1SC3A

Crystal structure of the human caspase-1 c285a mutant in complex with malonate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 47
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sc3A00
1SHJA 2FQQA 3GJRA 2HBZA 3UO8B 1ICEA 4M9RA 5IC4A 4JJEA 2XYHA 1NW9B 2CNKA 3V4LA 4EHKA 3R7BA 1SC3A 1F1JA 2H54A 2QL7A 2QLFA 2P2CA 4I1PA 5I9TA 1RWVA 1RWKA 3IBCA 4NOLA 3RJMA 4EHFA 1M72A 2HBRA 5IABA 2HBQA 4JQZA 2J31A 4QU8A 2C2KA 1QTNA 3H13A 4PRZA 1RHJA 2CDRA 2XYPA 3DEKA 2H51A 4PRYA 4PS1A 5IARA 3V55A 2C1EA 4N5DA 2K7ZA 3GJTA 4ZVOA 3PD1A 4JR0A 4DCOA 4EHNA 4QU5A 5LU9A 1JXQA 4QUIA 2FUNB 2Y1LA 4HQRA 4FGUA 4NBLA 3IBFA 3ITNA 4FDLA 3EDRA 4QUHA 3GJSA 1RWWA 3R7NA 4NBNA 4QUGA 4IEFB 2QLJA 3R6GA 2C2OA 4ZVUA 1KMCA 3R7SA 3OD5A 2H48A 1GFWA 1K86A 3S70A 2XYGA 3UOAB 1SC4A 1I4EB 5IBRA 4EJFA 4QUBA 3K7EA 1QX3A 4JR2A 5IAEA 2J30A 5H0IA 3V3KA 2CNNA 5I9BA 1RHMA 1NMEA 1PAUA 3H0EA 3H1PA 3KJNA 4JB8A 2J32A 3SIPA 4ZVQA 2H65A 1RHKA 3QNWA 4QUAA 1GQFA 3GJQA 3H11B 4I1RA 4PS0A 3D6HA 4N7JA 1SHLA 1RWXA 2H5JA 2DKOA 3PD0A 4QUDA 4ZVTA 3SIRA 1RWOA 2CJXA 4JR1A 2QL9A 3EDQA 3NR2A 1PYOA 2QL5A 1F9EA 2NN3C 4NOKA 4FEAA 5LUBA 4AWAA 4EHDA 4HVAA 4QU9A 5IBCA 1I4OA 1NMQA 5IAGA 4ZVPA 1RWMA 5LU8A 1NMSA 3V6MA 2QLBA 2WDPA 4ZVRA 4NBKA 4QUJA 4QUEA 1RHRA 3NS7A 2XZDA 3DEHA 4NOMA 1QDUA 1I51A 3H11A 4DCJA 3BIJA 3KJFA 1BMQA 1SC1A 4N6OA 5IANA 2AR9A 3S8EA 4JJ7A 1I3OA 2HBYA 1RWPA 3P4UA 3R6LA 4EHHA 4QULA 1RE1A 4FXOA 5IASA 1RHQA 5LUAA 2J33A 2H5IA 4IYRA 3V6LA 3DEJA 4D3YA 5IAJA 1CP3A 4HQ0A 1CVRA 2FP3A 1RHUA 4DCPA 4JQYA 5IAKA 3KJQA 3R5KA 4JJ8A 5IBPA 4EHAA 3D6MA 4QTXA 3PCXA 2CNOA 3E4CA 3P45A 3D6FA 1RWNA 2H4YA 2XZTA 4N6NA 4QTYA 3NKFA 4NOJA 4D3ZA 4D3XA 2CNLA 5IC6A 2CJYA 4AW9A 5K20A 4ZVSA 4N6GA 1K88A 3V4OA 4EHLA 3R5JA 4LSZA 3DEIA 4N7MA 4AWBA 2C2ZA 1IBCA 2C2MA 2H4WA 4QU0A 5JFTA 2Y0BA
chains in the Genus database with same CATH superfamily
5IYZA 2QQ0A 1Z56C 4NK5A 1JEYB 1T4CA 1V5GA 3O4GA 5KOHB 2G77B 4B79A 2PD4A 3FOAA 4B0PA 1PW5A 2OP1A 1F1JA 3QK7A 4EEXA 4G07A 3KT3A 1NXOA 2DWPA 2V1XA 3AVYA 5KAMA 4MKGA 2C8JA 2WM3A 4HYYA 2CV1A 3Q7RA 3H2JA 4X1IB 3H4MA 3O8DA 3O3MB 3TJRA 3AXTA 2HV8A 4G9BA 4Q0MA 4RJLA 5T41A 3SBEA 3KQHA 1SXGA 2JGJA 2E2WA 3D7SA 3EZLA 2FSVA 1XNJA 1GYRA 4RZ2A 2JDID 1HE4A 5L7YA 3FSEA 4WINA 2Z6QA 5LVAA 2GXUA 2V7QA 2IDJA 4ETNA 3DPSA 1SD2A 3NHRA 3GB9A 2BF4A 3I3OA 2M98A 3C8ZA 3BE6A 4DREA 4WNAB 4EQ6B 3JYLA 3K8OE 4E33A 1JWAB 1A9OA 4GSLA 3ZE8A 3HJAA 1RBZA 2I6FA 3HFSA 3FMOB 2ZUCA 3LFUA 5YASA 3D4LA 3V80A 2XXAA 1J00A 4BBJA 5KTRA 2W4QA 2BJHA 3L5KA 1WHTA 3DCJA 1YZVA 4UTXA 4DIBA 4FBGA 2VFAA 2C4UA 3T7RA 2J3IA 2W6NA 3HN6A 5EJ2A 2X4IA 4DA8A 1W5BA 2PV7A 2AC7A 5JNTA 3KHTA 4MP8A 1I4LD 1NMEA 3KQKA 2H1WA 1FBNA 1BKDR 3AKDA 4XX0A 1JHZA 2L18A 3P8ZA 5JAQA 2G76A 5CM8B 2QE6A 4EAAA 1ORWA 4MYUA 4R1TA 2OK8A 1HNNA 1TUGA 4MR7A 1P4AA 5M29A 3OTOB 3K0CA 2I2AA 1B7GO 1P2VA 3AFGA 3L7KA 1TEZA 2FZWA 1GEEA 4LQDA 3IPXA 4DDTA 2NP6A 3DL4A 3UJ6A 1E5QA 1DBWA 1F9EA 3ADBA 2I4LA 4NOKA 3PNMA 1NWCA 1LFDB 2LNDA 2V4MA 3KWFA 5AIBA 3VDNB 4EA8A 1N8NA 4V3CA 5I3ZA 3CCFA 4Z1MA 1V1RB 1B1CA 2X5KO 3DE5X 3FI0A 3WNQA 3F6PA 2OPBA 3EDCA 4NATA 2JI7A 2ZUWA 3DHVA 3ZGYA 2WJ3A 3B85A 2WWWA 5P8WA 4CEHB 1A9QA 2B37A 2XMGA 2Z5FA 4F21A 3TG2A 1KXJA 2EX4A 2CGEA 3GRKA 3LLVA 5FBQB 4RY9A 1NU8A 1XLUA 1WZUA 1K7FB 2J0UA 3DE7X 1RI5A 3VC7A 4B6OA 4LGVA 2PUDA 1IN8A 3NBZC 2FSIA 3BHMA 2FOIA 3U4MA 5EZYF 3Q8WA 4EMTA 3GGJA 2XUOA 3ZDXB 1XPUA 2FW8A 2P9TA 2ZUDA 4QUKA 2WU8A 2Y0EA 1RYHA 1WSBA 2X1HA 2C2XA 5DGTA 4BO3A 4EIWA 5I9IA 1SKMA 4NXMB 4I9GA 2W22A 2WF5A 2YWJA 3C41J 3IAM1 4Z86A 3RF7A 2IHUA 4MV5A 4MULA 4GX1A 5A4AA 3G8CA 3VPDA 2H29A 3EY9A 2LP4Y 1M7GA 3CISA 2FX2A 1U8ZA 2TYSB 5DNAA 3GLHA 4DR1B 2ZB7A 5FP0A 3T5GA 1H6BA 1YI0A 2AOVA 1EQ2A 4CM7A 5F9FA 3VZBA 1J1IA 1QCZA 4HDSA 1YMQA 5FRDA 2ZYAA 2P4UA 2GBIA 3TFWA 5HWSA 5LZ9A 1D2AA 2YMLA 3ESQA 3UB3A 4YAJA 2O8NA 1XMOB 1BWPA 1G21B 5J2TF 2XZLA 2XECA 4OQNA 4W5JA 4RKYA 3C4JA 2IL1A 5FD8A 1GNTA 2OQRA 1ENPA 3ZJYA 3BS4A 1I2AA 2IBTA 4MRMB 5F9HA 4JMLA 1WNTA 4GPZA 1PZMA 3MQ4A 4TTPA 1GAQA 1FRVA 3RRMA 3PFWO 4KMSA 4HI0E 3DG9A 1KC3A 1SUBA 2HRZA 1JAZA 2PFKA 1BAPA 4XCQA 1O94D 1S2DA 3PEUA 1B00A 5AM0A 1J99A 3V55A 1L1QA 1SZPA 4BE9A 1FXUA 2EWVA 4S3MA 3E23A 1N5DA 1CR1A 3NJRA 2H8GA 2IYQA 4GHWA 4QUIA 1P5RA 5COBA 1OA0A 2AUMA 2X5XA 3LL4A 1DAOA 5JC8A 3DMFA 4ZREA 1FVHA 3TIVA 3QVWA 4C6TA 1AURA 3U2QA 2XGJA 4ROSA 1C4XA 1NMZA 1XCMA 3FGOA 4G5XA 4QO7A 3RS0A 1C7ZA 2E3JA 3EPRA 2HJWA 3TSOA 2BFDA 2H48A 4WJKB 5AQEA 3OE1A 4ZODA 2FR8C 2IF2A 1IHPA 3PQ3A 5IMBA 4ZO4A 2W37A 3ZG6A 4EYGA 3SHVA 1L0BA 1JLMA 3QBVA 2AR7A 4DWWA 1UPBA 5KWSA 4PPFA 3AF1A 2VG8A 3I4FA 3VVBA 3WIEA 5L6MB 3KQNA 2Q5HA 2QZ4A 2O3TA 4NU0A 3GL9A 2J3EA 5FUVA 3HCBA 1OLOA 3F67A 4CMEC 1C2TA 2AZDA 1T6XA 4FHCA 2IXEA 2VNAA 2AYXA 5TQ0A 1LDBA 4DA7A 3P9KA 1TTHA 3DTVB 4FLEA 4H7JA 4I8DA 2JZNA 3QI2A 4Q19A 4MWDA 2GK7A 2V0NA 3FUXA 5TMEA 1BOFA 3RTGA 1N0IA 3LGAA 4GYWA 4A0FA 1LV8A 3B82A 2NU7A 1JGTA 4QPPA 3GBSA 3INNA 3ZLUA 1KH2A 1X7GA 1YQGA 2PEZA 4IGEA 2CXSA 4AL4A 4DNFA 3EISA 4B33A 2NU8A 3C7AA 3DFZA 2JI6A 3B7WA 4B2PA 4ZOLA 4ZI7A 5AKYA 2FYTA 3WLSA 1L5HA 5L3QB 3DLAA 1R9JA 3GLIA 2BTEA 1K7YA 1D4ZA 3IHWA 3DYVA 3AIMA 3GZNB 4M46A 4OU4A 2LWIA 2TSYB 2WV9A 1FDSA 1CQIA 1T29A 3D7NA 3GEIA 1KSJA 5HRUA 2XQIA 1C3XA 1PJ4A 5DF1A 5CYFA 1GNRA 1KRXA 5KTNA 3UWSA 4DZZA 5BV2P 3BB4A 4KAJA 2ZSIA 1SJ9A 4GGPA 8OHMA 3RAGA 1KYVA 3UYLA 1WHSA 3BL8A 4RZUA 1AKEA 5BV1A 5LNK1 3U17A 3K5WA 2FPKA 4NJMB 1M2GA 2YHSA 4J0DA 1E0AA 1SR8A 1XD2B 4I81A 4NMLA 1Q7BA 3UO8B 1W30A 2NQTA 4HH3C 2OD7A 2XVXA 4Q15A 5HF6A 4JA0A 4F86A 4U9UA 1W1IA 4PHTA 5TV2A 3D2CA 3HCFA 4PZ9A 1GPWB 1UANA 4Q4AA 4D80A 1GKKA 1FFHA 5FBHA 4DWVA 2JPDA 4ZMBA 5JCPA 4AY6A 3HXTA 3PTZA 5IN4A 3B70A 4FDTA 4B2IA 2O59A 4QFCA 4CIVA 4PLWA 1E4VA 3KKOA 1UK6A 1NOIA 2E6KA 2GO7A 3CJRA 1XNHA 5CEEA 1ABFA 4NBSA 3HKDB 2FMKA 3GLGE 2ZBQA 2RH8A 5LOVA 1SFRA 1LWNA 2J31A 5EJFA 2ATVA 2HADA 4II3A 1AM4D 1ZHOA 1TCAA 1JECA 1QTNA 3LUDA 4NIMA 3QIVA 4TPKA 4BE4A 3F98A 1QE0A 2R7MA 3T0GA 2VHYA 2JCYA 2NT3A 4RPJA 5AVYA 4L8WB 3SEFA 4JT9A 1HEUA 3JQAD 5D3KA 5AM5A 3THYA 1ZJWA 2PXCA 1E1YA 3PKJA 4YNBA 4NONA 3FNQA 3OZAA 3CW8X 3I30X 4B45A 1NSYA 2NZJA 4BAZA 4BRZA 1AJEA 1S3GA 2FDXA 2FSSA 3MRSA 1OVGA 5AW8A 1VL1A 2JLQA 2ZR0A 3EVCA 4NS4A 5FOTA 1YCHA 4OPMA 1FS6A 1GCUA 1I3LA 7REQB 3FKSA 1Z33A 3PXCX 2K5UA 1ELOA 1PGPA 4ZOLF 3TMYA 2C78A 4ZI7F 5A5FA 1BX0A 3CRQA 2NTYC 5FR2A 4E2ZA 4DMFA 4YAUA 4RGQA 1RNLA 2DSNA 4QOHA 2H6EA 3AT1A 2WFAA 3R3ZA 2CEKA 3BORA 4WA8A 4DW8A 1ZH8A 4I36A 4DDKA 2XNDD 2CNNA 2R4UA 4FQ5A 2VUHB 1NBMA 3Q98A 2OM6A 3DCYA 3TQHA 3VZPA 2IXFA 3ENQA 4LJAA 1SUSA 4XFJA 4H16A 4WADA 4MXDA 4QEDA 1X39A 4RIGA 3USCS 2CLDX 6GPBA 3MTQA 2V5VA 3VC2A 3T7EA 2X9GA 4CUZA 3N2GB 2GD1O 4OK5A 1R0KA 1IY0A 4UDNA 4YRTA 1VRCA 4CR6A 1P6QA 5D3ZA 4CRWB 2VDRB 2ZTSA 2ECPA 1ODSA 4JC8A 2K2WA 5EMLA 3KJGA 1HDXA 4RHYA 4MTCA 1OZHA 4FYWA 5FPTA 3T3MB 3D3JA 2A9RA 1WUKS 3WKBA 1A9TA 1YI1A 3Q9SA 4G9EA 3ZNQA 4MI3A 4M49A 1AQNA 3T1YB 3SLGA 5DE3A 1R0WA 4URHA 16PKA 1QVAA 1KYXA 3HQ4O 1HKHA 1QDUA 2DLNA 3FF4A 4UNRA 3GP5A 5JISA 3DDNA 3E81A 1OZAA 1UCFA 1XQVA 3L7IA 2OG1A 1W2HA 2EQAA 2R8RA 3UBMA 2AEEA 3BMQA 5CX1A 3UANA 3U4AA 3OIVA 4B74A 1XAIA 2WTNA 4EDFA 1CY1A 4F2PA 1SKAA 2VATA 2PKXA 4DMUB 1BVRA 2FG7C 1F8UA 4QFBA 3WS7A 4QDZA 4BLSA 2WHEA 3OCJA 1RJWA 2X5JO 5AR1A 5GP1A 4C07A 1WVMA 3OX1A 2YWXA 1TADA 3AKEA 4JJAA 5DHRA 1M67A 3E9ZA 2B9VA 5K6RA 3VQTA 1NJ6A 5BMVF 1T5TA 5DISB 2ZRNA 4AMUA 4JYZA 3LRXA 1LPPA 1ZIXA 3DOHA 4ZTBA 3UJ3X 4CMEA 5C5EA 1Z37A 2VJNA 1SXJB 2Z5GA 3L1HA 4IPTA 3RB8A 5JH7A 6AT1A 1XZFA 5D1NA 3RUCA 2HQBA 1K0FA 1YDFA 2Y1XA 3ZGLA 5EMJA 2BKUA 3NBYC 3KKEA 1SOVA 2DQ4A 2DPGA 3DMGA 4P80A 1D2NA 3DVAB 3KPWA 4AU1A 1JAIA 2WSYB 2BGGA 1KO8A 3K2BA 3U0BA 3CVWA 1HEYA 1JT2A 2WMDA 1JFVA 3EZ7A 3PWTA 3TLEA 3W2FA 3ZDZB 2OHFA 2IW1A 4QTTB 4JXZA 4JC4A 4GC9A 4RK4A 4M1EA 1YJ8A 4TYMA 1M6YA 4I9HA 3TGLA 4IKPA 2QG4A 2ZWAA 5HNKA 1NR1A 2P9HA 4QEZA 2DLCX 4L5AA 3OVMA 4ZGGA 2XAAA 3EZNA 3AP2A 1UFVA 2YRFA 2YFYA 4RACA 3OAAD 4BFSA 1BOOA 2G83A 2RGGA 5HX7A 3B48A 1UMKA 2LTAA 1HDOA 4N4AA 2C2WA 5C7LO 1Q3HA 2A0FA 3R5SA 1DAHA 2GGSA 3LOQA 4OM7A 2JIOA 2C03A 1XVVA 4IGFA 2NUPB 5JPIA 1DKOA 1JQBA 2RH4A 4JU8A 4O8CA 4ZEVA 3VKHA 3CZQA 3AH8A 4KBFA 1J1ZA 5L8VA 4IV8A 2D0PB 2CL5A 2MSLA 1A4IA 2AYYA 3G88A 3HLTA 1RC0A 4XJTA 5LBTA 5E3HA 4HN4B 3DQQA 3ZOKA 1XU4A 4YALA 3BWEA 2G80A 1OVMA 4LK3A 2QU7A 3IVCA 4DJ5X 1DAPA 1XEWX 4TV9B 4BB6A 1KZGB 1OU4A 1Z2NX 2V6IA 4KNWA 3ZY3A 4NYJR 4PG4A 5FPPA 5BUZA 5I7VA 2CLKB 3HXMA 1UIMA 4FOLA 4GMHA 1RS0A 2AKAB 4XPIB 4GOXA 2VZ0A 4WY2A 5L51A 4DB2A 4ZAZA 1LQ2A 1T5LA 3EGCA 3AXSA 5AK0A 5L3ZA 3TJZA 3WBKA 4HNUA 3Q3CA 1PNOA 1BWQA 4CV2A 2WPDD 2D2EA 4UULA 2OXFA 4KE8A 4GLBA 1F5NA 2W70A 4KITB 1K6EA 4AWAA 1FFAA 3WGOA 3CZAA 2ZYHA 1I0ZA 4UTVA 3BEDA 3E3MA 3IQHX 4OJYA 3OM8A 5IXJA 1Q1NA 5KNDH 5KPDA 4FYIA 3EUEA 4I4TA 1LC0A 1NMSA 1QJCA 4JDPA 1NR7A 5JI3E 1JR3D 3AM4A 3I58A 3AR6A 1UJBA 2AWOA 5AK5A 1U28A 2XTZA 2J3DA 4JP3A 1VJCA 5ELLA 1RT9A 2Q1UA 2P2NA 2XJ9A 4TT8A 3JQCA 5A7FA 3A3NA 2VDLB 2XUJA 5CW2A 2NPOA 4U1RA 4P3KA 3DMNA 4N8SA 2O2ZA 4A03A 3H1AA 4L4XA 3FI9A 1U2EA 4F2GA 4M7OA 4OFWA 4H31A 3DBVO 3WWYA 2WR8A 3G2JA 3MGGA 4E12A 5FFNA 4AUKA 1PFQA 2WD8A 3DPIA 4CLRA 2AFIB 1GUYA 5JCJD 4LYAA 1Z6YA 4KRGA 2GEVA 3UWKA 3DOCA 1J9EA 3VRHA 5E4JA 3PEWA 2YHBA 3IQGX 3OMLA 3NZEA 2Z2XA 1NXPA 4J49A 3JYNA 2ZFUA 1SHUX 1Z74A 2GTIA 4PXSA 3HU3A 1JAHA 5C81A 5CVTA 3QU5A 3QLTA 3EVEA 2FPGB 4D74A 3OG9A 4Y6SA 3T7CA 3KVRA 4LJ8A 1FFXA 2DZDA 2UYGA 5FOWA 3PNLA 1PL8A 4PLPA 2RHTA 3DMYA 4QARA 2QPLA 4KQ2A 2OBMA 3E05A 4BU1A 5JAPA 1YZLA 3AR9A 3UAOA 1SC3A 2CXXA 1HF3A 4R0NA 1ZJJA 3IFSA 1SWVA 4WK4B 4DR6B 4CMHA 4JV5B 1XZDA 2JJQA 5JCXA 1Z0IA 2C54A 1J42A 1S7GA 2O2XA 2R7AA 1NX6A 4M0KA 5BSHA 1NVDA 1I4WA 1WKBA 3F4BA 3ROXA 1Y7IA 5TDHA 2I0FA 1WB6A 3CLVA 3R3HA 2UXBB 2C2KA 4Q9DA 1RHJA 3AEKA 3S3TA 4L50A 1E6WA 4BNGA 3L8HA 5TY0A 2PUGA 5E6UA 3FF1A 2YIDA 1XCJA 5DOZA 4BN4A 3U4IA 1GNQA 1EVYA 2HDNB 4F4DA 3OH8A 3WSWA 3NUQA 4UUNA 3LC1O 3O3NB 3LY7A 1RIFA 2Y1LA 2F8MA 4MQBA 3S40A 2HIMA 3P9CA 4NBLA 4R2WA 1ZN7A 2GXQA 2FVXA 2Q1WA 1SHTX 1YQDA 5BQPA 3UM9A 2EBFX 4F7WA 4RTNA 4HTFB 3MUNA 5EZ6B 2YHUA 4TRNA 4HFNA 4CLOA 3J80A 3P97A 2F8TA 4ZP1A 2B8WA 2QLMA 4CZ2A 2A84A 3QFTA 3NWOA 3BHNA 5J4KA 5TVKA 3I04A 4F1KA 3BULA 3DGFC 3T9FA 5L4LA 5J58A 2I2BA 2I22A 2DULA 2PS1A 1QCDA 4GOJA 3DF7A 1PHRA 2I55A 1GQYA 1ZCJA 4L4YA 4G4SP 2BFOA 4JJZA 3M6UA 1EJ0A 1Y8CA 1LPAB 2BL4A 1DV2A 4AZTA 1ZIYA 1CR4A 3G3EA 3IOCA 1ECPA 2CJXA 2WNIA 1Z8HA 3V8PA 1C50A 1KU6A 1O6CA 1RJ9A 3K15A 4N9QA 3W8NA 2KYRA 3EVTA 3PUIA 4WERA 1L5RA 3HCOA 2QZSA 3H9CA 5BWNA 2BFNA 5L53A 3K0SA 2WTEA 5KOIA 4IWXA 5EE0A 1W76A 3AUXA 5JG7A 2EW2A 1P8AA 3OE7A 4OQZA 2QP3A 5D87A 3RTDA 1H9CA 3C1UA 1TW2A 3G89A 2DEUA 4ZI5A 1UOPA 3TQSA 3NGXA 1HORA 2WPNA 3MIIA 2C4NA 1RQRA 1EIWA 4P7KA 1XRSB 1ZXXA 2W6ID 4R7GA 1L4KA 1NVKA 4B76A 4E5MA 4YHHB 2GWHA 1YDEA 4MPPA 4Z4CA 4JVOA 5AOAA 1ARZA 2PRZA 3IS3A 4JLMA 2ZJFA 1R18A 2F9LA 3RG2A 1DTWB 5DO9A 1UPUA 5JIBA 1XA4A 4GMXA 4Y7CA 4DV6B 4N8DA 1EDOA 4HQ6A 1SKBA 3PXUA 2LE0A 3K09C 2IV3A 2IIPA 3CMCO 4WKOA 4GX5A 3WIBA 3B52X 1XTRA 4GQAA 5B6PA 2H07A 5EKDA 4CUKA 1J6UA 4ZI3A 3PCXA 1LLDA 3LO5A 4GI3A 4OHVA 4YP0A 5C35A 5JZBA 1QH8B 3A1WA 3V8EA 1COWA 1DBRA 2WEKA 3IUYA 5FOVA 1EDBA 2C07A 4EPXA 4J2HA 1I30A 4Q37A 2QORA 1O0CA 3HY4A 3PPIA 3CWCA 3AIIA 3D0OA 2YCBA 2J3KA 2WYUA 1HWYA 4I3GA 1QMPA 5DNEA 3WB9A 4YBRA 621PA 3AVVA 1U1DA 4YAKA 1RU3A 3V5NA 4DHEA 4HMOA 3G85A 5ELMA 4PSCA 3X2EA 2JA2A 4I7EA 5BN3B 3QEBZ 4CT0A 4EF4A 5CA1A 4DCMA 1IVSA 1O58A 1W59A 4R01A 4ZAXA 1P0CA 1UIRA 2BV3A 3LCJA 1QRAA 3F47A 2VHTA 4BDSA 2PVPA 4W5RA 1SCNE 4MVJE 3FSJX 3I9OA 4RAOA 5EZQA 1RC8A 3KK0A 4LBYA 4RA9A 1VSTA 4OX9Y 2CMGA 2X0FA 3W7BA 2Z57A 2R60A 1D4OA 1R6XA 1XRRA 1NVAA 2WV7A 3K0CC 4G3XA 5JC1A 4R0VA 3IT2A 4KQWA 1ZRNA 2R1VB 4HJRA 4V3BA 1FP2A 4I50F 1QDLB 2Z8XA 4TYYA 1S7CA 3EDRA 3TNYA 4L57A 4Q9NA 1EZ1A 1Z8FA 4KO3S 3WYFA 3ZCRA 1SIBE 4EYEA 4Z8YA 4BNFA 3FXAA 1IG0A 3KZOA 3JASB 1HKUA 2EEPA 3L8YA 4XX0B 2RGNA 3OMWA 3AM5A 4F5DA 3AK4A 3P0RA 4YQEA 4BC1A 2XB2A 1MAUA 4WVFA 3LTNC 3FPSA 4BGVA 2RE8A 4UUAA 3K2EA 1SCBA 4FILA 4BWGA 4E15A 1N6OA 5ALZA 3BJZA 1O9BA 1KFEB 3KXIA 3FPGA 1IOLA 3T7IA 2R85A 3DT9A 4B6JA 3F97A 4ZJYA 4X63A 5K4GA 3LUCA 4CDNA 3WAGA 1FSSA 3T3DA 1NDUA 5CYOA 3VU1A 4RLQA 4V0KA 3QGMA 3HG7A 4GPTA 4RHCA 2BFCB 3PC3A 1OD6A 3AYZB 4KN8A 3UWDA 4BNVA 3DV9A 3VJMA 4CTMA 3QPUA 1FTSA 1SQFA 2B2XA 2WB4A 5J2UB 1YQXA 4OJKA 4JIMA 4D8WA 4GX2A 4UAVA 2VRWA 4NESA 1D2HA 3ND7A 5HZGA 1OJ7A 2JLAA 4UMVA 4FE3A 1UBRS 5HBRA 5TS3A 2XNHA 5LB4A 3OY7A 1V4NA 4JJGA 1XWFA 3ELYA 1Y5IA 4V0LA 4DC0A 4FSDA 2E82A 4NICA 1JTFA 1A04A 5LYJB 2DFKB 2XRFA 5JSFA 2PX8A 3GLRA 5EPEA 4GD3Q 2Z2IA 2JKVA 2QIPA 3BFJA 1GZDA 3PVZA 3OFJA 1MO2A 4B3RB 4F85A 3H4IA 1AA9A 1J0BA 4V03A 1KIAA 4PQYA 4X45A 3WGIA 5KNCA 1QWSA 2BJVA 1WA5A 3TZ6A 1XTTA 1ZS9A 4DCPA 1E1CB 1Y5NA 3HJBA 2OQVA 3HJTA 3QWAA 4X0EA 4BHTA 2AN1A 3BPSA 2RHJA 2ZBUA 3M70A 1DJOA 521PA 1C9MA 3BZBA 4R1NA 5E8RA 3T7JA 3P45A 5FOUA 3H1GA 1ZA2A 3LCCA 3PIIA 2WWIA 4GAEA 4WFIA 2D1SA 3D5EA 5FWDA 3UC9A 3UENA 2C8KA 2R00A 3QMMA 4R1SA 3H99A 5TVGA 3NAGA 1E1QA 5F98A 3T5MA 2C2MA 1DJPA 1CY7A 2KWIA 2RH9B 3NRJA 4E7PA 1CYEA 3ADDA 3G8DA 1XP8A 2R1TB 3P0EA 2B3TA 3RVKA 4HH0A 4KQFA 4CE6A 5ISMA 2XE8A 4Z8XA 1P2UA 5BW5A 1RM4A 4EBBA 3JQAB 1AGRA 2ZJ1A 3NRBA 2R2AA 3B5EA 3WMFA 4G6ZA 1QRTA 1G5RA 3W34A 3EVNA 1HYQA 3SJZA 1YOVA 1SKUA 5EXSA 4QGGA 2BHRA 4IDOA 2JBHA 3RHZA 1B8NA 2NZ8A 1AHPA 4PNHA 1ML3A 1FNDA 2XQKA 5J4VA 3O9VA 2GM9A 2JJMA 2TMGA 2NZVG 2XXBA 1JHQA 2ZTMA 3R0ZA 1XEXB 2K7ZA 1K06A 1NLYA 3QHQA 4P31A 1BCRB 1JDJA 3SR3A 3KLPX 2WDZA 3S2UA 5EN4A 1DRWA 1KJWA 1SK9A 3IMGA 4M6WA 4RVFA 5KJ6A 1FZQA 5E0KB 3SYRA 2ZYRA 4G0YA 5CVUA 4YMGA 1TXGA 2LDXA 1VC2A 4JX8A 1UEIA 4CUJA 1XZPA 1MW9X 3MFQA 4EKGA 3EH2A 4AS2A 1D9XA 3G8BA 1HLPA 1PLKA 4MUBA 3BRSA 3T1TA 2PA3A 4XM0A 1E4OA 1KFKB 1N0UA 4MPJA 3TFOA 1QO0D 2EP5A 1XA0A 1U1EA 1EP1B 3HBAA 4JUAA 4GSYA 3FNHA 4DBZA 5KHOC 1DC3A 3PKIA 1KSFX 3O1JC 5B4VA 1XLTA 1QYCA 2Q2QA 2J08A 2QD5A 2PR2A 2YNMA 3CZ4A 3E7FA 3KQPA 4I8IA 4FGLA 4PG6A 4EK9A 5JXWA 1SO8A 2Q3EA 1N78A 3VTKA 3RS2A 1MOSA 2PQ0A 4M3NA 1CUYA 1EWVA 5B1IA 1Y9EA 4MVJG 4OQXA 4B71A 2QTLA 1E60A 4C0JA 2FB9A 1ISPA 3QKRB 1RI3A 4U2GA 2PH3A 3LD9A 4BNKA 2V59A 1YS2X 4RK6A 5BXQC 13PKA 2OCIA 2P68A 1S96A 1TUBA 2E4UA 4PSVA 5BSGA 2QA5A 1PTKA 2PGIA 2KBEA 2W11A 1MABA 2Q27A 1RJEA 1XOIA 1XHEA 2PH5A 1A7JA 2W6QA 3GNLA 1BVYF 2RKBA 3V8RA 3SWWA 3BWYA 5EIBD 4ZKDA 1SRQA 3MB5A 5DN6D 2IYRA 5BN3A 3V2HA 1Q95A 1QYRA 1W34A 3WLLA 4W5WA 4BJHB 3I45A 4KR3A 3O21A 1T9ZA 2W2PA 2H18A 3NHLA 1QRSA 5HF9A 1QG0A 3IE2A 5JBQA 4PF1A 2FDRA 1AQUA 1C9NA 1SPXA 1XKTA 3ZZTA 1Z34A 4NZPA 4PR0A 4X20A 2FGKA 3X0DA 2W2LA 3OPYI 2CHGA 1THGA 4B8ZA 4HH1A 5I47A 2H59A 3A9SA 2C1XA 3LHFA 1PFGA 1NA5A 3AESA 4RKQA 1S9HA 4I9UA 5ALVA 1Z7GA 1YULA 2JLCA 1MIOA 2AKYA 1TFUA 2PKCA 1XL1A 1BN6A 3NM5A 1DAKA 5HFNA 4NABA 3DF9A 2DOKA 3BA6A 2IYWA 4ZEOA 2GCEA 3WLIA 4ZYLA 5A6SA 4ZCIA 1XTQA 2FU5C 2ILTA 3VNVA 1QF7A 4BVAA 4JYBA 3FGPA 3IGFA 2OHJA 5DCYA 5I45A 1Z16A 2ZROA 4RPCA 3VTAA 3NIBA 4GXQA 4ZO7A 4DAOA 1FTWA 3FHLA 3NYRA 1YMUA 4TYPA 1VRVA 1WQ3A 2PRIA 1OT3A 2YYAA 1VBFA 1IOWA 3MRXA 4X8MA 3KLBA 4YGXB 5MFZA 2LD4A 4TTRA 5C32A 4UUOA 2DBVO 4FKBA 3T52A 1MMFB 1WW8A 3K0FB 1AKYA 3PU6A 4LX0A 4HDOB 4LXTA 3W8EA 4HT3B 1JQ5A 4HRVA 3TIIA 3C3DA 2Q99A 2VBFA 1M6WA 3TEFA 3D6UA 4C0WA 2XUDA 5CT6A 2R6CA 2B0JA 3PPYA 4F9EA 3ZHYA 3V4LA 2YWGA 2BP7B 4KUGA 4QVGA 2IU6A 1UBCA 3K96A 5AK6A 5LCXA 4EWLA 2JVIA 1GPLA 1EWYA 2G9ZA 3WLNA 5KMGB 5H81A 3ISVA 2XKJE 4MDHA 1N5IA 4CKWA 3LYAA 4C0LA 5AW7A 1YB2A 1JHUA 3ASZA 4GEKA 4M53A 1OPRA 3BZUA 3CA8A 4M7WA 4OBWA 5TS2A 5KKCA 1QU2A 2BMFA 4TLEA 4L7VA 2ZTHA 3JSAA 1TJNA 4QFDA 3T4PA 1EVLA 3KXKA 3QM1A 2IYNA 5PNTA 4BECA 1L4UA 1QP4A 1TZKA 2O19A 4ZQGA 5F4BA 4BJ5A 1WB5A 3WBJA 2W6ZA 2QI9C 2YZ2A 2I7CA 2WWHA 1FF9A 5ENDA 4ALNA 3T95A 4XPIA 1Z6GA 3UJPA 2FAXA 4RY0A 2Z9DA 2AW3A 2PKQP 2EKZA 4CQMD 3E15A 3GROA 3ZGOA 2ACEA 4JU9A 5HQ3B 1S3IA 3T3EA 5KSOA 3ZR4B 3AY7A 1SVLA 3EQ9A 3A06A 4G1BA 1KO1A 1PEDA 2EJBA 2JLSA 2PRYA 2MSCB 3HYRA 5H0IA 3ZGNA 3QUAA 4ILKA 1RM5A 4OQYA 2P6UA 3MMXA 2OL4A 4RQTA 5AI0A 1OWLA 1FEZA 3WDKA 4C22A 3NC1C 2H2GA 3EEBA 1JSXA 1TO2E 2HSWA 1UM9A 5JJLA 4OGGA 3EWIA 4I1RA 4J90A 2W4IA 4XPZA 5HZMA 5KVVA 1BHJA 1SXJE 2BH2A 2W2XA 3JS5A 1MO6A 2VP9A 1J0DA 1KF0A 2O2DA 3K53A 4UJ5A 1VOTA 1NFFA 1FS4A 3G9TA 4AZ3B 2XV1A 3H2HA 4E3WA 4PNZA 4EPWA 3L43A 2XAUA 3TL3A 5LP6F 4MV6A 3TQTA 4KZPA 5DMHA 2VJAA 2VJCA 4EGJA 4LJ6A 4EGCB 1YQUA 2O3JA 3GGDA 2UXDB 4QOEA 5GOTA 3OZWA 5AM1A 2KBFA 3NALA 3TE7A 4DQKA 3RUPA 2GZDA 1ZWKA 5B3JA 2Q9UA 2IK8A 3GJ5A 4LRWA 4QYIA 4GOKA 2A86A 1ECGA 3NPAA 4QM6A 3O74A 4DR3B 2G70A 4DLRA 2JGRA 3L77A 5ALSA 3BH0A 1UDRA 1TM1E 1LDEA 1G20A 3FYTA 4DY6A 4WVLA 4Q4JA 1XVAA 5DHFA 3EFBA 2YOHA 4KE7A 3NTRA 1UP4A 3TRJA 4R2KA 4AP6A 4M98A 1PDWA 5DP2A 2IS6A 1K8XB 4Z9FA 4F3CA 1SCUB 3KUCA 1WEKA 1LCIA 4UXIA 5SYNA 1E79D 2VJLA 1HT3A 4X7RA 4CW7A 1Z4KA 4KVZA 4EJSC 3AL2A 1WP9A 3MM4A 1FBTA 4I5IA 4D0GA 2ZVQX 1C1DA 3D0KA 4Y0NA 4AWBA 4UTRA 5LMUB 1JBKA 1P61B 1YFZA 1R0XA 1XZQA 2HMWA 3HB7A 4L1KA 4MITA 1LPBB 3UG7A 2OD9A 1GXSA 3QX9A 3WIDA 3EEQA 4R71A 5B7QA 1BDJA 5FI0B 3K0AB 2GCOA 3EBPA 1SELA 2GRAA 3K0EA 3Q6NA 5LQUA 2O7VA 1OY1A 2CFOA 2QL7A 3F5MA 4LYYA 4ITVA 5IP5A 3GC6A 4BO4A 5KHAA 1OE0A 2XPCA 1K63A 1F17A 2QB5A 5I5EA 3T7SA 3AOEC 3USES 3VI3B 4BATA 5BNWA 4W5TA 1N33B 1FFSA 1G2PA 4EB6B 3RGGA 2GUGA 2P3SA 2I3GA 4MS4B 1VSUA 4FDUA 2DFTA 3F71A 3ZHRA 1U2PA 4U7DA 4R51A 2WTAA 1PR0A 4F3TA 3ZHUA 3ZK9A 1CUDA 2LUOA 5F73A 1ZCZA 2YZ7A 1TECE 1J2YA 4QGBA 3ZHCA 1V11B 1L4MA 3QJYA 1QM5A 1FUYB 4V1CA 2F64A 2R8ZA 4UJ3A 3P2IA 4US2R 4PFJA 4V0SA 5ILOA 3F7MA 2C61A 1KXZA 1G5TA 1PTJC 1PZHA 1JBEA 2ID7A 2J7PD 2X2PA 3BF8A 4HY3A 1DC8A 3LYLA 1Y8QB 4Y2GA 4D42A 4ZCQA 4WRRA 1O9GA 2J48A 3RLFA 1SVOA 1PYDA 2XHZA 2HSJA 3D0QA 3G2QA 3OZXA 2DMRA 2G8LA 1JIJA 1POXA 2JJYA 2PT7A 2REOA 3D8NA 1WXQA 3D3EA 4EGQA 1I9GA 2SICE 3K1AB 4LYDA 3IOMA 1VLJA 3HGQA 1SZJG 1F4LA 2H65A 2Z6UA 2D13A 2PGXA 4OLHA 1DTEA 1IYZA 1D6NA 3GY0A 3LLSA 2BEUA 3OX3A 5J5VA 5ARBA 5CUQA 2WJVA 2O23A 4S35A 4TS4A 1GZ5A 1T8RA 5HIAA 2R86A 4NJEA 1OX5A 1EE9A 4ODIA 4B3CA 5BWMA 5L9AA 1IE3A 1X7ZA 1L7PA 1Z9BA 3KL2A 4NTZA 4ZOEA 3PQEA 1H2RS 1B6GA 1QHIA 5AXCA 1O97C 4A7PA 3L7BA 2BDEA 3SR4A 1Z4JA 3B38A 2UYOA 3CPEA 4XWWA 1QB8A 2FQXA 2ZE7A 1PFWA 2CUNA 4XD7A 3TNJA 1MFPA 4XM2A 1Y8RB 4LJ4A 1V9SA 1Z5OA 1V4BA 3IDOA 2C7VA 2I7XA 1H2ZA 2BTQB 4O1IA 4EUFA 1QR2A 1G18A 1GTSA 5FXMA 4D96A 4WZAA 1FJGB 4TS9A 4D46A 4Z0PA 1H3FA 1ZC4A 2PQMA 2Q3FA 2G6TA 1UMBA 3G59A 3H04A 3NIFB 4ND1A 4UD6A 4Y9TA 5FPYA 1I6LA 5TGZA 2BM0A 2YMPA 1SUCA 4QODA 3SHFA 5HIJA 3SZ3A 2ORIA 3LPAA 2CDNA 3M49A 4N0PA 4YIHA 3KVVA 2O8CB 1TLFA 6REQA 4D5EA 2FPIB 1O97D 1XUOA 2ZREA 4RZXA 4ANFA 4NC9A 4D44A 3AF4A 3EXHA 2EGGA 5KCMA 2Y1WA 2Z8ZA 3SM3A 5JAOA 1R8QA 3FPEA 4FCCA 3DDCA 1CUJA 2JLYA 2ID9A 4ZZ1A 3HRIA 4PNPA 2A9JA 3NM6B 5KB3A 1PN3A 4D4HA 1PU2A 2W6IA 2AC2A 4JVLA 3B3AA 5EZYB 3FTNA 3WGLA 1SA0A 1JILA 1IUKA 2HUNA 4L76A 1T2NA 4JX9A 3UWPA 1LD3A 4HB0A 2OAQ1 3ZHSA 3QPCA 5ENVA 3DJYA 1RFGE 3WZLA 3G1TA 3ZVMA 3IKMB 1J8VA 4B3IA 3EDYA 3VKVA 2JL1A 1SCUA 4NOLA 5FUYA 4I14A 3X2SA 1NUSA 2HBRA 1R6AA 3FNRA 1FUIA 2GHRA 4XVCA 5CITA 10MHA 4JGGA 4AG5A 4MVXA 3DZIA 1AO0A 1X7YA 2WTUA 1ML4A 4H1TA 3FLBA 5HKOA 2WA1A 3BBPA 1RPNA 4HGYA 3OT1A 5HK8A 1L4YA 1F8GA 2ZSEA 3EFOB 4YCSA 5CXUA 3I9FA 1GFZA 4Q9LA 3A1UA 3EZ9A 4QYIB 3TNDA 1IHDA 3DS8A 3GJ8A 4QBFA 2QY6A 3LUFA 4R5HA 4RQUA 4HVCA 1GGVA 1VHLA 2IYLD 1J8FA 2PNJA 4OM8A 4IOLA 1R5JA 2QM7A 3BWDD 1CIVA 3I8SA 4FZ3A 2GKGA 1O1YA 2GN8A 4YY3B 1EHYA 2IVFA 3BXXA 4C06A 4CV0A 3ENVA 4DUPA 4CEJB 1F9AA 2O05A 2WWGA 2B21A 2PJUA 3R4VA 4L0MA 4MJXA 4KSCA 3WHPA 3HCRA 4LC0A 4AKTA 4KUEA 2CL6X 1HFKA 3QTBA 3DVSX 2WHPA 5I4BA 2POCA 1ZZGA 2HK6A 3K1ZA 4DGQA 1F0YA 3ZE6A 2YIJA 1QOQB 3PNVA 5DLQC 5E3JA 3VR5D 3AF3A 4DY4A 1KR2A 1R8JA 2EOAA 4P3PA 2P77A 5EQFA 3EAFA 1GM5A 1IMJA 2C5HA 3CR7A 3FHCB 4BEVA 1FLNA 1UXJA 1ZH6A 5BSEA 1TPYA 4MCAA 5CEFA 3O6VA 5DXAA 4PONA 4Y2RA 2H1HA 5DHSA 1XZIA 4GXNA 2DTEA 2GCOB 4M1QA 3OZBA 4RHXA 5FV7A 1VHQA 1EG7A 3L84A 1ZMTA 3MWDA 4I9FA 4JLVA 4PN3A 4TM7A 4YCNA 1GYPA 4YP5A 3NT4A 3HYSA 4X62B 3RYFA 4UE6A 1A2QA 1NU6A 1P9LA 4GECA 4B47A 2K2QB 3LX8A 2H7XA 2GJKA 2IPOA 1FP1D 4HFRA 2V4UA 3L4BC 4UNQA 3DEHA 2EGHA 2XA2A 3LWBA 4LYJA 4DZTA 3ZJVA 1UQUA 4G8CA 5H3CA 1SQ6A 4ISBA 3HL0A 4PU0A 4IG4A 5K0BA 3A6GA 4MKFA 5BMVB 4KPYA 2CF5A 4HYTA 1E5LA 1LS1A 3HPQA 3EXAA 3TDNA 4AG3A 3W5AA 4ZEXA 1HTBA 3LX4A 2A57A 2RKOA 1LS6A 1FSPA 1CP3A 5JVDA 3KHSA 2IELA 4MDEA 1Q1AA 3FCAA 4UNSA 3BMQB 3SJBA 1GFIA 5IAKA 5IKMA 1KORA 3ZCXA 4RVUA 4ND2A 3CF6R 3F74A 2QTWB 3PXEA 1EH5A 1WZCA 5FJIA 4QSMA 3ETLA 5JRDS 3I61A 4OTZA 2WNSA 2KS6A 1RTTA 2B1RA 3K4QA 4YQZA 4POOA 2YYYA 1V95A 3PQ4A 4YYZA 4UM7A 4JBHA 4RK0A 4U3JB 2MHCA 3A3YA 5ALDA 3LHDA 3S0JA 3VHXA 3IILA 3J81A 1RP7A 3G2KA 4MINA 3RIGA 1GGNA 2KHZA 1PL0A 2XF8A 2ZSDA 1M33A 3GZNA 4PLTA 1IJFA 1VBKA 4Y6LA 5EMMA 4EHBA 3H9EO 3VH1A 4RQAA 2H1OA 3G0HA 1UUFA 5EHXA 2ZRMA 2BFBB 5AVXA 1EEHA 3R3VA 3L8CA 3UT6A 1ORIA 3IPYA 4QOSA 5KYGA 2F9MA 3V7WA 1KNQA 1N6KA 2RBEA 5TPZA 3FW1A 5JT1A 5LOVF 1GSIA 1MDFA 1TYEB 3N1UA 1XPRA 1MZVA 2HDHA 2QUBA 3PC8A 4YB8A 2F90A 2ZB4A 1V6CA 4UU1A 1LF5A 4LRTB 3EZ6A 2HA5A 4KH1A 3O03A 4UEQA 4G0QA 1OH6A 3RYIB 3RYIA 1OYOA 1MIOB 5DHUA 5KWVA 3BFVA 3QP9A 1JYEA 4EY6A 4EY7A 3LVFO 3OQBA 5AUPB 4G0OA 3Q7IA 1HL3A 2PRJA 3NWBA 4JLDA 3HZZA 1JEQA 1DKMA 1X1SA 1GQ2A 1FDIA 2XVMA 4MI6A 1C7JA 4XGRA 5FNZA 2JFYA 3ROEA 4F9GA 1JDPA 1GL7A 1NOJA 2MIIA 3FMFA 3ND9A 3QITA 3CVUA 3FTCA 5BR7A 1PQUA 1U3TA 2ORYA 3P96A 4YJFA 4H77A 5B2ZA 1PBNA 4DYVA 1DBVO 1V48A 2Y1EA 3F49S 3JW8A 4HQFA 5FTLA 2W2KA 2I8CA 1ZY2A 2X6QA 2X7XA 3RYCB 2P6OA 2ETXA 4G0XA 4S1PA 3AVWA 3MJFA 4W4TA 1ZEMA 2L69A 1P0PA 4G9GA 4KDFA 2QWXA 4YRQA 3GRYA 2XVYA 3JYHA 4OA5A 4P0TA 4FNGA 5TC4A 1C3OA 1US8A 5TEWA 5ER6A 3PYXA 3ZCTA 2IZ7A 2O2CA 4C2UA 4FYMA 5DM1A 1VJ1A 1ZUNB 3DGEC 3ABIA 4HB3A 3PQ5A 2BJWA 3QOYA 2GF0A 4RC9A 2WU3A 1T0PA 4OP1A 4ZAGA 1KI7A 1MAVA 2WSIA 3P2MA 5FEUA 1OAOA 2XODA 1NQOA 3QA3E 3CLSD 4L74A 4YRRA 2YS7A 4JUFA 3W5SA 2CXTA 2WHYA 4RVCA 1E61A 1WCWA 2QL9A 2XYVA 3AR2A 1V9CA 3AP1A 1MQ8B 4Q00A 2XCIA 3QEMB 4Z9XA 4PM4A 1R5NA 2GVDC 1J97A 3KV3O 3E2IA 4Q02A 1Z6TA 2CF6A 4ITUA 3IAHA 4DADA 3C5CA 1R0SA 2JZCA 4I1VA 3X1YA 1LI4A 2B8NA 4MS1A 4RM3A 3UOGA 4W7HA 1TM4E 1Y4AE 4BX9A 3HA5A 2P35A 2FH5B 4G4GA 4YBZA 1N3BA 1V6AA 2F3TA 3E8XA 3BH7A 4H2DA 4MWSA 3V8NA 2PX6A 1PKEA 3MUOA 3SM9A 4CMIB 4E1AA 5EE1A 1KMHB 4E1BA 2QAGC 4K40A 4K03A 2OAGA 4DLNA 1FX1A 4KG7A 3I5MA 3LHIA 4MWEA 1YHNA 3P4UA 3ZW9A 3FAZA 2XMDA 3TQRA 3W0LB 3EULA 2YOGA 1XF9A 2XMSA 1U65A 5JO0A 2X0IA 3GVPA 4MGKR 1RBQA 3R3YA 3R0JA 1BYUA 1KBZA 2ZI3A 4I6GA 4J0QA 7ABPA 4HNHA 4ZJZA 2DF8A 5IM4F 2DPLA 2ENUA 1GUAA 1W85B 2DHEA 5FTJA 1LTHR 3G8YA 1FC0A 4X6UA 2GLTA 1LZKA 4ZVKA 4UFOA 1L1FA 5D3QA 1RQLA 3OQOA 5LFAA 1P5JA 1M8FA 3TOXA 1W2GA 1YT5A 3L6DA 1HMYA 1F4PA 1D09A 2QN2A 4HEA1 5EIBC 5HUQA 2XDYA 1NRXA 3URMA 5DM70 1HETA 4TYNA 4GOND 2FWAA 1M1XB 3D31A 2ZBPA 5HRCA 1QGED 3EEFA 1EBBA 3SU8A 3ORFA 3HO8A 1CZKA 4QBHA 1PEAA 2FZEA 4MKXA 5IC4A 4I2VA 5BV0A 3OJLA 2IZ0A 4MIOA 2P0AA 4QDXA 4X7PA 4TS1A 1XU7A 1IJKA 2NSHA 2P8SA 3OCCA 4NZNA 3ZU3A 4UM8B 1C7QA 3ADOA 2W6OA 4KGXA 1XO1A 2E7ZA 4O4LB 2XQVA 4AJ1A 1QHSA 4EFNA 1YZGA 3RFUA 5IVHA 4HC4A 3PQCA 2NO7A 3GT0A 3EZXA 2HA4A 2BI7A 4IUBS 1P7CA 3PQ2A 3FYDA 5CB4A 3FOFC 5J4HA 1SIWA 3GRUA 2CBGA 3D3WA 3NORA 4QVKA 4PY2A 4TTJA 1HDYA 1QYXA 1XDSA 1UDCA 3IRVA 4G23A 3TFQA 3PFFA 3BCHA 2WKSA 1YDGA 2AFIE 2EZ9A 1FPMA 1V8OA 3D7KA 5ECWA 3R7AA 3EMBA 3U60B 5EHZA 3RHFA 4MP6A 1W5FA 3Q0EA 1RKXA 1GP2A 3GJ4A 3IQIX 1M6HA 3JASA 1S89A 3RI3A 5DFAA 3SXUA 3DFKA 3UUWA 4YMIA 2ZDGA 4NF2A 3O75A 3VAAA 3NWPA 4B3BA 4EECA 4FFVA 4IBOA 1GU1A 3A7EA 4Y9UA 5K3EA 2WM9B 2UZ0A 4IWYA 2EG9A 1CU1A 1TUIA 5E2IA 1NVBA 3AEYA 3JWHA 1NI5A 1N2ZA 3RFXA 5IG2A 4U2DA 1H2XA 4ARSA 1FMCA 1XIVA 3QE4A 1TC2A 1T10A 3GEEA 2WU1A 5ALJA 3U40A 1GZUA 2FG5A 1J8YF 2Q2NA 4N12A 4ZVQA 2XNKA 1Q0TA 1S0UA 1DAIA 3FUVA 1QORA 3MYYA 2HH9A 1E69A 3N39C 1XXHB 2C94A 3DULA 4LNHA 4RH0A 1NASA 1WPXA 2ACKA 2B0CA 2YC4C 2NO9A 2OCPA 3CZRA 3AX6A 3L6BA 4L4UA 3RC1A 1GCIA 2QAGB 3WYEA 1BMTA 1CY6A 1OTHA 3D1VA 4I4TF 4DAEA 4DJAA 1JEQB 1ZFNA 1K6JA 4LVNA 2ZQYA 1JEJA 1U80A 1Q15A 1NN3A 3SPXA 3UA3A 2ZBDA 1V1JA 1Y8RA 4PC3A 3TTTA 4B3DA 4DABA 1NV9A 1XVUA 1GL6A 2FX5A 3UGQA 3W3AD 1SXPA 5BWLA 3KB2A 1T5IA 3JTMA 4JCCA 4E2FA 2BRUC 3WG9A 2PT5A 2BHNA 3BIJA 3K92A 4IQGA 4OMDA 3HDYA 4FXPA 3EGDA 2HK8A 1UPXA 4TV8A 3V1TC 4BNJA 4YRZA 1QH0A 4YFVA 1D1SA 2QN9A 2GZ2A 3AIOA 4WFJA 4WWHA 1KK1A 1YI8A 1N2CB 4WZZA 4PZPA 3THWB 2JGDB 3PPVA 2OKCA 4HZGA 1R9GA 2QX8A 1KMQA 3GGSA 1SU8A 2NSDA 1ZJ4A 1R4NB 3LSTA 4WCDA 4M4SA 3GRVA 5GY7A 1IEXA 4FYVA 1VL6A 4KL8S 3P71T 1X7WB 3U3XA 2GM5A 3HXQA 1FFBA 1EX1A 1FQWA 2R96A 4MIKA 1UBOS 1I32A 3AU9A 1VE7A 5LA6A 3VR2A 1MOZA 2JATA 3EE6A 2ZYDA 1PLLA 4L8FA 3TW8A 3G68A 4ML3A 1Q12A 2C88A 3BTOA 3M4NA 2HRBA 2JJ8A 2A7QA 2K6GA 4HL6A 3ZWBA 4BAUA 4XQ9A 3DB2A 1IBCA 3D59A 5AKIA 1ODIA 3NEAA 5JAMA 2B1GA 3H84A 3WRXA 3B9PA 2ZRBA 5HKLA 1WMDA 3EPPA 2ANBA 3ZDEA 3N70A 1IAQA 2QE7D 3P9QA 3LT2A 4B4UA 1PR2A 1V2HE 3KFLA 5E2AA 1P44A 2G40A 2VSNA 3FNFA 4RWEA 2AK3A 1Z4MA 2POQX 3D7RA 2FDCA 2A92A 1SUIA 3VVLA 1YAJA 3QX7A 1ESZA 3DAYA 4EI7A 1Z36A 4HXFB 4TXMA 1DKUA 1M83A 1ORHA 2NWQA 3NBQA 1QQ6A 2OOKA 3I2FA 1NM5A 3ESBA 5A4FS 2MSKA 3MB8A 4S1VA 1B76A 3W1WA 4DJJA 2QYSA 4UHKA 2C29D 4PQEA 4B82A 2FMXA 2QYHA 4QXRA 1A8QA 2GNAA 3QTTA 3MWDB 2HFJA 4MVCA 2GETA 3DDUA 1QZXA 1HSZA 2G9UA 2VP2A 3IDQA 4HQRA 4UU7A 2ZWVA 1XQXA 4OEHA 4D0RA 2H1RA 4HXYA 4CKEB 3IBFA 4OBXA 2E49A 2M2IA 2NXNA 1UP6A 1M66A 5AM4A 4RULA 4OA8A 2SKEA 1YE5A 4ZHQF 1L5NA 3JRXA 4FOPA 5MN6A 3ZIUA 3O5AA 1M6EX 1ECJA 3ESYA 2QJOA 4P8RA 3T06B 3QVUA 4BQNA 1ZM9A 1HM5A 1HLFA 3PS9A 2PGJA 3HFGA 4D5GA 5JD4A 1VFPA 2KX7A 1L3IA 5F77A 4DNQA 4DILA 2FWIA 2VK8A 1EB9A 2VPQA 3HKCB 4UBKA 5ADVA 4IO0A 1R4MB 1CDEA 2WJAA 2WJIA 1CB7A 4NRDA 5DBHX 1E66A 1K7EB 5D84A 3Q2OA 4ER6A 2J32A 2Z43A 4UM9B 3MS7A 3TK1A 3U37A 3IAEA 3OKFA 1CJTC 1UL1X 4I2NA 4OMCA 1UK9A 3OHMA 1NI4A 1F7UA 3H9JA 4CT5A 4CKZA 4F6RB 3BT7A 1VGQA 3AEQB 3G0IA 2GN0A 3TXYA 1OB5A 4OVKA 4ZDIA 1ZBQA 2A1UA 1ZH2A 1VL2A 2D3WA 2HAEA 1IUPA 1PR6A 1JR3A 1TAQA 1U2GA 2JW5A 2RGDA 3N0XA 2NO6A 2D1YA 3KETA 3HE3A 5JADA 3ZXIA 5CK4A 4EG6A 1E5DA 3N2KA 1TMGE 1A8IA 3LS2A 2NSYA 1DCKA 1Q77A 1B41A 1VG8A 2CJPA 3LPMA 5BQOA 3WICA 3QUCA 3W7AA 1E1LA 2OHXA 2O14A 2UYQA 4K46A 5CT5A 2GK3A 1JG1A 2D74A 3QYFA 2IEYA 3LVQE 5C5CA 3CC8A 4YDRA 2OV2A 2GARA 3PGMA 3MW8A 4RDIA 1ATZA 3EBLA 3EFOA 3HUTA 4C5AA 1GSOA 4D98A 4FBLA 2HI0A 2B5VA 3OTWA 4N5IX 4WW0A 5KHLB 2ZR9A 4YAFA 2E85A 3OD1A 4QQNA 1PZFA 1USGA 1IZ7A 4NCNA 2WWVD 1ENOA 5FA8A 1L5FA 1TTTA 2FQWA 4AJLA 5CYPA 2M1ZA 3C3EA 3N8GA 5KOJB 5JWRA 3GJ6A 4OAPA 2FR8A 4NL4H 3ZNPA 5J2UA 3IUPA 2ZAGA 3I8OA 4HAUA 4DQDA 1FFYA 3JQ7A 3GUHA 3UW3A 3R9KA 2H4YA 5FIUA 1TLTA 4QTYA 5BYAA 4ITRC 4BIMA 4EM6A 4X41A 1P2SA 4FOSA 5JJCA 1K88A 1T5DX 1AQYA 1H8HA 3HYNA 2P7IA 3OECA 3PDUA 4YECA 2IWHA 3S44A 4AAYA 3WFIA 4PBTA 2OEPA 3QXJA 4EZIA 1KO5A 3RASA 3U7FB 1JLHA 3TLAA 4M22A 1APBA 5B3JC 2B94A 1XTPA 1GRVA 4GM4A 3I32A 2WD9A 1SBTA 1UXKA 4ZHQA 5TQJA 4S1NA 4F5ZA 1NLFA 1ULAA 3ECSA 4U7TB 5KYKA 2H1SA 2NW6A 3PEVA 1YQ9A 1OFUA 4AMYA 3KOXA 3P27A 5A03A 4MR9B 4WXEA 3VVCA 4G24A 5LBIA 1W5AA 4R69A 1YQWA 4RMHA 2HWKA 4W8GA 2WM8A 1BFKA 2N47A 4WLUA 1JPVA 1UINA 4WI1A 4QD3A 5DHPA 3VTFA 1FYVA 1LZLA 4C87A 3V7FA 5KX5A 4U39A 5ALHA 2R87A 5EVCA 3DDHA 5FNVA 3IE1A 4P58A 3P2OA 3AI7A 5BUCA 3EOAI 1G55A 4N5DA 1SCAA 1Y1RA 1JNXX 4UQOA 1JV2B 2R7NA 3GJZA 2Q8NA 4BVKA 4ZYWA 2PQ2A 3BQNB 4M37A 2QTVA 1EG2A 1G9XA 1U2RA 4FBMA 3N2EA 4RHEA 4ARZB 4EGSA 3C8MA 5HDQA 1W47A 4EYQA 1CY2A 1EVQA 4GBED 2I3DA 3V1MA 2F17A 3OCUA 5DPMA 3PICA 3R9WA 1T5OA 4LF9B 2CXOA 1XC7A 2V98A 2WU4A 3AKCA 1CUCA 4CMKA 4JJFA 4ZWNA 3REFA 2PPVA 2Y1KA 3MQFA 4J9UE 3CIOA 2NM0A 2OAP1 1R10A 3KO8A 5J59A 1ZC3A 1R64A 5D2CA 1TNDA 2WZDA 2NZUG 4YV0A 3FMGA 2IEAA 1NBOA 5D51S 3RSQA 3W6PA 2YZMA 1KZ1A 2H9YA 1T43A 2ODAA 4FD2A 4LBWA 5BWCA 1HE2A 3WXBA 4BLVA 3KKQA 3WYGA 5F5XA 4H27A 1JBQA 1PJ8A 2Q5CA 1OOEA 4WBNA 1J56A 3D3KA 3OCXA 3T41A 4CM4B 1W6RA 3BB1A 1X7ZB 1WW3A 2AIRA 1PD0A 3GT4A 3MWFA 1XNQB 1C29B 3W4KA 1T1EA 1DBQA 2AI2A 4HDMA 5ANRB 1A98A 1U1IA 2AMLA 1LBHA 2BZSA 4ILEA 4PLZA 3RUAA 3S99A 4F8YA 5IH7A 1UKCA 1GQOA 1YDHA 3GVHA 3AVTA 4AY4A 5LP6C 4XQEA 1FSZA 3QOXA 1I4OA 2IYFA 1H2AS 2FRXA 1CJKC 3F2VA 3PYMA 4LQ4A 4OHWA 5FTKA 5T6MA 4YLGA 1VKJA 5GOZA 4F84A 2XB6A 2P9YA 3H3FA 3LQKA 3SC2A 3SHOA 3KQUA 2G36A 1M5TA 4MVJM 3PBKA 3S2IA 2PL5A 4PO3X 5E38A 2FRDC 2WC1A 4ZALA 1WD5A 3LDGA 3RVSA 2AEMA 3NAZA 2QT0A 3H1FA 3SQLA 5FV4A 1C7FA 5AUOB 2PZAA 1C3LA 1V7QA 5J4YA 4P4UA 1J24A 2X4GA 5JS6A 1UEXC 1WZNA 2EZUA 2OV3A 2JCXA 2YC2C 3L41A 3ZWDA 5CA0F 3E82A 1NBAA 5H9VA 3ZBTA 5DTQA 4N48A 3K72B 4QPZA 1C81A 2DBZA 1ZXBA 1TU0A 4K0KB 4RTSA 1JIQA 4PCAA 2IUFA 3O82A 3OLWA 2GJAA 1T4MA 1B26A 1RQ2A 5TLSA 3IL2A 2NGRA 1RWNA 1EHCA 3B7PA 3WB0A 1GGFA 4WEQA 1KWKA 3IERA 3VPBA 4H9GA 2IUTA 3AW8A 2YW9A 3VR3D 2Y4OA 4EHLA 4IMIB 5CX1B 2LVBA 2NQ8A 2EYUA 2BM1A 1Q16A 2D06A 4Q4HA 3W77A 2ZE6A 2RH5A 3CSUA 2FPMA 3P9RA 5IXYA 1OXTA 1XKLA 1RJGA 2IYVA 1WEHA 3ACDA 3IIJA 3PFGA 3OQPA 5AJHA 4D8VA 2O8BA 4OLBA 1NW9B 4UOZA 3E9QA 4FK8A 2O0MA 1G20B 4ZCTA 3UFXA 1E9SA 3A6FA 1AN9A 2PZMA 3QPWA 4J7CA 3TL2A 4F4FA 3ESXA 3O92A 1Z2DA 1J0XO 1WCV1 2HF9A 1KY5A 4H7HA 4QECA 2Z30A 4WXPA 4QDJA 3UCXA 4KACA 2OORA 5KQSA 1CT9A 2XGSA 3F78A 1LJUA 3IR6A 1F20A 4HR7A 2AJCA 3SHTA 4C2AA 5BVHA 5HUJA 2IS2A 1REQA 3N2LA 2XEDA 5HOEA 5HRAA 4D82A 1FYDA 2XA9A 1DAMA 3QYAA 1EP2B 1C8VB 1GEGA 1WB4A 2C3YA 5AOVA 1EUZA 4EO7A 3K6SB 2GWRA 2PGNA 3FVWA 3VJRA 1QOPB 1KEEA 3ZDDA 1W5SA 1TC1A 1KEVA 1B3BA 3UNXA 5K2OA 4YJKA 2X2FA 1PFUA 3WQSB 5H8WA 3IP1A 1GR0A 2AHOA 4TRRA 3JCZA 2QTGA 2HX1A 2XCTB 4GLJA 4NWIA 3KB8A 1JG7A 2H4HA 4HO1X 2QRNA 1NXWA 1QZZA 3A36A 4R6WA 1F3OA 4I6EA 4WAUA 4YJDA 4EHHA 5KBYA 1SVKA 2JIDA 1X0XA 3QE3A 3S1SA 5AO9A 3WNVA 5A5VA 3BIXA 4XAQA 4ZKEA 3KOZA 4WESA 1ZN9A 2JGDA 4JIGA 3G5AA 3W5BA 4QRHA 4M1OA 4KRYA 1EQUA 1RM3A 5CA0A 3IO5A 1Q1GA 4TT3D 4A8JB 2B98A 2NU9A 3ZV3A 3KKKA 4KYUA 2I99A 2ZIVB 4MEJA 2OLJA 5A06A 1ACJA 5JEEA 3VJKA 4MRRA 2EFCB 2ZZMA 4DSAA 1QKIA 3DVRX 2VJPA 4N03A 4RDCA 2R8YA 3Q6MA 3HJCA 2IEIA 2NYRA 4E5DA 3HUDA 1HE3A 5TRTA 4XARA 4E5UA 3E9NA 2DGDA 1QVVA 4ALKA 4Z0HO 5DB4A 5ALGA 5JASA 4R1UA 5HQJA 3TE6A 1RRVA 5BNZA 1NQTA 4Z53A 1G41A 3MBOA 1Y48E 3FBTA 8ADHA 5JD6A 2E1RA 3P1JA 5FBRB 2PYDA 3KPUA 1N2CA 4F6LA 4TL7A 4MJLA 1JTEA 4J2OA 4NR0A 4X6LA 3N8HA 1EX7A 4RCYA 3MELA 1B43A 5J4LA 3EGXB 2DT8A 3U3DA 1QF6A 2JH3A 3NUGA 1XVIA 1YCGA 1IJEA 2IYPA 2G4LA 4F2DA 2N3ZA 5T3YA 1XZKA 4QSHA 5BPHA 2XLCA 3U26A 1NQ5A 3DKPA 4B4KA 1RXWA 3DOFA 2AN4A 5F3RA 4QT4A 1A9YA 1DEHA 1XQWA 2IPNA 2VA9A 1SMKA 2MWMA 3BX1A 1I5OA 3IO3A 3MFYA 3Q4GA 3PFHA 3EEIA 4G8DA 3RYHA 3QVGB 4BZWA 3FBWA 3NKFA 1JQLB 2YWCA 1PJ3A 3N7UA 3IP6A 3RS5A 2OCAA 4G97A 5EIOA 4IP0A 1KIMA 5KZMB 3SICE 2IS4A 1JN0A 1S3FA 5GMOA 3MJRA 1VG9B 2AYZA 2V7VA 3RFFA 3RT7A 1YUBA 3UMMA 3NX4A 4FSXA 1QC5A 4PYJA 4EYKA 1O03A 1KJZA 2Q4OA 4KQEA 2Z1MA 5CB4B 1K8ZB 3ETEA 2QV0A 2LKDA 4PG7A 4XM1A 4LJLA 4KXMA 4UD2A 4QJIA 2SBTA 1CUFA 4OXNA 1IM8A 3GVIA 4C0HA 1K5DA 2OCBA 3BZWA 1L4BA 1URPA 2R65A 3CE6A 4CKCA 3ETDA 1SY7A 1A95A 4X3PA 4AVYA 4JOQA 4O8ZA 2IWRA 5FL3A 4KQ1A 1T1IA 2WYWA 4PG5A 4PZEA 2R4TA 3D2BA 2Q0XA 4CBVA 5BSMA 5HQTA 2VYCA 4RD6A 1KYTA 3WK6A 3ZXSA 4LQLA 4OF4A 4DG9A 3AILA 3NTXA 4XIJA 3VBCA 2IXTA 2QAGA 2OESA 4MS3A 3AHCA 4ZAVA 4N0DA 2VZEA 3VDQA 5AIAA 1U5BA 4QGHA 3FMVA 1H0RA 1X3SA 4GOMD 4NV1A 3PX7A 2WB2A 4YMLA 1VDZA 1I94B 1QG4A 4I3FA 5ITVA 4MWTA 3KVOA 5LQCA 3ADKA 3HU2A 1G0OA 1K86A 1YZUA 2HTFA 3ADPA 4LRXA 3EGDB 2HEIA 5IBRA 4BB9A 1FSFA 1J2EA 1XTZA 1FJHA 2J7KA 1MX3A 1E9VA 2L17A 2QJRA 4G85A 4MLDA 2C0PA 2BELA 1SUFA 3KJNA 1DV1A 3I9V1 3KTFA 2ZE8A 2ZVJA 4AZWA 2GUWA 4NX2A 4OFXA 3GX1A 4DFDA 1E58A 1MABB 2HOQA 2ODPA 2H7CA 2Z2ZA 4LNAA 4DNPA 4BGEA 5KSYA 3IAS6 2QT1A 2PFGA 2CB0A 3C3KA 2G04A 2O2HA 1DC4A 1SUWA 1KBQA 1R0CA 2QZPA 3AHGA 5I6DA 1WXFA 1RLTA 2RI1A 1XWWA 3FDZA 4WY5A 4N1AA 2OXEA 5LD2C 2ZVDA 3KEQA 5AUNB 2JHCA 4TQAA 1I51A 4FIZA 2YASA 3DMPA 1IWPB 3QE0A 2CJFA 3GGGA 2LCQA 2CK3A 4TMFA 1TU4A 5CVCA 2Y9PB 3UAVA 3RDPA 2PN1A 3D9QX 4OG2A 1HURA 4XASA 2MR5A 1U6IA 3TZKA 3ZX4A 1Z75A 3LDAA 3V46A 1NTRA 3B2EA 3THXA 3RLIA 4ICIA 1CVRA 1DKQA 1OJLA 2D2FA 4MW4A 4C76A 5GADl 1B8VA 1DOAA 1EQAA 2ODQA 5CLFA 3DXFA 2VI5A 4JUDX 5FF9A 5HF8A 3CEPB 5DNYB 1TA9A 5DZSA 2XUIA 5A3RA 3RBAA 1OROA 2YQ5A 1RDFA 1O95D 1R3UA 1IK4A 4YJHB 3CF4G 2FW1A 4DC9A 4HNQA 1G21A 2C9BA 4EJ6A 1UKAA 5LLSA 1BMFD 1M1NA 2CY0A 3R0IA 4R9VA 3SDBA 1MH1A 2ISQA 3WHKA 1WVIA 4B5LA 2E48A 2CNDA 3PIRA 1CY4A 4UTPA 2ZRQA 4TMKA 1ISJA 3PDWA 4Z1OA 2HQ1A 2IU3A 3ASYA 4HDRB 1GITA 1U8EA 3TW6A 2QG9A 2QN3A 2HIGA 4OFZA 3TPZA 1GPMA 3GRAA 5I9TA 1QP7A 4F2HA 1Q7GA 3W1VA 2G17A 4P4NA 1Z15A 1U3UA 4ZRDA 4W5QA 4ETMA 2ALJA 2WHRA 3NKVA 4A2WA 3NAMA 3IQEA 2RG7A 4LJRA 4ND6A 3T5BA 5K3OA 1W581 3CNBA 3NOOA 5DJ5A 5DSXA 3KBOA 4OHRA 1RZRD 2EL7A 5IEJA 4EY3A 3EIHA 4EUKA 4ZC8A 4DLSA 4XGKA 1A50B 2D54A 2IYTA 1MG0A 1V2GA 1G8KA 3A28A 4LFBB 1E1NA 5E9QA 1NW7A 3IUJA 4JHLA 1ATIA 3TLKA 4C0KA 2O8DA 1CRLA 3S27A 4ATNA 4P4SA 5FKJA 1Q2UA 4MIYA 2FWNA 1FPQA 4PSUA 3DMTA 3ETHA 3KYDB 4MQMA 3SQNA 3QEAZ 4MR8A 2P65A 2PUFA 5BR4A 5AVJA 1XTKA 2DKNA 3G82C 2QRQA 1YDWA 2D4HA 3CO5A 4JWKA 1D2RA 2B30A 2CEAA 3DM9B 1G7SA 2Y93A 3E8SA 3BMOB 3A4TA 4LWQA 3PNKA 1KJIA 4RD3A 5H5JA 3W2GA 5JXHA 4NFSA 2VXCA 3T5AA 2BRUA 2W7TA 4Q4CA 2WLSA 1JFLA 5BSFA 1P29A 3BMNA 4HLUA 2WFZA 2ZR7A 3OPXA 1UJCA 3IURA 1JW9B 3SIPA 3ZY6A 3A1TA 3EDOA 2OY0A 4P5DA 2AV6A 4LZPA 1ZJYA 1LTKA 4J94A 2C7GA 4F93B 2D2XA 5HXAA 2WUDA 4A5SA 1AZTA 3GDGA 1IZ9A 3DUFA 3O4FA 4LNUB 5HW0A 2IYAA 4EI8A 2P9ZA 1GSAA 4OK3A 3OWXA 3RVBA 5K3AA 4ZCPA 4FMBB 3KAKA 2R751 1BJTA 4DWJA 1K0UA 3OZIA 1RQNA 2PBLA 2Q9BA 2DG2A 2QNBA 5A4DA 2Y1FA 4G2TA 4R31A 4BUZA 3PDHA 2ZT7A 7MDHA 2ZOSA 5DX8A 5KQPA 2FN8A 4HWTA 3EVGA 1T15A 2JF0A 4IR7A 4LYEA 1K98A 4P3OA 1CZUA 3OKCA 5IFKA 4XWGA 5DNCA 5ECDA 4XYLA 2YHIA 1Q7RA 3V34A 2AX4A 3F6CA 3PYLA 1SKYE 3QWFA 2FEOA 1BQ4A 1AX9A 5KAPA 4MQEA 2ORED 5EKXA 3TAXA 3K70D 5B7GA 1Y82A 4PE5B 3VZQA 1XMJA 3WV4A 4ARUA 3ZU6A 4B73A 4F91B 5HM8A 2QUHA 3GEPA 3JAKB 3LP5A 2CZGA 3A1EA 3RUHA 1J7JA 3TSYA 1G8GA 3T4XA 1XE3A 2CW5A 1ANKA 5DMXA 5IDYA 1NC3A 5D3MA 4KXYA 4K9SA 3N8KA 4IUYA 2VH2A 2DY0A 2FLVA 4N5MA 4GDFA 2VVTA 3UGTA 2W83A 4GVXA 5FL7A 4DBLE 4MKHA 4G86A 5K0SA 2Y1DA 1CNFA 3DKRA 3G13A 1J5XA 4LXGA 4A2PA 3IH5A 4JEIA 1R2QA 3RR2A 3RK0A 2A5YB 3JQBC 3UKOA 4CMIA 3RV3A 4P08A 3R5TA 5T67A 3PD7A 2X1MA 1KJNA 2A59A 4YJHA 9GPBA 2BONA 3I2HA 3CX7A 3ANYB 3HY6A 2ZIWB 2X4LA 4WESB 1NF2A 3KJEA 4F92B 5LMZA 1XP5A 4QNRA 4D25A 5ULLA 5JZMA 1X86B 1KK3A 1QO0A 2NNLD 2UZ3A 1QBKC 2AOTA 5HBGA 1Z28A 5J1SB 3IQFA 5C7IO 4MV1A 4B09A 4CL8A 2G5GX 5LNK6 3ZH9B 4RV4A 2PKYX 1A8HA 4RABA 2CXHA 5JECA 2OM2A 4R9NA 3ZXUB 2A4KA 3HZHA 4F3KA 1DDOA 4WDQA 1PZGA 2HHHB 4EX6A 2VPTA 1W1UA 4QBTA 1YZKA 2KM1A 3IV9A 2ZJAA 5A5GA 1V5EA 1QK5A 1ICIA 1P1RA 3EVZA 5GTDA 5FB3A 2C4HA 4RK5A 4CIBA 3ONWA 1CIPA 4CXMA 3QE9Y 2RARA 2Z0MA 4Y1RB 5G0SA 5JATA 2D8MA 3B78A 2C9DA 2O57A 1OBVA 2VP4A 3CIFA 4BUJA 4PYIA 5CM2Z 1S2GA 1K8RA 1JQDA 3ITDA 3QKUA 4KXWA 4TVSA 4O2RA 3GWGA 5LQRA 2Z8YA 3I09A 5A3QA 3GCDA 5HIMA 2OBNA 3NYQA 1U63A 3ET5A 4YCLA 1ODLA 1JWLA 1N7IA 1KI6B 3LZ6A 4KMOA 1Y42X 5DASA 4TYWA 2ZI4A 4M8KA 1EM6A 2H1FA 1T5BA 2YICA 5D5HA 2IYOA 1O57A 3KUUA 4G01B 1KBOA 4BB0A 3KR1A 1VXOA 4Q4HB 4YPOA 4CL3A 3ZWKA 1I2CA 2AOUA 1TKCA 1K4YA 3R4CA 1NYQA 1MJGM 2P2GA 3EOZA 1UZMA 4IIFA 2G1UA 2EW8A 3SIWA 3VPHA 5B53A 2WF7A 2FPIA 3BDIA 3UJHA 3CLTD 2DR3A 1BX3A 4CG2A 3PLAE 4XD7D 3SSMA 3HBNA 5FWXA 3TCXB 1RRMA 4CTNA 4B0OA 3JY6A 4R2HA 5JZOA 4R2JA 1ZXLA 2B1QA 2B25A 3QFRA 3IVRA 5JNSA 3GUCA 1Z26A 4L0QA 5IC5A 4ROTA 4C89A 2MYUA 4Q39A 5CFNA 4NNJA 4TWZA 4B85A 1QHNA 1ZD9A 4HFJA 5AKXA 4P38A 3ZY4A 3NYIA 4PN7A 2BFWA 2O2EA 4CEJA 2OQ2A 4B6QA 3L07A 3KAJA 4LZJA 4R9UC 4IDCA 2WUFA 5A3JA 2ZJ6A 5EUMA 2ZAIA 4U3JA 1LBTA 2WD7A 4RFSA 5JSKA 1P5ZB 1N2EA 2ZUUA 1XHLA 3D0RA 3S1AB 4YJ2A 1E5TA 2EU8A 3IALA 2PX5A 4WLEA 4A8HA 4CM5A 3E27A 5B55A 4FYHA 4LXYA 1D1TA 3UMCA 2C92A 4U0KA 4U2CA 4MWZA 4WN3A 1SQ0A 1ZVQA 4TL6A 3F3SA 1E4YA 4ND8A 2Y3IA 3DDZX 3WB2A 2NV2B 1SC9A 1Q22A 3DBHB 1UBHS 2VKTA 3T5DA 4ER5A 3AFNA 3TKLA 1H1LA 2VHXA 1U98A 5DYIA 2HRRA 4B3SB 1QANA 2PQ6A 1YB5A 4PQRA 3ODPA 3KP1A 3U31A 3LCRA 4EW6A 3ESCA 4BAGA 3THOA 1YZQA 3KWLA 3QPVA 3JQRA 4MQLA 1JLSA 3N0VA 2PTGA 3U6KA 3K8QA 4MRAA 1ADFA 1Q1ZA 3JVEA 4A1OA 4PAGA 3HABA 1S6YA 1H66A 4AJ9A 3LPNA 4AMZA 4YUXA 2P69A 2ZBGA 4KSYA 3T54A 4E5NA 5A9RA 3ICEA 1LPSA 4ZO9A 4C6RA 4DDMA 4RKEA 3JAWA 1Y8QA 4RGVA 1PJTA 1Q7EA 3LCMA 4DBLC 3RROA 1HX7A 3HM2A 1W94A 2H0RA 3AKYA 4X61A 2C82A 4ETIA 2LDBA 4DA6A 3B2NA 2QEQA 4JJKA 4EYOA 1GPNA 1U2SA 3WKCA 4LDPA 1MAAA 1R5BA 1RLIA 3F5SA 5BORA 5A4JA 4GKBA 1E3IA 3EAGA 4YH1A 4M9CA 1M2KA 3ZXXA 4GR5A 4AJHA 1E2DA 4P9NA 4DNXA 1C3EA 3MHPA 1FXSA 3ZC3A 2PH7A 2FQ1A 5KINB 3WBBA 2JARA 2R6ZA 3BOSA 5IJAA 5KYNA 5BT9A 2PLWA 3Q5EA 3VZRA 2X40A 3VC3A 2XKAA 5CLGA 2UZIR 2WLTA 4N5NA 4X3CA 3ENKA 2CD7A 1IJBA 2CJWB 3KQTA 4MI1A 3TQCA 3IUNA 4QLBA 4OOFA 1A77A 2B4KA 1YKFA 5H1YA 3SI7A 1T1GA 3BERA 1J25A 4H3HB 2OCKA 3NHKA 4H1VA 1KDTA 4BJ6A 4KDRA 2ZXFA 1Z3CA 4I4TB 3USZA 3WL7A 1TMKA 4HOYA 3KJHA 4TGLA 1B73A 1ULBA 3ZBPA 3WQBA 1FE8A 2RG1A 3MXOA 4D92A 4OXQA 4L2IB 1SZDA 5FCDA 1IWBB 1AKWA 1EHIA 1J21A 4HKTA 4RFLA 4NQRA 1JT9A 1NSFA 1DKNA 5HG0A 1NBME 3VHQA 1G2OA 1NW4A 2JBAA 3OT4A 1N32B 1FW8A 2P5SA 3NR2A 5AW5A 4IIJA 2PMKA 1YOBA 2R6HA 1X74A 1CS0A 3MTIA 4BQFA 4IDFA 1I80A 3TVDA 5KYUB 3NTLA 1ZH4A 3RUIA 1F12A 2WJYA 1OAAA 4PINA 2SKCA 1JJAA 1FP7A 2RHHA 4FMDF 2W71A 3HB9A 4D6YA 1O0BA 5AW4A 2P5TB 3BWCA 3DBLB 3PFBA 5GZ6A 2OB2A 5HA5A 5TPWB 3WGHA 1NUQA 4BVLA 5JNRA 1QJ4A 5CFLA 4DCJA 3EX7C 4BNHA 4KDEA 4DLTA 2P4HX 3IBSA 1QO9A 4AQ7A 1MB0A 4MUYA 4Q9KA 1UK7A 1JHOA 2AWNA 4R4JA 1I10A 1L7BA 3ZJUA 3U4CA 1VPVA 2Q5FA 4ZVLA 5GV8A 3UC5A 1X9IA 3TRDA 1JHYA 1FRFS 3ELWA 1CF4A 4FCTA 1P4RA 3CXUA 2FSGA 3H16A 2I1QA 2CXQA 1UC9A 2PGOA 3L0CA 3CWQA 1J33A 1L5WA 2EF1A 4JLSA 3WGVA 4BZXA 1VB5A 4O4HB 4NBRA 1HOTA 3KE8A 3HVHA 4LJ5A 1OBHA 1TRHA 4GL2A 2ZSBA 3SGLA 2HJRA 3IP3A 3W9SA 1H23A 4HDNA 4BFYA 1E7YA 1ZUD1 2QRKA 4LY6A 4AJ4A 3A6KA 2QJFA 4M0PA 4HZIA 1U02A 1VLHA 3CPJB 1C8LA 5IJ0A 1WXIA 2ZBVA 3BRQA 3E3OA 2QQFA 3R7WA 5BNTA 1ZD3A 2I4IA 3D64A 3PJFA 4UXHA 5C8XA 3EFHA 5BUQA 3UVEA 2HA2A 2IV7A 3LJKA 1JA9A 1YU6A 1U0FA 1ONSA 3QU4A 4UMDA 1UKVY 4NMHA 3ZHXA 1Q0SA 4MUIA 4E08A 3FM9A 3OOYA 2GD6A 4Z3OA 2WOOA 4YPFA 1BA3A 1G7TA 3IV6A 3UK1A 1ST3A 5AI5A 1VGVA 4NCJA 2XI4A 4CKYA 2KLBA 4BX2A 1HDIA 4YUWA 3I4CA 2VQEB 4FW8A 2QPTA 3DUFB 4LNUA 4GVLA 4EW1A 1A8PA 4REOA 2VT2A 2GKSA 3SOPA 5CYGA 3A9CA 3FCSB 4EJSA 2FP4B 1V1MB 4MH0R 1WMAA 5BRJA 1JYSA 3R2JA 3K9BA 4P22A 4QU5A 4XYMA 2H4FA 5HJ5A 3WWEA 4AXXA 1PVVA 5CXSA 1CRZA 3PVCA 3V1KA 4CR7A 1G38A 1HYEA 3DWEX 3IYLW 3KVYA 4WIAA 2WW8A 4F6CA 5JXGA 1RW4A 5KNCH 3BK2A 1FW6A 4MVJH 4R3UC 5F21A 3I5YA 3VNQA 1OX4B 4BY9E 2QVLA 3N87A 3TL6A 1SVSA 2F3QA 1WDMA 1AK1A 3EODA 3L1JA 1R4NA 3E5MA 4FIDA 5BRNA 3UXMA 4P6VF 1MFZA 5J5AA 4FZ5A 1CULC 4IO1A 5CXQA 1FFCA 3LHKA 4NDZA 2QX4A 3N2GA 2DTXA 1UBSB 1HOXA 2RGCA 3SBDA 4Q93A 2NV0A 1MX1A 1NNI1 1TLLA 4BQSA 3BFPA 3H11B 3CUWA 3SYTA 4QQ8A 3HYTA 3WGJA 4MMZB 3BE8A 5FWAA 2DKOA 4LYFA 5FAKA 3WIVA 3KOWA 2MMCA 4EHJA 2AE1A 1DTSA 1YXMA 2FW9A 5CB0A 4RD2A 4BPBA 4D26A 1E3JA 1SM4A 3FTQA 4LHXA 3UGJA 3M6MD 1P2GA 3RK1A 1E79A 2YV4A 1QONA 1J22A 1X9GA 3R76A 2X0RA 2RGXA 1UMDA 4RXMA 1VI5A 5FX2A 4A9AA 1JDTA 3C6QA 3SKXA 4U63A 1F5SA 2ONJA 1H4QA 1Q1EA 3KD3A 2IXGA 2JCGA 2CCKA 3CV3A 3H65A 2PKEA 5H9WA 4HDRA 1UAYA 2VQSA 1LX7A 4MPTA 1P39A 5LDGA 4ASUA 4ARZA 3GA5A 4BVJA 3QPAA 2W43A 3EG9B 4KFRA 4Y1EA 4CT4B 1ZLYA 4RPIA 2H4ZA 2GN6A 1R16A 1HFWA 3RVPA 3A70A 1A7AA 3NTOA 3DSRA 1JU3A 3ZY2A 3L4KA 2WIJA 5TQ2B 2GEFA 3NHZA 1ZGZA 3CSDA 1Z0FA 3JD3A 1KK0A 3NG1A 2CDAA 3KUXA 1CUUA 2UAGA 3KB1A 3FR7A 4Z6KA 3D8UA 4FLMA 3B1YA 3AC0A 1M0WA 3UBTA 2ZUBA 1F1BA 2QDXA 2ZRFA 5FFFA 1JHRA 1KARA 4E5KA 1NPYA 1ID8A 3VGJA 4M0LA 4IZOA 5LYJF 1D1PA 3M0EA 3WLHA 2HU5A 3U49A 1RZ3A 3NOQA 4JD5A 4JBWA 1YFJA 3BJRA 3HJFA 5HVNA 1VPLA 2HXSA 1QS0B 5JBNA 121PA 1JYFA 1PLJA 2XWSA 1HA3A 3DYIA 4NG5A 2P6PA 2X8JB 4B80A 3B2QA 4JI3B 2NXJA 2Y77A 3A32A 1P7PA 3EHDA 3RS4A 3AERB 4ZQIA 4NZ9A 2XX3A 2WNHA 5EL0A 1T0HB 1XHFA 3S68A 4QOJA 2GZ1A 2BKEA 1LLFA 3ITKA 5ED4A 3CPSA 2YJ6A 3UAZA 2WP8J 1Z08A 1XT6A 1WPRA 5L3QA 2FN9A 3L05A 2AN3A 1TVMA 2XEXA 1IRXA 1F8FA 4IMRA 5B37A 1H1LB 1VJGA 3QE2A 2CN1A 2B92A 4HGNA 3GJYA 4KO2S 4WSOA 3UB2A 2AOWA 4ENVA 3HI4A 4B46A 4ND8B 4CDMA 2O4CA 4NCHA 2Y6UA 4U2FA 5CLJA 3C16C 3LH5A 5G0WA 4YV2A 5KNBD 5L3SB 3AEXA 4A2QA 5CT9A 1OXVA 5LSAA 1GD1O 2VJQA 3WV5A 2ZZNA 2BF7A 5EEHA 2I62A 1BW9B 4OQEA 1C7EA 5CURA 1P9RA 1MC4A 4G0VA 4PSAA 2HCJB