1SC3A

Crystal structure of the human caspase-1 c285a mutant in complex with malonate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
173
Chain Sequence
b'TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta convertase
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sc3A00
2XYPA 4D3ZA 1QX3A 3GJQA 4NBNA 3NKFA 4AWBA 5IASA 2C2ZA 1RWPA 2CNLA 3D6HA 4JB8A 4QUBA 2HBRA 1CP3A 3D6FA 1IBCA 1RHMA 3NR2A 4QUEA 2DKOA 2H54A 2XZDA 4QUJA 3QNWA 2HBYA 3GJSA 5IAEA 4JJ7A 4NOKA 3R5JA 5IAGA 3BIJA 4NBLA 1RWKA 1I3OA 2Y1LA 1GFWA 3R6LA 4FEAA 4NBKA 5I9TA 5LUBA 3UOAB 1ICEA 2H4WA 4ZVOA 4AWAA 4JR0A 1SHLA 2J30A 3H0EA 1CVRA 4QUAA 3V55A 2CJYA 3EDRA 3EDQA 1RHKA 2H65A 3KJFA 3D6MA 4M9RA 3DEKA 5K20A 3R6GA 1RWXA 2C2MA 1M72A 2FP3A 3PCXA 4JQZA 4ZVTA 4I1PA 1K88A 1SC1A 2H5JA 3DEHA 3GJTA 4ZVPA 5LU9A 3S70A 4EHLA 3P45A 3V4OA 1JXQA 4FGUA 4EHDA 1RHRA 2Y0BA 4N7MA 1F9EA 2NN3C 5H0IA 5IC4A 1PYOA 2HBZA 3PD0A 3PD1A 4QU5A 4N5DA 1RWNA 2C1EA 4JJ8A 4QTXA 3SIRA 4QUDA 4PRZA 4HVAA 3S8EA 3DEIA 3ITNA 4PS1A 4I1RA 2HBQA 3H11A 1QDUA 4ZVQA 5IAJA 3UO8B 1RHJA 4NOJA 1RWOA 2H5IA 4ZVUA 4HQRA 4AW9A 4JQYA 3IBFA 5LUAA 2J31A 2CNNA 4D3YA 4EHKA 2FUNB 5IBPA 3V4LA 4EJFA 2H48A 1I4EB 3E4CA 2XYGA 3RJMA 2C2KA 4JJEA 4JR2A 1RE1A 2H51A 5IC6A 2QLFA 4FXOA 5IBCA 5IBRA 1F1JA 2QL9A 2CDRA 3V6LA 3DEJA 4LSZA 1RWVA 1SHJA 2FQQA 4QU0A 4EHAA 5JFTA 2CJXA 3KJNA 1BMQA 4N6NA 4ZVSA 3H11B 3GJRA 3H13A 4N7JA 4NOMA 2QL7A 1NMEA 4N6GA 4QULA 4QUHA 1SC4A 3R7SA 1PAUA 1SC3A 2AR9A 2J33A 4QUIA 3SIPA 5LU8A 1RWWA 1I4OA 3KJQA 4QUGA 2K7ZA 2P2CA 4ZVRA 1NMQA 4IYRA 4DCJA 2H4YA 2WDPA 4HQ0A 3OD5A 3H1PA 3P4UA 3V6MA 1RWMA 4QU8A 2QLJA 4QU9A 2CNKA 3NS7A 5I9BA 4DCOA 4NOLA 4QTYA 4EHFA 5IARA 1KMCA 2J32A 5IABA 1RHQA 3R5KA 1I51A 5IAKA 3V3KA 2C2OA 4EHNA 1NW9B 4JR1A 4D3XA 3K7EA 4N6OA 1GQFA 2QL5A 3IBCA 1QTNA 4DCPA 4PRYA 4EHHA 5IANA 4PS0A 4FDLA 2XZTA 2XYHA 3R7BA 1K86A 4IEFB 3R7NA 1RHUA 2CNOA 2QLBA 1NMSA
chains in the Genus database with same CATH superfamily
3N6VA 3NOVA 5AKGA 1LQ2A 3FTNA 4XWAA 1VIMA 5EJ9A 2XKJE 1CRWG 1G9TA 5IFLA 3ZDAA 1OXXK 3BWYA 2FN7A 2HI0A 4GMXA 4YROA 1BQ3A 2ZROA 3K31A 2AOUA 1WBJB 1FY2A 2CXNA 2QRMA 3PP8A 3T52A 2JJMA 3VHXA 5HKAA 2YXDA 5EERA 1GPMA 1T2NA 1F06A 4JJIA 5I9TA 5HQ3A 2D8MA 4BAZA 1DEAA 1S3IA 3P8ZA 3JQAB 3NETA 2XLBA 3ECAA 4MLZA 3SEQA 1SKQA 2Y0DA 3E9YA 3O9VA 3R6TA 1XOIA 1R9NA 4PLGA 2ZI6A 1EJ2A 1GAJA 3C87A 1N7GA 1NVVQ 3OF2A 1PCXA 5F77A 1CJVC 1J90A 2JHCA 4JOBA 2HY7A 5IVIA 3LC7O 1DBSA 3E3MA 4CQJA 4YYZA 3CX8A 4FGKA 4BNMA 2Q6OA 2RG1A 4NDNE 4EBBA 3G0DA 2A5FA 2ZRFA 1R9JA 1TQ6A 3FE2A 2ERCA 4CUZA 2Q6VA 3H9QA 4QX6A 1GG8A 1GSIA 2R6GA 3NWEA 4BEBA 2V65A 4EGSA 3NIWA 2W11A 3K96A 3UC5A 1LBIA 5ICMA 4B7XA 1YA6A 4IDNA 3L8DA 1FXUA 4MPPA 2DY1A 1R10A 2P8JA 5HBGA 1NG1A 4GWGA 1NDQA 4J49A 3D64A 1B8VA 2HEGA 5L4LA 1SQ5A 2IYEA 4ZEMA 1V1MB 1X1SA 4LECA 3A4VA 1Q0PA 4EUHA 1Z45A 3BJEA 2PMBA 1Q0SA 3I30X 5ALXA 2GZDA 2VIIA 2VJYA 2AMVA 4L74A 3VPBA 4O8CA 1A88A 4GC9A 2QMUA 3AJ9A 5KYTA 1KAEA 1WU7A 3CPHA 3OQ1A 4LJ9A 2ID9A 4LZOA 5AI0A 4PZZA 1YI8A 5L45A 5HDBB 4B81A 3L7LA 2YQ5A 1ADJA 4BVEA 1J0CA 1QJ4A 4FFOA 4ZC1A 1O6FA 3IOBA 2XSZA 3FFXA 3O91A 1J5PA 1ABBA 2VK8A 2WYVA 3G9ZA 2WSYB 1XLTC 2ALJA 3UT0A 3FTQA 2AI2A 5BQ5A 1NOIA 2YVUA 3JZFA 4BQSA 5LYJF 3W8RA 3CZ4A 5EAIA 2RIRA 2J9YB 3DEFA 4YACA 3W8NA 4OMFG 3ZW8A 4HJXA 1QBGA 1TJYA 1N5OX 2I2CA 3SR0A 2DPXA 2VJBA 1GUFA 3KTAA 3LAWA 3B48A 3OX2A 3KOOA 3T38A 4C6TB 2BMDA 1WDTA 2E4XA 4OI0A 2DFLA 1HV8A 2O0JA 2NUPA 2B4KA 3OQBA 1GM5A 4B3BA 2FSSA 4OFZA 9ABPA 5FLXA 4FBGA 3I6BA 3NT5A 2QENA 2W98A 4RXUA 5KWJA 4S35A 1GTL1 1OZFA 3EZGA 1SZCA 3D7SA 3D4BA 3ENNA 4GE0A 4URHA 3RVJA 4JLWA 1AXEA 4F4HA 1ISJA 1P7PA 1AZSC 5KU7A 1L5WA 1QFZA 2ZT8A 1GZ4A 3PT9A 5J40A 4R1MA 4DARA 5IX8A 1NJFA 3CRZA 3CYFA 3I9JA 4IUDS 3HKEB 3S1AA 4HYTA 3ROGA 4D82A 3JQ8B 3VYTB 1I51A 1U1IA 4KU4A 3H4MA 5FPYA 4CLOB 2JLSA 5L53A 1FTSA 1OWNA 1WZCA 3O4HA 3WAGA 3LQQA 1I0IA 4AF6A 2PXXA 1CCWA 3ASUA 1C0LA 4NFYA 4ZJYA 4Y6GB 4E46A 1A5BB 2CDBA 2EKLA 1LSJA 1AXRA 4D96A 4FMDF 4WMLA 3ZCQA 2VH5R 1FSSA 1NVBA 1QFXA 5KQLA 3UXYA 1E2QA 3NOOA 4J91A 1M1YA 4YMIA 4TLCA 2QYTA 2JHPA 4JEHA 1P61B 2IL1A 3JWJA 3PWSA 3HFJA 2BONA 3FFTA 5IDXA 5I9SA 2FW7A 1R74A 1CUHA 3DBHB 4LIPD 3LWNA 5I8ZA 5LP6B 4K8OA 4H0FA 2J6HA 3R0IA 4RHTA 4XFJA 1L4MA 2OSVA 4G97A 3GGSA 4FNMA 3HJGA 4EG0A 2B78A 4RLQA 1Y63A 4EK9A 1TVEA 3LC0A 5E4JA 2IEZA 3IV9A 5KHOC 1OI4A 4MEBA 4QOIA 3HZHA 2BZ1A 2H9YA 4ML3A 4NLLA 4URXR 3VPGA 3HPRA 5DNUA 4HAYA 4YDSA 1AKNA 1NQXA 3ESQA 3AEYA 4YMUA 3U7HB 5IC4A 4K26A 2E4ZA 2QV7A 3QEOA 4X85A 3KVNA 4H4CA 1XPJA 1N5IA 3I1FA 4YI5A 1CIVA 4F4DA 4TYMA 1N0UA 1XMVA 4FC7A 3K0AB 4QTXA 2VLBA 4PHGA 1PI3A 4RS3A 3BK7A 4R31A 3OVMA 2JLBA 4LOKA 2LKDA 5DI3A 1LPAB 3Q0EA 2XRMA 4L08A 3LSTA 4TZ6A 1M2FA 4RORA 1YZTA 4CIYA 3DO8A 2RJOA 4ZT3A 4HS4A 4R84A 1OA1A 4DCVA 4CQMB 4AURA 1B0ZA 3CZMA 2OLEA 121PA 1RXCA 4F3NA 1KA9H 5AVQA 3K6JA 4BNNA 3G5LA 1VA4A 7ABPA 3OIYA 4FCVA 3K9WA 4MKXA 4GX1A 4DUGD 1AUPA 1POXA 1N6KA 1NSFA 1U7PA 1AUVA 4XUCA 5F1OA 4PICA 4CL2A 5JADA 1QRRA 3G0OA 2GOYA 3OJLA 4AKTA 3N7TA 2D00A 3JD0A 4FHCA 5F7JA 1X8JA 3ADBA 1OFTA 4UBLA 3IAFA 1SHJA 1C9YA 4GH5A 4F84A 2D1RA 5BUQA 1VYHA 4GGMX 1RYNA 1Q83A 1XDZA 1YZKA 4I9GA 4WCDA 1DXYA 3NBUA 4MP8A 4Q9JA 5FOQA 3G89A 3ISJA 2IF2A 3O9MA 5TMBA 1LK7A 2BFOA 2DJIA 3ZCXA 2AD1A 2JFBA 3AHJA 3DHVA 4D79A 1IEWA 4O08A 5L40A 1ID1A 2H4XA 4JB2A 3SX4A 2P5TB 1SZJG 3TQQA 5IG2A 1XZQA 2XUQA 4I14A 5ILQA 2FRDA 2NZWA 5A02A 5M2QA 4KHZA 2EBHX 2WHQA 1N1GA 2ILTA 2XDAA 3BF7A 3FA2A 5K6AA 3AVYA 3BMQA 3FZNA 3H0CA 4O2LA 4GIBA 1QV7A 2DJ5A 3NFYA 1F3OA 4YUXA 3TBKA 3NUGA 1TLLA 4PBTA 3OT1B 2D1YA 3JWGA 2LGJA 4IHJF 3ZXXA 2OKGA 4Q9DA 4YTEA 3CUTA 4FSDA 4ABYA 3GFBA 1JSXA 4W5JA 4CM3A 5EI5A 1P31A 4OXKA 4ASUD 2YWDA 4C7KA 1Y33E 3EVZA 3WGQA 1UF9A 5IT5A 2XOXA 4NU8X 3F8SA 4JB3A 4D9JA 4ASUA 1KMMA 3TX6A 4MLCA 3DZCA 3D2CA 3HB9A 4FYXA 1H05A 1G59A 3NMUF 4AN0A 4WLOA 1RXSA 4QODA 2AVDA 2PM8A 1HE3A 4RKQA 3SAJA 2ET6A 3QXGA 1L9KA 4ZK2A 1PW7A 1W44A 2JS7A 3V4VB 1XK6A 3RCBA 3M6WA 4GLOA 5BN5B 4KQ9A 3HRHA 2UYHA 4DA9A 1DAGA 1W25A 2P1DA 3CLVA 2CDNA 4FEAA 3KUXA 2JZNA 4KSBA 1HE2A 1G291 3L1JA 2GTPA 3EXIA 4P83A 4O1MA 3OPYI 3FFBA 1GGNA 1Q16A 2C0QA 1AS2A 2Z98A 3ZHOA 1K3FA 3KKOA 2CHFA 2PSEA 4R51A 3DD1A 5BV8A 5JDIC 4BNYA 3TEMA 3DPUA 4KL8S 2N0SA 4BQNA 3ZGNA 5E6SA 1N0VC 3RF6A 1WSDA 4WCVA 1T2EA 2IHJA 4PG5A 4TWBA 1MJNA 3HZZA 2QRVA 1DCFA 5HIAA 1XPUA 3U7JA 1PL7A 1P4AA 1VBNA 2QSYA 3DAHA 3SGLA 3ZE7A 4IV0A 1FMTA 4MI6A 3PDIB 4NH4A 2R6ZA 5J4LA 2AR7A 1XCPA 4OA5A 2C9ZA 3CH5A 1GT91 2X19A 1MC4A 3VO1A 1JYFA 2VP0A 5CDFE 1T8TA 4IZOA 3FNIA 1FJHA 3M4ZA 3VC3A 1DJMA 2E55A 3PXXA 4WBNA 2FRDC 4ZODA 4BO8A 5LPNA 5ARBA 1BZYA 3IAS1 5K6AC 5EFZA 5U4QA 3LY7A 4ND8A 4Q3CA 6NULA 5CCXA 4ENTA 3DB1A 3W6NA 2E1RA 1DKMA 3D3QA 1P3DA 2C7VA 4LVUA 1CUEA 1BDBA 2ZTMA 1YTLA 1RTTA 4YCJA 3VDNB 3B1KA 3WS7A 4AKIA 4OHOA 3AIKA 1SVSA 3C45A 4JJEA 5T57A 5TSDA 4BNWA 4ZRMA 5FUYA 4C5BA 2IS1A 2H18A 3D5EA 1QGAA 4R7TA 4EG8A 4N1AA 5G41A 2A5JA 3U39A 3BJMA 4CQNA 5EL0A 2ZTSA 1E4OA 2FQQA 2WZDA 1ISMA 3VDQA 1PWEA 5FBRB 1EHIA 1VLHA 1JXAA 2NLOA 2FDRA 1JEJA 4EG7A 1VI5A 3AONB 4IIVA 4Z4HA 5IBQA 5DCWA 1F3LA 3RIMA 3LUDA 2R1UA 4HTFB 2HHHB 2CSXA 3ANSA 2ZBRA 2G04A 4IX1A 3I52A 1WW2A 3F3SA 4P5PA 1RRVA 2B7CA 1FNDA 3MWJA 4ZVRA 1ZH4A 4BMYA 4AULA 1AGPA 1MTOA 4M0CA 2M6LA 4M46A 4DB4A 2JAPA 2CNKA 4ZPXA 1G21E 3HXOA 5CLGA 1JU3A 1ZBQA 5CX1A 2WSIA 3T9DA 4XFDA 4GSLA 2B1RA 2VNSA 3FVQA 4Z9YA 5F1YA 4J7UA 1WLYA 4TXHA 5EJGA 1JHYA 4EO9A 3O83A 2W6QA 1JPNA 3OURA 2H4ZA 2QMZA 3CZAA 3LUJA 3MEQA 1H8ED 1UBLS 3T5DA 4PSAA 3T5TA 4M3NA 1QR6A 2ZRMA 4UW9A 4M7OA 1H8EA 3I9MA 2PZMA 1HOXA 1PP4A 2QRNA 3B7PA 1RCFA 1E2HA 2C4MA 2J59A 2ZI5A 1ZU5A 5SZKB 2Z3VA 4EFNA 2PAFA 3IAAA 2JLVA 3QVSA 4Q6WA 5CT6A 2GA9A 1RRMA 4S1VA 1RHMA 1UK8A 4TRJA 1GCIA 4C20A 1QK3A 2WB4A 3MJ4A 3I34X 2QIOA 4ZHQB 5BV7A 3ZWYA 1J8FA 4L28A 2GEFA 5G0WA 3IAUA 2BGGA 3HR8A 2EBWA 2PKQO 3DHWC 3S5UA 4C7XA 4F21A 4L8YA 4D0SA 2PRKA 2ZRGA 1B2RA 1ZW1A 4GP6A 1X9GA 4NRDA 3W5IA 2GXQA 2H1FA 4YQYA 2WKWA 2P78A 3LQ4A 1U3VA 2YUIA 4KIUA 1DFGA 1OFHA 2VDOB 3PQ3A 1EWVA 4REQA 3DB2A 5E6RB 5F64A 3QE9Y 1E7SA 4MMZB 1GGKA 4E03A 1KMHB 1Z82A 2ZBQA 1SVIA 1J7KA 2G06A 2JFXA 3U5TA 1VE7A 1J99A 1ITZA 3ET5A 5H0IA 1LRKA 2DYKA 3AERB 3EFOA 1VHJA 3K5WA 1T6XA 4OHFA 4RD4A 3UV7A 4S1NA 4BO0A 1O8CA 4HL6A 4PTZA 3AL0C 1L7EA 3HCOA 2XB2A 4P3KA 2PZ8A 5JZMA 4EKIA 2XXAB 1ZVMA 2I22A 1P1IA 4CKXA 3WOHA 2F3RA 2C1EA 3T3HA 3DDNA 2XBUA 3JWHA 5HEKA 3KJEA 4BQQA 3HDTA 2CLEB 4F4JA 2ZK7A 2DPLA 2RK3A 1X86B 2PZJA 2WDZA 5KAPA 1DUSA 2XQJA 1BE1A 2G40A 3SYNA 1JTVA 2B3TA 4OGGA 1EIWA 2AKAB 3ZY6A 1WV1A 4U2DA 4IIYA 1SXJD 1YRYE 3U7EB 2DWOA 2EJBA 2O6HA 1ZD1A 1SXJA 1HT0A 1Z4MA 2HU8A 1RLIA 2B8JA 4LE1A 4CJXA 5MF6A 1QTRA 1AC5A 3E5NA 3QU7A 3SHFA 4TMTA 2FOLA 3TAXA 5JAHA 1XROA 2WVGA 3CNLA 1JLHA 3DVRX 1I7NA 2VA9A 3C7AA 3EOZA 3LHSA 2I3AA 1QH1A 3PXEA 3V8NA 5K5EA 4LCEA 5LNK1 4HQNA 2B4RO 2QA5A 1LTQA 3MF4A 4MVCA 4TS4A 2HK6A 1Q2UA 4HH4A 4M54A 5B1HA 4DM7A 1H2BA 4JJGA 2A1UA 1W6RA 5ALZA 2IE0A 4MA5A 3UH0A 4A36A 1WQ1R 5DU2A 2QIPA 4L5JA 2FPWA 5IN5A 2NUAB 1FRVA 3RU3A 2WHYA 4UVDA 1EFPA 2J3LA 1L8XA 3AL3A 5FUVA 2OM6A 4RTRA 4L76A 1G20B 3QF4B 3EVNA 1FFWA 4DN6A 5HXAA 1JG6A 1S8AA 2GHIA 2CUKA 3NC4A 2X40A 2UZ0A 4QT0A 3E9DA 4WESB 2C7OA 2O8EB 1QZZA 2B2CA 4KO3S 1A98A 3T4PA 2YHBA 3G23A 1GAWA 3W5SA 5C51B 3EHDA 3ZU6A 4MVXA 5L7TA 2GAFA 4D9FA 1N8SA 3RC2A 2OL4A 1SCJA 3H2BA 1WOMA 3ANYB 2EU8A 1JSLA 2ZJ7A 3ZBTA 4RD1A 1HFKA 1IBSA 1VHLA 4AYWA 1WUKS 2QB5A 3FPLA 3LE8A 2XUOA 3BHIA 5LZ7A 5EUQB 5D51S 1Z06A 1AV6A 1N25A 1KO7A 3JD1A 3C5VA 1DO2A 1YB4A 3WFZA 5FIUA 3DNMA 3B9QA 4QOHA 4L0CA 3TW8A 2AFIB 4S04A 3NASA 1A4IA 4I9FA 5DFAA 5HHTA 2X0IA 3GPBA 4OB6A 5F3DA 2VSNA 4UFPA 4L85A 4R1SA 5L3QA 5BORA 3PNOA 1YMQA 2SNIE 4AG3A 2R751 4FDVA 3EEOA 2YDXA 4JUBA 2YZ7A 4MLDA 5HE9A 5K0ZA 4A15A 5BP7A 5DYTA 3K0KA 3MA0A 3O8CA 2AF3C 2I2DA 4DIFA 5EJEA 2WNHA 1WJGA 3G79A 1SXJC 3HUDA 5LIPA 1SHLA 2QRKA 1CVRA 2GEVA 4YFVA 3MTQA 1C8KA 4QIHA 4WDRA 4JLJA 5DXAA 4AY4A 1F5NA 5KNLA 4FE7A 3TR6A 5GOZA 1T9KA 3NWOA 4N5HX 4G23A 4PHFA 1MQSA 3FCXA 3L9XA 1LI4A 4JA0A 3EH1A 5E0OA 5TJ9A 5JRJA 4NICA 1Y34E 3PKJA 3IJRA 3MOIA 4GGOA 3W9SA 1QMPA 5FNVF 1O58A 4YAKA 1UJ2A 1ZK4A 3I2KA 4OHPA 4NG4A 4N3NA 5FULA 2J0SA 3FB4A 1KFEB 4C6HA 3SBEA 1D5WA 1V1RB 2HLHA 3IMGA 2XBMA 3L1IA 2C9BA 1G5IA 4P3NA 3W5BA 1FFXB 2LCQA 1MEOA 1O5IA 1DFHA 4B46A 4LDJA 3U4CA 1J06A 2XUIA 2X23A 4ENQA 3H2GA 1A4UA 4RDHA 2OORA 4ZVQA 5IAJA 3DJYA 4JOCA 3WV4A 2OCGA 2ZPAA 5KPJA 4EY4A 5KJ6A 4ZI7B 4F8EA 2FN4A 4WASA 4J1TA 4IRUB 4U7JA 1L2TA 1NKTA 3AB3A 4IGFA 3SKYA 1U0RA 3V4LA 4GM1A 4GZMA 3R9WA 3L6EA 5KYYA 4WLFA 3EIQA 1M2OB 3T06B 4BZWA 4DNFA 3WL8A 2WIFA 3AP2A 3H5OA 3IT0A 2CJPA 2OHOA 1UBUS 5EMHA 4BFUA 4FYYA 4DLLA 1ZVJA 2AW5A 2XF2A 4KN6A 1C1DB 1F8UA 3JX9A 3EE6A 3E7WA 3ILXA 5FWXB 4KKXB 1M2NA 1FP6A 1BMQA 2XY4A 3EEQA 4GM0A 4H17A 2W2KA 2XCOA 4Z8YA 1QP0A 2G5GX 3OLVA 4E6EA 1DRWA 1L5YA 3AKCA 3L0YA 1VI6A 4G07A 2HF8A 1JNYA 2FEWB 1EFVB 3QKRB 3ZW9A 2PS3A 2FMUA 2OTCA 2WLSA 3C6ZA 3MRXA 3ONDA 3BORA 4PPFA 3PUZA 4Q6BA 3IUQA 2RHBA 3H4TA 1CUZA 1UM8A 4GGPA 3U19A 3TH5A 1G8SA 1ZOIA 4W8HA 2BHLA 4M7WA 1IJEA 4H59A 4G0QA 2OD2A 2IPXA 2JJ8A 2I9PA 3DHNA 2VYFA 4X3CA 3PDHA 1LZLA 4F92B 4A0SA 1BU8A 4BMPB 521PA 1RHQA 3RGGA 3LUPA 3QUSA 5BYJA 4M38A 3LF1A 1EHYA 3OG9A 4URZR 4IQ4A 3WR5A 4DXAA 3L1KA 3OPQA 5C31A 2BZ0A 3RJ9A 3ST7A 3PQFA 1HZJA 2QZJA 4FONA 4K2AA 5EPUA 4U00A 4AECA 4ZIRB 4NJMA 2R62A 4A8HA 1D6SA 1V43A 3C15C 3QW2A 4I1IA 1SIUA 3H16A 1LRJA 5FTWA 3RAFC 3NC0C 5GADl 1MFZA 3ENQA 2WWXA 1V4VA 3LCMA 4UTVA 4P8RA 2YV4A 2R6CA 2J46A 3CJQA 4LNAA 4BO4A 3DMNA 4C0BA 3TDKA 2P6PA 2BGNA 2PWAA 1I4LD 2ZWMA 3DBIA 3OH8A 3TLGA 2GQ0A 2JK0A 1Z37A 1NJ5A 4LXGA 1U2PA 5B55A 2Z6UA 2HMYB 3G2HA 1FU4A 1J25A 4OQQA 3CPJB 2L0XA 2EZ8A 5I8WA 5KX5F 3SX0A 3GUHA 1Q5PA 3R5JA 1XCLA 3ND6A 2OORC 1QF7A 2VHJA 1TKAA 3W8FA 1MX1A 3UK7A 4EVIA 2VDRB 3PZBA 2I7CA 1DELA 1CS0A 1GUDA 3AXSA 3BJIC 3ESAA 4I1OA 4J1TC 2Q3LA 1W85B 4A2QA 3DP7A 3DHEA 3KE8A 4D9KA 4UDXX 5IT9A 3O8QB 2RI6A 4MUJA 1DG9A 3NP9A 2BBOA 2NMVA 1EEXB 1NBEA 2NYUA 1A71A 3D7LA 1K06A 1TVMA 5IJ0A 1Z6XA 4LYEA 4ZXFA 1DZIA 1WR8A 1MB2A 1FRZA 3E9MA 2IV7A 4BCBA 3O2QB 2YIDA 1CVLA 1Z5OA 3EXG1 4TTVA 2JLRA 5KKAA 3QOXA 3RSHA 1UDBA 5EKUA 4J6FA 5HIMA 5CDUA 3UTCA 4V1CI 1RCUA 1XF9A 1DIHA 2QM7A 4JQOA 3ZHUA 1BDHA 1O96B 1UZAA 4N5MA 1QQBA 2WHEA 3AU9A 2D1SA 2ZBDA 2FR8A 4ZYXA 1BVHA 3VPHA 3DF9A 4DSUA 4EKDA 3JPYA 4IILA 4IO1A 2R79A 2OAEA 1TPZA 2CMFA 3D81A 3WLFA 2NUBA 4MUIA 1YCDA 3MTDA 3PNYA 5A6SB 3WHLA 4RM2A 2E4UA 1VLZA 2O7RA 3GLQA 4HNTA 2JF0A 4ZALA 2ZTLA 4YECA 2GKGA 4C05A 1O08A 1R66A 2II6A 3N3BC 2C2KA 1WMBA 4Y1GA 1TZBA 1VFNA 1U8YA 2J48A 2X5XA 2X4GA 3E3AA 4ND3A 3U1TA 4CHTA 5CA1B 3HWSA 5HJEA 1ONBA 4QLBA 1HDYA 3GXOA 2H1VA 4YJDA 3HJBA 2FPPA 4I46A 4RXMA 3B8EA 5LA6B 3WDMA 5CD1A 3FM9A 2O6LA 2R4UA 3EIHA 3G8AA 3H4VA 3K1AA 3U80A 2H59A 2QV0A 4LDNA 1A8HA 1NNSA 4QRIA 1Y7HA 1QP8A 1XNJA 4L5BA 2GFHA 5SY4A 1HEUA 4PR0A 4Y2SA 1UINA 4A5SA 3EG5A 2XIJA 1KP2A 3A3YA 4GOND 4DDMA 3R7LA 4NJOA 3PNMA 1JECA 2XZPA 3M6VA 4MMXB 1QIMA 3HCEA 5CEJA 3E7XA 5C9ZA 3CISA 4DRXA 4IDDA 1U5BB 1TOAA 4F5DA 1D6JA 4YAEA 4EYGA 2ZTHA 3ZLJA 5EWJA 1R4MB 1BKSB 1M34A 4B7AA 2XKAA 2NYAA 3F49S 4GF5A 3NIGB 3N6RA 1HMPA 1TUEA 3UCXA 4LBWA 4CMCA 3S0JA 1EMDA 2WKPA 4MRNA 4ERXA 3SNHA 4DM3A 3TG2A 1P9NA 2Z83A 4LXIA 3CE9A 2P9QA 4O5OA 4TSFD 3SE7A 3LHIA 2MJLA 3N9IA 4ZMRA 2WC1A 5JS6A 1CUJA 1Z4PX 3L0ZA 1S7CA 2CZCA 4TSFA 4AP6A 1TJ5A 2VP2A 3TSOA 5C18A 2AMJA 3L7BA 2NV0A 2PUBA 1SULA 1HFEL 2BHRA 4WJKB 2DBZA 2RH5A 7YASA 1OYYA 1N2XA 4B82A 2IK8A 1GL6A 5J63A 1NQ5A 3FPEA 1VKNA 3H6KA 5LZ5A 4GBED 1Y8QA 2ZIEA 4N5LA 3VQTA 1WM1A 3PFWO 2ATEA 2FR8C 2AZTA 4MQFA 2QG9A 4CDNA 2B0JA 2Q4DA 2PSSA 3AJ8A 5LXTB 3KSBC 1FFBA 4Q4DA 3F5QA 1SU7A 3TQOA 4FS8A 4NOKA 3MWLA 3RVBA 5FJIA 4AB1A 1KERA 1FS5A 1Q2XA 2V1XA 1VJRA 3OM9A 4KQ6A 3RIHA 3FSGD 2TMDA 2ADOA 2IEDA 3EPKA 4Z86A 1RW4A 2CFCA 3P20A 1FYXA 2F8TA 3FSGA 1X80A 4JROA 3HCAA 2VOJA 1MVNA 1D4OA 1M76A 1RHKA 2YH2A 3CG0A 3F3MA 3LIIA 3NAMA 4V03A 3WP1B 2PRJA 3CUEF 4A27A 1ICIA 3EDCA 3NC1C 4G8DA 3ROMA 1V25A 2EEPA 1N0HA 2YJ5A 5BQFA 1EDDA 1B6GA 4L0DA 2UUAB 1C7QA 1V8PA 1J1IA 1Q6ZA 1YQUA 1Y4DE 1AZWA 2GPTA 2VL7A 5K09A 3TTTA 4F3CA 2G83A 3COJA 5JI2E 1IN5A 1JXOA 2BGRA 3CUYA 1SHZA 1LH0A 1A77A 2FEAA 3LKZA 4XR4A 4ZOCA 5BXQC 5DNCA 4M22A 4R5HA 5E1OA 1FTQA 1EK1A 1MW9X 2GNOA 2Y4OA 1E89A 3P9QA 1Z73A 1Y7TA 3GO4A 4QXRA 4UDOA 1XLWA 5G3ZA 2R65A 4RA9A 1NYQA 5TDHA 1PJSA 3AKZA 2QYOA 1W73A 2B98A 4ROSA 1MQ8B 1BGWA 4I19A 5FPPA 3UQYS 5BOSB 1S1CA 2DT8A 1FBTA 2PZEA 4MOWA 4PNZA 1ZM2A 3FZEA 4PLYA 5E4TA 3KBOA 4ZFNA 1Q20A 4GXRA 5CLHA 3P9PA 5ALKA 3TX2A 4D3YA 4IDCA 1WE2A 4YAJA 3UNXA 3OQNA 4JI7B 2VPTA 1H1TA 1MB3A 1T3ZA 1U7UA 4HYEA 4RKRA 4WK0B 3RUIA 1UMBB 5TLSA 5CT9A 3NORA 3PT5A 3T5GA 2XKKA 1NUAA 1W9HA 3B5EA 4Q7LA 5FO1A 4G0UA 3KDPA 1FDTA 2IOHA 3GEDA 5IAAA 1XSEA 1F1JA 2D0IA 2QL9A 3I6ZA 1W0KA 5HRUA 1BFUA 1I7LA 2Y2UA 1UWKA 3TZBA 1DE0A 4OLAA 3B6MA 2GCEA 3RADC 1DRJA 2JGRA 3R3YA 3CKYA 2ZU6A 2Q3FA 3DKKA 4LPSA 3OCWA 4O2AB 2YIJA 3NB0A 3REQA 2A3RA 4EHIA 2B83A 2ZIAA 2ZJ0A 1NZDA 1G16A 2EG5A 4N6GA 3W4KA 2RAUA 1NGSA 1ULZA 2Q46A 3EQ8A 3HYTA 3THOA 1GN8A 2RGBA 2WTUA 4KRYA 2ZJZA 5BOVA 1RT9A 1KDVA 3IQWA 4YCBA 3VH2A 2C57A 3P4UA 3WDKA 1SKMA 3ULKA 2BV3A 3RJ5A 4ICIA 2RGYA 2O05A 4V2UA 5I9BA 3D8BA 2BFEB 3TKLA 2A92A 3RS8A 3RTDA 3GRUA 1Y8RB 2O5RA 2HZBA 3RAJA 1I9CA 3FIJA 4AUMA 2NVWA 2XVAA 4UHKA 3K8QA 2AL7A 1X13A 3PGXA 3WLKX 2QL5A 4YGYA 3CV3A 3Q7RA 3ZDYB 2O1EA 5CFZA 1EFDN 5JZBA 4ZAVA 4MW4A 4GUAA 1WXQA 1ZMRA 5D84A 3B20A 2C0PA 3KOUA 1QMGA 3PNLA 3WLMA 1A3CA 4TV8A 1WVIA 4KPGA 4UHEA 1GZ7A 2GCOB 1EXWA 3N8DA 4WEQA 4ARZA 2WZBA 2BMFA 2G9RA 3EZ6A 2VZ8A 1ONPA 1PHPA 4RLSA 3ZDDA 5LDGA 4Y2VA 3VU3A 1P75A 1CUUA 4PZLA 1ZD8A 4YAFA 5FI1B 2UZ1A 4C0LA 1TZKA 3RG8A 3IEVA 1AMNA 4RE6A 2ZSKA 3UB2A 4UMEA 1RM3A 3GV0A 1XVUA 1C3LA 2C3YA 1ZHOA 1XMJA 3DPIA 3GN2A 2R48A 3N1UA 4CM7A 5LWHA 1JA1A 3UVEA 1IL0A 2Q0HA 3ABZA 2Q2WA 1NT2A 3R4CA 4G9EA 4US0R 4ETIA 2C4WA 5CBKA 1KKLA 5DNWA 4LHWA 4WWHA 3RYIB 3E5MA 4DLWA 2PFKA 4J1QA 2E4VA 4O59O 2CNBA 3WP0A 2IS4A 3V5NA 1BVRA 1WMAA 1G66A 3HB1A 1IOZA 4K05A 1VB5A 2HFJA 3DO6A 1K8RA 2VSFA 2WWRA 3DV2A 3U1BA 1XVTA 5J58A 3STTA 1A96A 3D6TB 4S2UA 3WTBA 2YXBA 1F0NA 1SXHA 2AJ8A 3HYNA 3ZCRA 3SC2B 1PYGA 2OCPA 3J7TA 1GAXA 4CN8A 2RGCA 4DE5A 3OIVA 1UBHS 3HYCA 4NC9A 1YR9A 2MT9A 2XUAA 2FSHA 1G3IA 2WJWA 3RC1A 3PPWA 4TYPA 3KCNA 3THXB 1KYZA 4OOEA 5IRCD 2JIBA 3HNRA 5I8PA 2OC4A 4YAIA 1ZG3A 1N8KA 2QTGA 3L7DA 4FD3A 5JYCA 4JI8B 3BQMB 2Q9BA 1YQGA 2WR8A 3VZQA 2WYIA 3AKEA 3G7SA 2FSIA 4FCTA 3WXBA 5B7QA 2Y05A 1FW8A 3AF2A 4NKRA 4P80A 1EQ2A 3NHKA 3HPQA 4JP5A 2BGJA 3DLAA 4EI7A 4XJXA 5IT0A 1J9EA 1ZK2A 2H48A 4DJFC 4DR7B 3LOPA 2WJPA 3VOAA 1MG5A 3BGSA 3LW8A 1O6BA 1AH2A 2BF4A 3EGDB 4ZQHA 2AOUB 2HREA 1WKCA 3PUWA 3ZBQA 4GYJA 3QV2A 3KEQA 5ENDA 2WQ6A 2Y6UA 3CGGA 4MV3A 3OTGA 2EWVA 4R6XA 4ZAGA 4YV7A 5HQ3B 1ATIA 2WFLA 4R3UC 3IVGA 2VNHA 1C4KA 3CRNA 4Q7MB 3TS1A 1NQTA 3VVBA 5B7GA 4B76A 5DBEX 2WFAA 2XVXA 3HA3A 3V7YA 1N2GA 4IDGA 4B6GA 4F5WA 1YF3A 1IQUA 3FUXA 1GEGA 2L2QA 4MAAA 2CT8A 3JVUA 1OR8A 2ONCA 2D62A 2LIPA 3CONA 1PNQA 4GBGA 2B7BA 4TTPA 1ZQ1A 1ZR2A 1HY3A 3QKTA 2GTHA 3OLZA 5BN3B 1BC5A 5K8JB 3ME5A 2VNAA 3UPTA 4V0LA 3Q7PA 1QQ7A 3WISA 1Z13A 1YGYA 2RK6A 3I01M 3PDJA 1HDXA 1US8A 2KI5A 2WIJA 1IHXA 4UVEA 1Y9AA 4D9MA 5GJVC 4D3XA 2D0DA 3X1WA 3SXJA 3N6XA 3QITA 5DNVA 3RUCA 5KC9A 3IQEA 5L3SA 3H8SA 4KH1A 2J5RA 5CB6A 4WTOA 4JFAA 3L2OB 1BWSA 2JC3A 1VKOA 4HDNA 3GCDA 4OI4A 2Q3DA 2D06A 3U3MA 2VUUA 4EJ0A 4F71A 4RZHA 5BYAA 3AB7A 4RY0A 1WZUA 4QSMA 1QCZA 1ZS9A 2JARA 1AK2A 3HI6A 3LG2A 4FXPA 5CIWA 1I3CA 3OF5A 4ZMBA 4U2CA 5DGIA 3G59A 2NAPA 3NBAA 1QNFA 1U7XA 3NTUA 3AR4A 1G8GA 4K1LA 2A9VA 1FSZA 2XMRA 3N0RA 4FMPA 3E53A 3IQIX 4HKTA 4AO7A 3WOVA 4MP6A 2HA2A 3SQXA 2IYPA 3DUFA 4I5DA 2X1LA 3KTAB 4YMTA 2F4VB 3GLIA 2XBLA 3R74A 3VNVA 2KHZA 2PUFA 4YRNA 3DLHA 4G84A 1ZRNA 4UARA 1TC2A 3SI7A 4EX7A 1YQXA 3IP6A 2XDQA 5ECWA 5ARCA 5HFJA 3OQJA 1Q1EA 3RKSA 1LNSA 3SEAA 1WMSA 3ZV3A 5JVDA 4HAUA 2H1SA 1SC1A 2JVIA 3ESBA 3ROTA 1CRZA 4XVCA 1TYZA 2P4SA 4BWVA 1RC8A 2VWGA 4NXNB 3MCZA 4CV0A 1RHRA 2JHAA 5ALOA 5TNXA 4R41A 5KNDD 1YUNA 2I2BA 4BGVA 2RJNA 3X1ZA 4R0NA 3MGKA 1C30A 4D6PA 1I6KA 1W5EA 5KNDA 2EKQA 4QLAA 2IU0A 1QBKC 4ZO9A 5EXTA 1K6IA 4UHJA 1P2SA 2VF4X 4AYTA 4U5QA 3RS3A 1Z07A 2HT6A 1LCIA 3I53A 2F1KA 1VL1A 3UO8B 1A9TA 1AV7A 2AN3A 3DTNA 3L4BA 5HF9A 2A8YA 4GVLA 4LGMA 4M55A 2LUOA 4OKIA 4F0JA 3GNTA 2C95A 2JGKA 2YIMA 4RFVA 1M1YB 2NNWB 3QY9A 5EVJA 2IPMA 1C41A 1Q1ZA 2H07A 2PQMA 1T2FA 3BRSA 4RTPA 2CWWA 2V03A 4W5TA 4LXXA 5K3OA 5BWNA 4CMAA 1VCHA 2FN9A 1Y6QA 1QB8A 1WMEA 2ONKA 1KEVA 3OJFA 3HN6A 3V4ZA 5DRTA 2C7PA 1C0IA 3MW8A 1ZMXA 5DWDA 1IXSB 1KYQA 2WY2D 2IBTA 4HEJA 4BMDA 3L84A 3SF0A 5CLJA 1ZGZA 5T4HA 4RGQA 5CB0A 4EIWA 1YR3A 2LBPA 2QX8A 4FWBA 4B4DA 2HMUA 5K4GA 3VKHA 3BC1A 5HJ7A 5SYNA 5LDHA 1SNYA 3KQHA 4CODB 4F85A 5AW7A 1NUQA 1QRSA 2V6BA 4EFLA 3R44A 3ED5A 3VO8A 5BSRA 1KORA 2YR0A 5K8VA 3K71B 1U0JA 2P6NA 3JSXA 3A1DA 2H2WA 2W6PA 3KPVA 2IS6A 4P3OA 5KYXA 1V9LA 1XTRA 4FX5A 4RM3A 1IEVA 3SQOA 4HWRA 1V6SA 4B2YA 4Q4JB 4E51A 3SQLA 1KK3A 3KJZA 2XZTA 2GBPA 3GVCA 4IEFB 1UJ5A 2RHOA 1ZJWA 2LP4Y 4KE6A 4QHTA 3P32A 1ZNZA 3KYIB 2OXIA 2XUKA 3CA8A 4R9VA 2DPYA 3T94A 2HA7A 3U1VA 3L93A 3OCCA 2VTBA 4X93A 3OT5A 2JGAA 4A0HA 1YS9A 4MWTA 3WL5A 5AW4A 5CNKA 5A5VA 4M76B 4AX8A 4GQBA 1D1TA 5EIAA 5F3WB 4XEUA 5CLLA 1SHUX 2XMZA 5LYJA 2ZUDA 4N7BA 4XYGA 3EQZA 1RPJA 2V7GA 4A91A 3PICA 1QAOA 1TMKA 5ICSA 1HBJA 2WM9B 3L4BC 4IKEA 4PVDA 9LDTA 4DIOA 1TE2A 3OIWA 3B53X 4LDRA 4PG7A 4QATA 5D01A 2HCFA 2VT7A 2CHGA 1KAQA 2GDJA 1JVNA 1NZJA 2HLDD 4AMZA 1E9FA 2JI9A 3N2KA 1P1CA 4LFBB 2HLDA 3IVRA 2H2FA 1MRZA 1QK4A 1T0JB 1HURA 1PBTA 1GVNB 2IYAA 1G7SA 2OUIA 3COYA 3R3HA 2FPGA 5H68A 4DL9A 2C5BA 4HQFA 4LYGA 2BKVA 1S2LA 1CUWA 1W87A 1M6WA 3B3GA 3NXKA 3ZJYA 5CB8A 1K8ZB 1O9BA 1PGJA 2I7DA 4JBHA 1XA0A 2FK8A 3OTQA 4OBXA 5FA6A 4D97A 5A5EA 4CCWA 3FTEA 5C52B 2Y1OA 2I1VB 3NM4A 5EE5B 1UK6A 4TS9A 1RU3A 3S8MA 4E2FA 4O4IF 4NU5A 2R7KA 3FF4A 3ON5A 1WKVA 1EVJA 3OC0A 1JHAA 3WL4A 4B32A 3WA7A 1ZWKA 5ES3A 3T1YB 2CLFB 4JFRA 1KEKA 4R2KA 3BXGA 4FGSA 5FOSA 5G2OA 2EKBA 5FFNA 3E84A 1F2VA 1OH8A 4BKPA 3FNEA 4JUAA 3BH7A 3IELA 2O8BA 3OZAA 3WAKA 5GV7A 2BD0A 1Z8FA 2EL9A 1I7QB 2PGOA 1G6HA 2CL0X 1ZJJA 3EGCA 5ALRA 1FMFA 3CWQA 4IOMA 2PUDA 4DLYA 1HYEA 3TEFA 3ZQ6A 4DQUA 1ESCA 1QKIA 1XV5A 2GEKA 3HE3A 3GAAA 4Q18A 4ARAA 5BPHA 3BE8A 1Z2EA 2VDMB 1CR1A 3H4IA 5EXEA 3EXIB 1Q1QA 1FTNA 3TW6A 1KDPA 2SHKA 4OM8A 5C5IA 4H7EA 4IXWA 1W96A 3AR6A 4KLCA 4N0MA 1PAUA 1JFVA 3LY8A 1HDEA 4BWYA 5JYBA 5AK0A 4Z3OA 4W8OA 2YS7A 4J3NA 2E5FA 1P5RA 3IUBA 3F47A 3JQRA 4K8RB 4UFNA 2HU7A 5E6SB 3HXQA 4KREA 7MHTA 2AT1A 5F73A 3SR4A 1ISPA 4CR8A 2QRVB 2QUAA 3H2HA 5ER6A 3NBZC 5FLEX 4CKWA 1U02A 1FS4A 4FGWA 5HWSA 4DNPA 1ZCAA 3P94A 1P4SA 1TYCA 3H9EO 4QBIA 3C3XA 3K5HA 1E96A 1Z08A 1H66A 1K92A 4P98A 2IT1A 4NYIQ 4LZJA 1T13A 1HF3A 4GZLA 1WBDA 1PBNA 4I9UA 4JVSB 2QMQA 3R7BA 2XNCA 3QHQA 4S0XA 4L50A 3PVSA 1S2GA 1R8QA 3AK4A 3JARA 3N58A 4FJ2A 4WBNB 1YVUA 1SBIA 3C70A 1A7UA 4ND8B 1KFJB 4HGNA 4NNPA 5I47A 4OQLA 1ADGA 2C7BA 2PJDA 1OGIA 2RH9B 4RA6A 5FXMA 1CG6A 1SRQA 2QPAA 4GDMA 1FLNA 3TNDA 5I45A 1CVIA 2JL1A 2QDXA 2RHGB 2ZYHA 1ZD4A 1M8PA 3F5MA 3L7AA 5DX1A 4C0WA 2PUCA 1P9OA 4M49A 1FNCA 2I4OA 4QQ8A 1W5SA 5TC4A 1UDWA 1G6Q1 2GI4A 1QHHA 3SJBA 1U3FA 1PGQA 2I6GA 5D3ZA 4C0QC 1N5JA 1NBHA 4MQEA 2VDLB 5D2CA 4BNLA 4ENVA 4JUCA 2WTAA 4HOYA 4B8YA 3WGIA 3T3IA 1O7JA 2HNKA 2PWZA 1TU3A 4Y9TA 4AO6A 4ZDJA 4S1WA 1FVFA 3GZNB 1RQ2A 2FAXA 2ZB3A 3FWNA 4UBJA 3MWKA 5ERXA 4BNZA 1EK2A 2R11A 2HV8A 3MT9A 4PANA 5E4FA 3R9IA 2IC5A 5HVNA 3G0GA 1UMDB 1CUCA 1TUGA 2FP3A 3CRW1 1E18A 2C9MA 2Z9CA 3EEYA 3LBYA 3GLUA 1CZUA 4X41A 3R0XA 3DDUA 3KQKA 1KFKB 2Z09A 5CX1B 2FVYA 1S7GA 4CF3A 4LZPA 5EEGA 3FBGA 1CUXA 4IHJA 3ELYA 1JDSA 4ZAFA 5EYPB 2B4TO 5AUPB 3X1YA 3L5OA 2P6RA 1MO2A 3SVZA 1K63A 1NATA 4G8BA 2J5XA 4GI1A 4HH0A 3U3OA 4HDOB 5G02A 3KAJA 4CM8A 1B76A 2H2IA 3IHLA 3QIAA 4KODA 3QFCA 3L0CA 2YY6A 4XDZA 4BZPA 5HSGA 5J1SB 1YMVA 4X92A 1CY2A 4Y67A 2P3SA 4Y2YA 2K2WA 2WHPA 1LDMA 1XMXA 4V2IA 2OCXA 2A0UA 3L3BA 1KGSA 3RLIA 3LHDA 3DE6X 2TYSB 5CD9A 2BRUA 2XQKA 2Q0SA 4RQAA 4UHFA 1RZ3A 3LA8A 2AS0A 5COBA 5EGNA 3RJMA 3VNBA 2XLCA 5A03A 1OAKA 1FDVA 1N8TA 3HCDA 1HG1A 2G1AA 2VKQA 3FUWA 3N8IA 4B3SB 1SB9A 3C5WP 5SZIA 1EX9A 1DJQA 1RSZA 1IE3A 3AHEA 1Z6YA 3HFGA 2Q29A 5F5LA 5HW0A 3PE6A 1BXRA 2R1VA 2QT0A 5REQA 9MHTA 1FMCA 1UXHA 4Q39A 3ZLUA 4KPYA 2OCYC 4CKEB 2WJ3A 4CR7A 4XYBA 5ILOA 1RJDA 4PGHA 3OIUA 1S2DA 4GWKA 4M0EA 3BWMA 3OQMA 5D6OA 1FX1A 4TVBA 4REQB 1P6UA 1EQUA 3MJSA 1CEXA 4X20A 3P2EA 3FDZA 1XN4A 3LQ2A 2YHIA 4MH0R 3N0XA 4QJBA 4E1VA 3INRA 1BHQ1 1DOHA 1FLAA 2YOGA 4KYVA 2XXJA 1KR2A 3O4IA 1FX0A 3IA7A 3AEQA 3AHIA 3O8RA 3VH4A 3SD7A 1ACJA 3E2IA 3IUEA 4BCDA 1ZNYA 2Y76A 3HVIA 4OQPA 3H1BA 1I14A 1OA0A 3ENWA 4FMCB 4QJIA 1WA5A 4CLEA 2VJMA 4PN7A 1DEKA 3LK7A 3H05A 3N8GA 4TVSA 3GB9A 2UUCB 4GRAA 1U7WA 3CKKA 2UXCB 2H1CA 5K8IA 3MUEA 1ZKMA 2NTYC 4X24A 1SXJB 1YSCA 3P97A 2C42A 3S2SA 4OAQA 2HRQA 4MGYR 3UHOA 1G3UA 1JQLB 3JTEA 2NO1A 3P4YA 4PE5B 1F0PA 2C9OA 2I1WA 3HKCA 4G89A 4R2IA 4MPTA 4Z5XA 2E49A 5JSKA 2B36A 2JI4A 4WOCA 1JB1A 4B9AA 1A1SA 4QFMA 4H7IA 1W581 4AF8A 1L5MA 4DNOA 4WL0A 3MYYA 1ZRSA 3GDGA 3ILSA 4E15A 1COZA 2BFAA 4JDPA 1C2YA 3GVHA 2QW8A 3BRWD 3H9BA 2BRUC 5B1YA 1EFPB 3DE5X 4RZIA 4EG4A 3BRWA 4E5VA 1V48A 3D3JA 3EZXA 1V11A 3R5XA 3DNFA 4ZZ2A 5JMPA 4MMYB 3HVUA 4CYMA 2FJ0A 2X1MA 4OGKA 4E09A 1J0DA 4FSHA 3KSDO 3NTOA 1U81A 4YP9A 1ZC4A 3NOQA 5EE1A 2W2PA 3KO8A 1V39A 3O8OA 3CRMA 3F6CA 3O2SB 1DJNA 1K9VF 3OZSA 4RQUA 5THQA 3QXXA 4I7EA 3RU9A 2X2EA 4BHTA 3EMDA 2JEYA 2P7HA 4QJ4A 3JAKA 3QPVA 1UK7A 3W2TA 4E3WA 4Q3NA 4CMIA 2B4YA 3UV3A 4FD2A 2HGZA 3RT1A 3VSCA 2R86A 5IYZB 1X74A 4EL0A 5K99A 4Q9LA 1T5IA 3OAAD 1OV4A 3UM9A 4DW8A 3A6DA 4G5GA 4TQAA 3OAAA 1OHHD 4NR0A 5FPTA 1SQ6A 2NZ2A 4EG6A 3JSAA 1AO3A 1MRSA 4M1YA 3ES9A 1H0KA 4RLHA 4ZO7A 3UN1A 2PT5A 1OHHA 4Q93A 3TW8B 1Y5LA 3TR5A 1KJ9A 4DGSA 5KYGA 2DVMA 3AHFA 1V5EA 3EPRA 1KQOA 1HDRA 3QBDA 5LVAA 2HWXA 4BP3A 4KTVE 2ZPUA 4U6QA 2Y1KA 4BGIA 2FZ4A 3A27A 2Q62A 4YJ2F 2QD1A 4G8CA 1HQYE 4FYVA 5DTIA 3RRBA 2GNPA 3MK31 1W2GA 3KQSA 4N0PA 1TIPA 4F5YA 3BRQA 2FPUA 3ZV5A 2L19A 4YEDA 2FZVA 3FHLA 4R16A 1U9IA 1CB7A 3JAWA 1N3YA 2W8BB 2O2IA 2Y9PB 4Q24A 3SDBA 3Q8KA 4HWPA 2G6TA 1H6BA 3GJ6A 4HDQB 2ACKA 3NEJA 4DMHA 3USZA 3GJXC 1DIAA 2BR4A 4JLOA 3CEAA 2P0AA 4LC9A 3TW0A 4B33A 4Z8XA 5IUNC 2FZ5A 2BM9A 2O5CA 4OLBA 2IOQA 2GASA 2Y1WA 3Q1KA 5DNAA 2V6IA 4Z2AA 3HJAA 3BL6A 3V80A 3IEMA 3TNFA 2Y4NA 4R40A 4UNIA 2YJ3A 3TLMA 1DHTA 2G88A 2FQ1A 3IAXA 3VO9A 1GQSA 3GPDG 4YMLA 1QHXA 2PGJA 4J0EA 4JYZA 3I2GA 5JCOA 3HL0A 1VBFA 5LJIA 1EFRD 2RHCA 1G7TA 2FX5A 5AI5A 5EHGA 1IPFA 3VMFA 1CF4A 3KHKA 1EFRA 1QG2A 4YUYA 2ZR8A 1ZYUA 2D0PB 1EX6A 2O4CA 2ECOA 8ABPA 3KS9A 4TROA 1J42A 1ZJYA 2WE7A 2FX3A 3BJZA 3BWCA 1BA2A 1U90A 2X6QA 5JH7B 2JCGA 2ZJBA 2XF8A 3JU3A 1FYDA 4RD6A 5E7QA 1PJRA 4YBZA 2MSCB 5ULLA 1EGQA 2FX2A 4JBNA 1BE6A 1X38A 4KXQA 4PLPA 4C4TA 3H5VA 2W6CX 1KO4A 4YP5A 3K1TA 1A9XA 3THYA 3LL4A 2XQGA 4IIDA 1R0RE 5ALGA 3HA5A 4HLUA 1KXZA 4JNKA 4J9UE 1MW8X 3W2GA 3W3AD 4JJKA 1Y5IA 3A28A 2A0WA 3I1JA 3M1LA 1YB1A 1TM5E 3EZFA 3OOEA 2HIAA 4NDZA 3W3AA 4EB6A 5K9ZA 5ISMA 5DSTA 4IWXA 3QLTA 4KYUA 3WGNA 2E4WA 3LX8A 1NLYA 3BB4A 1PZFA 2DPGA 4OXQA 1AKUA 1D2GA 4BX0A 2O8CA 1TVKB 4A1FA 2BEWA 1ACMA 2XADA 2JGDA 1XD8A 3KHTA 2Q2NA 2O1WA 2OC9A 1WETA 1A27A 1U8AA 2YCLA 5H3CA 2C9YA 2ZBUA 4QXPA 4A8TA 4ALMA 3OQ6A 2D8AA 2Y1DA 4CZ2A 1LY1A 5KNCH 1N78A 5ED4A 3EY4A 3WNBA 2GRJA 2J87A 1Y9JA 1U9IC 1FQWA 5BYKA 4ZVVA 1PR0A 1XT6A 1DUVG 3CNHA 2O9JA 1BA3A 3HHEA 4NJMB 2ZAMA 2G9NA 1F17A 4MVJM 2B6NA 1R64A 1XZEA 3PJEA 2EHJA 3A25A 5BRNA 1Y9DA 1J2TA 2GPBA 4JLNA 2VYND 4DC1A 2JGJA 2WJGA 4BVLA 5IJAA 4UQLA 2VYNA 3WDLA 5CCDA 4JN6B 3KYJB 3TLGB 3PJFA 1P6QA 1AU9A 4FLEA 4JBWA 1KEZA 1SKBA 4ER3A 1PD0A 1VXRA 2QTCA 1QHSA 1Z4IA 2RJ3A 3D0OA 1OILA 4K9RA 4P7GA 4D4JA 4HXFB 1VPEA 5JWOA 4IWNA 1V3VA 4HUQA 5JCOC 1WY5A 2CFOA 2GZ1A 4Y2PA 4PFKA 4MKFA 1FFSA 2ECKA 3TIIA 1KI3A 2O3JA 3CMCO 2QLTA 2PLAA 3DGFC 3GDOA 3TTVA 1CS0B 5CTAA 3ETGA 3LDUA 3DFIA 3PC3A 3CM0A 3KK0A 4UD2A 1XI2A 5ALQA 5DHRA 3UEOA 2BEVB 4ZQIA 3WGTA 4B3IA 1ZM3A 3LLCA 1Y4AE 2VHVA 4FFSA 1ZN8A 3EVGA 4J75A 4ZMSA 4D3DA 2VDUE 2WMNB 1XKLA 3COZA 4PGAA 3F6BX 5FWYA 4AJHA 3BMCB 3MOSA 1JLMA 3TOCA 1KC3A 5GP1A 5FNVA 1KMNA 5JPIA 1S0UA 3LD9A 4LI3X 1PVDA 1SRRA 1YR1A 5CM2Z 1XMPA 3RTAA 3S1SA 3D0QA 1NIJA 5TQJA 3AFIA 1SQGA 4HLUC 2JAOA 1E32A 1JLRA 1OLUA 2CKDA 1UWVA 3LOUA 3A7EA 1QS0A 4JLVA 1UPCA 2WIKA 4OHXA 4AVYA 1T43A 4G1MB 5ADWA 3Q7QA 4LJ4A 4YJFB 3FPAA 4G2NA 4DA6A 4I1VA 5BURA 4JOQA 5ALPA 4LHVA 1MCZA 4KQCA 3C2QA 1JIUA 1QH0A 1EDOA 4ZU3A 3AF3A 4KFSA 3LI2A 4TOIA 3JY6A 4N8DA 5AJWA 4HDKA 4W63A 4Z4FA 5EY5B 3GT7A 2VA8A 4UEWA 3KEGA 1VFPA 3AG5A 4LYDA 3IJEB 4CT5A 1U04A 5LLSA 4L6IA 2CLKB 1P7CA 1KS2A 1L4KA 2JIPA 4CQLA 4PO3X 3CZ5A 4MVJI 1PTJA 2NM0A 1GAEO 2FEMA 2IP2A 2ZYSA 4JLKA 3Q9NA 4IMRA 2FGKA 5K8LA 1NXTA 2J0EA 4GOXA 5ESRA 4JL8A 4BJ1A 3ZY3A 3K1AB 1FUUA 3EGEA 3MTBA 4WIAA 2P3QA 1Y1PA 4NE7A 4RVNA 3MFYA 2PKYX 1IHUA 5I4BA 3HXMA 3WMRA 5BPFA 3QYAA 1UBNA 1YK1A 1P7WA 2C59A 1TLFA 1ZWLA 2A1TR 3V2IA 2NP6A 1RI5A 2PH5A 1R7RA 1USWA 2V6JA 3GFOA 4AROA 421PA 1Q7TA 4DRXB 2JBAB 1LPMA 1L7BA 4TKLA 1NF9A 1R8YA 2YWJA 1KEWA 3LZDA 2RI0A 5EWJB 1NC3A 1PJBA 3QXJA 1M34B 1A2BA 4KE9A 5I7RA 3K2QA 4WGFA 2VTKA 2VHZA 2X3YA 1XK7A 5AM2A 2ZSEA 1F4PA 3OFJA 4DXDA 4DYDA 1K7YA 5COAA 3VBEA 2EL7A 3N8NA 3ML1A 4GE3A 4EUKA 1ZK3A 2ZJOA 4RHEA 3ETEA 1U7TA 1UC8A 4L8VA 1BQEA 4L9WA 1P1HA 1S96A 1T2UA 1YBFA 2JJQA 1EVZA 1LKZA 4KUHA 2F7SA 2OESA 4ZPJA 1FXWF 4FTWA 3NAQA 4HB0A 4LF8B 1A9ZA 1G63A 2O3UA 2VF7A 2GKSA 1R6UA 5D3KA 5IDVA 5CEFA 2IIVA 2HSJA 1UC4B 4L22A 1BS2A 2ANCA 4PIMA 5IC5A 1OQAA 4QEKA 1SCUA 2IGTA 2ZIUB 5IM4F 1DG1G 2ZRIA 1II8B 5KX5A 4MQFB 4W82A 3WKAA 3IAM6 3G2IA 4WV3A 4AJ2A 5JR3A 4TN5A 4F8JA 1JJFA 4QPCA 2QK4A 4U7TB 2I7VA 9LDBA 1VE3A 3I4CA 4PZEA 4QU0A 1XO1A 1XJ0A 3OT4A 1VG0B 1E2FA 1ZIYA 3EUWA 4RF3A 4F3RA 3JQBA 1UAAA 1E3QA 1ZIPA 3UJ8A 2BELA 4NULA 1UZMA 1X80B 1LTHR 5JDCA 4AQ7A 4IUYA 2BISA 3VOBA 2Z6VA 2NQTA 3TN7A 4KW7A 4JC5A 4QAJA 2AG0A 1P2UA 3Q7TA 1PZEA 4IQFA 1XDGA 1PTJC 2YMPA 1NSYA 3QUTA 1TNDA 2CMDA 4DCJA 1TMOA 1DQZA 5C5CA 5SZHB 4DCUA 1DKRA 2PKXA 4RVHA 3TB6A 1XQVA 1KZGB 2IHUA 1DFIA 3HN7A 4JJ6A 3KR1A 3TDNA 1Y3FE 3KQVA 5IM5A 1GN9A 1QC5A 4V0QA 3R7FA 5SYAA 3L8MA 3JXEA 5GQSA 3PQ4A 4G2TA 1YMUA 3KRTA 4OHRA 3TTXA 2FY8A 3O0DA 4RFLA 4K81B 3R24A 3I62A 3V8PA 2ZRAA 4YJGA 1RHUA 3V8QA 2YIVX 4GMHA 2QLBA 1Y98A 1DWQA 1I3MA 3KD2A 4RVSA 2CJWA 1A4RA 1LW6E 1GKYA 4YVFA 5AQEA 2X0EA 2P9TA 3KM0A 1E3DA 3WIDA 1BCSA 1B0AA 3ESXA 4HF7A 3SE0A 5C5EA 3G2JA 2AOWA 3B6KA 4JHXA 1YCHA 3PVCA 1L5LA 2NTNA 2ZYTX 4IIUA 1ZVVA 4KHPB 3PKZA 5DLQC 4BLUA 3ANLA 4HN4B 1GLNA 4QOFA 4UHHA 1FRQA 3QZUA 4Q82A 5B36A 1RMTA 2IYZA 4D99A 4KQEA 1VLMA 1NG9A 3FXAA 3ABSB 3T4UA 2XUGA 3C6MA 2BEJA 3DT9A 3BHMA 3PC8A 5MN6A 2DPMA 3GR6A 2XZLA 3WHPA 4Q3LA 4KBFA 3KBBA 2JFPA 2R8XA 4UUBA 1LSSA 1Z62A 3FKJA 1P4GA 3KDSE 2IEAA 3REQB 3DAOA 4LWPA 3W2HA 4I5GA 4ZD6A 3GGPA 2W22A 4YRTA 3X1XA 4D02A 3QQ5A 4FHEA 5FLKA 3R6GA 1IIRA 1X3LA 3QEMB 5CA0F 3TECE 2B8NA 3HCRA 3RNOA 2EFHB 5IDQA 3LW7A 4R54A 1HETA 2I34A 2M6RA 1NT4A 4M9CA 2Y0BA 2C3MA 1JG3A 3WE7A 1MVOA 3I3SR 3A9SA 3I5AA 4C1BA 4LA4A 5J5CA 1OBFO 3JQBC 4L75A 4RETA 2VDNB 3EXAA 3RQSA 1NRWA 1Q7GA 5E7JA 3HO1A 3JVDA 5JDCC 4CPDA 3AIMA 3FZYA 1UWCA 4F6LA 5BQ3A 2ZBEA 3PXBA 5SY9A 4UMVA 4M83A 2BR3A 1ZH8A 3R09A 4HWSA 4NE2A 4CTJA 5JXJA 1XQ9A 3HADA 4OLJA 4TTTS 2DEUA 4EF6A 2PYDA 3COVA 3ZV6A 2A86A 4ARZB 4X7PA 4ER6A 1GAQA 3WYGA 3T3EA 4KPUB 1B1AA 5FI0B 2I0FA 1KBZA 3ONVA 1F7UA 4PYRA 4AF7A 3GUUA 3GU3A 3D54D 4WCFA 4X84A 2GD1O 4A16A 5FTJA 4HS9A 1V47A 1FDIA 4UUMA 3NVDA 5FOWA 4AYXA 2MYPA 5CGQB 4NY1A 4BFSA 3ZWOA 4JLMA 3STWA 4WZBE 3PFBA 3UIEA 1Z5PA 3D6NB 2IEBA 2OHFA 1VJCA 1KAMA 3VZDA 1JFFA 4PC1A 1T0UA 4PPYA 4G8JA 5LQSA 3ZHQA 5CFLA 1E4VA 3R3JA 3VR5A 4NQRA 5J2TF 1TF5A 2V8OA 2XWBF 5EJIA 1W2HA 4TXJA 1GLVA 4LJ8A 1GQRA 4Y6QA 5AKEA 2RONA 3LPMA 4MVJE 1DXQA 4ZGGA 2DBVO 1XMOB 2ZREA 3PC8C 3STVA 2EV9A 4A7PA 3W77A 2C83A 1D09A 3TVYA 1TC1A 3K2EA 4LDQA 3DFZA 5IARA 4PC7A 1EWQA 1NVGA 3IBSA 4GOLD 4EQZA 4ITRC 2Q4TA 4BNKA 4E5UA 4JYPA 1VJGA 2Z5FA 1H9BA 5FL3A 5DM60 1WVGA 2C20A 3QVGA 3CW9A 3AUAA 1RRFA 2Q28A 4MHTA 5T3UA 4XX0A 3JS5A 2VQEB 1UM9A 2DWCA 3QJ5A 3VU0A 5CVVA 2ORWA 5IASA 3OUTA 4S1OA 1D03A 4J9VA 4PZCA 4DJJA 2JFGA 4BQFA 4HWKA 3VNQA 3QU9A 3ISVA 5FUXA 1X3SA 3DOFA 4FYKA 4DHWA 4EJSA 3IQDB 4PLZA 5JFOA 4QBHA 4MUXA 2F9FA 2JFWA 1TGVA 4D0RA 1VPTA 4F96A 3DZ8A 3A4MA 1TEXA 2IJGX 3ZIUA 4K5QA 5C2JB 2G67A 4KK3A 2N3ZA 3ZCTA 4BB9A 4D45A 1G8KA 2GETA 1AF4A 1I2ZA 2J30A 3KTFA 6ABPA 5B2FA 3AM3A 4PINA 4EZEA 1BN7A 4TL8A 3M70A 3T1OA 5KTKA 1YH3A 3GGGA 3RYFB 1ESDA 2M6SA 1JP7A 3JTMA 4WCFC 3WLPA 5CITA 5DDIP 2J9FA 1WXGA 2PX3A 3H18A 4Y2RA 5KQGA 3QY0A 3UICA 5CVJA 3OX4A 2FSGA 3BXHA 4P6VF 2KBEA 4UMDA 3FDIA 1OD6A 1HO3A 2CLLB 3GROA 1SCNE 4NS1A 3UOGA 4LXYA 4EMBA 1IY2A 2HBZA 3NTXA 4Z3DA 2NO9A 3RNLA 4EPYA 2B0CA 4YMGA 1PX2A 3KELA 1US8B 5K0LA 1OVMA 3KHSA 3USES 1WRBA 5CM9C 4EAAA 4PXAA 3TTUA 5DHAA 5HPYB 2W4IA 4TKZA 5ALJA 5AI8A 1JN0A 3D8NA 1P17A 2C9DA 3S7TA 3HJFA 3W5HA 1GFSA 4OUDA 4HDNB 1Z6GA 1QIHA 1ZLYA 4INJA 5AK3A 3Q11A 4GPBA 5CDGA 2P11A 3OM1A 1YQEA 2F43A 3OTWA 1SBTA 1CQZA 3HKBB 3IDFA 2CYAA 2YUTA 3ZXYA 3KSUA 1JE0A 1YONA 3RV4A 1HR0B 2I2XB 3H83A 5CT8A 4GBMA 3C7CB 3OZCA 1A69A 3M6MD 2E21A 4B47A 1WBBA 3U4DA 2FZEA 2QRJA 2Q1YA 3H2ZA 1L7VC 3E6AA 1K7CA 3ENZA 1VRCA 2QN2A 2IPOA 3FBWA 4C2UA 1XMQB 3VSBA 1U3UA 1A9RA 4XARA 1DAHA 1OUMA 3K16A 2ZUSA 3GLIB 4HSEA 5HP4A 2WTXA 5E8JA 1SC4A 3QVLA 4IG9A 1DMSA 3A6LA 3TRDA 3CTMA 4LG1A 5CDFA 4EJSC 1QRAA 5ESWA 1KWGA 2CL5A 5KOJA 1GARA 2VYQA 3K09A 5KU1A 3T1TA 4HCJA 3EIOA 3FKSD 5FI5A 3NEAA 8AT1A 1M8KA 2JA1A 3MUOA 5CYFA 1DU4A 3VR1A 3I2IA 1YI0A 1A9SA 3FKSA 4LDPA 3NNNA 4RPLA 2ZRKA 3ZNNA 5JZSA 4NZPA 2PXHA 3IMCA 4NENA 4CEHA 3B5IA 3ILHA 3GYBA 1JZSA 4ZAXA 3BULA 1KU6A 3F2VA 3QMVA 4MKRA 1T9CA 4DWVA 1CY0A 4Q1FA 4Z4CA 4URWR 4IFBA 3LUFA 1VJTA 5D5QA 4DPLA 1TVCA 2PX0A 5AVYA 1XRQA 3VTAA 4MUHA 3DC2A 5FRDA 3EWSA 1EFLA 3DR3A 4E5KA 2XUPA 1Y3CE 1YKGA 1CY6A 2QTZA 1WS6A 2ZSIA 3KOZA 2GYYA 3LCUA 1CEQA 3N07A 1XDBA 5J9FA 4MS3A 3BFXA 2AJLI 2EQ5A 3BE4A 1JMVA 3CC8A 3IO3A 2GCIA 3UWDA 1C4XA 1NF8A 4X8MA 4JP2A 3EW7A 4IIBA 1XZAA 3UB4A 3UB3A 1M0TA 5JQGF 2GXSA 1D4ZA 2VHTA 4BLRA 1S3GA 4D8TA 2PS1A 3FVVA 3UJDA 1CUGA 1G7CA 1M7BA 5D7BA 3RDPA 2GERA 1G21A 3P9IA 1HGXA 4QPNA 3EIXA 1F8GA 2C4VA 3LECA 4C0SA 4ZC8A 5FLYA 4I55F 2I8LA 3UJAA 6GPBA 4M9RA 3I12A 3Q9LA 4JD5A 3QMPA 3HUTA 2Z58A 3ZE8A 4I50B 1TMYA 1W9MA 4J0QA 4MTCA 5BQPA 3V3TA 1TUBA 3H99A 4XDYA 4DG9A 2F62A 2Q5OA 4LS3A 3GY0A 3U16A 2NVOA 3M7IA 3PHLA 1GRCA 2X0RA 1JILA 3DC7A 3LP6A 4URUR 4ECEA 2VSYA 2QOEA 3PBKA 3DWFA 1PYOA 1EFHA 3CW8X 1OX5A 2C2YA 4B3HA 1ELOA 4OYHA 3PD1A 4ID9A 2GK7A 4W99A 4HLCA 1XZIA 2OPHA 4NAHA 5A62A 4LMAA 3MS2A 4AZVA 4OX9Y 3T5PA 5H8WA 2ZIWB 1QRTA 2BP7A 1B26A 4MZDA 3AFHA 1QFYA 3PK0A 4KR3A 5C80A 2HMVA 1O8BA 1GTMA 3H11A 4N4AA 2OVFA 1YZNA 2WP8J 3C4VA 3WBKA 1GPLA 1N5MA 1RM0A 2GARA 2EFYA 1AT1A 3K09C 4BP9A 1QM5A 2QTBA 2VTBB 5A3SA 3I0ZA 5IF3A 1BE8A 4GBJA 4BVBA 4JMPA 3SVTA 1A9OA 2QMEA 4OGFA 3NBXX 4D8YA 4CIXA 4BE9A 4UDYX 2D5AA 2I2WA 3R3ZA 2Z4RA 1MA3A 3PDUA 4TTQA 4G5XA 2V7BA 2ZJAA 1SCQA 3NIBA 5AESA 4DUZB 4H4EA 2EQBA 1RJWA 2UZIR 1VLQA 5IC6A 5LYJB 4MR9B 4UE6A 1E7QA 1AGYA 1YQDA 2RAPA 2UYQA 3I3OA 3OFSA 4IDQA 3U4HA 2ASEA 1F48A 2QF7A 2FQYA 2P9EA 2X5NA 2OZKA 1YASA 3NONA 4QYIA 1J8VA 1DCKA 2X4LA 1G7RA 1TYBE 1N4AA 5JROA 3PXUA 5AI4A 3BMNB 3H9CA 4KO8A 4NOMA 4OQXA 1T3HA 3ZD7A 2HFKA 4I99A 2OBMA 1BYIA 3M4JA 1XZJA 5ALHA 5EJ5A 2VT6A 3VYVA 2I6SA 3DE1X 2FPGB 1CJKC 3LPLA 1KPHA 5DEOA 1YB5A 4RD2A 2QTAA 3TD6A 4WBXC 3W06A 1Z25A 3SM3A 3Q9UA 4R2XA 1PFQA 4LJ5A 4IVRA 3HJNA 4FI3F 1D7OA 1MGPA 2Q8NA 1QWSA 2C04A 4NV0A 1VZ2A 4J03A 2ERXA 3SSMA 5IAKA 4YCAA 3HO6A 3VKWA 2ZQ5A 4M87A 4J90A 1X2EA 2W00A 2Z8YM 3PG5A 4WA8A 4DRYA 3LUHA 1YAHA 3I2FA 2D5LA 3NOXA 2NTVA 3PL1A 3UUGA 1WXXA 4FYJA 4FMDB 1AS3A 1VE9A 4P54A 3LFUA 4RNCA 2JPDA 1WW8A 3IB3A 5KYUA 3ZPXA 4BNJA 3VDXA 2YN4A 4Z54A 4DOMA 5BQXA 4IFIA 3GP5A 2V74B 2L17A 4L3OA 4RULA 2FUCA 2YN2A 2CNLA 4Q34A 3ZWQA 1D0VA 3GCZA 1HT1E 2CC2A 1PUJA 2HPAA 3JWIA 5B1SA 5HDQA 1JX6A 4CIWA 3RRJA 2O8BB 4EI2A 3ZWAA 4QGFA 3T61A 5JUWA 3GFRA 4AZ3A 1IBCA 1SXPA 1THGA 2XKBA 3N8HA 3K9FC 2QRPA 4N0QA 4Z51A 1NWCA 4LY0A 1GTSA 4Q9HA 3SC3A 1MN6A 4BJ3A 1W29A 3R6DA 3AZQA 3SF8B 2C77A 3ICPA 3ZVLA 1YR2A 1W4LA 2OFXA 4B71A 5HOQA 4NAVA 1QAMA 4RLFA 4TL7A 5EJ7A 1WB6A 1UXJA 3FG9A 3T0FA 1EBBA 2R6FA 3OLQA 4LDZA 4F4FA 2A57A 1VE1A 2HTFA 2NV2B 2GCNA 3B2QA 2ZXFA 2VSQA 4TMXA 1V6AA 4RZ3A 1FQKA 4XSHA 1K4MA 2J5BA 2F90A 3B3FA 1C9EA 3OPYA 1Z2DA 1BRMA 4LNUB 4ZVTA 3ZGVA 3E0XA 1ISHA 4FUQA 4IXTA 4TKVA 3D1JA 2DUWA 3I2YX 4N18A 1A0OA 1Q0RA 4MW1A 4L4SA 4E5NA 1L8AA 1SH7A 3OEYA 3ETCA 1G2IA 4H7JA 1JEQA 3OZEA 2MR5A 1U28A 3IJ5A 1U6JA 3HYRA 1DLIA 3IAHA 1VE5A 4MB6A 2C1XA 3AFOA 1Z6PA 2NIPA 2Q8PA 4K3VA 4IIEA 1CR0A 4W7HA 4ZI5A 1K89A 2WOJA 1PX0A 1EVKA 2JASA 4Q4HA 4LY3A 4RGBA 5KQSA 1J9ZA 5F98A 2IE8A 3A70A 1B14A 4LNHA 2CD9A 4IYJA 2WD8A 5DWVA 4KQHA 3SXUB 4AXBA 2GF0A 3IBFA 2X9VA 3MCVA 1V6CA 4F9TA 3IT1A 4DC0A 1G3QA 3R8XA 1EGAA 4YMHA 4BFWA 3DSRA 3EZ9A 4B8WA 1OW3B 3FSEA 3QJGA 4TWZA 3V1UA 3C7DB 1AKRA 3FCEA 3JCZA 3C16C 4K03A 2ESRA 4Y2GA 3RF7A 4BKUA 4RJIA 1W4RA 4MQEB 4OP3A 5D1HA 1SPXA 3HVJA 1HL3A 3DKPA 3ICWA 4R1TA 4E70A 2R66A 4EKNB 4UAJA 4EGCB 4AX4A 1YFJA 3U56A 4AUNA 2OOSA 5H80A 5HTKA 1JG2A 1WDKA 1PGNA 3BXPA 1W2WB 2J07A 2Z8ZA 4DIMA 5EKDA 3P0RA 3ENKA 3C4JA 4WH0A 2V3CC 2VC2B 1IHDA 2VPPA 1E5DA 2DLNA 2UZ3A 1BWRA 4PZYA 5HK9A 1PIWA 2XYQA 2AR9A 5EIBD 3IAS6 2O50A 5MFZA 5JTUA 1IUOA 1ES9A 4RHUA 1KVRA 4RJ2A 3RO7A 3T3GA 3G2KA 3IV6A 4J2HA 4WJZA 4Q9IA 1EP2B 1L8OA 1GYPA 4LOJA 2ORYA 4GKBA 5IXJA 3WRWA 4R7GA 2JFFA 3AJEA 3OBBA 2OY0A 3E0QA 4IHJB 4NNOA 4NOLA 1CJUC 3GELA 4TV9F 2I55A 5IZCA 1AMOA 5J5VA 2BTEA 4O4IA 3DM9B 2IODA 4FOOA 2JI8A 5AWFC 2SKDA 3FLAA 3OHMA 5FB3A 1SUWA 4CM8B 1TADA 1U1DA 3WGYA 1SURA 3WZMA 4YHHB 1UJCA 3MPOA 5IANA 3LX6A 1NP6A 2QD3A 3GK3A 3STHA 4EA6A 2V0GA 1GZ6A 1DV2A 1NW5A 2GD0A 1QB7A 2ZJ1A 3DOHA 1WPQA 4NCBA 4FQ7A 3ZY2A 4BO3A 4YCLA 5D3MA 4EYQA 4HFJA 4TZTA 5DV9A 1U28C 4J0JA 2VDWA 1HSZA 3W8DA 1T0PA 1MRNA 3R9XB 3Q3JB 3AINA 1IJFA 1IN7A 1AKEA 3K05A 4Q00A 3WNQA 1EWTA 2JLXA 4XUDA 5C3UA 1S9HA 3IUPA 4GXTA 3T7IA 1BXRB 2DAPA 2IWRA 4YWHA 3QA3E 1LX7A 2I6QA 3TF5A 1Z68A 2RHDA 1IONA 2YRFA 1CD5A 1KVTA 2GZRA 5C8YF 4AJ4A 3CHYA 1PRYA 3QX8A 3MTIA 2QUJA 2JCVA 1PL8A 1E9AA 5JXHA 1R6VA 3INGA 1YR8A 4IIFA 1PVVA 3PRJA 1JR4A 2BI8A 3LT5A 4UBMA 1YS7A 2G07A 2EIHA 2YHIB 4PQRA 2WTNA 3BWXA 1X1QA 3ZH9B 3P45A 2PSJA 1I2AA 4HDMA 3HB4X 2APJA 3DZDA 3UXEA 1T35A 2QM3A 3WMWA 3P0EA 1AMUA 4ZN6A 1YWGO 3AEQB 4MNTA 4DAEA 1N2CB 4FDUA 1E5VA 1R12A 1WG8A 4I5FA 1TMGE 1YAJA 4P3PA 1X0XA 5FFFA 2NZUG 2JD2A 4F9GA 4UNRA 1I3KA 1AB5A 2HF2A 4FCWA 2PK3A 1XU7A 1ILEA 2IYWA 2F3PA 3ROQA 2VJMB 4C08A 3CSUA 3PC7A 5CR9A 4S1PA 3UJPA 2MSLA 3T9AA 4RTSA 2ZR7A 5EIBC 4CF5A 2G8LA 5IXSA 2WRZA 1L7PA 1T1GA 2ACWA 4ZVUA 4X8HA 3ZTWA 1Y3BE 2DSTA 1II9A 3V97A 2GSDA 2J31A 4HLDA 2ISQA 3ANNA 2ASVA 3QXCA 3MSXA 3GPCA 1T9GR 2EGUA 4X6XA 3VM6A 2JFUA 1C7RA 2XYGA 3HKCB 2ZIVB 5IZCC 3MBOA 4UUAA 4PPNA 1MB4A 4I9HA 4Q1AA 4GAEA 3FCCA 1B2LA 1WDMA 2HA0A 4IHQA 2FZKA 4ZU6X 4IPTA 5FBZA 3W5UA 2VBFA 1UXIA 1E64A 2DC1A 4NCIA 3ZU5A 1E9DA 2YHSA 4BXOB 1YB7A 3DCYA 3EC1A 4F4UA 3USCS 1I13A 2VHEA 1N0WA 4QKQA 3NFRA 1W8DA 1ZJ6A 1QZ3A 2PO7A 3EMBA 3IBTA 4X44A 3N2IA 2H1OA 4EY6A 4HHEA 1UEIA 4QUHA 3UJBA 1EP1B 2DR2A 5I7AA 4R71A 2F8LA 3WK6A 2V4MA 1E5LA 2JLQA 3QVTA 4FNOA 2GLUA 2EOAA 2QPLA 3KQUA 1DCTA 5ITZA 4X60A 1FFYA 1OYVA 3HV2A 5DHFA 1QZUA 4YLEA 4QU9A 4RSHA 4LV8B 3O8OB 4B3XA 1PKXA 4GPTA 1W93A 4AY6A 2YMMA 2V9ZA 1OTXA 2ZI4A 3SOZA 3WLQA 4FDMA 2RBKA 3O38A 1USGA 4WDQA 5DTRA 1GDHA 5LNK6 2R8ZA 3EYAA 5GAJA 4NSNA 4TPKA 1E2NA 1HKUA 1SQSA 1VG1A 2ZOSA 3GEIA 3HB0A 1FMJA 3JAKB 3K0FB 4ZCQA 3IDQA 4KOEC 1HK7A 3URKA 2JIMA 4CMIB 3K8YA 4YB8A 1ZLXA 2L82A 1JHMA 4X00A 4J76A 2GXAA 2DUMA 3RYTC 2JD0A 2AMFA 3G85A 3K94A 3LH5A 2EG9A 2BYTA 1YHZA 1XRSB 1ZGBA 2LDBA 3GJQA 4BNTA 5CNIA 1LB1B 1JQJC 1P1KA 1WWKA 4I5EA 2ORIA 3TD9A 2HXSA 2LCFA 4KR9A 2WOOA 2JEZA 3VTZA 2W83A 1B6RA 4ON9A 2P6OA 4JEIA 1A1VA 1OX6A 4I9NA 2JI6A 2Q5IA 3MBKA 4J0FA 3N28A 3EA5A 2ZUVA 3RVSA 2C82A 1SKYB 3HVHA 5CT5A 3O2JA 5DK4A 4DTCA 2AHRA 3HXLA 5HZHA 1Q1GA 4LCJA 5DK6A 4DLRA 4YUAA 4RTLA 2A9JA 3SZOA 3UJ9A 2DSNA 1PD1A 1TTQB 4HPXB 3F6EX 2F67A 2R9VA 4KBGA 2P6MA 2P5UA 2VP5A 4MYTA 4OAOA 3GD5A 1O9GA 3EF3A 3JAWB 4B3MB 2NSJA 5GGXA 5AXCA 4KRFA 2HXYA 4OSPA 3V7UA 1CUIA 4K46A 4YONB 1NNLA 1JDPA 2X22A 2IUSA 2F1HA 4JL5A 3N0TA 4X45A 4ZAZA 3OX3A 3UENA 2VF2A 1Q3HA 3HDQA 3TTWA 2X4IA 3HDYA 5EQFA 2QS9A 2ODQA 3PXCX 3WWYA 2QMHA 3GJZA 3DONA 5LBUA 4ISCA 3IT3A 4MUGA 3N0VA 4EKEA 3M6FA 1RKXA 5LZ9A 4RPGA 3TBFA 5AVUA 4EBFA 3FMFA 5K0FA 4WZ6A 4YBRA 4Y1EA 4JB0A 3PHGA 4MWSA 4C7MA 4W1SA 1V8OA 1NULA 1VBKA 3M5DA 1HLGA 3N3AC 3QE4A 2GPYA 3WNZA 4JL6A 1LLCA 3PUXA 4FNAA 4N76A 1X1BA 3MMNA 4X1YA 4OIMA 3QFSA 4GPEA 2ZUUA 4OHKA 2VEDA 1UKAA 4G1CA 4CCYA 4DRZA 5JSYA 4TQGA 4JLAA 2RG7A 4E5SA 3QGMA 3P19A 5EINA 3L1HA 5C35A 1BW9A 2Q99A 3AW9A 3OC6A 4HXGA 5B1DA 3BZWA 1A9XB 3THYB 4B4VA 3SYRA 4RJKA 1GD1O 1AOXA 3IOCA 3AI7A 5JQWA 4EDHA 3CIFA 3IVCA 4MVJF 4P4LA 1MQ9A 5F1KA 4AMGA 3UMCA 2ZXUA 3QKSA 3U31A 3A2NA 4EB6B 5JD5A 3GBVA 2RGEA 2W6ID 1HYGA 2R25B 4QGAA 2WD7A 4RK0A 1SQFA 3PGKA 3R75A 1PUIA 2YY5A 1X42A 4YRIA 2O8CB 3WZLA 3CEPB 1M5UA 2BEWB 2AEMA 4D57A 2A88A 3FY4A 2C84A 2LPMA 1T6BY 4P35A 5J1TB 3W2FA 1C2TA 1E3LA 5TQ0A 1U9CA 2XGMA 2XX3A 4ETNA 4M0LA 3E3OA 3GF4A 4U2BA 4QTYA 1SCAA 3KHUA 5T4BA 5FV4A 1P80A 2OMKA 1PFGA 1TA0A 4L57A 4QPDA 1KWKA 2CYCA 1G8YA 5CU7A 1ZX1A 4N6OA 3EAFA 1XJCA 4C07A 5HCUA 2IUTA 1RXWA 4C06A 4H0CA 3Q7SA 1EWKA 4K9MA 3R7NA 1JEDA 1N92A 1W88A 1Z8DA 1MAAA 4BRSA 1E2BA 2P4EA 2XGJA 4R9UC 2BEKA 4WVFA 4WOPA 2FFBA 4K28A 4QELA 4CMHA 4RL4A 1U0SY 1P0FA 3GLVA 5FUBA 4DXHA 2R2GA 5C8ZA 1OB2A 1W36B 3QVWA 2BKUA 2GJSA 3OE7D 2EFJA 2OBYA 3FKQA 2HRCA 4RQBA 4L9SA 3WB1A 3OE7A 1QCCA 2FLVA 2YMLA 3A2KA 5BY2A 4YJ2A 4EAQA 1L5VA 3K1YA 3EMVA 4KO4S 3WZ2A 3DWGA 4OJQA 4TUYF 2W2XA 2DR3A 3UXMA 3FNQA 1G20E 4I3HA 2NNLD 2Y8EA 1E0AA 2WT8A 6Q21A 3QWFA 1IEXA 1RI4A 1ODIA 3RFFA 3OP4A 3FPKA 4R98A 4X7BA 3T9BA 2BBWA 2XQFA 1EPUA 5WRFA 1E5QA 4BVHA 4DT1A 3C3JA 1I94B 5FPHA 5K0EA 2R1ZA 1JJ7A 1JA9A 3BHNA 3D6MA 4Q7EA 3RC9A 1J49A 5KPDA 5FWYB 5CPBA 1XPRA 2H0AA 1XZKA 3C0KA 4D3SA 4I1PA 1T4CA 2ZZNA 1SO8A 3D3EA 4LZZA 5B37A 4ARUA 5D5HA 4ENUA 2ODWA 1XTUA 1B8UA 2FFJA 2DTDA 5ALUA 3C1UA 3GT3A 5MDHA 1OI2A 1SA0A 1V3UA 1V16B 4X54A 1DEOA 5B30A 4KX5A 1M6YA 2VK4A 3G88A 4S1TA 4MICA 5E95A 5F4BA 2R00A 4BX9A 1I2CA 1QS0B 3KQYA 4M6WA 4PYNA 4YASA 5F5NA 4YRSA 2UXDB 4J0KA 4TMFA 3AHDA 2QZSA 3FWHA 1WCWA 3LQFA 1LSOA 4V1CA 2EZTA 5CVDA 1VCIA 2J9ZB