A 3ON5A 3G2JA 1BWPA 3G17A 3MTIA 4XGNA 1JTFA 1XT6A 2EARA 3SP1A 5FOSA 4C4YA 4NJMA 1M7HA 2HLDD 3CHYA 1A5SB 2VPTA 4OI1A 3WHPA 5HHTA 3VZQA 1R2QA 4AZ3B 1HQYE 1GZVA 4Q9NA 1Y3DE 1I5EA 3ZWYA 1PLJA 5IDWA 2ZRNA 1NXTA 4J1NA 4CR8A 16PKA 1U4NA 2F6RA 4ZA2A 2ZVDA 3WGJA 3B2EA 2HJWA 4M1QA 2QJTA 3TK1A 3G82C 3PKJA 4DCTA 1XP5A 5J59A 4MRAA 3KB2A 2G8LA 3S8EA 3I72A 2IRWA 1TVMA 3LKBA 4DYHA 2AC7A 4TKVA 2FEAA 2IHNA 5TMDA 1IHDA 1UBGA 1OKKD 1E8MA 1S8NA 4N03A 5F2OA 1IZZA 3SQLA 5B5SA 1XTTA 2PS9A 1A71A 5CXUA 3MB5A 3DL7A 4PRZA 5CAEB 5K0JA 3IPRA 3AEYA 4L9AA 2QTBA 1SCDA 1YMUA 3I01A 3PNSA 3O3CA 2JIMA 5IBPA 2QV0A 1QFYA 3W2FA 1NR5A 3DZBA 5B57C 4NCJA 3NHWA 5EYPA 5DX1A 2BHSA 4TSKA 3OVMA 4XVQA 5ALQA 1UBEA 2FUCA 2JA1A 2R6DA 2WWWA 1K7XB 3B1ZA 5KSWB 1YHNA 1TX4B 4ND1A 2RHGB 2X0DA 1MOSA 5E4TA 4DDVA 4KLNA 5DTEA 2CFCA 5D8DA 3PVCA 5K8CA 2B98A 1INLA 2BFCB 2LXNA 4C5AA 1G64A 1ZC4A 4F9TA 2YS7A 4RQTA 3MT0A 2HADA 4CTMA 1LA2A 2ZRBA 3ER6A 3P27A 1SK8A 3EZYA 4M0UA 1Z7EA 4OQEA 4W5WA 1VE3A 5IYZF 5IT0A 2JCYA 5JZOA 2GM3A 1I01A 2QTLA 2WILA 1GPJA 4IMIB 1RABA 1E7WA 3QVVA 3T15A 4WZBE 4D26A 1BWSA 2QA5A 4LRQA 4WAUA 5E3IA 3G9QA 3KEQA 3PGLA 3RFFA 1F60A 2QBYA 4HADA 1JTVA 2BGIA 3FTQA 3BXXA 3R44A 2IBMA 3RVSA 4IVPA 4IV5A 1VB5A 3EXEA 5C8YA 2UYOA 3DXZA 4ZKDA 1TYEB 3DEIA 2VQEB 1U1GA 3EXG2 1MZPA 3WP1B 1NV8A 3BJEA 2CNWD 4NFYA 4C4AA 1U5AA 5DHSA 4K6CA 4ZVPA 4FYWA 4Q1VA 1V1JA 3OOHA 2VHXA 3ZU4A 4H4CA 4PN3A 3DV0A 2J0QA 1WRBA 3K5PA 3PC8C 3BXEA 3UBMA 5I7RA 4HL6A 3RQIA 2HX1A 1LLQA 4EYOA 1H0HA 2XUHA 3H84A 3KYCA 3U80A 3N8GA 1SVWA 5ELXA 4YT4A 3BMQA 1QCYA 1R64A 1U2PA 1ZEJA 2Y1XA 4M54A 1UJCA 1BHO1 1Q1ZA 2FQYA 2PX4A 4G84A 4HTFB 5HKKA 2BMDA 4RQBA 1AG9A 3DYBA 5AKIA 4LJ8A 1P2BA 1NBOA 1XJQA 3OPVA 3S2GA 2I6SA 4EP1A 1N1GA 3AKDA 1UMBA 2XT9A 1MO5A 2BM9A 2MOKA 1G1AA 1H1LB 1W0JA 4L4ZA 4R8KA 3U62A 4TTIA 3NV7A 4C5CA 5AM5A 3R9WA 1T15A 2HEGA 1EIZA 2WSSD 1AO3A 3RS5A 5GTDA 2BKVA 2EZ9A 3GFRA 2C82A 4A5OA 5ICMA 3PP8A 2GBLA 3NTLA 3OPMA 3VDQA 4CEJB 3A3KA 1SCKA 3N74A 2XWBF 3IKVA 3L8HA 3INNA 4RA9A 4UDXX 2X1MA 5GVRA 2C54A 4F6LA 4QRHA 2D1TA 4JQCA 1JEDA 4C1NA 4RAQA 3WKAA 4ES6A 2EZ4A 3VYVA 1X38A 1EZ1A 2QROA 4B3HA 2XUDA 3A2LA 4X0EA 3FRHA 3K9QO 3KQYA 1XN4A 1AKMA 4C0XA 3E1GA 2QZ4A 1X3LA 3WFIA 2PRZA 3SU8A 2W00A 1VE5A 3A4NA 3ENKA 3H3XA 4V38A 3V1YA 1W88A 4FBMA 3W0LB 3T9FA 4F04A 1W30A 1VXRA 1K5PA 2UUOA 4BMSA 1M0EA 3RADC 1J9EA 2V65A 1RRGA 2JZCA 3ZC3A 2PZLA 1GDTA 2Y1WA 4EUEA 3PGKA 3QLTA 1XROA 5C8XA 1T8PA 3OY2A 1QZZA 1LEHA 2CYCA 4EEKA 2W4IA 5F1KA 1UC8A 3VVMA 3DC2A 3EK2A 4O4LA 4LE0A 2Q3JA 3G89A 1OU4A 1PFKA 3U4MA 2ZI6A 1J00A 1TA0A 3IAUA 1Y1LA 4TKZA 4W4TA 3UXHA 2GMWA 2NUBA 4XFJA 2V7QD 4WBXC 4D1YA 3BIJA 5H9VA 4E3WA 2GR9A 1NF9A 2LDBA 1KP9A 1ACLA 1T9ZA 4RS3A 3GB9A 2ZAYA 3G85A 1QHEA 4BYMA 1RJ9B 2ZT5A 1NVKA 3QW2A 2WY2D 4K6HA 3C41J 2JI7A 2CSUA 3CEAA 1SVIA 2A0KA 2XUPA 3L1IA 3OCXA 1AK2A 2KHZA 2QL6A 3PQ4A 3SG0A 5EXEA 2ID9A 1KH2A 2VQ6A 1B00A 3ZTYA 5DM0A 4DIEA 4BX2A 1WBDA 3TW4A 9LDTA 3NVAA 2IZ0A 3R6DA 5HQ3B 3A9UA 3FUTA 4L5CA 4DA6A 3EVGA 4NZOA 4OGGA 1IY8A 1X74A 2PD6A 2YHBA 1CR4A 4N41A 1FFGA 4NP6A 1XWIA 1WCYA 1D09A 5FI5A 5KJEA 3UCEA 3WBFA 1ULHA 1T2UA 3HKBB 1KK3A 1MNQA 2DFNA 2HD4A 2HN9A 4J16A 3RU9A 4K3UA 1LPPA 3P2IA 3W9UA 3ZZNA 4DA9A 2HYDA 1JI0A 2LUOA 1D3AA 3THYB 3DEKA 2GCGA 1F8UA 4JC5A 4XJTA 3AR6A 3L8FA 1YQWA 3RC3A 4PCAA 2PZEA 2XT6A 4IW3B 3AB8A 4IDEA 5LQRA 1RKUA 4FINA 1KI3A 3A9WA 3O8OA 5LNK6 2VP6A 1K7FB 4E13A 1XFDA 4ILKA 5CM2Z 5B7PA 3GAFA 5EMNA 4ALKA 3IEMA 3WGKA 4Q21A 3TMYA 3OT1B 3IT1A 3ZY4A 2DWPA 3GY0A 2QLJA 2BFNA 4ZT2A 3GH3A 4AO7A 2R60A 2ZSEA 2AV6A 3G7UA 3GUYA 5G1OA 4J6EA 4OQXA 4FR2A 1NQTA 2XGJA 2NZWA 3VM6A 1HWYA 3UGJA 2FWIA 1W5FA 2ZRHA 2Y93A 5G4LA 2DHEA 1G5TA 2L17A 1R6TA 1W85B 3RIHA 1XGKA 4HAZA 1ZUIA 2HTFA 1MXFA 4XJVA 4A2PA 1T25A 3L8ZA 4I8DA 4YMHA 1QLWA 2DSNA 3OHPA 4NDAA 3EVCA 5IASA 2GXUA 2P4SA 4V24A 4KXNA 1U0EA 2FWBA 4RKFA 2C8JA 1RHRA 4WOCA 1UT5A 5GV8A 1QGAA 1XMSA 3UMBA 1A97A 1GUFA 1O6ZA 3ILXA 2GHTA 1COWD 4MV1A 2ZDHA 4GPEA 2IZ1A 3L84A 1V96A 1Z0SA 4CQMB 4DV6B 1NURA 1U1EA 2QTGA 2Q5QA 3LIPA 3NXKA 4FC6A 4OUKX 4Z0PA 3UIEA 5EMHA 1QK3A 1CQZA 1MKYA 3IPCA 2ZXUA 2JLSA 4Q37A 3RTDA 4I9UA 1GT91 2YVQA 1YOVA 1XZAA 3DAPA 3O73A 1N2HA 1OWLA 3GNQA 3P20A 3E7XA 2JGDA 2NVBA 3HFGA 3LU1A 1EGVB 3R0XA 5COBA 1P2UA 2FSGA 4EY6A 4UVHA 1V8DA 1EP2B 1MF7A 1UF9A 2BP7B 1XFAA 3EVBA 1RKVA 1ESEA 4XDYA 1J07A 1UMCA 3BD8A 5EVJA 4ZCSA 2I9KA 3C8HA 4OP3A 3MOSA 3TZKA 3IEUA 5CVUA 1RAIA 3KLMX 4TUYB 2ZBVA 3DVLA 1E4OA 2HA4A 4IH1A 2JKZA 2ODWA 4OGLA 3ZS8A 5A3VA 1RJEA 5C1BA 2ERCA 2DY0A 3U4HA 3FTCA 2GRAA 2H7VA 3EMVA 5IKMA 2P1ZA 2FXIA 4UNPA 4ZREA 1WZIA 3SZGA 3AEUB 2ATCA 4LDPA 3GLFB 4B73A 1HNNA 1SC4A 5CVJA 1BXZA 1KZ7B 4KYVA 1NM5A 3JU3A 2WNHA 5CLFA 5JZMA 2OWEA 2R2AA 2WFLB 3P0EA 5BWBA 3H2JA 2VPIA 2X9QA 1F2TB 5JECA 5EXDA 1ABBA 3M34A 4Y0NA 1ZGZA 4IL5A 3LQ2A 2VEOA 2IYSA 1JVSA 4I4TB 1FXWF 3JWJA 5A1TA 2YRFA 4N5NA 2TRSB 1NMSA 1W0CA 1WDLA 2EV9A 1MP0A 2OZEA 2XCOA 5D1NA 2QYSA 5KAPA 3R23A 3T3EA 4AKSA 4L9RA 2V03A 2B4QA 4I50A 4TLCA 3IHLA 3CG4A 1M2FA 1M1YB 3EOBI 4BQSA 2Q3EA 5LBIA 1GZUA 2P9ZA 5IEBA 4I08A 2CDBA 3L0CA 4EGSA 2MTBA 3W5BA 1PN3A 1ZMBA 5EQFA 4GI5A 4WNYA 1KWKA 5BVGB 2A1UB 1X7WB 1VMAA 1ZVMA 2GNAA 3R5KA 4TYMA 4ASUD 4LV8B 4U00A 1RXUA 2OBFA 4KVFA 2GF0A 3ZWOA 2NZJA 4D25A 4RAOA 5KINB 5CXQA 2XW6A 2NACA 1S96A 4P35A 1Y8ZA 4ZZ0A 3IUYA 5CXXA 3GA5A 4LDZA 3C3EA 3R3XA 2RGNA 1UBCA 3WKEA 4YCCA 1MUUA 1K6JA 3HRHA 5I4KA 3VH4A 1EBFA 1Y1RA 4PYRA 4PHGA 1LK0A 721PA 1JQ3A 3Q87B 2D1QA 3TFQA 1E3LA 1GTJ1 4A0SA 1L8QA 2A3RA 3ZXXA 2ZRGA 3DVAB 3LZDA 2JD1A 3P9RA 1QM5A 2EC5A 2MIIA 3TNYA 3FVWA 2UXDB 3PFIA 2C94A 2QMEA 1Q7RA 2AC4A 3INYA 1NWHA 1X1QA 3NEJA 3E9RA 1GPKA 2Y2UA 3LXMA 4WLOA 3RBAA 1TKCA 1VB3A 5MGNA 2O8CA 1YZTA 5AKXA 4BY9E 2AMFA 4U63A 3BICA 3CVOA 1ODLA 4YUXA 4BNZA 2CEAA 1IWBB 2M2IA 1RJFA 2NSLA 3NNDA 4PLVA 4ESOA 3GO4A 4ML3A 2BMWA 3M9XA 3VR1A 4ZAGA 3UT0A 3VKFA 3WS7A 2VSYA 4Q16A 1E18A 2BGTA 4LQ4A 1QCZA 3V1TC 2VPZA 4YT2A 4J0JA 3HZHA 4P8RA 1Z4IA 1U99A 5LKRA 4S05A 3JQ6A 3CW8X 1CP2A 2P3SA 4IILA 4TXNA 4UKDA 4OREX 4B75A 1HX7A 2PNJA 1C1DA 3C6ZA 3SLRA 4ER7A 3E58A 4QE3A 1Z5OA 2ZZNA 2FUNB 2AG1A 2C1EA 5KTSA 5CNIA 2FMKA 3UGKA 4CI9A 1Q0ZA 2HDOA 1NSFA 2O0JA 2QRGA 2YC2C 4LVNA 2ZRQA 2RB5A 3EVAA 1ODIA 1NC1A 1LBSA 2BKUA 1HDIA 2GPWA 3WZ2A 4BRZA 1UBLS 1YB2A 1SVOA 1XQ9A 1GQ2A 2IV7A 5AIBA 1Y9DA 4LOKA 1Z8FA 9ABPA 2YJ5A 3HXLA 3R0QA 5EE0A 4HEJA 1Z6XA 4QIHA 4JT9A 1GM5A 1EXDA 2VDLB 4A8JB 3TRJA 2FFBA 2OTCA 2XMBA 3TNJA 1T0IA 2QZ9A 2FP4B 3K0EA 4F1JA 1QOPB 3C8DA 4RD2A 1LPSA 1TJYA 2A9JA 2CXNA 3WQBA 3RUIA 3TLGB 3FMPB 7AT1A 3PV0A 2EFCB 4MW5A 3WIEA 2C5BA 1ZH4A 2QMZA 1NHGA 4M8IA 1TYCA 3OSZA 1IPFA 1ZONA 2FY8A 3BN3A 2VYND 5B2FA 5ICEA 2R751 1QHFA 1ZJJA 1B74A 1ZM2A 2XQIA 3P9IA 4B35A 4AUNA 4WLUA 3COPA 5IJAA 4RTMA 2R4UA 1T4BA 2FMUA 1E2EA 2VSFA 3U9TA 3E9YA 1C0IA 3TQIA 1KI8A 4NTZA 4RABA 3ZCUA 4B3IA 4F21A 3NVKI 4XW2A 2XEXA 2Q1XA 3NLLA 4S1WA 2CF5A 3PD1A 2ETVA 4X3CA 4FLMA 1IM5A 2YH2A 4EA7A 2GILA 5FTWA 1P1FA 1SU6A 2GUGA 1HNXB 3X1MA 1QQAA 4K88A 4L6CA 4YRLA 3U7EB 1E1DA 4M1ZA 1MTOA 4NZNA 2VNSA 2WF5A 4RS4A 4F4FA 1YDGA 1REQA 4CUKA 1DCKA 1G4UR 1C41A 2IYNA 4IHJF 5ENDA 3RU2A 2ABWA 2JANA 3DSRA 2HEIA 3HYNA 4PZAA 3GPDG 4QQRA 3L77A 2HZ7A 1DC8A 5CB6A 1UJ4A 1Z18A 4GT1A 2RHJA 3B1VA 3O2JA 4C76A 2O8VA 4LX0A 3GRPA 1JHAA 3ANXA 3W2IA 2D8AA 5H3HA 1WUHS 3TCXB 2R4QA 2I66A 1XMOB 1Z47A 1YBMA 4RV4A 3R7LA 3MIIA 5D84A 1ZOIA 4NE9A 1XD9A 2GEKA 2X15A 5F33A 4D0LB 5HVNA 4MMXB 1XKQA 5JD3A 5IZCA 4EJ0A 1UMKA 1Z34A 1EKXA 1ZX1A 2B6NA 2QQ0A 5L6MB 2CVQA 5MDHA 4NKRA 3RB8A 5LBTA 4KXLA 3T3DA 4BNIA 2ZI5A 4IMJB 3C3PA 1UPTA 4YDHB 4GE3A 5FOWA 3B8EA 5CNKA 5FYDA 4WX2B 1YZ3A 1E5TA 1CY6A 1F14A 4NQZA 4LWPA 2WHPB 3QUQA 4ETNA 2RGRA 4FQ5A 1KZYC 5KTNA 3R5FA 1M2KA 4R8SA 3MYYA 3N3AC 4MQMA 4B80A 1OLUB 3IAS1 1EFAA 1HSZA 1PSWA 3ENZA 3L43A 5KTKA 1SB8A 4KN5A 1F38A 4EY4A 4XWOA 4G5FA 4FDVA 2I62A 1BW9B 1QKJA 5A03A 4QZVA 3Q7IA 1MA0A 2FKAA 2K6GA 1MX9A 2QTHA 4KQ2A 4UUMA 5CJPA 4YIKA 1KQFA 3ZD7A 4YV1A 3RANA 4JKOA 3T8YA 4LTDA 1R88A 4U0KA 3ZWCA 4DB2A 4UEOA 3G8BA 3CS3A 1JXQA 1UCFA 4Q39A 1P1RA 5D6OA 4RK4A 4ZT7A 4URVR 5CMLA 5B3KA 3E1KA 1JH9A 3UHOA 5H02A 5D3KA 1GDDA 1HEIA 2IKQA 4YUYA 2YYYA 2BFFB 5HIKA 1P5ZB 4JP2A 1R9JA 3ZH9B 2J5XA 1G0OA 3M89A 4K5QA 1Z88A 4JI6B 3W8EA 4HWKA 3VI3B 2YV3A 4ZHQB 1GRRA 3I8OA 1PV4A 4WEOA 2XVZA 4O4HB 3IQWA 3X43A 4BX8A 1DQSA 3FPKA 3O8QA 3ZHQA 3C7AA 4QFCA 1SUWA 3AHFA 3FPGA 1YGYA 3NPMA 1CJKC 1U7HA 1P9NA 1B2RA 2WHQA 3KLBA 4FFBB 2AQHA 2YV2A 4FX5A 5C8YF 3HVJA 1M0WA 3OM1A 3RASA 6NULA 1EVKA 3BMCB 4QYTA 1KORA 5KOJA 3AUYA 1QDEA 2NPIA 1V5FA 2OLKA 3BYZA 3JAKB 3JRWA 4KXUA 4MICA 3KAQA 5HFJA 1G291 1G21B 3GOHA 4BKPA 2OB2A 3G23A 5CLQA 3SZMA 1JHOA 1TCUA 4I3FA 1DC7A 3FN4A 2PJZA 1I94B 1NI4A 1LRJA 4ER5A 4RDCA 5KC8A 3KPVA 4URWR 2X8AA 2OGUA 1XVTA 3LUHA 3MBOA 4LGVA 4TVBA 1SURA 3DD5A 3M33A 4LY6A 3SMQA 3UAWA 5CB0A 2KYRA 2OAEA 4BRSA 1B8UA 5J9FA 5CD9A 3E7DA 5LQUA 1EFCA 1T9DA 2EBUA 2W9XA 3AERB 5DH9A 2IIPA 4RF3A 1DBWA 1X1SA 1YXMA 2QN3A 1V4NA 2ZB7A 4AURA 4MEAA 4B32A 1SN7A 3QQPA 2P2LA 1J9ZA 4Y6RA 5HQJA 3VX4A 4ZIRA 3KETA 1KJWA 3NQ41 3LZCA 3OQMA 2X0EA 4E94A 2OOSA 1FP6A 2HU5A 3M6LA 5A06A 5AOVA 1CWUA 1SUBA 4X84A 4Y2PA 1XB2A 3M4JA 4G07A 4ERNA 1NUHA 4XIGS 2HSWA 1F3LA 3L9WA 4IKOA 1NW4A 2HBRA 2J3IA 1UXIA 1QZ3A 2RGWA 2O0KA 3DMTC 5F2EA 3WLOA 4RXUA 4MH0R 2ZSBA 1EYZA 2WFMA 3I04A 5BQOA 5KTOA 3H6HA 3I9OA 1IHXA 4OYHA 4FYJA 4Y7CA 2VTVA 4XUEA 3ZLJA 3S29A 3E1SA 1ULSA 3QU5A 4R1SA 1GTG1 2BZGA 2CMFA 1IG3A 5KJ6A 4G0XA 3NDPA 4RPKA 4W7IA 4KUGA 4E12A 4P38A 4FSXA 1AX9A 3AP3A 3ZWBA 1J8YF 5SZKB 4CM1A 4KRYA 5EIBD 4Z2AA 3OY7A 3PTAA 1S2IA 4YQYA 2I8CA 4EG3A 2D6FA 4HDKA 4TLEA 5EUMA 5BSMA 4FQ8A 4MI6A 2ID4A 5SICE 3MJ4A 2Z6VA 5DI3A 4CEHA 2X2FA 4S24A 3F7MA 1WABA 2RK4A 2ZUDA 4FOTA 4IAOA 2WU8A 3MWLA 4HB2A 4YJ2A 1TD9A 2C5EA 5DX0A 4GYKA 1QYVA 3KB6A 1T2EA 4O4LF 3LVQE 5AOBA 3O6VA 1R4MB 4GKBA 1S89A 4KO3S 1L7OA 2LCFA 2WK1A 2DT8A 3BMOB 3X3HA 4AJHA 3THXA 1VP9A 1Q3HA 4WCVA 3SR3A 3NJ4A 4Q47A 1Y7IA 1KEVA 3HU2A 1J1UA 2RD2A 1E8NA 4ZV9A 2QRZA 2HA2A 1T0UA 3OZDA 3KPWA 1OY1A 1K1EA 1BQEA 3N2GA 3DDNA 1RWOA 1Z2AA 3O90A 1SXJE 2BKLA 4WINA 5J4YA 4WZAA 1G2OA 5AW8A 3DBIA 3L0IB 3UB4A 3UWKA 4WKCA 4H1WA 2KS6A 5ADHA 1M34B 3CUKA 4YRBA 1W76A 1SHUX 1W2GA 4MHTA 4TTQA 3QKTA 4Q5IA 5FTLA 2YQ5A 2MDTA 1RLTA 5LOVA 3MJFA 1SOMA 3FRJA 1RI5A 1J2RA 1DO2A 3FOBA 1UDBA 3N8NA 1OTHA 3DFFA 5L3RA 4E5DA 3CIFA 5JFTA 3QKSA 1UKEA 4KXXA 3JRXA 5EJ4A 3ZYCA 3P0FA 2FFRA 4U3JA 2EFEB 3LT2A 4M8NE 3OAAA 1BSVA 2FG6C 3A1DA 5ADVA 3AUXA 5CG1A 2OYSA 3M6MD 1DGQA 4LDQA 2YY6A 1LZLA 2FU5C 1QTRA 3PFFA 4Y2SA 5CYPA 3WYAA 4BNGA 2WLSA 4DM7A 5LZ9A 4R2HA 3IKJA 3RHFA 4DDUA 4NOJA 3IV9A 3VNQA 3BKXA 3NBZC 2JAQA 2P8SA 3O7MA 2H9YA 4R71A 4L95C 2LVBA 5DXFA 3UJ9A 1MDFA 1XVIA 1GNVA 3KM0A 1BCRB 3OKAA 4JLSA 1ORWA 3DTVB 3HL4A 3I32A 3SIXA 4BFTA 1U3TA 1U0RA 4DIFA 3DE5X 2PLNA 3LPNA 1YUMA 1PWYE 1E9BA 2BEKA 2RH8A 3HNPA 3OA2A 1QIIA 4MUKA 4UEJA 4I2NA 1XF9A 2XTAA 4BO5A 4M37A 3ZN2A 5BPFA 2J7KA 3BF7A 5E9QA 2H1VA 2JFPA 4ZYWA 1V41E 2X8JA 4TZKA 4L8GA 4HNGA 3FGPA 4HXFB 5CEJA 1EESA 4BWYA 5KQRA 1ORRA 3HCAA 3LNCA 2MINB 2R8PA 3S6JA 2YDYA 3CY6A 2Q9UA 3KYIB 1M2VB 5CCEA 3ROGA 2HBZA 1BE8A 3ZK7A 4C05A 4EJSB 3QE9Y 3GARA 3NGXA 1RFLA 3K4HA 3ORHA 4IJKA 5DSXA 2JFGA 4EO9A 4XQ0A 1RHQA 3GG9A 1D6JA 4EZIA 5KB3A 1GRQA 4WDRA 4F45A 4LRXA 5EJEA 4KDRA 4PFSA 3C14C 5JYCA 3QE3A 3WGTA 5DNYB 1VG9B 3OPQA 4OQ4A 1JDVA 4G4GA 1QH1B 3QMVA 2QRMA 4IJVA 3KB1A 4P4GA 1MHPA 3EZLA 4J94A 5DCYA 4BNDB 2BFDA 4YCMA 4BMCA 2QVLA 4E5SA 3RNLA 3NFRA 1X92A 1RFGE 4REQA 4RTNA 1ID1A 1JLRA 2XYGA 1UK8A 2XDWA 3OJFA 2I7CA 2D8MA 5EESA 3W8DA 3TTTA 5HKBA 4RCVA 3Q3GE 1V8PA 3P97A 2AK2A 4GMKA 3UMFA 1HDRA 3PNYA 4Q3CA 3L1UA 1CYDA 2NO5A 5TARA 3T1TA 5J2UA 3SDSA 4Z9AA 4HWGA 4FIDA 4AU1A 5K45A 2X0IA 1QYXA 2P62A 3CN7A 3V4PB 5TR9A 1M1NA 4TWJA 1XAJA 2DG2A 1JJ7A 2O5RA 2E4UA 3QTTA 1LU9A 4N8EA 1KI2A 4XKJA 2Q0HA 5ALGA 1OXMA 5HIIA 2ILTA 2PL1A 1FSZA 1G3MA 1BD3A 1GGKA 3HCNA 1QYRA 2E4ZA 1A9ZA 1BKYA 2XTZA 3LO5A 4ZQBA 1Y9EA 2B99A 4CG1A 4JMLA 1Z2NX 4I81A 1JKFA 4YH1A 3CRW1 2JFFA 4HT3B 2DFPA 1JSRA 4BQPA 2R79A 1NBMD 4HUQA 4GOXA 1P8AA 4ZQEA 3UOAB 1EK0A 2MJLA 3L6EA 3DQPA 5ARBA 3X0DA 3ONDA 1QFXA 1WEHA 1G5HA 1NJSA 1IY2A 1XCPA 1CLUA 2YZKA 3C1AA 3KOWA 2K2QB 3PFHA 2IW1A 4LJ9A 3TB4A 3RSFA 4R2IA 1EGHA 1OJLA 2W5UA 2P9YA 2D5CA 3GT0A 4PTZA 3FI0A 4WN3A 1IWOA 5DLDA 1E2FA 2NAFA 4M8LA 4NL4H 3VDMA 2OY0A 4J4BA 1UXKA 4MUHA 3T54A 5DHQA 3X1DA 2G83A 1IMOA 1D4AA 1FVFA 3CLRC 1IXKA 3CT6A 4RSHA 4Z9BA 3CLKA 4I50F 4D9FA 4DWVA 2QSJA 4KMRA 4YRIA 3FUUA 2QTZA 5K0BA 5L8VA 1XZBA 3IQIX 3FSGD 1SQSA 4PLGA 4X60A 1P29A 2GBLC 2IWHA 4D98A 5E1DA 3OEWA 1HDOA 3ND8A 5HTKA 4DCSA 4E03A 2Q1SA 5LDGA 3KXIA 1E1RD 1XJCA 2C42A 1X86B 2ZUSA 4OHXA 4PLFA 5JDCA 5THXA 2GTPA 1N0WA 2HXSA 3IHKA 2TMGA 3MFQA 4FYYA 2RGAA 4C7XA 2HMTA 4TKUB 3GGDA 3D4BA 4HDSB 1SCNE 3LYUA 5A9SA 3DZJA 4RANA 4UTXA 2XH8A 1YMQA 2OXFA 4O2RA 2GZ1A 3W6UA 5JSZA 4DQKA 2V55B 2VPWA 3HR8A 5FOUA 4C2BA 4IMPA 2GERA 4UAVA 3OU2A 1UBSB 3OQOA 4ITVA 4OHCA 3ZKWA 1HRKA 2GZRA 4L5IA 5EWLB 4CM7A 4ZGBA 1NY5A 3AP1A 4RK0A 3M4ZA 1GG2A 3JATA 2EF1A 4PZ9A 1E4YA 1W52X 1D07A 2YXNA 3D6HA 3H87A 1YDWA 1P2FA 2Y1DA 3JQ7A 3BZBA 1A1VA 1TYBE 2INGX 4OKIA 4HHEA 2YFHA 1DTWA 3MS2A 5DGDA 4MS1A 4BFXA 1DX9A 3W9BA 1CD5A 2EKLA 1XYGA 3TAUA 1DP4A 2I9PA 4JBNA 4RSRA 1KBZA 5FXMA 4X3PA 4AWXA 3V9AA 2XMCA 4DCCA 3UMMA 4HBZA 3CV3A 3IQHX 4JB0A 4BJ5A 4N48A 1RWWA 3VVLA 3CA8A 4YJFA 3CISA 3RSOA 3OD5A 5K20A 1E0AA 1GYPA 4L74A 3OJLA 2IZ5A 3DOUA 3TBKA 3K96A 3ZQJA 2L19A 4YAFA 1WHSB 1XJWA 1GJRA 1UMDB 5JAQA 3WGIA 1XQXA 4Q4LA 4QXMA 4JI2B 5LP6A 1IAVA 3EWSA 1BN6A 3UVEA 3WSVA 3VNUA 1SXPA 1DQPA 4L0DA 4LDAA 1BE0A 5F5XA 4O63O 2ESRA 3E5HA 1ORDA 4C88A 1RQ7A 5JVDB 3VI4B 1JG7A 2AMLA 4DSUA 2GTIA 4RL4A 3SGLA 3N3BC 3HDYA 2GHIA 3ZJVA 3DC7A 3PNVA 3K0AA 5HX7A 1WJGA 1D4ZA 5EE3A 3FD8A 2CWWA 1LX7A 2J3JA 2C4MA 4L7QA 2ZIZA 5FPYA 1PGNA 2RGBA 4JAVC 4N5LA 4DRZA 5LDHA 1ADGA 2A5JA 4LBYA 4HQFA 1U3GA 2Q5EA 1QE3A 2XHEA 2QIOA 3Q3HA 2HWKA 2WU0A 4FLFA 2Y27A 5EE9A 3UWPA 2D4AA 4HUJA 4AICA 4AJLA 4XYLA 4PXAA 5UKDA 4UPDA 1ZKDA 1C30A 3L8CA 4DYVA 1PR1A 3HBLA 4ZMBA 2ZJ5A 1B26A 4FI3F 4W82A 4BKUA 3U5ZB 2NPFA 5B58C 3ANSA 3TIGA 4E5PA 4YP9A 4IIEA 1SUDA 4MV7A 4LHZA 5DVZA 1XU7A 4B5LA 4K9RA 4N0QA 3LS2A 4Z9XA 2DBQA 2JDIA 2C61A 1P2TA 3QPAA 4XQEA 2PGLA 4D43A 1X94A 3RYCA 3PJGA 1H0KA 1EMDA 1BVRA 3LHKA 5E7MA 4LMRA 4ZVRA 3IR7A 3RV4A 4WK4B 2OYCA 5KNBA 4MVJG 1NZFA 1IVNA 5IVHA 5L7YA 4BE9A 2FFAA 3FB4A 2IIBA 2HJGA 1X8XA 3KT6A 3FZEA 3ASVA 2CLCX 1MEOA 1H2YA 2DKFA 2QQFA 4PS0A 5EZ6B 2BJHA 5EZ5A 5CDUA 3H1FA 5I7EA 1OPRA 2BM0A 2XNDA 3DWIA 1N7GA 3BS4A 1NL3A 2Z3WA 3V80A 1X8KA 3TZCA 3W7VA 3WLAA 2PANA 3OO1A 4PX9A 1YHZA 4DLUA 3E53A 3CKLA 4L6AA 4M53A 1GFSA 1KC1A 3DMGA 4DIBA 3QHPA 3OIYA 4QEDA 4QUDA 5AVRA 4N40A 4R1LA 1RYBA 3DUWA 4NBTA 3BFVA 2D3WA 4MA4A 3R5JA 5A7HA 5BPHA 1YU9A 1CK4A 2JFUA 5IFLA 4Y3UA 2O59A 3DKKA 2GAIA 1EG7A 5DTRA 2O6LA 4PR0A 2ZYIA 2V7BA 3HYTA 4ZYYA 4Z8YA 2B37A 4ENUA 1W4AA 2VJDA 1J7KA 1BEUB 4FFMA 3ZHZA 1SG0A 2KWIA 2QRVA 1C8BA 4WUTA 3RRYA 5B3JC 1VIVA 2BPOA 1XZMA 4BOYA 5LCXA 5DSZA 5ALLA 4DY4A 3DE6X 4D3YA 1O94A 4FOSA 3NRJA 3EFBA 3P2OA 1G20B 3KD2A 4Q4HB 2N42A 2H0QA 3AWDA 3I45A 4D9GA 3W8NA 4TMWA 1MX5A 4ZJYA 1TU3A 2B1RA 1JAIA 1WXWA 2BTQB 2WG2A 5FBKA 5IJWA 2XCLA 5ALUA 2DFLA 2IU0A 1T9AA 4X7BA 5CCXA 5JQWA 1AUVA 3EBLA 5DLYA 1AM4D 1KPGA 3FUXA 3IJRA 4I1SA 3D4LA 3N59A 1UJNA 2XT0A 2GK4A 2ZTVA 1JJBA 1VCOA 1NMYA 3BIWA 3D5EA 3QBJA 4G0YA 1M33A 1Z39A 4K05A 5BORA 3G5MA 1NNUA 3D43A 5E8JA 3F5SA 4D4GA 3KLNA 2R8XA 4BN5A 5AXAA 1XZHA 5TB5A 4ZCIA 4C2TA 1UOQA 2P91A 4DR4B 1V6AA 2JIQA 2VDJA 4WFJA 3ZZTA 2PG3A 5F4BA 3OU6A 3FTDA 1VPEA 2ZUBA 1ISIA 4WHMA 1SBTA 2V7PA 3QXJA 1QG4A 1P7ZA 3ADOA 1KHHA 2G67A 5AKZA 5C32A 4F6CA 3FYDA 3D6MA 1CZUA 2HFJA 2DY1A 3MN1A 1KHTA 3CUSA 4D79A 1EDDA 4YS6A 2PO7A 2J0SA 1CQIA 4YI3A 4CCYB 3ORYA 4LK3A 3SVTA 3U44A 3GJ0A 1U7DA 2NLOA 4ZAZA 3EOZA 4HVCA 1BA3A 1T3HA 2RGNC 3EQ6A 5K3SA 5E6SB 3W6NA 3ANTA 3H2KA 1RW4A 2GPNA 1KOLA 4C4ZA 5F2NA 1E62A 2GN2A 1PV2A 1QFZA 1DFIA 1I6WA 1O87A 1H2AS 3DBOB 4YECA 4A92A 1NF2A 1ODFA 2QN7A 3PFKA 2OENG 3ZIAA 3D4IA 3DS8A 4Z7OB 4TMKA 1O0CA 2CVPA 4QEZA 4TRJA 3NCTA 1HDXA 1YR6A 4WECA 2C9DA 4ZEWA 4H6VA 1I7PA 1KYVA 1DRWA 4UZEA 2PGIA 3CG0A 1NR1A 3NASA 3RU7A 4R69A 2B5WA 2WPDA 2XF8A 4P3YA 4X8MA 4UCQA 5LL6P 2WV9A 2NM0A 2QVCA 5SZJA 1E2IA 4QD3A 1A5TA 3I58A 3WLJA 2OK8A 1TZMA 1F0NA 2H3EA 1QANA 2ZR8A 3Q88A 3X2EA 3ROQA 4ZN6A 1DJMA 1I13A 1KJJA 2VYVD 5TC4A 1NJ8A 1AQUA 5TVGA 3FHCB 2B78A 1ODKA 1JLMA 4UM9B 4UXIA 1BCSA 2YNMC 1DSSG 2WOJA