1SC3A

Crystal structure of the human caspase-1 c285a mutant in complex with malonate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 47
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sc3A00
3GJQA 2XYPA 2CDRA 2HBYA 2QL7A 4D3ZA 5LU9A 5IAGA 4D3XA 4EJFA 3NR2A 4QUJA 3UO8B 1RHRA 2XYHA 4QUGA 3ITNA 2C2KA 3D6FA 4NOMA 1QDUA 4QULA 2WDPA 3R6LA 1CP3A 1NW9B 4N7MA 2DKOA 2QL9A 1RWVA 3NKFA 4I1RA 5IARA 2NN3C 4EHKA 3DEJA 4QUDA 2C2OA 3EDQA 1RHUA 4ZVRA 2FUNB 1SHJA 1RE1A 3D6HA 3NS7A 4JQYA 3V3KA 4EHFA 4HQRA 3S8EA 1F9EA 3R7BA 4NBLA 4NOKA 3UOAB 4N7JA 3V55A 1SC1A 1RWWA 4EHHA 1RWKA 2H65A 4JJEA 4JQZA 4EHDA 3D6MA 1ICEA 4N6NA 2Y1LA 3IBCA 4QU0A 1RWXA 2FQQA 3PD1A 4ZVOA 2CNNA 1SC3A 3P4UA 4DCJA 1NMSA 2HBQA 1RHQA 3V4OA 1I51A 2QLJA 3SIRA 2QLBA 3DEIA 2CJXA 1K86A 1I4EB 5K20A 2H5IA 4FDLA 1RWMA 2XYGA 5H0IA 3V6LA 2CNOA 5IBRA 3H11A 1CVRA 2J31A 5IASA 2H4YA 4HQ0A 4ZVQA 4EHLA 5IAKA 4QUIA 5IC4A 1KMCA 4QUEA 4QTXA 3V4LA 4D3YA 4NBNA 4JR0A 1I4OA 2H54A 3H0EA 4N6OA 3R7NA 3E4CA 5LUBA 2XZTA 1SC4A 2H51A 3KJQA 4JJ7A 3R6GA 4IYRA 2C2ZA 2C1EA 4PRZA 1PAUA 3V6MA 4QUHA 2J33A 3P45A 1NMEA 4FEAA 5IANA 3H13A 1JXQA 2C2MA 2QLFA 2P2CA 2HBZA 1QX3A 3K7EA 1GFWA 2CJYA 1QTNA 4DCOA 1K88A 4JJ8A 4PRYA 1RHJA 3OD5A 1F1JA 2Y0BA 3PD0A 4NOJA 4AW9A 2QL5A 3GJRA 4EHAA 4JR1A 4DCPA 3R7SA 2CNKA 3EDRA 3IBFA 4ZVPA 4QU5A 4QU9A 4ZVTA 3PCXA 1GQFA 2XZDA 4N6GA 4EHNA 1RWNA 4N5DA 4QUBA 5IC6A 1SHLA 4AWBA 3R5JA 5IBPA 1BMQA 3GJSA 3DEHA 4I1PA 3H11B 3S70A 5I9BA 2AR9A 3R5KA 4M9RA 4JR2A 2H5JA 3SIPA 5LUAA 2HBRA 3KJFA 3KJNA 4ZVSA 5JFTA 2J30A 4NBKA 2H48A 1NMQA 2H4WA 4QU8A 4QTYA 2FP3A 4HVAA 5IAJA 2K7ZA 1M72A 1RWOA 4LSZA 5IAEA 4ZVUA 3BIJA 1RHKA 1RHMA 3DEKA 2J32A 5IABA 3GJTA 5IBCA 3QNWA 1RWPA 1I3OA 4NOLA 3RJMA 4PS1A 4FXOA 3H1PA 4PS0A 5I9TA 4IEFB 4QUAA 4AWAA 1IBCA 1PYOA 5LU8A 4JB8A 4FGUA 2CNLA
chains in the Genus database with same CATH superfamily
2C5HA 2XYPA 3NWBA 2HBYA 4FR2A 1BEEA 5AJZA 3ZW9A 3GLFB 2O1XA 1VCIA 1ZD2P 3G8AA 4QPPA 1USUA 4WADA 3DZFA 3RK1A 3VMFA 1CE8B 1W36B 4MRMB 1TM5E 2C8JA 1K2WA 1NXTA 4GYWA 3AZOA 1VOTA 2QL9A 2DH6A 2BN4A 3TQSA 3BHNA 3ZY6A 3H1AA 1PWZA 1ULSA 4FGWA 2WINI 4M1MA 4YAIA 4DMCA 4PHFA 4IUYA 1E62A 1SC1A 4UTXA 2GEUA 4J7CA 3I01A 1UK7A 4G0ZA 2C0QA 2NQTA 4JT9A 3V2GA 1XPOA 1WMEA 1DRVA 2HLPA 5DP2A 4MWOA 4WDQA 1PK9A 1P2FA 2QW1A 4FHDA 2Q2VA 2YRWA 1GAEO 5JJKA 2W2OA 3K1YA 5ALDA 2B35A 2EJWA 1P91A 3PFIA 3Q5DA 1X8LA 1SKBA 1GT6A 1ZBDA 2B6HA 2J07A 3NKLA 5JAMA 4NQRA 1XQXA 3C1TA 2ZUWA 1L5OA 3IO5A 1T43A 3KR0A 4L4SA 4W5NA 4PPQA 2VRCA 5DHUA 2Q7DA 1ZM2A 3G2QA 4DQDA 2OFOA 4B6QA 1JDBB 1HTBA 2ID9A 3F6RA 5THKA 3VISA 5GJBA 3GT3A 2GPBA 1UFVA 3DOOA 3CPHA 4BAZA 1RJ9B 1H8EA 2RG1A 3ED5A 3EE6A 5AM4A 5DYGA 4Z54A 4X20A 1HEUA 1U02A 3CLKA 4PVDA 5C3MA 1NKTA 3KE8A 3M2PA 1E3WA 3EC7A 2ERYA 1NW8A 4D4MA 1YWGO 1R50A 3VUEA 1SVIA 3QJGA 1B3BA 4FNOA 4XX0A 3KAQA 2IZ1A 3WL5A 1KKUA 4F6CA 5IWAB 1WZNA 3ZWWA 3DT9A 2UZAA 1WZ2A 1NKSA 2RKWA 5FDFA 1GTRA 5T57A 3T3DA 5B6JA 5D3ZA 3TPFA 4CTOA 2ZP1A 5A06A 1Q92A 5I7OA 3GLFA 3E70C 3CG0A 1XDGA 4YJFB 5HG0A 2HA5A 1LRLA 1GV1A 4MAAA 3EWAA 3L7OA 3RIMA 5AVKA 2EJUA 1F1JA 3H5LA 3PD0A 1H1DA 4D44A 2GSDA 4L0CA 2OESA 4LYGA 1Y6RA 1KYZA 3E2PA 2M6SA 2IS1A 3J7TA 4YO7A 3A04A 4Z2YA 2QP9X 3NTUA 1J42A 2E2WA 3KZ1E 4ZODA 2CMKA 3TOXA 4GMDA 1SHZA 4QIHA 1EE2A 2Y99A 3WQSB 1GEGA 2AS0A 2JJ1A 1WSDA 4P4GA 4PX3A 4QLOA 2C77A 5FNVF 3SOPA 3E7DA 3KG2A 3FUUA 2GN2A 4RF2A 3RVSA 1KBZA 1RI5A 4J0JA 4RFLA 1T36A 3E9YA 4EB6A 3FIUA 3ZY5A 2CL7X 3VNVA 3PXBA 4YONB 3T7CA 1II0A 1WKBA 3B6KA 2CK3A 1SVOA 2HQBA 2VP0A 3TLEA 3PKIA 1RP1A 1CZRA 4JLSA 1V16B 3SZ3A 1N2JA 1A98A 3C3DA 3W6ZA 3DMFA 2JGEA 2C7BA 1JIUA 5LA6F 4BLWA 3JQ7B 1PV4A 3EB9A 1MPXA 1K6XA 2CL5A 4MA4A 3W5VA 2WT4A 1KR5A 3DT8A 1GL9B 5AI6A 3ZHUA 4EYEA 3KB1A 4UFNA 4TXHA 3SN6A 4E2XA 2FQXA 3R6TA 5BN3B 3FTFA 1BS9A 2MSNA 3HCOA 3EDMA 4PBRA 4BO2A 2YOHA 1J7KA 4ZEXA 3T3NA 1RIFA 5IJ9B 2P4EA 2XWSA 7YASA 1AV7A 3M4YA 2VATA 1AQYA 4IIFA 2QTFA 1HEYA 1POXA 2FZKA 3W6OA 3T3OA 1PQUA 3AY0A 1CP3A 4UOQA 3WVNA 3D9QX 3HCAA 3M4JA 3KKEA 3MPOA 1TM3E 1RRFA 1B6GA 1UMDB 2B78A 1Z07A 3QG1A 1XA3A 4V0QA 3FW1A 2PEYA 5G3ZA 1RXVA 2ZSBA 2RHWA 3KSUA 1C7JA 1O9GA 4K6GA 3PC2A 5JCOC 4BNFA 1XJQA 2E5WA 3PNBA 4IJKA 2WE7A 4OOFA 3MJFA 1C5KA 4OJTA 3RAGA 2AF4C 2IT1A 1X74A 2PZBA 2QTBA 3C5CA 3DKVA 1HE2A 3EVGA 5CDTA 3LC0A 3LQ4A 4AS1A 4M89A 3FPSA 4KHZA 1IEQA 4KQKA 3NP9A 5B30A 4MJ3A 2ZTVA 2ZSEA 3PFNA 2NO7A 3QV1A 5J2UB 3ZCQA 4OKNA 3RG8A 4KSBA 1QYXA 2KMLA 3VOBA 1CUUA 1AHNA 3RBZA 3VPDA 1I4TD 5D7BA 2DBVO 2PSSA 3GJYA 1T5IA 1O87A 2CNOA 2JI7A 3NTQA 1G0NA 1VRCA 4CCSA 2CCJA 1FFHA 1XEAA 4HH3C 3FYDA 3DM9B 4FYIA 1NBAA 2YQ4A 1SRRA 5AOVA 3JQRA 2XDQA 1OTXA 3L6UA 3ETCA 3VR4H 4C2BA 1IUPA 1TTHA 4XB2A 2BONA 2WV9A 2AN5A 2B3TA 1U8FO 4B9EA 1T1IA 1V11A 3R3XA 4K2HA 1BXRB 3NHZA 3O4JA 1SJ9A 2BMFA 1Y3BE 3LLCA 4ZAVA 1FYXA 3LO5A 5DM60 4LJSA 3W3AD 5JZBA 3Q4GA 1N9ZA 4BVEA 4F3YA 3GUUA 4D9BA 1AGRA 2ZRMA 3QLVC 3S1AA 1N2EA 3WK9A 2ANCA 3MJSA 2OXRA 2R8BA 4BGUA 1ZI9A 4MCIA 1BS2A 1A7KA 3C0KA 1ZW6A 3O2QB 4RE6A 4MS3A 1ISSA 2XWQA 4RJLA 1VL2A 1AUOA 1G6OA 2IXDA 3HLTA 1E1DA 1H2RS 4DM4A 2PH5A 4IGEA 4RK5A 2ZYRA 4RK1A 5PGMA 3TAHA 4DSZA 3RW9A 3TMYA 3WK5A 5BRJA 1EFCA 3C5VA 4IQ8A 1MXHA 1WEKA 3EGDB 5IT9A 4AF8A 1IDOA 2Z5FA 3FPCA 1KMMA 3I76A 4R68A 2FPIB 2V7QA 4NU5A 4AAYA 4YIHA 2VLIA 4A6DA 4YHBA 2OA0A 4ZCTA 2OLKA 4WKCA 3TZBA 4NBKA 1FFWA 1BWRA 4IILA 2CXSA 4TLEA 2HSWA 4IIHA 1Q0TA 4PC3A 2OCAA 5FADA 2OL4A 4PLYA 1B26A 1L1EA 4YN3A 3RIYA 3GA0A 5ELMA 3P9RA 3MQ4A 4ZOAA 3MMNA 4WL0A 3R76A 3TTSA 1XPRA 1X1BA 3AR8A 4BBZA 2QRKA 4XM2A 3N53A 4YLEA 3MLBA 3PIIA 2AR0A 4AWAA 2F1OA 3FYCA 1ZGGA 3O4VA 2VF4X 2XB6A 3I5AA 1ML3A 3E05A 3ECAA 2I4TA 1ZKMA 3R5SA 4KPUA 4P9NA 3W5CA 2OFWA 4CEIB 3WKCA 4KVFA 1QZTA 5BR4A 5FUMA 2FLWA 3EVBA 1SBHA 2JD2A 4EUKA 4F5ZA 4XGNA 5E2AA 2VDOB 1NXWA 3ZI7A 3OZAA 4MO9A 2ACEA 4KN9S 4B2LA 2OGSA 2ZRFA 1YDEA 2J4DA 1NSTA 2TMKA 2PBZA 3C3MA 3HDTA 2DKFA 3OF5A 1N3LA 4RKYA 4GPAA 3ZWKA 4ENVA 5BP7A 1NMZA 4RPIA 1H6AA 2FPIA 4PYNA 3S8YA 1V3TA 1L7AA 4FHGA 5EVCA 2Q4EA 5BWNA 2GLTA 3LIPA 4IV0A 4YAUA 4Z4QA 4RPGA 1QRSA 2Y1XA 2B2NA 4DLWA 3GLHB 2CV0A 5CA1B 2ZJYA 5ARDA 1KI4A 2QF7A 1KRWA 1IEVA 4MW5A 1Z88A 4RSHA 3I28A 4DPKA 2P1RA 3OQ6A 3LUBA 1B73A 2VHYA 4PEVA 5IK2A 4C76A 5JCZA 3C4QA 4HN2A 1GFSA 1P1KA 1ZITA 3DTVA 4EUNA 3R8CA 3HXPA 5FOTA 4KQHA 1UAYA 1DAMA 4KQIA 4MR7A 3HKDA 4D9IA 2O54A 3WBBA 3FTCA 2WJYA 3WNDA 2GK3A 3CLRC 1I1NA 1C1XB 4HB0A 1G20B 5ESXA 1I3KA 2CY0A 2Y2VA 4EY5A 4QPNA 3KSRA 3WO1A 3VFDA 2JIDA 4ZJYA 5TLSA 1RJDA 2FWBA 1Y1TA 4I0WB 3WMGA 1E0KA 1BO6A 1LJLA 1XTKA 2ZITA 3OQPA 4BX0A 3EIXA 3AY6A 1ZK4A 4PX2A 2ZREA 2HYDA 4Z3OA 2H51A 1J2UA 2PIAA 1Z4IA 1OWPA 3K6KA 3K09A 4NEHB 1GTMA 4OJQA 2JBAA 2O9JA 1FPQA 3M9XA 2Y1OA 3GMSA 3PHGA 3PD7A 1N4AA 1R6TA 3PQCA 5CX1B 4TT8A 1RYZA 1ORRA 1PO7A 5F4BA 4D9FA 1RRGA 3RHFA 2IJGX 3OG9A 3D4LA 2Q62A 5J1TB 2OXIA 4JI7B 3F6EX 4KQ2A 1NXOA 1P4HA 2HDNB 3B2NA 1OX4B 1RHJA 1A4XA 1X94A 1ZFNA 3NLLA 3ZQ6A 2C5SA 5FFNA 3DTVB 1Z2OX 1Z4QA 3DC7A 4NU8X 4TKVB 4B3BA 1HYQA 5AVRA 3B9RA 3K4HA 2O8DB 2VK2A 3ASUA 3DO8A 5BXQC 1EXNA 4WK4B 1BNCA 4IR7A 1GU7A 2RHTA 3IQHX 4LWZA 4DCGA 3AIIA 1P7VA 1U9ZA 3NWEA 2UUCB 3EVEA 1QYVA 1P5JA 3INGA 4KXLA 2BSQA 4WLEA 2VJMA 4DLAA 4DIMA 4FDUA 2W6PA 2OV2A 3IOEA 4BQRA 4CMEA 1W6RA 2ZVJA 5DYWA 2J30A 3KYBA 3LXRA 4HTFA 1SMKA 2M32A 2QD2A 3PX2A 2FWJA 4AJ1A 4B8ZA 4DOMA 2MDTA 3VYVA 3RWBA 1WD7A 4ACBA 1JVBA 1Y81A 2W0MA 1KAEA 3IP9A 3ROQA 3T3HA 2RJNA 5HE8A 3K71B 2ERCA 1X9GA 4NE7A 4RYDA 2XSZA 5IBCA 1S8NA 2IZ7A 3CRZA 1RWPA 4BN4A 3KS9A 2P0EA 4G0MA 4V0LA 4LFBB 2KPOA 3AH8A 1YULA 1DX9A 3WGLA 1QRRA 3ABZA 4NBWA 1WULS 4I1IA 4NV3A 4Q3KA 1TLLA 1GAXA 2YJ3A 3I04A 2HA3A 3OC0A 4KN8A 5IAGA 2J3QA 4KUHA 3U4QB 3OWOA 3HN6A 1IMOA 2CLMB 1HTWA 4MWZA 4R2LA 5IFKA 3VTZA 3GEIA 4UUAA 1IY1A 1R88A 1V35A 1XZBA 4EJSA 2J9ZB 1NW9B 5AYVA 3TIFA 1JKJB 3D5EA 1DKLA 3WIDA 5DSZA 3KV1A 4DB4A 1EWVA 1PR9A 1Y7HA 3F1KA 2BFEB 1YVPA 5F9FA 3WNZA 3TLJA 3EDCA 5DE3A 4EMSA 5F5NA 1SC9A 4O59O 1I2DA 4L8VA 4Q7KA 2AQHA 3DZBA 4B6JA 4Z99A 1X1TA 3OEYA 3JAWB 1G41A 2G36A 4GE3A 5THQA 3TGPA 3L9WA 2XTJA 1PUIA 1T26A 1CUVA 4ZC1A 5I7HA 1BDBA 1J2TA 3LV8A 2F6RA 1EJ0A 1EX6A 1YJBA 2HTEA 3GUZA 1N9KA 1P2TA 3F5FA 4KE9A 3S99A 4ETWA 4M49A 2WM8A 4MDEA 3ZJYA 1T9BA 1TVCA 4X3PA 2JFNA 3VU9A 2PGDA 3U9SA 4MRVA 3UMBA 3EIQA 4BN0A 2Q46A 5I7UA 4EPRA 2FFJA 4JJGA 5EIWA 3D5TA 1XRRA 3T5GA 2Q41A 1V4VA 2CXOA 5A0FA 4R2JA 4U7JA 1ZS9A 1OC2A 2BMDA 2FYTA 2IC5A 4P3KA 5J2TF 1ML4A 4WZ6A 2PUCA 3ADDA 4RADA 4IIEA 1DARA 2Z57A 4TV8B 2I4IA 3TL2A 4EHJA 1JEAA 1ZWLA 2D4AA 4HX2A 3GUHA 4D80A 2E49A 4FW8A 4OHZA 3DLTA 4NG5A 2G76A 2C5AA 1JBQA 2R5WA 1KVTA 1LCIA 1MJNA 1U1EA 1Q1NA 2I1LA 4Y6OA 3HI4A 1OH5A 1PFQA 4JVLA 4O4JA 4GI1A 4B4OA 4F8YA 4KCGA 2BGNA 1C1YA 4HDMB 4A82A 5ALOA 2PH3A 5KNDD 1C9DB 4IIJB 1KI7A 1E2KA 1CUBA 3U13A 1LV7A 2E87A 2ASVA 2Q1SA 1TEVA 4LNUA 5E7JA 5LYYA 4DKJA 2Y0BA 4HNGA 4UMVA 4F91B 4U8HA 4KZKA 1ZM3A 2CD9A 3PYXA 4XIGS 5FT9A 4BZXA 5CFQA 1P0PA 5JRJA 1N6IA 1XVUA 1B0AA 3ZWDA 1U4OA 1P39A 4TMTA 4BVKA 3VPFA 1I13A 2AOVA 3LIIA 5LD2C 3O8OB 2QQFA 3I6BA 3VSAA 1MHPA 1RZVA 2FA9A 4ZIRA 2CSXA 1P4SA 1Z4LA 3R5XA 1NN1A 1JAHA 1SUIA 3VU1A 3TVYA 3TD9A 1Y6ZA 4P7KA 1NDQA 2F43B 1Y6QA 4RD2A 3ZQ4A 3B1FA 4BGEA 5C9ZA 3CSSA 2WKSA 1FP4A 1SVWA 3G9TA 3O2SB 4OGKA 5B12A 4K03A 4ZTZB 3DVRX 2QMEA 2BFFB 3KEQA 1D4FA 2GF2A 4HLUA 4HVAA 4IKPA 4U63A 3RNOA 3VR6A 4EW6A 2FQ1A 4YRSA 1LLQA 2CLEB 2B99A 2O5CA 2IZ5A 2VYQA 5EJ2A 3UAZA 2H7VA 5FI1B 2RJOA 4FGKA 3DD5A 1I01A 1VLZA 3RUAA 4BO7A 1NUPA 4MRAA 3PXUA 1TJYA 1NBEA 1KYWA 2VDQB 4RVUA 3TINA 2NU6A 2IGTA 5BVGB 4GQAA 1XCBA 4IYJA 5DEOA 1C41A 3BJEA 4P3PA 4CF3A 2OO7A 3QPVA 2IBTA 3E58A 4GR5A 3QBTA 3PNKA 1DEAA 4LYYA 3NDPA 16PKA 1MO6A 4UEJA 3O4RA 1YU6A 2N1BA 1JDVA 1VBFA 3EPKA 2VHEA 1FX0B 4XDGA 3TMAA 3GVHA 1FDUA 1K9VF 2O2IA 3L4SO 2J3JA 1QE3A 2O8NA 3EDQA 4IDFA 3QP9A 5EJGA 3WGQA 3WGUA 1FDTA 5KYYB 1YR6A 4KPYA 4C7MA 4P31A 4KITB 1GRVA 1YUBA 1XTUA 3D3QA 2OK7A 3QWFA 5D8DA 1FXWA 1WSAA 4NIMA 5DBGA 5U1PA 2RC5A 2XTMA 1CY1A 5EIFA 1P44A 1DCTA 1T9HA 1VHWA 4FWIB 2ZR7A 3F4KA 4ABTA 4KMRA 1KNQA 1MB9A 3C24A 2CN1A 3FRIA 3F3YA 3AVXA 3I1JA 4YAEA 2IS2A 1SCKA 2N47A 2CXQA 2L0XA 1QR2A 3SQNA 3VSCA 2CFTA 3ZDQA 2R00A 2JL1A 1XHFA 3AEZA 4ZGBA 3GT7A 1RMTA 4G1BA 1Z45A 1GSOA 4KSCA 2WG0A 3L5KA 5EZ5A 3ET5A 1EHIA 4X64B 1FZQA 2JKZA 1B8VA 1VI6A 3V7YA 2WU4A 2EV9A 3M5PA 2OP0A 2AJDA 1L5SA 1QIEA 1V8BA 2ZI5A 3LA8A 4I55A 5HA5A 1QHGA 2C3UA 1ZLYA 1XTTA 3LOQA 2PZEA 2R8RA 3KWLA 3D1JA 3UXEA 2AQIA 1M8FA 1UJMA 1W49A 3T06B 2QW0X 3ZUGA 3CCBA 2HJSA 1DMRA 1HE3A 3BK7A 3SQOA 5L3VA 2BT4A 1Y5NA 1R4NA 1KI8A 2NUAB 1OUMA 3GMIA 4L9SA 4L74A 3R9KA 3IEVA 3I8SA 5COAA 3SPXA 1FFCA 3T3GA 4P0PB 3CX3A 3H8JA 1Q5PA 1DO0A 4KE6A 4EO7A 3EHEA 3GAZA 3QLUC 4WLVA 2FRVA 3OPXA 4Q16A 2EWWA 4WN3A 3ROKA 2X7JA 2O7RA 1RADA 3HWWA 4LVOA 5AM5A 2ETXA 2GTHA 1YBMA 2W37A 2Y0DA 3D31A 5ALQA 3CISA 4BVJA 4RTPA 4WZBB 3OQHA 3QEKA 3A1EA 3IV6A 2IZ6A 1NYLA 3OIGA 4WZAE 5I9SA 1T9AA 1L4YA 2CVOA 2RIRA 4UM8B 1QAMA 4I08A 4YNBA 4C14A 1ODKA 1M8GA 3LZ6A 5CH8A 5CX4A 3LXMA 3OZBA 4LHWA 5IDYA 2CUTA 2N75A 2IY9A 1PWYE 4GMKA 4G1CA 4JEUA 3H5VA 3HEAA 1JG6A 4YECA 3SEQA 1IBLB 2P6PA 4MKRA 4DIUA 2HSZA 2PL5A 2X5NA 5KO2A 3TRHA 2NLOA 3EDYA 2EFYA 1K8QA 1JPJA 2H2DA 1TYCA 2B9EA 5FHRA 4UBLA 2RBKA 3A1NA 1D2AA 2JCXA 3PDUA 2EIHA 4ND8B 5AI9A 4OYHA 1H66A 1TPYA 1KZ7B 2HRCA 1ISIA 2PSDA 5K9ZA 3HXTA 2R86A 1LQTA 4GRAA 4Q01A 1PZGA 1MB0A 2JCSA 2QRLA 1T8YA 1AX9A 2QJFA 2YNMA 3HB5X 1XD2A 1SPBS 1V1RA 1FLDA 1AMNA 2XE7A 2FJPA 2JIQA 3ND9A 4FBGA 1K6EA 1CT9A 2HC9A 4N3CA 2HTFA 1S3FA 2BTQB 3E84A 2Z0MA 3RSLA 4YRTA 5ES4B 1WXIA 4ZAFA 2C2YA 4QYWA 1LW7A 3I8XA 1HG0A 2E5FA 3RUHA 2VPYA 3QKSB 2C97A 2XYHA 3BGIA 3IPAA 1ZUNA 3OOWA 1XN1A 2RAUA 4TL6A 4CR7A 2HDWA 3H87A 4I9GA 1W1IA 2W2VA 3M33A 2WUDA 4JIMA 2RSLA 1U9IA 4X3OA 2OP1A 2B5OA 4HP8A 4B3HA 1NTOA 1AKQA 1KXJA 4WMLA 1A7AA 1MEOA 3RRFA 2WKPA 4JLJA 3QOFA 3OZIA 4DLTA 3D81A 2GERA 4YMGA 3EMDA 4RL6A 3WLSA 4QM6A 1XRPA 2XUZA 3OFVA 4KC0A 3KZNA 2C8VA 1DS6A 3WGJA 4UASA 4PGFA 4BFWA 4F7DA 5BMVF 5EXTA 3KWFA 2VDKB 2VYCA 3ILSA 1E1CB 2HDHA 1IZYA 2OBLA 1RPJA 2IP4A 3NOQA 4ND8A 4V38A 1OXSC 2C82A 1KK2A 4DR4B 4RH1A 3BHIA 3U61B 1N92A 1CR4A 1VSBA 2A92A 4Q00A 1T8PA 2W11A 2Z43A 1H2ZA 3GEMA 4RHEA 3T7KA 5CM2Z 1XN4A 3TFOA 3CR7A 1V2HE 4LF7B 2RDMA 2MYNA 1Y8RA 2UZ0A 1VJ5A 4YRQA 2JG3A 2HWKA 1F7VA 3IAUA 1SC6A 5AP9A 1OR8A 4DXHA 1C50A 1MX5A 3DTYA 3GNQA 4EEZA 2EWMA 3A14A 1PT6A 4FILA 4LYAA 1LA2A 3HP1A 3DL2A 1RWBA 2EDCA 3E4CA 2GTPA 4PQYA 4YPOA 2AR7A 1RAHA 4D56A 4PTLA 1DWOA 4P4TA 1QPGA 1UWVA 1X1DA 2FPLA 2F1IA 1O6ZA 3OE5A 4FHEA 8ATCA 1D04A 2FUG1 1E79A 1B7GO 3SC3A 3UIEA 1ZRNA 4YP0A 4P81A 1YQ9A 4R2XA 1DXQA 2WJPA 4DUZB 4EW2A 5DK6A 1BIFA 5GAJA 1RKBA 1ZNZA 1JL3A 2P9ZA 4Q4LA 3ZIAD 2DUWA 4DCPA 1SCUB 5A4AA 3O90A 1PHPA 2ENUA 3N3BC 4AG3A 3PE6A 4D9JA 4WK6A 3JQCA 2FJUA 4LE2A 1ZEJA 2IUYA 4ML3A 2NUBA 1M8KA 3IPRA 2J3HA 3ZVKA 1YNSA 2VL7A 3JYQA 3LOUA 2A9VA 4I1VA 1MZPA 3H9JA 3UOWA 5IJXA 1MAWA 1DT5A 1XMSA 4IJ5A 5CXUA 5IYZB 3WTCA 1GQOA 1A8QA 2Q4OA 3RASA 1UP6A 1BG6A 1HYEA 2H4WA 3U7EB 3DNMA 1R0LA 4P7BA 4CCYA 4PZLA 3KQKA 1O9BA 1QOQB 5D2CA 1TIKA 3EWNA 2J32A 3K9FC 1WA5A 1Q1AA 3DDWA 3HYTA 4YFVA 1MABA 5TF4A 2IHKA 5KBYA 4DYHA 5LMCA 1RXUA 2GPAA 3D7MA 4QAJA 1C80A 3Q6MA 5F1KA 3PKJA 4CMIB 1U0NA 2JLBA 4EHIA 4CR8A 2JNWA 3OVMA 1A76A 5TX7A 4KN5A 1SU7A 3AP2A 4MKIA 3P26A 1GCGA 3CLTC 4D3XA 1IZZA 3PL1A 1ZZGA 1H0KA 5CLIA 2FHSA 5DLPA 4N65A 1EX7A 2A35A 2P30A 4MAFA 2ZYHA 1KFKB 4L0QA 4L9WA 1O96B 4BRUA 2IU4A 1KI2A 4TV9B 1USKA 3QKTA 3NFRA 2FR8C 3EXHA 2H52A 2C2OA 4LJAA 4MW7A 4CQNA 2IYFA 3H2BA 1LBHA 3MMSA 3E48A 4MUGA 4HTAA 4Q9NA 4U2FA 3RFTA 3DNFA 1I6LA 4UPDA 5HUQA 3EPHA 1V8DA 3LPAA 4GOOD 2HMAA 2QMHA 1T9CA 1YK1A 1VJGA 5AOBA 1K6MA 3L0BA 3PLNA 4JVOA 4GKKB 5SV2A 2Z3ZA 4Q1DA 4Q4CA 4FLEA 2IIBA 2UVPB 5A1TA 4EJ0A 1G3QA 1Q0RA 5G1NA 1ULHA 1EXDA 2BH2A 2CUNA 1NQUA 1ZK0A 1E2QA 4LSWA 4X1YA 3N7TA 4E7OA 4KBGA 5BQFA 4IIUA 3U4AA 2BTOA 2I65A 5DVZA 3HJRA 1CZNA 5EIAA 4YAFA 1Q20A 4Q19A 4L0DA 1GTL1 1P7YA 1T2CA 3B9PA 3FCSB 2P67A 3LK6A 4C6TB 4FMDF 3H4MA 1LBEA 1TGYA 3DHNA 3ZHTA 5HIKA 1UWCA 2QQ0A 2EHDA 4Y9UA 2HK9A 1PZEA 4NTZA 1E7WA 1C7EA 1RYNA 3DMHA 4WASA 1Z4NA 1J2EA 2VYNA 3K9WA 3R9IA 4YMHA 5K8JB 3U7HB 6GPBA 4FXPA 3ICVA 5DI9A 1X1EA 3U31A 1CR6A 1LD3A 5DV9A 1SKQA 1NMEA 3UGQA 4URVR 4NARA 1N2XA 3TRKA 3UJNA 4MUIA 5EHGA 4ZYZA 3UT5B 2NXWA 4RANA 1AN9A 1S8FA 4M1WA 4DCOA 4JC5A 3SKYA 4G2NA 4R1NA 1Q17A 1QO0D 5H83A 3QNMA 5L3ZA 1E6EA 4DPLA 4N0EA 4B81A 1K7FB 4QO8A 3U19A 1J06A 4JU8A 1FUKA 1ZHOA 3TSZA 5HWSA 2QBYB 4HPJB 3OEHA 3HKCB 5EZYA 1SU4A 4N5DA 2C88A 1G38A 1FDWA 3T9CA 1NWCA 1HUQA 2AG1A 2GA9A 4UTPA 4A8TA 3A06A 2ZYGA 1RPTA 1HNXB 1EGAA 3GEBA 5TVKA 1Y33E 2DWUA 3NEJA 2V1UA 2IYQA 1KDZA 1BVRA 3FUVA 4GZ6A 3RIEA 4DJJA 1VG0B 3D8SA 5INTA 3H18A 3RV4A 2A5JA 4MIKA 4KIFA 4DANA 2Q3LA 3AFMA 1U04A 1WMAA 4ZVSA 4D7AA 1N0UA 4E5KA 1R0KA 1FP7A 4OOEA 4C7XA 4DR6B 4EL5A 2OLEA 1TQ8A 1QRAA 3HYRA 4F4FA 1JAIA 1Y1LA 3V7UA 4H4CA 1TZJA 4RJJA 1SCUA 4F45A 4B6FA 3MCTA 3B5EA 3P7MA 2R6DA 4FYKA 3I12A 3JQEA 4LMAA 3W5SA 3GXBA 4WCDA 1I7LA 5K3CA 1YFJA 3BORA 4NNPA 3L0DA 3B1YA 2XNDD 5DO9A 3ZHBA 1NI5A 3CBQA 1AGXA 2LNDA 1Z16A 2WYWA 3NRBA 2YHBA 5CFZA 2EJVA 5CEFA 3AU9A 4QXOA 1BEUB 2EYQA 3B8HA 2JGIA 3W8EA 3HP7A 3PBKA 4HUQA 1GZ3A 1Q2UA 4A15A 5F2EA 3MTGA 4RWZA 1AXGA 5DTJA 3WO0A 3FNGA 4XIYA 2JCVA 4E12A 4RDCA 1TKBA 1V41E 3AKZA 1QDUA 1WB6A 2PL1A 4WOPA 3E5NA 4NU6A 1JZTA 1RVDA 2FGKA 4J4TA 3I2HA 4BLQA 5C5EA 2CGEA 3K9NA 1TQDA 4Q4DA 1L5FA 4LTDA 4KQFA 2YXNA 5KIAA 5JBNA 3HA7A 4X97A 2BTEA 4DWJA 3HU2A 4OM7A 1NZDA 4Q24A 2SKCA 4KAXA 2CLFB 4G26A 5AW5A 1WXFA 2QRQA 3QVKA 3DH0A 3GOHA 5CIYA 1FEZA 2JAQA 2Z9BA 3KHKA 1IBSA 1D07A 3F9IA 3GLUA 5IDWA 4K1LA 3NTRA 2WTNA 4J16A 4PLTA 3CNBA 3KKLA 3HN2A 4P3NA 4W5QA 5ESDA 3AM1A 3O8QA 2HCFA 2WIKA 4I50B 4F2DA 4DFDA 2I0FA 1J23A 2HBQA 2H8KA 3BL6A 3GPBA 3O0DA 5DPMA 3QELA 2AOUB 1JHDA 3FDJA 1AE1A 4WECA 4K8OA 2FSHA 5BSMA 3DFIA 4QOSA 1EG2A 3U48A 3RSOA 1IQPA 3W6PA 1X7YB 4EGFA 3IO3A 2HMYB 1WTCA 4IJVA 4PLWA 4QODA 5EA2A 5B4VA 5JMTA 5L45A 3WBJA 4FLFA 4MARA 4MRSA 3MELA 1A7JA 4ZQFA 1NJ1A 2OZKA 4P5DA 3TXAA 2XNDA 3B1VA 1SKUA 3FI9A 2HF8A 2BE9A 1BZYA 5AJHA 1L6RA 4PIVA 2ZT8A 4Y30A 3IRVA 1DO8A 1ISHA 4IQ4A 5HF9A 5IVIA 1ZSNA 1OH8A 1KO4A 2HQRA 4LEIA 4P6VF 3VO1A 3OQNA 1IZ0A 3U40A 4KO3S 1ETHA 4EPTA 3B3JA 2Q5JA 1G20E 2ZRQA 1DKNA 4MJXA 3PHCA 4KLZA 1BJTA 4DMFA 3T0GA 4BNXA 3R5TA 2Q1UA 4MPTA 1Y89A 2QPTA 5CYPA 5ETJA 1V48A 2O6HA 3BMCB 2JGAA 4JLWA 4EG7A 5J43A 2G9ZA 1NN5A 2VSFA 1K06A 2NZ2A 2QYSA 3DXZA 2JEZA 4KGVA 4PN3A 3ZTYA 2HK6A 2QL5A 1N5MA 4N8EA 5DTEA 5JNSA 1GPUA 3EW7A 3SHQA 4YUVA 1DADA 2YYYA 3JD0A 3DDUA 3ZDBA 4TRJA 2ZSKA 4YCLA 3TD6A 3OQJA 2F3SA 4N5LA 5ADUS 2O5EA 1D0VA 1X0VA 4OLJA 1FJ2A 3JZFA 3PX3A 1BKYA 1Y37A 2X5OA 3LQ1A 4ZAXA 1VMDA 2ZXEA 2OYRA 2GBFA 3IHWA 4F46A 4G6ZA 3IP3A 2O19A 1DLJA 1QLHA 1EFUA 1SB9A 3BWXA 2W2XA 5JW6A 2H5JA 3KU4A 5C52B 5AKJA 3RO7A 1O0CA 5A5FA 4FI3C 5BN4A 1MH9A 2AUMA 4F8JA 4GP6A 5EZYF 3T0IA 4PAGA 3CV3A 5B7GA 3C39A 3ZI4A 5EMKA 5KVCA 1ESMA 2FPUA 2JIPA 1H2WA 4IHJB 3MMPA 4L73A 6YASA 1N5JA 1U4SA 2GFHA 4HS9A 4YJDA 2Z6QA 3SU8A 1XA0A 4QDKA 4XARA 2HCJB 1JQKA 2FE4A 4CUKA 2E4ZA 1MOSA 2JS7A 3EZ6A 4XA8A 1R3UA 1WS6A 4YI3A 1BA2A 1JAZA 1CDDA 3KUXA 1XQWA 2QAGC 2WFZA 4CTMA 4EBFA 2QXYA 5K0JA 2RGAA 4BZZA 4YRIA 3CRVA 1KKMA 4YC7A 5KYWA 5A5GA 4OQXA 1BEZA 4Q7EA 3GJQA 4RTOA 1JHUA 2O7NA 3AJDA 3RYFA 5F9HA 3ROTA 3LPLA 5IKOA 1P18A 3C7CB 1GA1A 3KZCA 3A9SA 3VR5A 3P71T 1H4QA 1A4IA 1ZEMA 4RKQA 2VVTA 5IARA 3A70A 2XE4A 3G0GA 3QYJA 2I8AA 4C1BA 1H23A 1QXSA 1T2VA 3DHEA 2BGWA 3CCCA 3VHQA 4KDFA 5CBPB 1GA4A 3AF1A 1VE7A 3UJCA 1H4TA 2BGJA 2LRHA 3H6KA 4OA5A 3TTTA 2IE0A 5D01A 3IV9A 4JQZA 1BRMA 1Q0HA 2NZWA 5IH3A 2C8LA 5DX8A 2XKKA 4UHDA 4BECA 4OHOA 3VI4B 3VX3A 3I2YX 4CCYB 1KOLA 4CIXA 5JNRA 5I7VA 3SXPA 1XYYA 4ALIA 3V1YA 2A33A 2PRJA 3CX7A 1H8HA 3QU9A 3L7YA 4ZZ0A 1SBQA 2R2GA 2X14A 3KKMA 4KK3A 2QRZA 3PRYA 3VYUB 4KOAA 3QF4B 2QW8A 5T67A 3NIDB 5C8DA 1P73A 2ZQZA 2NUAA 4RELA 4GQBA 1UANA 3AWIA 1PVVA 2BKXA 1JZSA 2LIPA 1IHOA 4IZHA 3T95A 1J56A 4BAGA 1NBMD 1WUKS 4O2AB 5TMPA 2PQ6A 4TKZA 3T99A 3GK3A 4ILEA 1S2DA 1M34B 2C95A 3N1UA 3QQ5A 4AO7A 1P77A 1N33B 1Z2PX 2JJMA 1WL8A 2H00A 3V6MA 4PZUA 2RB4A 4FGJA 3FA2A 5EPUA 3MGKA 2D59A 2AXEA 2ZJOA 3SP1A 1SG0A 1HDYA 4HYEA 4URHA 1Q95A 1RRMA 4JDUA 2DFNA 1YU9A 2GETA 3C8MA 4RFSA 2V6MA 2C8KA 4RTKA 4OJNA 1CSEE 4DMRA 2HT1A 5GINE 4QC2A 2PUDA 4FPXA 5HF5A 2YMPA 3CUSA 4OQFA 4OXIA 3RARA 2HL6A 2FPPB 3A0UA 2WTUA 2FEKA 3EDRA 4OQNA 4ZVTA 1UPBA 1XMXA 4I1OA 4C4TA 3DHYA 4NYJQ 4RWEA 1VLQA 2WMYA 3GROA 3JAKA 2ZBUA 4PBSA 3WWZA 1RM5A 3FPAA 3PTZA 1YCGA 3WLFA 4MB6A 4HDNA 3D4NA 3OQBA 4OXKA 4CMJA 3FNBA 1POWA 3WYBA 2OOKA 2VTBA 2ZAIA 2HMUA 3O3NB 2H4HA 2PGOA 2BGMA 5BSGA 1MTOA 1SCQA 1EUZA 2C5FA 1ODJA 1AKEA 2DPLA 1EUCA 3FSJX 5KSWB 1PJAA 4AS2A 1E79D 3EGOA 2Z1NA 3WJ7A 4ALLA 4YGXB 1GFIA 2P9GA 5FTMA 2WJJA 3TEMA 3BMQA 1W4AA 1SOVA 2A9PA 1HURA 5AVUA 3VKHA 3DAFA 2C3PA 3TB6A 1JWAB 5JXHA 1EG7A 3R4VA 3IBTA 4WLOA 5T3YA 3LHSA 5JXWA 5EVJA 4HMQA 5KYXA 2IV2X 3L18A 1C1XA 1SXHA 3VDQA 1PRYA 3DCJA 4O4JB 2CB9A 2ZAOA 5JNTA 4MW9A 1OPRA 2G4VA 2IRWA 1QRDA 4Y6LA 1FMLA 1NYTA 2XUQA 3ND5A 4ZV4A 1J1UA 3CRQA 5LIPA 3K32A 2E89A 1U90A 2OD7A 4CQMB 3B38A 1SEPA 4BL5A 5DCLA 4HBGA 1RT9A 1CS4C 1P6QA 4NCNA 4WFIA 5DTIA 5CDFA 3U3JA 1KRHA 1JIIA 1FIUA 3M9WA 1ONBA 1ESEA 2YKGA 4EHFA 1R27A 3DMPA 1JAYA 1RFLA 1RWKA 4KBYA 4KWHA 1J99A 1KL7A 4F92B 5FUXA 3CMMA 1UEJA 3PD1A 1T4MA 4WY8A 4LDQA 3GJ8A 3THYB 1JR4A 4GECA 1H9CA 4YP5A 1REQB 2HCRA 1Y5LA 2K2QB 3QWHA 4H17A 3ENVA 4ZT6A 4RJKA 4ENTA 4R1MA 2MCFA 2OMEA 2COEA 3H3FA 4AJ4A 1FUYB 4YCBA 1KQNA 4RSMA 4B46A 2M1XA 4Z86A 4FE7A 4E7PA 1SIOA 2PA3A 2WNHA 3GNSA 3ILHA 1A5SB 3E8MA 2IBMA 3O8DA 3TJRA 3VM6A 2JZNA 4E2ZA 4E4YA 3PLAE 1XQ1A 4BNVA 2AFIB 2CXRA 1T9DA 2V74B 3OH8A 3F97A 3IUSA 5HUHA 1Y48E 2FUEA 4RMIA 1T3SA 4WA7A 3CM0A 3K94A 1OBVA 1TD1A 1T2DA 4K8RB 1XVLA 4AMYA 3VSDA 4CLEA 3TFQA 1Z0KA 1RACA 3PQ4A 3ROMA 5K8IA 3DF9A 3W5JA 3GT0A 1T1SA 4CM4B 1YQUA 3PRHA 3CR8A 2NVBA 2L17A 4RL4A 3S27A 1JEJA 2JRCA 1QTRA 2HN9A 4LMBA 4XPZA 1T2UA 3X0DA 3A0RB 5HZGA 1AV6A 2J7KA 2Z83A 1UIRA 4FONA 3RD5A 4HQLA 2V9PA 5AK4A 4RF3A 4IUBS 1E3JA 4JL5A 4TTQA 4PO3X 4WKOA 4DV2B 4I3FA 4LRXA 4M4SA 4BB5A 4BGDA 3C6YA 2RGXA 3EQ8A 3UH0A 4CKCA 1ZUNB 3GARA 4O2AA 1KARA 1KF0A 1MC4A 5IC6A 2B5VA 3JQ8B 2LZ0A 3Q10A 1XAIA 3HCFA 3CH7A 1XK7A 1DAGA 4QOEA 2NO4A 3AFOA 3AEYA 4TUYF 4BOYA 6PFKA 2BTQA 5E95A 3TTYA 3CZCA 4G5FA 4M9RA 4P22A 1JKJA 1QCYA 4FMDB 5KWSA 4WJKB 5TPWA 3CPEA 4RK0A 1P9OA 1E9SA 4QRDA 2IIVA 3BJZA 4TSKA 4Q3BA 3SVLA 3OTOB 3HUFA 4BO6A 1JALA 3OPQA 4N03A 3TGLA 4MVJA 1XU9A 1ATZA 4NMWA 4RVFA 2I9KA 3GJ3A 1J8QA 3P96A 4BDSA 5IABA 4RGVA 2ENWA 4DV5B 1G5QA 2GH1A 3AUFA 4GAEA 2QNBA 2EL7A 4E5YA 4CFSA 1JHVA 3F5SA 4J0FA 4HDNB 3K6SA 1E1LA 5KNCA 1VG1A 3LBFA 1T0HB 2DBRA 9GPBA 1YBFA 1LKZA 3VNQA 2APJA 1JHXA 4A2QA 1M2OB 1N2CB 5I8PA 1Z2CA 1AHHA 1KDPA 1P7WA 2GD2A 3ACBA 1UK8A 3G0BA 2J5BA 1OW3B 3OFND 3OKPA 4H0NA 2B4AA 4PZPA 4ZO7A 2X19A 3B8EA 3STVA 1IXZA 1O08A 4EFNA 1L8QA 3LVRE 1Q19A 5AW3A 3B5JA 2JFFA 3N2LA 4KDEA 3SJ7A 3L4BA 2LVBA 3JU3A 4B73A 2P6MA 2W90A 1NFQA 1TZCA 5DKFA 4BKMA 3VHXB 4Z1OA 4G5YA 2CC2A 4JBIA 2V7GA 1Z9BA 3DMDA 1KZ9A 2FN4A 3EHDA 2NSYA 1CUXA 1WVGA 2A4MA 3ZC3A 1J0XO 2XUOA 4IMJB 5TQJA 3HA3A 3W06A 3D6MA 1ISMA 4FN5A 3ABRB 1XZEA 2Z1DA 2G5PA 2EERA 3I01M 5IP5A 1TZBA 5HRUA 1SOWA 3BIFA 3F5DA 3K09C 5BT9A 1U2TA 3IVAA 4NPAA 4RO0A 4B85A 1E1RA 4JBXA 2F9LA 4XGQA 3CVOA 4E3WA 4MQEA 6NULA 2YWGA 3UOGA 4DR5B 2ZAMA 4NYJR 3WGTA 2GOYA 2PUVA 2G9QA 3P97A 3PF8A 3BJIC 1ECPA 4WQMA 2NACA 4MVJG 5EYPB 4BRWA 2XZLA 4OFBA 1DI0A 3CEAA 3IKLA 1U5CA 2POCA 1WDKA 3LDAA 2B1IA 3KU1A 3O8OA 3TYXA 4B33A 2Q5LA 4Z0PA 3NBXX 4DZRA 4OHBA 4AP6A 4R9VA 1P1JA 2ZS9A 3UN1A 4FOSA 4PZZA 3UTDA 4BFZA 2AG0A 3PJRA 1N57A 3VA7A 1YE3A 1CR2A 1HRKA 1FRFS 2C2BA 3D2CA 4TVBA 5AVSA 5LKRA 3KXLA 3R6GA 2AJ8A 3OZFA 1MA0A 1RLUA 3GAMA 5AOCA 4XWWA 1BGXT 2KE5A 5BV7A 4WGGA 2QMOA 3BXPA 3IJPA 3OSUA 1JFTA 2XJ4A 1KKLA 4F60A 3NNNA 1JXQA 2XIQA 3NHRA 2KLBA 4IIJA 4UU8A 1HR0B 3B1XA 3HDHA 4DBVO 3EUAA 4G65A 1NLZA 3AHFA 3F73A 2WP8J 3ENKA 3WYCA 1COWA 4Z6KA 3B6MA 1MQAA 1W46A 4OK3A 2I34A 4TT3D 1B6SA 3W4IA 3MMXA 4IXWA 1X80B 1I7QB 5FTKA 5GZ3A 3HZOA 5J5CA 3WLQA 4TYYA 2I1WA 3JQ9A 2R8EA 4LXYA 3EZ2A 3G8CA 5IVPA 3L4JA 3TSOA 2P2NA 1XJWA 3IUPA 1SUPA 3E22A 4KAFA 2W2PA 3R77A 3RFUA 4KVAA 2ODTX 2XVXA 2J85A 3GDFA 5A3JA 1QG4A 1XMJA 4CF4A 5CYGA 1F6BA 1K98A 4LK3A 2B7CA 4G41A 1P5FA 3T7EA 1UFKA 3ANMA 1XF1A 4RF4A 4R84A 4RETA 3SYKA 2G9NA 1QRTA 4CM5A 1U63A 3NRJA 4ICIA 1NR5A 1MPTA 1YK0A 3OD1A 5ENDA 2DM6A 3SFZA 1JR3A 3HJNA 5CNMA 2C00A 2ET6A 3T7RA 5AICA 1W0KA 2RFLA 2GHQA 2P9QA 1EA5A 3RFVA 3E9QA 4IKEA 1LBQA 3S1LA 2BFEA 4QUAA 1GQ2A 2DXIA 2ZGVA 1NPTO 1Z6YA 3I4CA 3K1TA 3KAKA 5EJ4A 4JC0A 5YASA 4RQUA 2DR2A 4QJ5A 2GXUA 2VBFA 2X6QA 4EHBA 2BZ0A 1UM9A 2LIVA 3UV3A 4ZZ1A 4J43A 2Z5LA 2I29A 4I9FA 1Z18A 4BNDA 2RAVA 4NC9A 2DQKA 5JT1A 2DP4E 3R6LA 4WCFB 4HT3B 3C3JA 2GILA 4PSKA 3CVWA 3L0CA 4CMBA 1L5MA 3LC1O 3LPCA 1QG6A 1N8KA 2I6GA 3E23A 3H3XA 1KBQA 1RU3A 3MAGA 3PWTA 4G8CA 2XUHA 4QFBA 4TTSA 3B3GA 1NBHA 3STUA 5DOVA 3FNQA 1LBIA 1AOXA 1SELA 1XR3A 4XUDA 3G5MA 1ZK3A 2MU1A 5B53A 4PX5A 3CQ9A 3TKLA 3K8ZA 3I58A 3LYUA 4OSEA 4ZVKA 3DEYX 3FCUB 3ZGNA 1TU4A 2BGUA 2D5BA 2PT7A 3FVQA 4NKRA 4PCLA 5FUYA 1KOFA 1U2RA 2NU9A 3A25A 2IWHA 3LP8A 1NNSA 1NUTA 4XUEA 3ABQB 3P2EA 1VRVA 4QBFA 5IZ4A 2PU7A 3HFGA 4IDOA 5P8WA 2NX2A 3ZK8A 5HJ5A 3EEOA 3EC2A 3Q11A 1YASA 3TLZA 4YAOA 4V02A 1SWWA 2F8MA 2J9XB 4AYWA 1YS7A 5E6UB 4PANA 3R0IA 1A9XB 4O4JF 3B36A 3OJCA 1W0KD 2O48X 3M5DA 3O9ZA 3SDBA 1PBTA 1YR1A 2FPXA 5IKEA 5KMGB 3DDSA 1UM8A 1ESNA 3QPCA 4G0VA 4IINA 3ZWAA 1FUIA 1TAGA 3R40A 2JCYA 2CEAA 3LDGA 3WGHA 4M22A 4YAKA 1NA5A 1FDRA 1LF0A 1RQPA 3VU0A 4GR4A 1AB6A 2FY8A 2HSEA 2CJYA 2JGDA 1QH8A 3BEDA 4KJZA 4KL8S 2GPWA 2WVJA 4MHTA 2PNFA 1QDLB 2AMLA 4ZI2A 1XD2B 4PV7A 3BIOA 5J59A 5JXGA 3WLMA 1PKXA 3V1NA 2EU8A 1CQZA 5SY4A 3ANSA 4AJOA 1D4ZA 1IEXA 3MZ0A 3K6RA 4JUBA 1DBVO 3H97A 5I9LA 2BCJQ 2PR2A 4FJ0A 4DWWA 3II6X 1AKMA 3SE0A 4POOA 2XMSA 1Q7EA 5C31A 3HYSA 3M6VA 2CXUA 3V8MA 5BWBA 3N0XA 4RIGA 3MW8A 4CV2A 4RIEA 1U8AA 4B7ZA 5BNWA 2P2ZA 3VKFA 3BC1A 4EO9A 2Q9AA 2ZJ3A 1XZFA 4MROA 3P0JA 4XPIB 1NBOA 1ZNXA 3NIBA 1J07A 3JW8A 1JG7A 1HV8A 1S3GA 1WPQA 2G3YA 4JT2A 1P0IA 5C8XA 2GN1A 5CGQB 4YR9A 1KIAA 2GNAA 2Q3MA 3I39X 3R5FA 1EGQA 5F9MA 3ZPXA 2FPSA 3KSMA 2XHZA 2ZRCA 1QHSA 4IG4A 4K9RA 3TZCA 1AT1A 2Y05A 3N0TA 3CN9A 4F72A 1W1UA 2JI8A 1W35A 3IMGA 3LUPA 3SHFA 4DC0A 1FL9A 4MWEA 1J90A 4OATA 4EKIA 2QLMA 2QUKA 2QN1A 1OB2A 3LQQA 1WM1A 1DAKA 2JJ2D 2G5CA 4F6RA 5HQJA 5MHTA 2H18A 4OG2A 3ZE8A 2XF8A 3OM1A 5AJVB 2TRSB 5HILA 2CW5A 3UWMA 1P2UA 1X38A 3SDZA 3W5IA 5JQGA 2O05A 2QJOA 2BHNA 1Q7TA 1UC5B 4L72A 4PPFA 2C2KA 2G8NA 3KOYA 3MGGA 1E1MA 3AY7A 3ZE1B 4KYTA 3QVVA 3AF6A 1E2LA 4M0KA 1GOTA 1MX3A 5HCIA 2Z8XA 1NP7A 4PAMA 2MMGA 4ETMA 1FF9A 3AFGA 1A8HA 1UR5A 2QE7A 4OQYA 4UQOA 1VBNA 4JLUA 3NBUA 1TL7C 2Q5FA 4WZBE 5HCNA 5BSRA 1B23P 3GGJA 4N3GA 4S2UA 2D7JA 3M4NA 1SU6A 1TU0A 5JV5A 4KBFA 4JA0A 1KBOA 1TQ6A 1QORA 2FPPA 2FLVA 5JZ9A 5LM3A 4NZZA 1KAMA 4JY7A 2XNJA 5IXYA 5KC8A 2Q9UA 1WDMA 1G6KA 2Y71A 3JZDA 1I30A 2V7VA 3M6MD 3ND8A 4II3A 3REQB 1XRQA 3WLJA 1DUSA 3MRXA 5D7NA 1K7SN 2RH9B 4CIDA 4JWTA 3SKVA 3SG0A 2H5IA 1UQTA 1O9HA 2YYSA 2UUBB 1EHCA 2B34A 2P75A 1UIMA 4K9PA 3DDZX 5MN6A 1XT6A 3P0IA 1NQTA 2Z2JA 3JARA 3WL6A 2YWBA 2WUFA 1YZUA 1XMVA 2J9GA 4Q5IA 5DRTA 5KOHA 3RT1A 3C3AA 1O6GA 4B9AA 5CGZA 1H2EA 4RLFA 5K45A 3A9RA 3ANXA 2BKUA 2PS0A 2COUA 3CMCO 3DE1X 1RJ9A 3A1TA 3NB0A 4I1SA 4PRZA 2ATIA 5AI5A 3RUPA 4KI7A 5TQ2A 4DVGA 3AF5A 3M89A 5B7QA 3RQIA 3Q5GA 1JFLA 1ECFA 2ZE6A 2XYVA 3PNPA 1M8PA 1NKVA 3MTQA 1EM8B 2ONZA 4GRDA 4YP6A 3REFA 1JECA 4MWDA 4BQEA 4HGNA 2QA5A 2ID7A 3DZDA 1D2NA 1V5WA 3LP5A 1TEXA 3D4OA 1TJNA 4ZOLA 3RYHB 1ZONA 1D2GA 3TCKA 2R79A 3WLKX 3NHBA 2FCAA 3F67A 1H3NA 4ZKDA 2R1TB 4ZGGA 3D6NB 2XUKA 5REQA 2JEYA 5EP4A 2Z8YA 3RFCA 2V55B 1CRWG 1E6WA 2E37A 2G9UA 1IXYA 5E9WA 4MQ5A 5LMUB 2UXBB 3G82C 2O06A 4AS3A 2RHHA 2VDPB 3ZOZA 1CF9A 3NUZA 5EFOA 2VC2B 3PDIA 2XPCA 3U7IA 5EL0A 4HYYA 5K2MA 5FI0B 4AZWA 4JXZA 1QAQA 1ZD8A 1CB0A 3BCSA 2HPHA 3QEOA 2KB0A 4HC4A 3BBPA 1CQIB 4KJXA 4KNWA 2OVFA 4EJSB 4OX9Y 1B3RA 5DNWA 3HO8A 5E1DA 2HI0A 3V7WA 3RREA 4IMIB 1VCNA 4AJKA 2ZB8A 4RCVA 2JFXA 1H2BA 2AWNA 2PKRA 2R11A 3F5QA 3FGOA 3JALB 4K5QA 3A2MA 4P36A 5ILGA 3KXIA 1ZU4A 3D64A 3ZU6A 5I7SA 4ZI7B 4HCJA 4XLLA 3WWPA 3FMIA 4UOEA 4MVXA 1OI3A 3TBKA 3RRBA 2NTEA 3VR0A 4DTIA 4EB8A 4YRLA 5ENVA 3IOYA 4IDCA 3VZRA 4YBRA 3L43A 3AVVA 3AILA 2WNSA 5CT4A 3DAOA 1KO1A 3U49A 3WAJA 3LF2A 3EPRA 4U2BA 5JBQA 3PITA 5EHNA 5IX8A 2FAXA 1BHO1 2CKDA 3I1IA 3BK1A 2J5KA 4Y2TA 1DXOA 4HKTA 5AESA 5JFTA 2XMRA 1BVHA 4DXAA 4UDNA 4D79A 3AR9A 3L01A 5GJCA 1EFVB 1R0CA 4BO3A 5F1YA 2VPTA 5LBTA 1I3LA 2REXB 3LVFO 4D42A 2VSYA 3TLGA 1OWOA 1Q0QA 2IF0A 1V45E 5IKPA 1IATA 1Z0ZA 4Q05A 4QX6A 1ZOOA 4ZWNA 3VPBA 4CUJA 1NVXQ 4J9UE 2EGHA 4E5VA 1QSGA 1VP9A 3STXA 3AIMA 2YWJA 1QGZA 4FDAA 5C8YF 1E2FA 3ER6A 2KBFA 4PY2A 1H2YA 2Q2WA 4XM0A 3BA1A 4E1BA 1UC9A 3F96A 4RY2A 3Q7PA 2GHIA 1FNMA 1BX1A 2WJGA 1SVUA 4ENPA 3WMWA 5AJWA 2QAJA 3HCCA 1OLSA 1RXYA 2EOAA 1UPFA 2F3QA 3A2LA 3EARA 3QTTA 1VJRA 2QL6A 4FKMA 2WVAA 4QPDA 1Q1EA 1BMTA 2CB0A 2Y2UA 4PC1A 3H2SA 3TFWA 1HFKA 4AUKA 4DARA 3RU7A 1ZYUA 3BFVA 2YMLA 2XBUA 4OHVA 2DFVA 4MJLA 3BQ9A 4B0OA 4GDFA 4GLFA 4X7MA 2B37A 4TWBA 3KUUA 4ZOBA 3SCZA 3BL8A 5IZCA 1SXJE 4F0JA 5KTNA 3M6WA 4AJPA 2QN6A 3A6DA 3DVAB 3E3MA 3N8HA 4N0QA 4RENA 2XMCA 3EF3A 3TLGB 2IX9A 1Z4KA 4PSDA 3FNRA 4R31A 1F51E 3AR2A 4UEWA 4JBYA 3Q85A 4BU1A 1M6WA 2ATXA 1P9LA 3BQMB 1OLOA 3RBXA 4HX5A 5KNCD 1R15A 2JJ1D 3F4BA 3N2YA 5HZHA 4QXAA 1YR2A 4EHAA 5KWIA 3FROA 1ZK2A 2WYUA 3Q8WA 4O1IA 2X3UA 2A7XA 3Q2KA 4JR1A 5EE3A 3PNQA 4A0SA 5KWEA 2X23A 4J7UA 4QU5A 1YI1A 2LBPA 4GD3Q 1SHUX 2C4UA 4TRMA 1ILWA 5LNK6 3LBAA 1XMIA 2P78A 2ZUSA 1ZG3A 4RLQA 2FTKE 1VKZA 2O57A 1LQUA 3HSYA 5F77A 5IBPA 2XA2A 3RGWS 3T0FA 4BQIA 3A6ZA 2C4TA 3AUKA 4ZT4A 2Z95A 3ILXA 1EK2A 2BISA 1F2UB 1M2VB 1CU1A 3P27A 4Y18A 1MJHA 1XALA 1WWKA 2PKQP 3HVJA 1EFLA 1W88A 3I0ZA 1DU4A 1J24A 3A6JA 2BFBB 3TG2A 3OZUA 2F3PA 5LXTF 3KZMA 4LOIA 4F4HA 4YRJA 1WR8A 2FSVC 3ULKA 4KE8A 2F3TA 1Z3CA 3SHTA 2SECE 3IIEA 5BMOA 1O97C 4QFCA 1YNOA 1M2OA 4GI7A 1XFAA 4Y2HA 1EB8A 2A3RA 2Q50A 4ARZA 1DCMA 1KDTA 2E4VA 1TJ3A 2R8ZA 1U80A 4UE3S 3PYMA 5EN4A 4XYLA 2QXUA 2WTEA 3A31A 5DN6D 3R3YA 2WB2A 1EFPB 4Y9RA 1X2BA 1FX0A 1FYWA 1T3TA 5HKLA 3U1VA 3FLEA 3V4RA 4KFRA 2OO5A 2WIAA 5KYUB 4Q3DA 4DIDA 1QQ5A 1EBBA 1GUFA 1Q1BA 2NW6A 1RHRA 2GZAA 2W2LA 1T5DX 1Z7WA 3EZGA 4IDEA 4U1RA 5CH5A 2IPMA 5AR1A 5JJ5A 1K0UA 1T5SA 2PKYX 4XEUA 3WIBA 1O95C 1CUFA 2A9QA 2JIZA 1NUHA 2E5LB 3AIOA 4QWMA 1LJUA 3NJ8A 3VTAA 3O8RA 2JFQA 4DAOA 2I6FA 1EFRD 2DE0X 1NFFA 3JD2A 3PA8A 3V2HA 1Y8CA 3CTPA 2NO6A 3QRWA 3NS7A 2I03A 1NRIA 4G4SO 1YFKA 3STTA 3V3KA 4TWRA 3PCRB 4RF5A 5CU7A 3U17A 4G0WA 3PNMA 4MUXA 4JP3A 1A9QA 3V4PB 3AINA 3TPCA 1TXGA 3SZGA 4IFBA 1MX9A 4NL4H 3WWOA 3ZNOA 2XCRB 3I30X 4R9UC 4ESOA 3TQOA 1LSOA 2DHRA 1J20A 1QHXA 3D8UA 4NJMA 3TX6A 3LT1A 2HAEA 1M34A 2Q3DA 4O4HB 3CKMA 3G9QA 2LKCA 4NLLA 2C3OA 3ADKA 4RXTA 3FF1A 4M88A 3ZWBA 4AULA 2X8JA 3A3KA 4BUCA 1N2OA 3P4YA 4QZVA 4MDFA 3DVLA 4AJ9A 3MYYA 2P65A 2CHGA 1U6JA 5DCUA 1EM6A 4S1TA 1C1DB 2QVCA 2G0NA 2WC1A 3R0JA 4HAOA 4IV8A 4YMIA 2B4YA 2XKBA 1ZNQO 1T91A 3L7LA 4D5GA 5IF9A 1H5UA 2X15A 5CTAA 2C9CA 1P1FA 2DGDA 4MQUA 3OHPA 3PPYA 4OREX 3DS8A 1I1OA 1Q7RA 2J87A 4OGFA 2WJAA 5CK4A 3SD7A 1NOKA 4EATA 1E3QA 4TS4A 1I3CA 4DLRA 4S2EA 4MGHA 4XTRA 5HYVA 5JBIA 3TVDA 4RD3A 3H8WA 4GXTA 4JNKA 4L9AA 4QQ8A 3WL7A 1KJNA 1QGAA 1P2BA 3N6RA 2RH5A 1EP2B 3ITKA 3OWXA 3UGKA 4BCCA 1ZOIA 4FOPA 4K2AA 1PI3A 2YXPX 2VTEA 2IWRA 3PNSA 5FOSA 1R00A 4DCNA 1IWBB 1FNDA 1YAHA 5C5DA 1MEJA 1P2VA 4TN5A 1MJFA 3R3VA 1SXQA 1UKAA 1LLUA 1KAGA 4GVXA 4J0HA 3A9WA 2JI6A 2YVKA 2FKNA 1ONOA 1EUYA 1SM4A 3H2HA 4RNDB 2B94A 1SQGA 2HK7A 2ZBRA 4H9GA 3R5JA 3RWOA 2WR8A 5F23A 4IXNA 4YJFA 7REQB 5DGHA 3DEHA 4J0IA 4OXNA 3C1AA 1PFKA 1NJ2A 1UBRS 3GGCA 4FK8A 4JMPA 4GL2A 5LZ2A 2GK7A 2N0SA 1E61A 3OOHA 3MBKA 2YYZA 4M7PA 4V0KA 3ZG6A 5G53C 1YBAA 4RZSA 1I2MA 1PZHA 2QGFA 1HLGA 3EVTA 1VL0A 3T5CA 2F55A 4S04A 4CCAA 4BEWA 1CR0A 3H9UA 1P2DA 3BE8A 4AROA 4K9MA 1WZCA 2JAUA 2UYQA 1GTZA 3B6JA 3JAMA 3D0RA 1XHEA 1IJBA 1H93A 2DFLA 3OM9A 4X41A 3MWDA 2H9IA 2OXCA 3SC6A 3URKA 1UMCA 3GRKA 1T2NA 4DQ0A 2AFHA 4UM5A 3OF3A 1D8AA 5AKKA 1XDZA 2IH2A 1EEHA 3A6PC 1XEXA 2P2SA 1AUXA 3ECCA 2QN8A 1NN0A 3I2FA 2Y92A 4MCHA 2D00A 2G0AA 3GRFA 1D1PA 3A1WA 4RACA 1P9RA 2B2CA 1T3GA 3UCEA 5FYQA 2ZRPA 2Y1FA 2XUFA 3DCNA 1QH1B 2Z30A 3QBVA 4GBJA 1U81A 4UD6A 1LC3A 2CDRA 5D87A 3H9EO 1KIFA 1KH1A 3PEEA 4M7WA 4Q3CA 4MI9A 1ZN2A 2C57A 4GPTA 4O4IF 5C8YB 1DIHA 3HLYA 1U1GA 4BKRA 3NPMA 1CCWA 2H63A 2WT8A 1CIPA 1LTHR 1OSNA 3KCNA 5B58C 4Z53A 2AH5A 2FPGA 5DNEA 4CM9D 4MHSA 1B43A 3G0OA 1V71A 3D7KA 4JMLA 1QH8B 4HQRA 4MMXB 1CZUA 5JLJA 2FX5A 1RWWA 2ZIUB 2HWUA 3IAFA 3NQ41 4BKQA 4BO4A 3U1TA 2AZXA 4A3SA 1S3SA 2IIPA 3LCRA 4MQMA 1CFZA 1AKNA 1BMFA 3JQAD 5FFFA 3WMFA 4EMUA 4N49A 3QOXA 2E48A 5B2EA 2WE8A 3I37X 1Z15A 3D6UA 1VDMA 1ZIPA 3KQWA 4N47A 5KJ1A 4YREA 4HLQB 5JJLA 2FK8A 1QVAA 3HVIA 3KQSA 4HDKA 4R1UA 3RNLA 3OESA 4QJ4A 4GPD1 2WWYA 1CDOA 4RA6B 1EI9A 1SBCA 3REGA 4QNRA 3HE3A 2ZJ2A 2H57A 3GG9A 3WADA 4WOBA 5KJEA 2PSHA 4BWVA 4WFKA 4FWTA 2GEVA 3E0QA 1LK0A 3K0CA 3MCAA 4KR9A 4X65B 3KLNA 4LX0A 4P34A 3WGIA 3NZEA 1WW8A 3D54D 1VGVA 3C1UA 1G21E 4P54A 1NUAA 1WKVA 3B7WA 1E2PA 4DNPA 1UOPA 5A62A 2WYVA 1NX9A 3DAHA 5FWAA 5EMJA 4J3JA 5LQUA 3G2OA 4HDOB 3JYHA 4D97A 4WN9A 4LXIA 4N41A 3M5CA 1N6KA 4GOMD 3DEFA 3L1JA 4ND5A 1KPIA 2VQ3A 1Q3HA 1B2LA 3MBOA 1GYRA 3L0IB 3UT5A 4ENQA 3HUEA 3TVTA 2PDAA 3MERA 1DZIA 1G8GA 4AP5A 1CIJA 4BQPA 1Y3IA 4X44A 4MS4B 4ND7A 2R7KA 1OIVA 1NTRA 2IDJA 1U0TA 2BJVA 2LXNA 2VOJA 1LEHA 2YN2A 3SYMA 1QF9A 2D5AA 2XZDA 4CI9A 4YDQA 1KH3A 2QTWB 1OXKB 4RORA 3VAAA 2PMCA 3ZHOA 2AN9A 4LNUB 4EI7A 3HR8A 3ZHQA 3UJ7A 5C35A 3R0XA 5JNUA 3UICA 5K7SA 5TMDA 3L06A 3KL4A 2V5AA 3MINA 1JR3D 1Z8FA 1W6UA 3OBBA 4LJ6A 4DSAA 1Z83A 1BHSA 2UYCA 8AT1A 3BWCA 3T12A 4PXAA 4FFVA 4JI6B 1E99A 3EVCA 3TSAA 4I4TB 4CQMD 2QM3A 3G2NA 5K4GA 5FQOA 1YZTA 2H5EA 1SZDA 1E7MA 1XZLA 5I47A 4KFCA 1TI7A 2ODAA 3FTDA 4A0RA 1UBEA 2VAWA 4EI2A 4UVHA 1NVBA 2IF2A 3MOGA 3WYEA 3WBKA 3FLMA 4IWNA 8MHTA 1CDEA 4YCSA 1KTIA 3SEFA 5CFNA 2QR2A 1GVNB 2ZE7A 3LWZA 4Y2VA 4E33A 4MVCA 2VH1A 1SIBE 5IXSA 1OY1A 1Z5OA 4I8XA 4AJJA 4C0XA 3OTHA 1X86B 3DZ8A 3E7FA 5DB4A 5A5VA 2Z1MA 2IDMA 3VOAA 3KUDA 3WYNA 4KQJA 3ISJA 2VHZA 1GGFA 4NHOA 2Z3WA 3KVYA 1NSFA 2EQBA 4MKGA 3IDSA 2GZDA 4LXGA 4NOMA 4XB1A 2C1XA 2DY1A 2JFVA 1U0OC 2GEJA 1Z8DA 2OECA 3AG6A 4RQAA 4L2IA 5F2OA 1QH9A 1YAJA 1K92A 1NVMB 5AJTA 5H3CA 1ZN8A 4B2PA 1E0JA 1DG9A 3S2SA 1BQEA 4U7FA 4U7HA 1M75A 4M0MA 2YHUA 2WQZA 1BAPA 3TQFA 3ROZA 4ZQHA 4ZJPA 2WU0A 4BJ1A 2GF9A 3S7TA 1CUGA 3VBEA 4BCDA 3DYBA 2OXFA 1EH5A 1JQLB 4WOJA 3O26A 4B47A 3BMNA 5TVGA 3ZBUA 3F5MA 4V1CI 4BLVA 3KBOA 3OZWA 3QFTA 4WKPA 1I80A 1ZXLA 1HDEA 1XU7A 5DW3A 1SRQA 1NNI1 2AKYA 1Q44A 3GEEA 1BA3A 2H1VA 2NV0A 3OECA 4WFJA 5H02A 5J4YA 1QC5A 1Q84A 3H9GA 3L82B 4RY8A 2GO7A 5G0WA 4I19A 2QUAA 3RRJA 4US2R 4NCHA 4KACA 4CHGA 1O95D 3ZHYA 1FSPA 3ZBQA 2ODNA 3GHYA 4X20B 2N9UA 1BKSB 3V2IA 2O0MA 2RGDA 2Y1GA 3LYHA 5ED4A 3LNCA 1CBUA 1L8LA 1C9MA 1MH1A 4NX2A 3UW1A 5AVWA 1FDVA 3PR1A 1HI9A 2BSXA 4NS1A 3UHFA 1XUOA 1O54A 1BX3A 4JN6B 4O4LA 5J5VA 1DOZA 1TMOA 3GVCA 4N0DA 5AW4A 3IELA 3CINA 4E13A 1AK1A 1DC7A 4JB2A 1ZD9A 4WZAA 3ZYZA 3H4VA 4G4IA 5DGIA 2C5BA 4R71A 1L4LA 4QO7A 3AI1A 3EUFA 3RTAA 4DUPA 4X92A 3BD8A 1RWNA 3CR3C 1FS5A 3A4IA 3B9BA 5K3DA 5C4GB 1MD9A 2A1UA 3MJVA 1TZ2A 3FPLA 1E1NA 1RDFA 1SCIA 5HQ3A 4MKHA 2QI9C 3I0MA 2WUVA 4V0NA 2BEVA 2QEQA 3MB8A 4HK4A 4BVFA 2X4LA 1AO0A 4L57A 1XD9A 4C4SA 2JHGA 1VKNA 1GGEA 5TGDA 4ASUD 3V8PA 2GWRA 1F06A 3ZHZA 1G19A 1Z0SA 4WVLA 5A4MS 5C32A 2DBZA 2JRLA 3W5HA 3SM3A 2O07A 3PUKA 4LYHA 4IX1A 1K8RA 3MD0A 2CYCA 1J2JA 2QTNA 3EVZA 4V1CB 3TDMA 3NM5A 4CNBA 2IEIA 1PD1A 4HNQA 4B32A 1GPH1 5JO9A 4D26A 3RWMB 1UJ6A 4NYIR 4F86A 1A2BA 3D02A 2IITA 4C0AC 4US1R 4J2HA 3C5EA 4AZVA 4D0NA 4TYWA 2EQ5A 1QKJA 1PTJC 2CE2X 2G7MC 2UVDA 3L7CA 4ECAA 4V0ME 1DXYA 4D4HA 1V8FA 4XDHA 1GSHA 2X8JB 1KEWA 3ZHCA 2A5YB 1XDWA 5E7MA 4MYSA 3RRZA 5FBRB 1NSYA 4HQ6A 3QF7A 4J07A 5E8JA 1J5EB 1B8PA 1IUNA 1RYHA 5IJ9A 5L9AA 2R4UA 4NK4A 3VZSA 4JB3A 1CUAA 1G18A 1GQYA 2ES4A 2I3ZA 2XAAA 3I9OA 4EF5A 5JMOA 3K5PA 5DLEA 2X7HA 5FL3A 1U7HA 5D3KA 5TRTA 3W3AA 3PKZA 1M1UA 5HRCA 3LCJA 2OEPA 5F5LA 4IVPA 3AUTA 4R7ZA 2L2QA 4IXTA 2PUJA 1WDTA 2FOIA 4EHHA 1GN8A 1JSXA 1K4YA 2FX3A 3D8HA 3EIOA 1A5TA 2OM6A 4Y9DA 5HBGA 3WI7A 1KVQA 3CNHA 4HZGA 1GUZA 4IH1A 4KUGA 4CN9A 4EVSA 4IRUB 1CUZA 2QVZX 3PFFA 3IT2A 4DG5A 2QBYA 2X2EA 2NU7A 2V4UA 1X19A 1AKYA 3NBAA 3T9DA 2EFGA 2HUPA 3P9NA 3SVZA 4BS9A 5K8CA 1CEYA 1CHNA 4IOJA 5GVRA 3SSMA 2XOXA 2W93A 1L7XA 3KR2A 2GRJA 2HGSA 2VG8A 3DNPA 3MSCA 4UATA 5E0OA 5IBQA 3A05A 4LQCA 3QHAA 3O84A 2CMDA 1YJCA 1O0BA 3MJDA 3CURA 1I14A 2WZQA 2J1LA 2Q7XA 3UEOA 1K2VN 2ZETA 3FYTA 1VB5A 4ZRDA 4IDPA 3W7AA 4B8YA 4CKWB 5ITSA 3NHWA 5KINB 2WJHA 5T4BA 5I01A 4M21A 5SZHB 3EY9A 3G2KA 1RIIA 4D8YA 3OWHA 4S1OA 5D86A 4W1QA 2PLWA 3CZ9A 4REMA 3JVIA 2BBOA 1YS1X 3E3LA 4ROTA 2ZSUA 2Y9PB 3PT9A 2UZ1B 2WDZA 3QMVA 5FKJA 3RS3A 2VUUA 1BE0A 1D2HA 1VE9A 2NQ8A 4FYMA 5BOVA 5G0SA 4EL0A 2GM4A 1K5GA 3F98A 3ZKAA 4Y1GA 4BWYA 2JLWA 1RI2A 3P9SA 2BRUA 2XGSA 2ZYIA 1U8XX 1OZAA 2OD2A 3NWOA 4QUBA 4TXLA 1XV5A 2H4JA 4FFSA 3TEJA 3IR6A 4OIFA 1LI5A 1OT5A 1ZN9A 3QI2A 3RR2A 3ELYA 4N8SA 3UMSA 3PEVA 3PXCX 4Y2SA 1O2DA 1YIAA 1SVKA 2CLHB 2ZQ5A 3F6CA 4RVNA 3TAUA 2VJMB 3EF1A 3ZCTA 3ORYA 2PU5A 4JC8A 3U2QA 2V5VA 1YOVA 1TM4E 4Y2PA 1UBUS 4WA8A 4X71A 3UMRA 2VPWA 4CDRA 4OXQA 5EJ8A 4IAOA 4E5SA 2HO5A 1WLYA 3NM6B 5J3JA 3BRWD 4LW8A 4AZ3B 1PNQA 4Q37A 2I99A 4RHXA 3MWEB 4LJLA 5EXEA 4EWLA 1I5EA 5KYUA 3VO9A 1SQ6A 2C3YA 5B7NA 3UXYA 1KQFA 1VLJA 4D9EA 3OLWA 3FWZA 2H4FA 3EVNA 2C99A 5M29A 2R7NA 2K6GA 5ICEA 2C98A 3B6IA 3DAPA 1UKCA 4K6KA 1UPAA 4JCCA 4LDJA 5IAOA 1NJ8A 4GLLA 3E9ZA 2QJWA 3F78A 5GY7A 1HSOA 3AUXA 1TCVA 1MABB 4ZU6X 3U37A 3M83A 5LU8A 4W5TA 2DT5A 5ICSA 1NATA 4PYLA 1U8CB 3DC2A 1E98A 5CH3A 5LL6P 3IQDB 1CUYA 3LPDA 2ZIXB 3O0TA 4EARA 4OQQA 2BRUC 5C51B 1AKTA 2CJPA 3VTFA 5BNZA 5JYDA 1V3UA 2V7TA 2HJRA 3H2ZA 3RF7A 4AECA 1QPZA 1JU4A 2WIGA 1NC1A 2QX9A 1UK6A 3I4FA 3NYIA 2XW6A 3WGGA 5KSOA 2PWBA 5JATA 1HT2E 2B8WA 4DDUA 3JQ6A 3L8CA 3NVMB 4GM4A 5K09A 2YWCA 2PX6A 3O5AA 3BFJA 4MWGA 4C4PA 3Q41A 1UBCA 3QELB 4PYOA 2VJPA 5IDQA 1JKIA 1BFKA 4ZK6A 5DF1A 3E6AA 4QU0A 5BO5A 2L18A 2CCKA 4C5BA 3SICE 3OMLA 3C3KA 3MCVA 3MSXA 4PYIA 4Q3LA 3V4OA 1YDGA 3AB7A 3DQPA 3SIRA 4NFLA 3I9KA 3DFMA 4DIOA 3AR6A 2ZE5A 4K9OA 3RU3A 4F4JA 3UHPA 4QFDA 3QX7A 2EP7A 2X6RA 1Z7GA 2JHPA 2PBRA 3FZQA 3VPSA 1YCDA 1KGDA 1A95A 5EMMA 5H70A 2XQIA 3SX0A 3JALA 3WL3A 3N28A 1N9GB 1GU0A 3HUUA 2E3JA 4ZYLA 2ZSJA 2PT6A 2DTDA 2PS3A 2BI7A 3IEUA 1IB6A 2EFJA 4G9GA 5DGCA 2JPDA 4X1IB 1PJTA 5SYAA 1M1YB 3WNBA 1ZBQA 4RMJA 3I64A 2GLXA 4WXYB 1RI1A 2I2FA 2Z9CA 2Q1TA 5GOTA 3OEEA 2A67A 4URUR 4GG1A 4RTRA 3DUFB 1YKFA 1GPWB 5FNVA 1MO3A 1W48A 2M98A 3FKJA 5K8VA 5HNKA 4LWOA 1DTSA 4DR7B 2KM1A 2ZYUX 1NQXA 3TRIA 1Y8RB 1MNQA 3HJHA 2XB2A 5F2KA 3QVGA 1J09A 4OJMX 2JIOA 3Q5EA 3EOZA 2XD9A 4KAAA 4M53A 1BE1A 4L9RA 4PQEA 6AT1A 1WHSB 3L7DA 3ZV5A 4GX5A 4QBTA 4MS1B 2O3RA 1NYRA 2F9FA 2DRIA 3IJRA 1W2GA 3COPA 1ORTA 5I5GA 1CERA 3L93A 5F35A 1ZY2A 1N2HA 3GLKA 4N3AA 5J40A 1Z8NA 3JD1A 4TSFA 1H22A 4XTCS 3MWGA 1YSCA 3RUIA 3ERCA 4YCJA 4HQFA 1PWXA 1T8WA 2AC4A 3E3NA 4MQFB 2YZ2A 3LT2A 4I9NA 2OHIA 3AL3A 3OY7A 3UPTA 3QKRB 1UKBA 1CK4A 3BRCA 2DR0A 5E8RA 3ZUPA 1C3LA 2X40A 4DQVA 4XR9A 1JBKA 2YV4A 1YB2A 3NP7A 4FKBA 4B82A 1XZ8A 5J4HA 4UUNA 3DOEA 1D9ZA 1G21B 1VE3A 3GJTA 4IHKA 3W77A 2A9OA 1JILA 1K6IA 4WRRA 3UB2A 1KSGA 3KE9A 3C3BA 2ILVA 5HFNA 4F9EA 2OORC 4X1KA 2JGLA 2GWHA 1GARA 3NCHA 4D46A 1HM5A 1BXZA 3TQHA 2B6NA 3TTXA 2Q5IA 4P82A 3CUWA 4ISBA 3FNFA 3HMQA 5BSWA 5E9AA 2GK4A 3BMNB 3VGJA 4U2EA 3WIUA 4A2CA 4N12A 4BRZA 4PIPA 1JSZA 5CIQA 4BRSA 2O2SA 4PFQA 3IQEA 4I4TF 4K0KB 4CG0A 1HE4A 4HNAB 3GZJA 2IIQA 1CZLA 3ZS9A 5CDSA 3FNEA 2FH5B 1Z37A 3BWEA 3UJDA 1GQRA 3TN7A 5L6MB 1FLVA 1EFAA 3RC8A 4IJMA 3HC7A 2VOEA 5CB8A 4YT5A 4YUAA 3W90A 3OAAA 4RZXA 1B93A 3ZH2A 4E11A 4X8LA 1O5IA 3L8MA 4ZEWA 4MV3A 3KQHA 1M1NA 2NSHA 1QHEA 3AV0B 1T29A 4JEIA 1G64A 3OCCA 3DDCA 1DAPA 4CDGA 2AT1A 3CGGA 3CSUA 5C0OE 1X8XA 1AZWA 5H81A 2XEDA 1ZH2A 2ZB2A 1DJLA 4CCWA 3JQGB 4ES6A 3P4UA 4AZTA 1WUTA 4Q1CA 1EIZA 3MVEA 4W82A 1TYBE 4KRGA 1XZHA 2BAGA 4AMGA 1H6CA 2PY6A 3I6ZA 1QCZA 3OLZA 1NULA 2OBNA 2PH1A 3B89A 3UXMA 4DW8A 2W8BB 4JI1B 2HMSA 2X1MA 1NJFA 1Z6AA 3F6YA 5ECDA 3RVRA 3TZ6A 3X1JA 3GPIA 2ZI7A 2PLRA 1QZZA 5JROA 3VH4A 3T52A 3U80A 2J48A 4GYYA 3RG2A 4DM3A 3E22B 4I5IA 1UMBA 2NZUG 5FLEX 2HRRA 1QIHA 2UUPA 3IE2A 2Q6OA 3IIKA 5JZMA 4V0MA 4CIAA 4V3CA 2D2FA 2RI0A 3V00A 2I87A 4R1QA 4TQ9A 3H0KA 5LLTA 1TC2A 4RSRA 5AVJA 4PG8A 1R8SA 4D81A 3H13A 1E3DA 1TJ4A 1VE6A 2I54A 1UBSB 2BW0A 3KOMA 3CXUA 1TD9A 1RE0A 5CT9A 3ZVMA 4P38A 1WCIA 1S0UA 1UKEA 4D4GA 2QRVB 3GFRA 4JWKA 1A5ZA 1XG5A 3KFVA 4L15A 4NCXA 1QE5A 1XP5A 4Q1EA 4ITVA 2Q6LA 3EXFB 4WXPA 4YACA 3H19A 3K8OE 3R7SA 5C8YA 1ACJA 1WUJS 2IZOA 2YXBA 4GPEA 5M5BA 5KTPA 2EQAA 2BHRA 3QFSA 2J3LA 3VPAA 3PQDA 4FGLA 4UFPA 1IVNA 1NRWA 1TT7A 3VO8A 2RHOA 3N05A 3WQQA 5FOUA 3WNCA 2XDYA 3I2JA 4H7KA 4B31A 3TJMA 4MIYA 3AVUA 1GL3A 3FVVA 3OFNA 2FNAA 4YH1A 3HBAA 1R8JA 1MAAA 3GLSA 3IPXA 2VT2A 4ID9A 2ISCA 3ZGVA 5G0UA 1H9BA 1SY7A 2CXHA 2JHAA 2MTBA 4W1RA 4PU0A 4C30A 2QP3A 4EA6A 3AF0A 3EWSA 4QECA 2SKDA 4CLRA 5FOQA 1AGPA 2RHMA 1OD6A 3RUDA 4Z7JA 4E5MA 1JQ3A 1FW6A 4BUZA 3BN3A 3DWGA 3DMTC 2ZSAA 4NQZA 1PR6A 4H77A 3GLRA 3A2NA 5JSZB 2WU3A 3TEFA 3DLIA 4UNIA 3TZKA 1U7WA 1JW9B 1OGIA 2P40A 4PR0A 2H2IA 4R05A 3QU2A 3MTAA 3LC7O 3RKSA 1FUEA 3SF8A 1UZAA 2HJGA 1N7IA 4QSHA 4OMFG 3AJ8A 1E9FA 3GMDA 2FN8A 3M0EA 4TYMA 3HB1A 4RMGA 5JYEA 2B4RO 1HLFA 4EELA 4YCAA 3Q72A 1O94C 2FW6A 4XCXA 4X8HA 2NXEA 2BFMA 3HFSA 5IH7A 1IHYA 1QYRA 1V8ZA 1IXRC 3DBLB 3HU1A 3IKVA 3QQPA 4GPIB 1TO6A 1ZSYA 4A8JC 1N2GA 1WCV1 2PA0A 3E9CA 3LPNA 4CV0A 2R1TA 1Z5WA 1P17A 2QUZA 4RFVA 1J9ZA 1R3DA 1UKVY 2ATVA 2FCRA 4Q1VA 2HU2A 4EY7A 5HF6A 5AM3A 3F0TA 5BRAA 2HLHA 1NLYA 1RM4A 1UBLS 1AKVA 1VG8A 1VL8A 2WD7B 3FBWA 4HUQB 5TS2A 3ROEA 3BE5A 3T3PB 3IQFA 2IH5A 1NVGA 4US0R 2BKVA 1U28A 3Q0IA 4M36A 2WU1A 5G0TA 3THWA 4Q18A 1ZD1A 1DAEA 5IS2A 3NALA 1WCYA 4N9WA 1W0CA 2GZ1A 4EPXA 3PX7A 1TCAA 4KXQA 4X7RA 1AA9A 3MT7A 5EE0A 2O4CA 5H16A 1NW4A 1OOEA 2OCDA 3AHJA 3KSBC 4NZMA 4DLLA 4H0CA 4I55B 2P7HA 3WV5A 4NYIQ 4HLUC 4IYRA 3IOBA 3QWIA 4R51A 5C7YA 1LDYA 4G81A 5AKYA 5H7XA 2CFOA 2FUCA 2IPLA 3K0BA 4QWWA 4G4JA 4JOCA 3TI9A 4DHWA 1GZ6A 4HPWA 3M6LA 3QUAA 2NG1A 1NP6A 1DIOB 3KJZA 1NZJA 1YRBA 2HWWA 4E5PA 5AQ1A 2HRBA 3V80A 2HBZA 2NNWB 4IH9A 4RH3A 4C3UA 1QTNA 3ZV6A 2HFKA