1SC3A

Crystal structure of the human caspase-1 c285a mutant in complex with malonate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta convertase
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sc3A00
4I1PA 5I9BA 4JJ7A 3R7SA 4JR1A 1SHLA 1RWNA 3H1PA 4EHHA 3V3KA 4IEFB 3GJTA 1ICEA 2H54A 1JXQA 1I51A 4NBLA 4D3ZA 2CNNA 2HBQA 4QU5A 3QNWA 4QUIA 2FP3A 4AWBA 5IABA 4QUHA 2J30A 3NR2A 4I1RA 4NBNA 4PS1A 4QU8A 4QUGA 1RHMA 4JQYA 4ZVUA 3H13A 2CNOA 3IBFA 4NOKA 4QUAA 4N6OA 3EDQA 1CP3A 1QDUA 1RWMA 1RWPA 1RHJA 2H4WA 1GFWA 2XZTA 3KJNA 4JJ8A 4JR0A 3DEIA 4HQ0A 2XYHA 4EHNA 4IYRA 3RJMA 4DCPA 4ZVPA 5IANA 3D6HA 1I4EB 3H11B 4NOLA 1NMSA 1RE1A 4ZVQA 3PD0A 2XYPA 4FXOA 3EDRA 4EHKA 4QUBA 2HBRA 1SC3A 1KMCA 1PAUA 4PS0A 2HBZA 3OD5A 1IBCA 1RHUA 2CDRA 1CVRA 3P4UA 4AW9A 3H11A 4NOMA 1SHJA 5I9TA 5IBPA 4EHFA 1RHQA 4EHAA 4D3XA 1F1JA 4FDLA 1RHRA 3PCXA 4N5DA 4FEAA 4QUJA 4ZVRA 4D3YA 4AWAA 4LSZA 5IC4A 4HVAA 3P45A 3R6GA 2CNLA 3E4CA 4PRYA 2P2CA 4QU0A 2QL5A 5IAKA 2H5IA 2NN3C 1RWOA 3S70A 2C2ZA 3R7BA 1RWWA 1K86A 4EHDA 2XYGA 5IC6A 3V4OA 1NW9B 5LU8A 4NOJA 3V6MA 5IARA 4QTXA 1RWVA 3K7EA 4EJFA 2K7ZA 1I4OA 4M9RA 4EHLA 1NMQA 2H51A 3R5KA 4JQZA 4ZVTA 3V4LA 5K20A 2QL7A 3KJFA 2QLFA 3R7NA 5IASA 4PRZA 2J31A 2H5JA 3BIJA 2AR9A 2C1EA 4N6NA 2H65A 1SC4A 4NBKA 2QL9A 2J33A 4QUEA 2XZDA 3PD1A 2HBYA 4N7JA 4ZVSA 3SIRA 4DCJA 4QU9A 1QTNA 2Y1LA 2WDPA 3DEJA 3DEKA 5LUBA 3V6LA 4DCOA 1M72A 5LUAA 3UO8B 3R5JA 2C2MA 5IAGA 1RHKA 4ZVOA 2H48A 1RWKA 1I3OA 3GJRA 3NKFA 4FGUA 5IBCA 1F9EA 3NS7A 3D6MA 1PYOA 2QLBA 5JFTA 4N6GA 2CJYA 3D6FA 3KJQA 5IAJA 2C2KA 2CJXA 3SIPA 3UOAB 5LU9A 3GJQA 3ITNA 4QULA 1K88A 2CNKA 1RWXA 4JJEA 1SC1A 4JB8A 3DEHA 5H0IA 4QTYA 2DKOA 5IAEA 2QLJA 4N7MA 1GQFA 2FUNB 2J32A 2Y0BA 1QX3A 3H0EA 2C2OA 3S8EA 3V55A 3R6LA 3IBCA 5IBRA 1NMEA 2FQQA 2H4YA 4HQRA 4JR2A 3GJSA 4QUDA 1BMQA
chains in the Genus database with same CATH superfamily
3FTFA 3OURA 2P8JA 4L72A 2PZBA 2CDNA 1I5EA 4P5EA 1CZNA 1Z2PX 1VFNA 2PAAA 3O75A 3R09A 4H4CA 1KO8A 1ZRMA 3R9XB 5EIBC 4O3MA 1JPVA 3V1LA 4YV1A 5JMWA 1BGVA 3PUKA 3K31A 4OH1A 4QUIA 3RVSA 3I9V6 3W77A 1KOGA 1M33A 3PQ2A 1U2GA 2FZ4A 3RVKA 3REQB 5EQFA 4DAEA 2BEVB 2JZNA 3E81A 2R2AA 3W3AD 5KSWB 1HZJA 3CJQA 3COYA 3UYLA 1XXHB 2V7QA 1NI4B 1SXHA 5IJWA 5JDCA 3VNUA 4WOJA 5ES3A 2BFEA 2NWQA 3TZKA 2ZRHA 3M5WA 3WLOA 2Y99A 2FMXA 4TMTA 1XLTA 2I33A 2VHTA 2YJZA 4HQLA 3OQ1A 4RD1A 4FYPA 2HCRA 3OH8A 1N1EA 1N7IA 3THSA 3EIXA 4XCXA 1ZW1A 2KBEA 4AI6A 1NDQA 4CM8B 1TTHA 4KQ9A 3HU1A 1RRFA 2CVFA 1SC3A 1Z62A 2HRDA 3H2JA 4B3TB 1DIAA 1P19A 3BA1A 5JNTA 4MCIA 1R12A 3BILA 3GOHA 4IF6A 3RYHB 2ZYVX 4HDOB 2Q4DA 5FCDA 5SZJA 4F04A 1N4AA 4I6JA 1HE1C 1HLGA 2CXTA 2MIIA 4PHHA 1R9JA 3SSOA 1BE6A 5KEIA 4Q1AA 2DEUA 5TPWA 4KSBA 4BO3A 1IBKB 2JFGA 5CW2A 2QXYA 1VGVA 2QTCA 3IYLW 4A36A 1PX0A 3KNZA 5J47A 1FJGB 1ZZGA 4MUMA 5IC6A 4IUYA 2Q21A 5IZCC 1FQKA 2CT8A 1KETA 2ZT5A 3QQ5A 2GCEA 3WTCA 4BNKA 1HM5A 3IO3A 4KC0A 3PZBA 2ACWA 2Q9CA 1P1FA 4H7HA 4WOBA 1K3TA 2K2WA 4WW0A 1GP2A 2OXTA 3P96A 1Q0QA 1KNXA 3C1TA 4NENA 3IVXA 5L3RA 1D8AA 1KDPA 2XUAA 1QC5B 1W581 2QI9F 1UMBA 1HMPA 1XQVA 2M2IA 3FFAA 3IKJA 3DE1X 5EJMA 3BZUA 1USUA 4DT1A 1QGYA 2EFJA 2RSLA 1TM4E 4ILEA 1NQAO 5MF6A 1EVQA 3K9HA 1COZA 4C3ZA 1XVVA 4RDCA 5BNZA 1YJ8A 3IEPA 1WDKA 3L8EA 3V6LA 2W6NA 5EHQA 4QPDA 2JFFA 3RFUA 5CW1A 2G63A 1DC7A 1N1GA 1VHTA 3MVEA 4RHCA 3WKDA 3O93A 3HO8A 1A9QA 3F7NA 5IVPA 1ONSA 3VDXA 1K8QA 2XIQA 1GAJA 3BJMA 2O8DB 4BBZA 1NQVA 1HE2A 2R5WA 2P90A 1YL6A 3PEUA 5DK4A 1QQ7A 1BWRA 3T1VA 1MNQA 3PHLA 3EMBA 1JE1A 3T4PA 5AQ1A 2XUQA 1C41A 3A11A 4TN5A 4X20B 2A9PA 3K32A 1P75A 3A9RA 2XAAA 2XDWA 3U4DA 2BFBA 1X80A 3AJAA 3H0EA 5DOZA 1ZOOA 4EFKA 1HEYA 2OLJA 1K92A 4UE3S 1O77A 1SXJB 4AN0A 1OBHA 2O23A 2VHUA 3BX1A 1Q3HA 2I67A 3AESA 3UFXB 3VSBA 1L8XA 4Y2YA 4ZU1X 2OZLA 3G17A 5F3DA 4BMNA 2ODAA 2MYTA 1DV1A 3GJTA 1PK9A 2JD0A 3A2NA 1R2QA 3OE4A 4TLAA 3CUYA 4F45A 4EEXA 3QLEA 4KQ1A 4IKPA 4IP0A 4MKIA 2Y68A 3TZBA 2HLNA 2IXDA 3CUWA 4NULA 4QXQA 1EJBA 2X6TA 3PGJA 5DSTA 5EAIA 3KR2A 3HR8A 4QXRA 3EEYA 2VHZA 4N48A 2Y27A 1YASA 4N0QA 5B64A 2QPAA 2ZE8A 1ESCA 4PC2A 3RSHA 2GJSA 2I54A 2V4MA 3GCDA 4B1FA 1U0GA 6Q21A 1CB7A 2QK4A 1PLLA 2B8JA 4DCPA 1KMNA 3FOEC 2PA0A 2GI4A 5FLKA 4Y7DA 4MJXA 3NIWA 1W4ZA 1ZNQO 2ZJ5A 4Q7MB 3C16C 4KSYA 3C0KA 2EBWA 3Q15C 4QGHA 1NBEA 2NYRA 2ZIZA 3N1UA 5FPSA 1XTZA 4NV3A 2VDLB 4J0FA 2NG1A 4KDFA 4WASA 1EFAA 4HMOA 4MJ3A 1GILA 5CB0A 4BTEA 3OOSA 2O2EA 4H0NA 4H1TA 5KX5B 4ALLA 1AF4A 1GGVA 4LX8A 3S1SA 3D8NA 4DR2B 3I92A 4AS1A 1GEGA 4GYWA 3INNA 2XKJE 3P9XA 2AQIA 3HUFA 5CYFA 3CH7A 2KWIA 1TX4B 1Z26A 1W9HA 3NTRA 4HN4B 2MYUA 5IAKA 3A26A 3SPXA 4MHTA 2WMOB 5L40A 1ESMA 3BGSA 2JCGA 1YH3A 2GAAA 1X8XA 3C6BA 3EVCA 3N2KB 3QBDA 2GUGA 3DQZA 3HEAA 1SN7A 2XDQB 3IQIX 1Z6YA 1FUKA 2RG1A 4NI5A 3ZI4A 4AO7A 1XLUA 1M1YE 3FE2A 3B1WA 3CZ4A 5G53C 1PUIA 1I2DA 1WXQA 2IDKA 5I5GA 1R5JA 2D1TA 2QX8A 4BJ6A 1DOZA 4ZCTA 2XYRA 2J31A 1YFZA 3QVGA 1MO3A 4RSGA 1D0VA 1CSEE 3RSQA 3F5MA 3S55A 3PD1A 5EP2A 4NDZA 2Z58A 2PWAA 1JQ5A 4C1BA 4MPDA 4P80A 2I0FA 3U44A 1JLKA 3M4JA 3M6WA 1YMQA 1W19A 3W6OA 4MWBA 1F2TA 1T91A 3Q3HA 2DC1A 4NMLA 4R40A 4MGZR 4YXWD 4BNIA 5JFTA 1K8XB 2DSTA 1RQ2A 1O6ZA 4N5LA 4OGKA 5HF9A 1AZLA 4BQSA 3OPQA 4TQAA 3SVTA 4RO0A 2PANA 3DKRA 3T9FA 4AROA 4B79A 2WINI 2P9EA 2OCDA 3OG9A 4U9HS 2RI6A 2XGGA 3OWHA 4OHXA 5AOBA 3IDZA 4OXNA 4BP1A 3AKZA 1ISPA 3K1AA 1JQEA 3IXLA 1IC6A 2NO9A 4WRRA 4G2NA 3IMEA 1OVGA 4CV2A 3RVBA 2AMYA 3O8NA 4EYEA 2A0WA 3ZLVA 2C3PA 5I51A 3JAKA 2IHTA 1OLSA 1BXRB 2VAMA 3HI6A 4C6TA 3OEHD 1L5MA 4CF4A 4YCNA 4ZZ3A 1KEEA 3SHOA 1ODSA 3R7AA 4KQGA 5EERA 2CLKB 4Z9YA 5IW8A 4EG6A 4KLNA 4L9SA 1XUOA 3DM9B 5AVWA 1QGUA 4J6EA 5HQ3B 1ONOA 2NSDA 3LV8A 1R16A 1TUEA 1M75A 3IP9A 4LJSA 4R1UA 3GPLA 4IKOA 4C14A 1Q77A 2ONCA 1GYPA 4JT9A 4BNNA 3CSUA 1S1MA 1A97A 4LXUA 2IYPA 2NTEA 3CZRA 3DOOA 3B1YA 4YRLA 1MOQA 1NHWA 1W9MA 4L8WB 2Q5OA 3PCTA 1OX6A 5FORA 3D8UA 2FGJA 3NV9A 4QC2A 5TPZA 3ZLTA 1L5HB 1XCLA 3OFVA 3EIWA 1KWKA 3MOIA 3W4IA 1MRSA 3II6X 4QVKA 1M6NA 2WWGA 1H2EA 2OBLA 1AB6A 1V96A 1CIPA 1EP2B 4MMYB 1O96B 3TNLA 3PQFA 1KMCA 5CLQA 3A2LA 1VPVA 2C7BA 1NP3A 1XD2A 2PUCA 3B12A 2FPUA 3DF9A 1RJ9B 1L8QA 3F47A 1RAEA 3P2KA 1MAWA 1JSRA 1R4NA 2DCMA 4M99A 1O1YA 5TGDA 1HR0B 2VP6A 1YR1A 3BL8A 2AOUA 2JCXA 2JDIA 4HWPA 4EGSA 1WB5A 3JQBC 3L8ZA 1Z13A 3O9MA 2WZBA 1WZIA 3H2ZA 4NU0A 4P8RA 5JH7A 1GQQA 2PO7A 2ZOSA 2ZJ6A 4YPFA 4WY2A 3DMNA 4RFSB 1HI9A 1P7ZA 1DQZA 2WFLB 4FNGA 5BSWA 5LQNA 3U19A 1KXJA 4G4SO 3DNPA 2XYGA 1N75A 3WLKX 4MGEA 1U6IA 1R5OA 3LGAA 4J1SA 4F8EA 3A70A 5JASA 4WXEA 4FYXA 4I8DA 3VH3A 4DBLE 2HK8A 4GW3A 1PYGA 3CIFA 3BWYA 2Q1XA 1F12A 1W0KA 2WTMA 1Y98A 2ZUWA 3ZE8A 4MS3A 4LI3X 3L82B 2LKDA 5DX8A 2YWFA 4IIFA 3WSVA 4XLTA 5F7JA 4YRBA 4H7PA 2C92A 3QMVA 4LNHA 3TQTA 1FXWF 3AONB 4YP9A 2G06A 1GKYA 4Z6KA 3P0JA 2UZAA 3A1WA 5IKOA 1AUVA 1UZLA 3B20A 5HM6A 3VZDA 2R8XA 1UEJA 5FUMA 3AVVA 2CF5A 2C3UA 4IRUB 4L73A 4Z3KA 3LVFO 1Z5WA 1M2JA 1KDTA 3QU2A 1Z2AA 4TM7A 3DFFA 1KI3A 3PICA 2GKSA 1XDSA 1Z6PA 5A2QA 3JQ7B 3QWBA 4CV1A 4PYOA 3KSZO 3LCVB 1L6RA 3P26A 3IIJA 3M33A 3RUDA 4CKEA 1P44A 2HO4A 3EG5A 2FPKA 1KYVA 1XYVA 2M6RA 2IEZA 1CZOA 2R97A 2WJ4A 3KO8A 5I8ZA 3AF5A 2JGDA 3MJEA 3PLRA 2HB6A 2Z57A 4XX1A 5ULLA 2OV2A 3B48A 4ZJUA 1UAGA 3FI0A 4K3UA 4RETA 2CN1A 1YAHA 4FMDB 4KK3A 1UOEA 2HA0A 4PE5B 5LA6A 1OV6A 1Q3TA 2GYUA 3LW7A 5F78A 5A7HA 4BMVA 1CUVA 2Q1UA 3PXDA 1VZ2A 5LZ7A 1C50A 4BX8A 2PWYA 1C1DB 1DU4A 4BQPA 3NOVA 1MAAA 1RIFA 4KVGA 3VDQA 4E70A 2JHAA 2HU7A 2AN9A 3ILXA 3N2GA 4QU8A 1VG1A 3U3OA 3ZE1B 2YV4A 3I37X 2IU4A 3M89A 3ZW7A 4M1YA 4HWKA 2VLBA 2WRZA 1JXAA 1TIKA 3E70C 3HA3A 1VJCA 4NEHB 2WHPA 1JMVA 2IIPA 4D0NA 3QFSA 3VTAA 4EHJA 5A3RA 1QNFA 3I8SA 4WQMA 5D85A 3ZYZA 3WIVA 3LZCA 3NWEA 4NABA 3H05A 2A5GA 2C59A 2ZI9A 2I80A 3ZPXA 3BIWA 1XQWA 4KGXA 5M29A 1GTRA 4RH3A 3OUZA 1L7VC 3AO0B 4QUBA 3V80A 1ZH2A 1B6RA 3W5SA 1A8IA 5K2OA 4JIMA 2UUPA 2QD1A 5AI4A 4EATA 5CFRA 2YOGA 3KXPA 2AYZA 2IYQA 4TL7A 5JS6A 5IK2A 4DUZB 2Q3LA 3KWFA 2XT0A 1XELA 3V00A 2VK4A 4GX5A 1IB6A 2Z56A 4BKPA 3V4FA 2JIRA 3OWXA 3CLHA 4GO1A 1P62B 2ZYDA 2NU7B 3GWZA 1RXIA 3STXA 3V48A 2IL1A 5ALGA 4YDRA 3VR0A 5KTMA 2Y0CA 1AGYA 2EX1A 2J3HA 2WB2A 1Y33E 2AKEA 1AKYA 3L5KA 1NLZA 2E82A 3MIIA 3VR4A 2QT0A 5LU8A 5IHXA 1UWCA 4TVKA 1MZPA 2O3SA 4MGHA 4UC0A 3GW8A 1GL7A 5CX4A 1Z75A 4YTEA 4DLAA 1ODIA 3FB4A 3PXUA 1RPTA 5EQJB 3RD5A 3PVSA 3DHYA 1Y9EA 2EW2A 4E5NA 3LWDA 4JLDA 4B7CA 3PVZA 3EDYA 5HRUA 3CIOA 2I6SA 4QQFA 3EWAA 4ECAA 1D4FA 2NQ8A 5B7PA 2OMKA 3LRPA 4XQEA 1SKBA 3E9EA 3R6DA 2REQB 4DG5A 1P6QA 2JKYA 3SFTA 2P9QA 3WR5A 2NP6A 4Y9UA 4DXHA 1Q1EA 2ODNA 2R751 1RKXA 1OXUA 1Z33A 4E33A 2X9VA 1H3NA 1G20A 3L7CA 2A5FA 2HSZA 2ZUDA 3NWPA 1JQ3A 2VCEA 3FZGA 5G3ZA 5GPBA 1YMVA 4DMMA 1P8AA 1TEZA 4Q4JA 4U6NA 3O3NB 2EW8A 1DMSA 1O3YA 3G88A 3KELA 3BOSA 3OFNA 5GVRA 5LCXA 1AO3A 4DJAA 4S0XA 2IELA 3MC1A 2BFDA 4EI9A 1C8LA 4RLSA 4IGIA 3I2FA 2R8EA 2VBCA 1CK4A 2V8BA 4WE3A 1Z5PA 1WPRA 4NPCA 1ODFA 5E6UA 721PA 2XA2A 3ZI0A 1NVWQ 2EFEB 2UYQA 1NL3A 3BQNB 3TZCA 3D4OA 5JU6A 1ZX1A 2VXCA 3DGFC 1XMIA 2AZTA 3F9CA 3K96A 3M5PA 4HWOA 4RPJA 1NX9A 3ABZA 3BWDD 1VMIA 4XM1A 4ZQHA 2BSXA 4MV5A 3PBKA 2HCJB 3N8NA 3ZHCA 1XV5A 3KJZA 4KXWA 3VSCA 1NUAA 4EKGA 4HVLA 4CQMB 3U60B 3GRYA 2C0PA 1JH8A 4V24A 3HWRA 3PQ4A 1E2PA 4YJGA 1RZRA 1DTWA 1NNEA 2HA6A 4UARA 5NULA 2BF4A 4B46A 3RIXA 2VHXA 3IOMA 3I04M 3VVBA 3VYTB 3QYJA 5G0WA 1ZGJA 4Z4QA 1TJPB 3EEIA 1OTXA 1X3SA 1ULZA 1ZVKA 1QFSA 4OFZA 4TQUS 1B7GO 3UHJA 2FP3A 2Z5FA 1HT3A 2X19A 3PUHA 3WGTA 1SVUA 3L8MA 2QTVA 3O9ZA 4B3IA 5KSYA 2DQ4A 1GNQA 1VIMA 4Z5XA 4A9AA 3ZCPA 4UNRA 1KPHA 4JJ8A 5KQSA 3GGJA 4OHMA 1BNCA 2QHXA 5F33A 3NUGA 4RCVA 2O2ZA 1NR1A 2CCGA 4OQMA 5B3JA 3LY5A 1DLIA 4G8CA 2NSYA 3EVGA 1R0BA 4GU5A 1YE5A 1PTJA 2VJMA 4U2CA 5BUSA 1HTBA 2P91A 3CH5A 3IIIA 1YZLA 3ELDA 4M9SA 3R8CA 2FPLA 3U3XA 1I32A 3FCAA 2CY0A 3P20A 5CVDA 5EKUA 5FR1A 1Q7BA 2G80A 5TEWA 3PI7A 3PNSA 4OFXA 3NBKA 4QO7A 1H6DA 1XAJA 5DASA 1O6CA 1R4ZA 2P78A 3EXFB 4LYDA 2XGSA 1AS0A 2CHFA 5AKXA 5JBQA 3E7XA 3K8OE 2PPLA 2AG1A 1Q92A 4GVXA 5DGDA 1DRVA 3ZVLA 5JPDA 4S1VA 3EGEA 4N7RA 1QGAA 2WIJA 3T6KA 4QAQA 5GONB 1H8HA 4LW8A 1G1AA 1UFQA 5CVVA 3DEYX 2OK7A 1H5UA 2PX8A 3C3WA 1FCJA 9ABPA 5KU7A 2D13A 1UM9B 3NBAA 2VWPA 3C98A 4HVAA 5TQ0B 3OJWA 3FCEA 4U9UA 4N0DA 1N92A 4ZOLB 1K5GA 3GNLA 4FGKA 1C0KA 4JBLA 3RVPA 2R44A 3AUXA 3OA2A 1EXDA 5AJYA 5EJ2A 1YQTA 3F74A 4ZZIA 1G8GA 3C5CA 1QIFA 1IUOA 3ZHYA 4CQLA 3P1JA 2OAP1 1L7PA 4ZAXA 1CS4C 4J4BA 3S3TA 1NQOA 1VCMA 2AMLA 1Z35A 3AHIA 4AQDA 4TRMA 4GH5A 5EHNA 4PEVA 3GZ4A 5FUWA 3ST7A 4BO6A 5HX7A 2FN4A 2VSFA 3SXUA 2N1BA 4IGFA 2OHFA 5YASA 4JYPA 1DRKA 5BR1A 4H7KA 4RUKA 2GXUA 1WP4A 1P29A 2RKBA 3EGXA 5D00A 4BGEA 1K66A 4TL9A 3H83A 1NZFA 1GG2A 1T5DX 1VDZA 2I3AA 4Q6BA 3U3MA 2QD2A 4GQBA 3VJLA 4RZ2A 2QRZA 4EMUA 1Y89A 3JASA 5LBIA 2GHRA 1TL7C 2BKEA 2DQYA 2X3YA 3U4IA 4UMDA 4HGQA 3P9YA 1FJHA 1K27A 3IJRA 3HFJA 3WWYA 2C2KA 4PYRA 1VA4A 2AKAB 3TINA 4ZCPA 1CV2A 2YV2A 4KRXA 1QYIA 4GYJA 4MKXA 4RQUA 2XDAA 4ES6A 4GDMA 3HN7A 4WLUA 2VWQA 4AQ7A 1EP9A 2A9OA 5KSPA 2Y4NA 2KS6A 1AS3A 1TQ4A 1EXWA 4YALA 5GV8A 5IDXA 5L4LA 3WS7A 2W4QA 5C1PA 5KVVA 3TR6A 3F98A 3C4JA 1PNVA 3FHLA 4JJGA 5TMDA 4B6JA 4C4RA 1YTUA 1PZGA 1JKMA 4FB5A 5DHTA 3L79A 2G82A 3WKEA 3RIMA 3UYKA 1HT0A 1POWA 3FZNA 3MUOA 1JAYA 4U00A 5E0OA 1SKQA 1VCOA 2E4VA 2NTJA 1IZ9A 1AA9A 2WPDA 1KIFA 2J3JA 4OMDA 3SI7A 3VM6A 4B09A 4JJ7A 4KZKA 1BW9A 5CIWA 2QN9A 1RCTE 5JJIA 4HDRB 3W78A 521PA 1U2RA 3DAFA 4K8OA 4PHGA 3VU8A 2A9RA 3KFXA 4BLTA 4D8YA 4DDWA 5B30A 1W87A 2PMFA 1E2KA 1GRNA 3DDCA 1J2YA 2GS9A 3KVYA 1IN8A 2HYDA 1HYGA 2XTMA 2CJWB 3UHAA 1PL7A 4R9NA 1OX4B 2V6MA 1CB0A 3E8SA 3TCKA 1QM5A 4M38A 2MU1A 4MTLA 4RK4A 2X5KO 1G2IA 1GGMA 5ALQA 3TE7A 4ZMBA 2JEOA 3QOWA 2XTJA 3TB6A 2VSNA 3NHZA 3WIBA 4B4UA 1FXWA 3DWFA 3NHRA 1PZHA 1JDSA 3ENNA 4BNWA 1D04A 1SXJC 4KO2S 4X60A 3A06A 2OQVA 5IANA 1FJ2A 1QK3A 5IYZF 2A0XA 2HWXA 1VMEA 5F73A 3OKCA 1RWQA 5KYKA 2FWRA 3SOZA 3PXAA 3TDKA 5FA8A 1ZGZA 3LG2A 4EPRA 1V1JA 2Z4SA 2FEOA 3QIAA 3GP5A 4JP2A 3L8FA 1R0CA 1ESDA 4V0ME 5EUMA 5C1IA 4IMJB 1V8OA 4A1FA 4ZKDA 1J70A 1F48A 1RAFA 1VRVA 2C2XA 1BU5A 4WKOA 3TBKA 4AY5A 2OHXA 1LPPA 3N5CA 1G18A 4E5YA 2XV1A 3QE9Y 1XVLA 3JY6A 3LCRA 1RQLA 4QJIA 3JATA 1J0CA 2IQ5A 3CF0A 1Q5PA 5C5IA 3E7FA 4IIJA 3ETCA 1Y63A 4DLXA 3GEHA 1TVEA 1EDEA 3ONEA 1IWOA 2I3ZA 1FF9A 5HIMA 1IQ0A 3JZIA 1NPDA 2ABWA 3EFBA 2XB2A 2UVPA 1HGXA 5B37A 2J6BA 4QJ3A 3E05A 4KAAA 4I7EA 2BGMA 5FPHA 3ZDQA 1K4YA 4FKZA 1HYEA 2WWFA 4MB2A 3T5BA 3HYCA 3K8ZA 2XYVA 4KEAA 4FD2A 4MI6A 3WJ2A 3QLJA 2QZ4A 2FSIA 2E2WA 4FEYA 4V2IA 1QS0B 1LTKA 1G7SA 3G13A 1SO8A 2HUPA 3ESDA 4N41A 1JG6A 1DFIA 4N0EA 3EXIB 3GLHB 1E2IA 4V0KA 3VAZA 1ZA2A 1O95D 4FBMA 2J3MA 3KXLA 1QHHA 5CNIA 1IXSB 1FZQA 1N2OA 4RVCA 1NVMB 5KSZA 3K5IA 1NXVA 1PYOA 1GUZA 1WB6A 2DFDA 2VPPA 2WD7B 1E2QA 3KEMA 4YECA 4ZT4A 3F3YA 1ZWKA 1WL8A 1QIMA 2WYOA 2HK6A 4XFDA 2PDAA 4KUGA 3EEFA 5I9LA 2WP8J 1KO5A 1AJEA 1EJ0A 1VHQA 4LOLA 3MWYW 3KJHA 3C74A 4ZEOA 1TJ4A 3H5TA 3QK7A 4DFDA 4MW0A 2GZDA 4C3UA 5K3AA 2XGJA 1H9CA 3IO5A 1G5PA 2XCIA 2XZPA 4MVJE 4W5JA 1A9ZA 1DG1G 1GFIA 2GOYA 3NHFA 4N03A 4Y2RA 4KW7A 1NATA 1FFGA 1EZ4A 4O4HF 1Z82A 1C9KA 1ZCBA 2FFJA 5HP4A 1Y9DA 2W48A 3QE4A 2O7VA 3JQBA 2XKBA 3HEBA 4OHOA 5CFOA 3B9BA 4E1AA 4E15A 2QZSA 1YDEA 3LIPA 4GZ6A 1YUNA 2IY8A 3LUPA 4FMPA 4FEEA 2BSAA 3HUUA 3OCZA 4IDFA 4TXMA 4CL0A 1MO2A 1UZAA 4QKQA 1YZQA 3G8YA 3QKWA 4DLZA 5KB3A 1D9ZA 2RI1A 1J97A 4CTKA 5J5VA 2DBVO 1MHTA 1H5NA 3GUZA 4O1IA 4JI0B 1EQAA 1R6DA 4XQ0A 5JYBA 2YQ5A 2JLBA 3WOVA 2FMKA 1F2UA 4RF2A 4DTIA 3ETDA 4ZP1A 2GM4A 1FP4A 1XTJA 1R0KA 5G4KA 2H31A 1BGXT 4C2UA 1P73A 2PKQP 3KZMA 2HGSA 4LWQA 4FI3F 4JLWA 2X2FA 4P08A 1F0PA 4YJ3F 4DLWA 3H11B 5KUTA 2C4KA 1Z2OX 2ZRBA 3LKVA 1BJRE 1XPOA 1OA0A 2BZGA 2IHZA 2WG2A 4FXOA 1L7QA 5C8DA 4Q3AA 1LXCA 1Y1RA 2PKWA 2WWWA 3Q3JB 4X63A 5U4XA 3FHOA 4ZGBA 2IJGX 2I99A 5F2OA 3MELA 4C08A 1Q17A 3CW2A 4S04A 3ROZA 3LUCA 3PC8A 1VLHA 4BZPA 1THZA 3V8EA 5LLTA 1EGHA 3ED1A 3L40A 4UNNA 1DWPA 4FFNA 1K6JA 4FYVA 2NZUG 2XVZA 1J25A 3FWHA 4EX6A 1G9TA 5CPFA 2ZRKA 4MW4A 5HE8A 4EY6A 4V1CB 2WF9A 4NLLA 4CMBA 1Y6JA 1CEQA 4FLFA 2I65A 4QU0A 1J99A 4YO7A 3UMCA 1U7OA 1WCYA 5DMXA 2ZBFA 2R87A 2H29A 3PUXA 3VYVA 3LDAA 5FL7A 3L7LA 3T0FA 2IODA 4C4OA 3L07A 1KI8A 4KN6A 1J8VA 1P0PA 1JHUA 2R6CA 5AH0A 3RWMB 4DVGA 1C9EA 4M0DA 1X42A 2XA9A 4RXMA 3BMQB 1NVGA 4MV1A 4HT3B 3AFNA 1FDSA 3RNOA 7MHTA 3GDGA 4GP6A 3QZUA 4JQCA 2ZJ1A 3GYGA 1L1RA 4P31A 3K8QA 4EY3A 5AI0A 3H6HA 1DQPA 5KDLA 1LK0A 1XE3A 2QYTA 3TZEA 4DRZA 3JALB 5IJXA 3LC7O 1SUFA 3KS9A 4QDKA 2YBDA 5FH9A 3WJ1A 2FEMA 2QN1A 3GQVA 4C2AA 5AI9A 3IUMA 2PWPA 5LQSA 4W5NA 1QP8A 3L6OO 1D5WA 4GM0A 3VOSA 3FWZA 2QF7A 1X7HA 2DUNA 3HWX1 4R3NA 3DKKA 3S2EA 1CFJA 2GA9A 1P7WA 3M3DA 2C7GA 1F2DA 2X8WA 3OHSX 2OAGA 3ZNPA 5IKPA 4W1RA 3VR5A 1LC3A 3TQQA 1M8FA 4NPHA 4TWRA 4FFVA 3BJZA 5DNDA 2GCOA 1H42A 4J4TA 1KVQA 3O83A 4MR7A 4MV8A 4NF2A 4MVJP 1J2JA 4PLPA 4FD3A 5KWJA 2BMFA 2IBMA 4JJEA 3U62A 3OZGA 1ZQ1A 1HDYA 3B1ZA 1KORA 3FTPA 5H16A 1R9GA 2BHSA 1IXRC 2LR0A 1XGKA 1BJKA 4EMTA 5HK9A 2ZE6A 2OGZA 4QGFA 3DTYA 2ISSD 4K0KB 4EA6A 1Z4LA 4MYSA 2WU1A 1HT1E 1ZOIA 2PGOA 2VP4A 1E79D 2WEKA 2QTBA 3WNDA 2FQQA 3R44A 4BP9A 5AXCA 2E9SA 3ZGOA 4EW3A 4K26A 3OUTA 2BUBA 2ETXA 2G9QA 2ADFA 2IF2A 4WVLA 3GDFA 5AK5A 4JD5A 1JEEA 5M3BA 2C1ZA 4W9NA 3T06B 4QVIA 2AE1A 3D0RA 4IQ4A 4EBBA 1M67A 3WAJA 2HHHB 2DX7A 3U16A 3SZMA 4KYIB 1BSVA 3UWKA 2CXUA 4CDGA 1UPAA 3I9FA 3KPUA 2N9UA 1ODTC 4BMSA 1Y8RB 2WF5A 5EIWA 1RHMA 2B8NA 5E6RB 5HGJA 4N6OA 3MCAA 4MQ5A 4D1YA 3DEZA 2RGGA 1Q1GA 1TC2A 1THMA 3LO5A 4JR0A 4MJ7A 4JLVA 5CA0A 4BEJA 3RBVA 3L0DA 4A0SA 3AR4A 3CRRA 1JDNA 2BKAA 1LSUA 4YH1A 3ISVA 5IS2A 1CYEA 2X1LA 5E3HA 4AY3A 3ZX4A 3KLPX 1WCV1 3OM9A 4OXYA 2A57A 3QKSB 2H08A 2ZLBA 4HDMA 5EL0A 1JXOA 3IR7A 1D8TA 2ONKA 2P41A 4YAIA 1JBQA 5C8YF 4REQA 2JJMA 3K16A 2Q6IA 3D0KA 3UK0A 3UWPA 4YPVA 4B7UA 4OQFA 2RBEA 5C32A 2QE6A 4FZJA 1UP7A 4FQ8A 3RE1A 3SQNA 2NAFA 4H17A 4JLOA 4Z4CA 3REOA 3E7DA 1MAHA 1N3IA 3W3AA 5BWCA 2GSWA 1Z39A 4XSHA 3EQ9A 5EMMA 1CY0A 2B2XA 3QEAZ 4U39A 2C2HA 2RGYA 3HKEA 3HVKA 3OLWA 1NLMA 2HJ9A 1J8YF 4WA8A 2FP4A 2J67A 3KTOA 2XNCA 4EYSA 2XOKD 2PZEA 5ED0A 2FLVA 2IV3A 2CL5A 5EJ7A 5DBOA 1KH3A 4FVTA 3DBLA 2C95A 2G08A 2FPIA 5HBRA 3KQQA 1ZUHA 5JJLA 2CYCA 4MPJA 4YX9A 1JKJB 1ZJYA 3DZJA 2JFOA 4BX0A 4FE7A 3I72A 3KPWA 2W70A 3C8ZA 5AIAA 5IVKA 3DUFA 2ZYGA 3CN9A 4ROTA 3TLBA 2VK2A 3W3ZB 2GEUA 2ZT6A 3WADA 4L75A 3D2AA 1TYZA 1OASA 4F9FA 2GPYA 2WU3A 4M83A 3ZZUA 1IK4A 1DEXA 1U04A 3PFGA 2JKVA 1ISIA 3BCUA 4ZCSA 5I7AA 1DNPA 5ALPA 1THTA 1A82A 4J7AA 1MLDA 1RRMA 2P6OA 1WCXA 4K7JA 4MW7A 4P5DA 3T4XA 2CEKA 3ACCA 4MRRA 1RI5A 2L82A 3EFOB 4B6EA 1C0EA 5BR7A 4M9QA 2UXBB 3BSFA 2PUEA 3FLAA 3RTBA 2OM2A 3R77A 2HQOA 4NZOA 2D5AA 1KJQA 3KQWA 3LKBA 4WFKA 5IYZA 1MB4A 1QGED 1M2EA 1U7ZA 2CMGA 1XCJA 4FGSA 1C30B 1X7XB 4UPVA 1L7RA 3HA7A 1L4LA 2J59A 2POCA 3VR6H 2W0SA 2BFFA 4LV5B 1IN1A 3A9VA 3RYHA 4EG4A 3CH4B 2P5SA 2ZAMA 2J5QA 1L5FA 4KFRA 2R1VB 2RHGB 4YJ2A 1VSQA 3E4DA 5K0JA 1A98A 1Z74A 1W0CA 2Z3ZA 4C0SA 3BZBA 4GOKA 2XQIA 3EGIA 4PZAA 2V6JA 5HXAA 1K6MA 4BP3A 2QPOA 1K98A 1RSZA 5DSXA 4ENUA 5IM4A 3EIOA 3LDUA 4O4IF 3Q3IA 2AI3A 3JZMA 3PJEA 4G9BA 2X3UA 2YOFA 4JB3A 4YJHB 4EB6B 1ZH8A 1F0KA 1Z12A 3RVJA 1SBTA 4R2MA 3F7TA 1I51A 1NUHA 1Z6XA 3M34A 5T6MA 1SUWA 3VPFA 2O8FA 4HPXB 5IH3A 3C24A 1HT2E 3IQGX 2H16A 1GPH1 1YBHA 3M6UA 1JVSA 4TV8F 4RSRA 2BRUA 3EWNA 3OZ7A 3NVAA 2XW6A 1CZKA 4D98A 2YHIB 1C80A 1IN5A 3RUIA 3SIXA 2E4ZA 4YCJA 1QVRA 5EE5B 1FNNA 5FAXA 2ZATA 5DN6D 5ECGC 1Q1NA 3G2HA 4C0BA 4I50F 1CUUA 3D6VA 1T26A 1Z8FA 1Y4ZA 4YRMA 4FLMA 4CQNA 3O9VA 5H7XA 1XG5A 1CUYA 3FI9A 4W4TA 2BVNA 1SC9A 2GBIA 3THYB 3DLIA 5J59A 4KKXB 2C4WA 4R69A 2QVYX 3OZCA 3SS8A 4E12A 4JVOA 1T0HB 1LCIA 4BRZA 2QN7A 2ZI4A 4FONA 3E84A 4E5VA 3FPHA 4UMFA 2JNWA 1VE3A 3QW4B 4DSNA 3FCYA 1T3ZA 1HDCA 3HC7A 1IM2A 2EKPA 1YA8A 5B1DA 1OH6A 1IRIA 2J9ZB 5KJEA 4X90A 3NANA 4AW9A 3LXRA 3HTXA 3OOEA 1EX1A 1MOSA 1ZKDA 3O7MA 3PHBE 3MMSA 3S68A 4L9RA 1WOMA 3U7IA 1BQEA 4HMPA 1SVSA 2FR8C 3WHPA 1HNNA 5LZ2A 2D7CA 2HRZA 3D4PA 2RHMA 4BB6A 5AKEA 3UUWA 1M7BA 1Y1LA 3I01A 4G5FA 3CVXA 1D2RA 1FUIA 4X9XA 4DC1A 1SGWA 5EMNA 4GZMA 2R2GA 5A05A 2Q2QA 2EP7A 3IVRA 1TT7A 3EXHA 4DSUA 3HCRA 1F1BA 1ZBQA 1AZWA 1ECGA 4WK0B 3QJYA 3M81A 1EUYA 1M1ZA 2FW8A 2O7QA 2PGDA 3OPYI 1MDBA 2LP4Y 3MB5A 3TD6A 2IPAB 4ND3A 4YACA 2NU6B 3CLUC 4URWR 1KR2A 3ZW8A 4BCCA 5C37A 4WJKB 1XCOA 4D9GA 2QSYA 1JL3A 5ARCA 3OPXA 4U7WA 4F2WA 5JNLA 1YI8A 3CZPA 3HV2A 2ZM5A 3I09A 1A95A 1KI1A 1SZCA 1XVUA 2AJCA 2FFBA 2RGWA 1LPMA 4AP6A 2B69A 3G1UA 4YJ3A 1ENYA 2NM0A 5KQLA 4X8OA 2GPAA 5AM3A 2ZUBA 1JG3A 4MCHA 3P71T 4MQUA 3OPYB 1CULC 1GGEA 4DAOA 1N3YA 1CQIB 5IXSA 2J5RA 1K9VF 2AE2A 4C6HA 3JX9A 4PZDA 1A5AB 2QZZA 3DMHA 4N0PA 3UK6A 3KP1A 2OC4A 1UOPA 5KMGA 2JGKA 2OO5C 3LQKA 4NAUA 2VNIA 4LXXA 4YROA 3UMMA 1X38A 2YJNA 3QPBA 4BFWA 1ZMBA 3BG5A 3ET5A 2EP8A 4WDQA 1YCHA 5BPFA 4EFNA 2REBA 3CO0S 4X71A 3MT8A 4Z7QB 1SVKA 3DOFA 1SELA 4TTSA 3MRVA 1V5WA 3T1TA 2CVPA 5BQPA 1FFBA 1JFVA 1QV9A 2F1HA 2QMHA 4IYJA 4EW2A 4YRKA 5K0BA 5BN3A 4QIHA 3PZRA 2G8NA 3E5MA 4YXWA 4A2WA 4ACBA 4YR7A 3ZLBA 3A4MA 3OF5A 2Q3FA 2X2PA 5JNRA 2PFKA 3AFGA 3PP8A 5A5VA 2VHJA 1ORIA 2PJZA 2RGCA 4IV8A 5AHOA 3WA7A 1WQ3A 1N8NA 13PKA 1EGQA 3ITEA 2UUBB 2MYPA 3CY6A 1GFSA 3C7CB 4GR4A 1XNHA 3D02A 3KOXA 4C0WA 4B35A 1DAGA 1UT5A 3L4SO 3TAUA 1XEWX 3PDHA 4JC4A 2GK7A 1TFRA 1G98A 4TYWA 1D6NA 4KR9A 3W9SA 2G9ZA 3P32A 2JJ2D 2IU3A 3OEHA 2ENUA 4IUDS 5CVJA 1SK8A 5K09A 4DL9A 1BFUA 1CIVA 1JDBB 1NDHA 2LCFA 2XNKA 4MI3A 2II6A 3OCWA 5EFZA 1O8BA 5DTQA 3HXMA 4Z4GA 4JMLA 3ETNA 1OMOA 3FPBA 2OBNA 1G0NA 2C8JA 4KAXA 4XCQA 4JX8A 4LHWA 4X3PA 5IDWA 1GPKA 4YBRA 2BM1A 1XB2A 1BN7A 2YY7A 2O57A 4R84A 3CCFA 2I1VB 1U8TA 4HK4A 3ZV6A 3LYAA 4ND5A 2XIJA 1FLNA 3PVCA 3PPXA 4O1HA 3RJZA 9MHTA 1II8B 1IIRA 2I6GA 5FNVB 2X0NA 2QW0X 1E4YA 1KC3A 1KVUA 2SKEA 4CMIA 2YYZA 2QZPA 1RAIA 2IU6A 4PXYA 2I2AA 3KRTA 3QGMA 4AZVA 4EY4A 1DPGA 3RYIB 3TZ6A 1E7YA 3A1UA 5KNCH 3UMBA 5EN4A 1JIXA 2RGNA 1DBWA 3UT5A 3NLLA 3WV5A 1QLHA 3KTAA 4BO4A 3T61A 1LGYA 3CWCA 4BYGA 1T9CA 3AHGA 4YRPA 1AXRA 3CEAA 5LP6B 1PQPA 1RWVA 2R6JA 4RMIA 4EJFA 3SEQA 4BO2A 2WVGA 2C03A 3EZ9A 1PT9A 2IW3A 2ZYUX 3ZXYA 2BTQB 5TMPA 3N86A 2FFHA 3EOAI 1PN3A 4RD3A 4FPXA 3VDNB 2ZWIA 3BIJA 2HA7A 3R0JA 5CBPB 4ZODA 2GASA 4GP9A 2ATEA 2I1QA 2J33A 5FJIA 4RD2A 3IP1A 4PLTA 1W1WA 2I1LA 2GUWA 4KO4S 4BUCA 5BYJA 3BE5A 3GGDA 3HL0A 4YT8A 2XH8A 1NW5A 2H59A 1V8BA 4G86A 4FCCA 2WTXA 2BTEA 1WS6A 1Z3CA 1J1IA 4R41A 5C8YA 1IJBA 2QX6A 1U1DA 3GQBA 3MEQA 4KE6A 2XUHA 3U81A 4N5HX 1DKRA 3QNMA 2CF6A 4J3FA 4GBJA 4MI9A 1KE1A 4FGLA 2VDVE 1OROA 4LI0A 1O94D 1UINA 1XQYA 2ZJOA 5DBHX 5ERYA 2IOFK 2HMSA 1GPWB 3LD9A 1PQUA 3E7WA 3OQPA 1XEAA 5J63A 1B41A 3I6BA 4G07A 3JSAA 4HCJA 1UKAA 3PU6A 1Z83A 2PYZA 1RYDA 3WLPA 3HH8A 4JL8A 3R6LA 3VPXA 4C43A 4O2AA 2C5FA 1NGSA 1Y37A 3T3IA 9GPBA 5BNFA 4OKNA 2ACVA 2JVIA 1JPJA 1BMQA 2C9OA 3A7DA 3HKBB 1KJ8A 3EH2A 3TSOA 3WIDA 1CJVC 3K2BA 3T7JA 3LQFA 3I5XA 1KRWA 2A7QA 2VDMB 1I0IA 2VJNA 2F8LA 3DE6X 1C5KA 3OZDA 3RARA 1SXPA 1TTPB 1I6KA 1C1XB 1SVNA 1GV1A 2HWUA 4LJYA 4TV9B 1J2UA 2Y1CA 3V8PA 3IB3A 2IH2A 1AG9A 1I7LA 3H13A 3U4QA 4IHQA 1T8PA 4YS6A 5G0SA 1N0UA 3EDQA 2CW5A 5BMVB 3KSDO 4DANA 4P98A 4IBOA 2B21A 1YQ9A 2FF7A 2BN4A 3RC9A 4MYCA 3V7UA 1G21B 3GLGB 4J7UA 1W36C 2OSVA 2WHXA 3G0GA 3ADCA 4TOIA 3GMIA 4B84A 1QCYA 5BSEA 2GZ2A 1V37A 2HCBA 3F4BA 3F7OA 1N0WA 4P33A 2NZ2A 1YR6A 5LLSA 5HKOA 2WG1A 3N8GA 4HUQB 2P0EA 1WQ1R 1W5EA 3QFCA 4BUJA 3EDRA 5JSZA 3SK0A 4EHKA 4GEGA 3FPFA 4GOND 4BV9A 1Z7GA 2AR7A 2C77A 3CLRC 2GJAA 2YVQA 1ATIA 5FWXA 1UQUA 3GLFB 1OZGA 1KY2A 1LRLA 3PUIA 5FBHA 3S0JA 4HNRA 3NXKA 4F4FA 2Y1XA 3ZVKA 3G23A 1UH5A 3MRTA 1FZTA 1YBVA 2A33A 2DLDA 4A5OA 4WXRA 1U0BB 1ECJA 4MROA 4G4GA 1RCFA 3LBNA 3FWYA 4RHUA 4LCEA 4XTCS 4XPIA 5DF1A 3I3SR 3ZS9A 4W8HA 3C1OA 1W93A 2V0CA 2ZB4A 1HDEA 1M2VA 2B9VA 3K53A 4TLEA 2D5CA 3M7IA 2PRZA 4I66A 1LA2A 1JFRA 3KXIA 2A5DA 2WWHA 3P8ZA 1NC3A 1KE2A 4D3DA 3FSJX 2Q4OA 1JFFA 2FSVA 4W6QA 1IJKA 1JFLA 3EVZA 3HRHA 2J3DA 4TV8A 5E2AA 3PC7A 5EPUA 4FT2A 5CA1A 2I5PO 1P77A 4LOAA 2VTKA 1MIOA 3W5VA 1BVHA 1PWHA 4WDRA 4WCFA 1SC4A 3GX1A 4MR8A 2X0DA 4ND8B 4HRXA 4EL0A 5FB3A 1DIOB 1UP4A 2BIFA 2JBWA 3MJFA 3MK31 4RZQA 3D1JA 4I50A 1NLFA 1Z0AA 1WOYA 2A0FA 3GZJA 3FDFA 3MB8A 3I01M 4V02A 4X6LA 5AJUA 4D4KA 4OB6A 4ON9A 2B9EA 4M7PA 2ODEA 5IXJA 5K7SA 3M1AA 1JN0A 3UUEA 5DHPA 3S27A 1NUPA 4YFYA 3Q7EA 1FS4A 4NCAA 2E1PA 5FBLB 2GXSA 2JFXA 1PT5A 1G38A 1H94A 4FQ5A 4FQ7A 3VPDA 3VV3A 3B7GA 3E3AA 4PX5A 4ZC8A 5BVHA 1XKTA 2ZQYA 1G4AE 1NVBA 1RE0A 4O4LA 4QTUB 3LCMA 4RADA 4OREX 2BFWA 2VK8A 2OO3A 3O6VA 4WIAA 1DJLA 1DTEA 3T41A 3FOFC 2OWDA 3WLAA 1IUKA 3IVMA 5EZ6B 2PR2A 4R2JA 1J9ZA 1Z5VA 1FB5A 3ELYA 5JOQA 2GD1O 4LE2A 4MCAA 1KZYC 2JZOA 3G9ZA 5DI3A 2ZRFA 2CLMB 3JZAA 3SDZA 2VOJA 4A2CA 4Q3NA 3PGVA 3B8HA 4W6ZA 1JLRA 4MDEA 1ML3A 1C4XA 5JXIA 3DVAB 4JAVC 4YT4A 3T1HB 5E8RA 2COUA 2QLMA 5I9BA 3RB8A 1KS9A 1GY8A 4OP3A 2IYEA 2VWHA 1KKMA 1YACA 2R7AA 3L0OA 4ZHQF 5IJ0B 1JR3D 3E9ZA 5E7IA 4HRVA 1CLUA 1TZ2A 4AMYA 3G2JA 1D4AA 3MGAA 5HSGA 3TEJA 1GRRA 5JW6A 1V7PC 1AK2A 3JQPA 4WZBB 2YQ4A 2HF2A 3GVCA 4BMPB 5AW3A 2OQ2A 4P3XA 4CF3A 1EVIA 3M2TA 2X23A 1Z3IX 3DULA 1TKAA 4IHKA 4K03A 3MGKA 3QU7A 5EJ9A 4W5OA 3IR5A 1A4UA 1H69A 1Z0UA 1DG9A 2QKYA 3KOYA 4GSKA 1MXHA 4JYCA 4P3YA 5LQCA 1RU3A 1SRQA 2XE7A 2O2YA 4G56A 4QGAA 4FTWA 3IE2A 1CF2O 3MA0A 1SQFA 4PC6A 1QU2A 2ERYA 3GLIA 3C3CA 1WMFA 3SEAA 4FFBB 3KFLA 4O0MA 4ACAA 4AZTA 1CNMA 2WJJA 3E48A 1GCGA 3IS3A 1W48A 3QPCA 4HGOA 4KXYA 4TKVA 1D0IA 3R5FA 4KUEA 2O8VA 4Q3DA 2DBQA 1MNAA 1T9GS 1U1EA 2QTRA 3WP1B 4UFPA 1K8YB 2C4VA 2W6PA 4D4GA 3BMCB 4HATA 4QYMA 3WGIA 2D6FA 1TGYA 4J7XA 5ILQA 2Z2JA 2JIDA 3ZJYA 1FLVA 1TZMA 2VT3A 3W8EA 1KBOA 4J9UE 2RAVA 1FY2A 4M88A 5JROA 2MSCB 4TM8A 4I9UA 1RHRA 2F1RA 1U2DA 2OHVA 1Y3DE 2AJDA 3FHTA 3N2NA 4EO7A 1MQ8B 3EAFA 3UAGA 5CGZA 5A3QA 3DWGA 4J03A 4PF1A 3MJ4A 4BGIA 2EEZA 4D4IA 3ONNA 4MV7A 3GGGA 5EEGA 3O7WA 2Z9CA 3B82A 4YP5A 4D8XA 3X1KA 2F17A 1G3RA 3QOXA 3OTQA 4PLFA 1T35A 1QAQA 1FRZA 1UODA 4PGAA 2Q27A 3JQ8A 3LSTA 4OHPA 3E9RA 5AJVB 3ILYA 3VNQA 5CDSA 1BOFA 3S99A 2I9KA 2YRFA 3IUNA 3L46A 3QE3A 3OOWA 4OXQA 1PUJA 2CXHA 2W2KB 2XZDA 1QK4A 2D2VA 4KLCA 3BDVA 5JNVA 2IZ1A 3Q7IA 5EJIA 4FCTA 3UJ6A 3R8FA 1F6WA 2R6GA 1CUZA 3F7MA 2X86A 4IF4A 1LI5A 3G8BA 5LUBA 1A4RA 2OUIA 5KVSA 4DDTA 1I14A 2Y71A 2CFSA 4PINA 1YTLA 3LM8A 3NKFA 2AZMA 1N57A 3UMFA 4MWGA 1G6HA 2G09A 5CIQA 2P40A 4B3CA 3VPHA 1HYQA 5G0TA 1UBUS 4G8DA 1KU0A 2GAOA 2ZE5A 3BA6A 3LHSA 3QITA 3UENA 3PFHA 2C5HA 2Q46A 3HL4A 1ECBA 2WTAA 2O8NA 1G20E 1YUBA 4FKMA 2WVAA 3Q2IA 1U1IA 3WXBA 2IYVA 4C7OA 3EZFA 1U7UA 3PIIA 5KI6A 2J08A 3DAYA 1SG9A 3S28A 1CUCA 2O8BA 2ZT8A 1CJCA 4QHSA 4TXNA 2EKQA 1KNQA 3KU1A 2ZXEA 1H4VB 2HA2A 4DR6B 1XWWA 3PT5A 3MWJA 2FWNA 4OB7A 2QUKA 2DCUA 2YHBA 4U2GA 4ERXA 3BHJA 1NOIA 4Q48A 1LLDA 4MYHA 1WAMA 4EI7A 1CZUA 4Q34A 2Q4TA 3MLBA 4O4JF 3Q98A 4JJZA 1Q15A 4J0QA 2ID4A 2EBFX 4G24A 4RH0A 5ARDA 5A6VA 4I6GA 3PXGA 1VZ3A 2NUAA 4G36A 3NQ41 3DEAA 5CT4A 3IBFA 4I1OA 4E51A 1HOTA 4AMUA 1GFWA 3EZ2A 1OFIA 3QF4A 4C0JA 5LBUA 3VKFA 1EJ6A 3THOA 5D8DA 1NYRA 4IY1A 4NYIQ 2QUIA 5HOEA 5K4HA 1CPYA 1ODCA 3FPAA 4NECA 1C3OA 2NUBA 2P6PA 4K6MA 5AQEA 2OBXA 2C9MA 3JWJA 4FB4A 2EIHA 1FFXA 4KPEC 4P0TA 3M9XA 2WSSD 3B2EA 3MW8A 4MW6A 4Y6RA 3FKJA 4LGCA 4H27A 3ZWYA 4Z2YA 3G0DA 4X64B 1L5YA 1M1YB 4TLCA 1NW6A 2DECA 3AXTA 2P11A 2H92A 3K9GA 4KRYA 2ZTSA 1MPXA 4TQGA 5CU7A 2C0QA 1NJGA 1MCZA 4MWCA 3UJHA 4B48A 1Q16A 1VMKA 2HGZA 2QPTA 2Y9PB 1MC1A 3HZRA 3IAAA 5E0KB 1N2CB 4BZWA 1PR4A 3B1KA 1OBFO 4HWTA 2VBGA 4AJOA 1IRXA 3NORA 2JHPA 4KX5A 2C8VA 3HZZA 2XTAA 3NXSA 3NDBB 3QOFA 3RT1A 1ZN2A 2BJVA 2JIOA 4YJFB 1M0EA 4DMUB 1U3FA 4BLPA 1FVXA 3CPSA 3CT6A 3GNQA 4IJKA 2CXOA 2F8TA 5I5EA 2A5LA 4IIXA 5H80A 1E77A 2ZETA 1ZVJA 4QYSA 3HBLA 2DT5A 2BFPA 4X92A 2FR0A 1WXEA 3GFSA 1IJFA 2J8ZA 4M2LA 5CDYA 3V4RA 2OB2A 2D0PB 1VE6A 1CY6A 1U94A 3LX6A 3CSSA 3DBHA 4KODA 1RYFA 1WRBA 4S3MA 4Y6SA 5LOVF 4W9MC 4UXHA 5IFLA 1II9A 4FK8A 1ZUIA 4YJKA 2A3RA 1VKRA 3EVAA 1E18A 2CLDX 3QXHA 3UPDA 2BM8A 4NESA 4TWJA 5HILA 3TLKA 4LNUB 3TO5A 3FFWA 5JANA 5AI8A 1YMUA 4FE3A 4K87A 5I7FA 1HDZA 2ATXA 1W30A 4Q1DA 4U0KA 3D4LA 2F3TA 5FWDA 1ZH6A 3WK8A 4ZMRA 5G1OA 1MFPA 2I4LA 4TROA 4DABA 3KOUA 4Y1EA 3AZPA 1X7ZB 1EYZA 4O2BA 3LCJA 4P32A 5AHRA 2E4UA 2D3TA 5C5EA 4C20A 4RA6B 1Y1KE 3IJEB 4U7DA 3HDGA 3PDUA 1EIZA 5H0IA 1MVNA 1USKA 3B38A 1JG4A 3PA8A 4FHGA 3RSSA 3OAAD 4ENWA 2XADA 5KOIA 2ZIFA 2P9HA 4ODIA 1QGOA 1QE3A 3QY0A 2V6IA 2H4YA 3DE5X 4WKNA 1TK2A 1O95A 2GFIA 4G1FA 4GPD1 4NKRA 4NH0A 1DQNA 3NTLA 4GPTA 1S3SA 4MX8A 3BFJA 2CL7X 1Y9JA 4RKEA 2X76A 4F4UA 1LNZA 1R6AA 4B40A 3KUCA 4EFDA 4PTLA 4DR3B 3VHRA 4KOEC 2CHGA 1AQIA 1KYTA 4LXQA 4W9RA 5KKNB 1JAHA 3MINA 5D01A 4NDNE 4Y1GA 5CX1B 2CNWD 3EYAA 1UXGA 3GLTA 3PRHA 4LISA 3R6TA 1WVGA 2HAEA 4U7GA 1JIIA 1CLEA 3QEBZ 3MWDB 3TGPA 1RVV1 3NPMA 3QHQA 1X7WA 4ZO7A 4CV3A 1QDUA 1YRAA 2X1VA 2H1OA 1CHNA 2IYRA 3PNOA 4ARUA 2O54A 1LBIA 1W76A 5IX8A 5MN4A 4XGIA 1RRCA 2VYCA 2QUBA 3OMWA 1U31A 4BFZA 3RQSA 2ZJ3A 1XQ6A 1R0SA 3BWBA 4LX0A 2ZR0A 3F8TA 3HUTA 1N6PA 1Z5ZA 3AUSA 2WBLC 3IEUA 3N05A 2J46A 1BKDR 3GVXA 4N8DA 1O6BA 4OXXA 2Q0SA 2MMCA 4JCCA 4KQCA 4QLAA 5CUQA 5DM4A 4BFVA 4GDFA 4IICA 1WV1A 1RRGA 2JLRA 3BSSA 2Q41A 4D8UA 5AUNB 1WHTA 3MS4A 4JEUA 2X58A 4QYIA 4W1SA 4DGSA 1KJWA 5A3JA 2WP0A 3AUAA 1P7CA 1RIIA 3DXFA 4PFQA 1Z5GA 4N0MA 2FNAA 4CKWA 3TQOA 2R11A 1GAEO 4LGYA 4MW2A 4EOGA 2NT4A 4ZI7B 1JH9A 1VSBA 2HL6A 1E4EA 2P9ZA 1HLPA 1WUTA 2OV8A 2SICE 4L2IB 2EZ8A 4OKSA 5CFNA 1BXZA 4BCDA 4YLGA 4BGVA 3SFVA 1E5XA 5L6MB 4X61A 1TEVA 4LY3A 1FMFA 3W9UA 1MJGA 4ZVKA 4F96A 1SQGA 1AC5A 4PBTA 5CVTA 1WULS 3SLGA 1L5LA 4X1IB 3UATA 1AZSC 2CYAA 3DHEA 4FYHA 1A1SA 5GGYA 1GGKA 2W8BB 5BN1A 2QSUA 3K6SA 2H1IA 1S8OA 4Q7QA 3JRNA 1VLLA 3T9BA 1FSPA 1C1YA 3Q9LA 1WU8A 4C88A 3K9WA 5FULA 1PK8A 3MJCA 1QORA 3VH1A 3A58B 4L51A 4NYJR 3WLMA 1LS1A 3HVIA 3NTUA 4NEGA 2H1WA 3AILA 3NWOA 4UBMA 1NPTO 2WFZA 4Z8XA 1VOTA 4DJTA 4ER6A 5BYAA 1SUPA 5CFLA 1IHDA 4IDOA 3X43A 3DL2A 4EA9A 5EJFA 3DE2X 2SHKA 3O95A 3TOXA 3W5IA 4D9CA 1VM6A 3HU2A 2CZQA 4HQKA 5DHRA 3OT4A 4R1QA 4EG7A 2OYRA 2R7KA 3AL0C 2DHCA 3LZDA 3W05A 4CM1A 3A10A 4DQXA 3LUKA 3AVOA 2AZ4A 2HMVA 4FWIB 4YFVA 2BI7A 3TCXB 2IDMA 2E3JA 3B1FA 4P38A 3AERA 4Y2HA 4DKJA 4CXMA 3FLEA 5JS8A 2E4XA 4DIBA 2FSPA 5LWHA 3IUPA 3BORA 3DLTA 4TWBA 5JTUA 3A6DA 4B74A 1A5SB 3CW8X 1ZR2A 3FUCA 3K0CC 4HLUC 5D51S 2C9YA 2D00A 3BB1A 3PFKA 2DKOA 4BC1A 3KJXA 3QX7A 4RHFA 1GQFA 1NT4A 2B5OA 1ZD9A 1IY0A 2RE8A 3TEFA 3LT2A 4FMCF 4IOJA 4DPKA 1VHWA 4UVDA 4HXFB 4ONEA 4IOKA 4ETIA 1FQWA 5BP7A 1AQ6A 2BDEA 1SUDA 1W96A 1DJOA 1WXXA 3R40A 2QUHA 5EZYF 4CIBA 3RRBA 1W8IA 3KT3A 2FPPA 4AJ9A 2A8YA 5FBKA 4F7DA 5EJ8A 1H4SA 4GE3A 3DUWA 1YI0A 2I4RA 3BPSA 1MH1A 2PRJA 4FOTA 5A3SA 3TUIC 3UANA 1Y6FA 2ATCA 4XI9A 2PMWB 4C4SA 3PKIA 1TAUA 3KD3A 3Q1LA 1GZ5A 2QRKA 2DJIA 3TNYA 4EUSA 2W2OA 4KXXA 4M7WA 1UJ5A 2TMYA 3CYFA 3OZFA 4RGYA 4EUKA 4IDBA 5FX2A 1G4HA 5KCMA 1DCMA 4WZAA 1PNRA 3O1IC 1C7FA 1BS2A 1R8YA 3GP3A 5CFQA 2Q9BA 2H07A 1X3LA 3GR6A 4NAVA 4XB1A 4E11A 4E1VA 3IELA 1E79A 8OHMA 3PWSA 3ORRA 2C2WA 3EF0A 3GF4A 1TW2A 3HB4X 5TE9A 5ALFA 1WIWA 1IUNA 4GXRA 4NFLA 2B4TO 3RTGA 1UMDA 3PITA 4DYHA 1IZ0A 2P9CA 1RE1A 3L6EA 4MKRA 4EG8A 3INTA 1QIIA 2IUSA 3KEQA 4Y67A 3W2EA 1AV7A 1G5FA 2IVFA 2WJGA 3N0VA 4MLDA 2EIXA 3GV0A 4RZUA 5DYYA 1PHPA 1R6TA 4FZRA 2Q6TA 2CUNA 4HB3A 4UDNA 3A8TA 1P4JA 3C3DA 4K40A 5BSGA 4DBZA 3ILVA 1LV7A 3AVTA 4RFVA 4PICA 4DV3B 3ZY6A 5IPFA 1GNVA 2AC7A 3VAYA 1RHQA 1V11B 1Z6GA 3G5TA 1W94A 2VO1A 2Q1TA 4IJVA 4LK2A 4URUR 5C5CA 3FZQA 4NEQA 3QPAA 2PZLA 1AU9A 4HDKA 2GILA 5ADUS 1OE0A 3QPUA 5B3LA 1E3TA 5FUYA 2HFKA 1OKKD 5E6SA 2QVLA 2ZRNA 3JWPA 2IZZA 5HPYB 2ZAIA 5IWAB 2GNOA 5KNLA 4ZOBA 3U7QA 1BHJA 4YAUA 2O0JA 4R8RA 2EQ5A 4O4JA 1NOKA 1RJWA 3DR3A 3OOYA 4R0VA 1QYVA 4K6KA 1B23P 2PSHA 1ZIOA 4RVNA 1ECCA 4QQKA 2RD2A 3JVUA 1NXSA 2C1EA 4A27A 1F6DA 1V47A 4PSDA 3ER6A 1YBFA 1WP9A 4RW0A 2C98A 1QKKA 1PD0A 1FFCA 2ZRIA 3H5WA 1JXMA 4RNCA 4C76A 4RCZA 1Y6RA 1P0QA 4AS3A 4DCJA 1X8JA 2JK0A 2XOKA 1WXIA 3HB9A 3P4YA 3TQRA 5AUOB 1FE8A 5AK0A 5EJAA 1ZJ6A 1VHLA 3RABA 4C29A 4CMJA 5AK3A 1R6VA 1TKBA 4PVDA 2PS9A 2EJTA 3DE4X 4JI2B 3PNYA 3SE7A 1PBTA 3HKDA 1EAYA 2XVMA 3KQPA 4FHDA 1GJRA 4EVSA 3HLYA 4R7GA 3EIHA 5HFNA 3SNKA 1TIPA 3UJ9A 3GA5A 3LPDA 1GITA 2QRVA 4HFNA 3ITDA 4Y3UA 3TI9A 2PSFA 1QHXA 2C7PA 1I1OA 5EIAA 3T7DA 2IPXA 3P94A 1N0VC 2OD9A 4PAGA 2ZXUA 2FUNB 1RVDA 4FDAA 2QTFA 3LI2A 1QZ3A 5ES4B 3H2YA 5L3ZA 4OAPA 4KR2A 3UG6A 3PA6A 2PXXA 1KI6B 2D1QA 4IVQA 3LYHA 1YS1X 4L4UA 1P18A 1A2QA 1MB9A 1W85B 3I5MA 3GZNB 3IUBA 4EF6A 3DZIA 5DGXA 4ABYA 1XEFA 4GKBA 1PS9A 1OWMA 3HO6A 3GUCA 1U5BB 2F3QA 1EWYA 4DA4A 1DAEA 4K1XA 3V2HA 1NMYA 2GN2A 4MAMA 4KMRA 2IYOA 3RV3A 2PVCA 1BS9A 1M0SA 2IUYA 1T5BA 3BXXA 4YREA 4CQMD 3SBOA 3KQTA 3NO4A 5EE0A 4EYGA 5E9WA 1UFOA 3KJNA 1P7VA 5BW6B 5LOVA 1S2LA 4RPHA 4PX3A 3E3LA 4LMAA 3QI7A 4WN9A 4WECA 3PR2B 5TDHA 2XZLA 1TE2A 1JHPA 1M6YA 3V9AA 3QX3A 1IY2A 1NSYA 3N6RA 1P2TA 4R83A 2W9XA 1WKVA 3RC2A 1F20A 3LHFA 5J5AA 3SJZA 3VH2A 3INGA 1B74A 4RK5A 3K15A 4GEKA 1CVIA 3AF2A 3M82A 4I1UA 4BY9E 2C5GA 5AW0A 4MEAA 2GVZC 3TLEA 4UFNA 5ICCA 3ZD6A 2NO4A 3KCNA 2WUVA 2YXLA 3CISA 2FJ0A 4NONA 4PO3X 2AIRA 2FPRA 5EKXA 2G28A 3MJHA 3MLAA 3O4VA 1IDOA 1GZ3A 3WNQA 2HLPA 4GLFA 2ZSFA 4L27A 5DNWA 3ZK7A 4BL5A 1EFKA 4KN8A 3OY7A 2DFVA 1G2QA 1I80A 2ZPUA 4JB2A 5DN6A 4AECA 1Y6GA 4U5XA 1XN1A 1N6KA 4TRJA 1WUYA 1IG3A 4AXXA 1L9KA 3T52A 3E9YA 3NT4A 3P9PA 1GR1A 2PUGA 2MSEB 3K92A 1T8UA 5JFGA 1Q11A 5B3KA 4IQGA 3OA0A 1DLJA 3GFQA 1JSZA 5DM70 2YWJA 4YMWA 3I39X 3IQZA 4BIMA 4D43A 1NMXA 1X70A 2Q0QA 2W37A 3NM4A 4D6YA 3R9WA 2QRQA 1GXSA 1R74A 3O8QA 2PNJA 2DWQA 1ZG3A 3EW7A 3H2IA 5B58T 4BBJA 4MYDA 5IASA 1OF1A 2CFRA 2E1RA 4CM7A 5ALUA 1GZ4A 5KYYB 1YDGA 4Q9HA 1YOVA 4E2ZA 5IKXA 1QB7A 2W6CX 3JVDA 2DH6A 4PVCA 2HJHA 1TT5A 4E5SA 4YV7A 5A4KA 3LGXA 2KBFA 2KJQA 3F97A 1MJGM 2O3TA 5JEDA 1T9HA 3PX3A 1G7TA 1O03A 2OOSA 2W8ZA 4PWYA 4QRDA 4XDYA 2HR1A 2B3DA 1VJDA 1OLXB 2FA9A 1ISMA 1SD2A 2FPOA 2P9BA 3GI1A 1ZSVA 2XBUA 2CLFB 1DS6A 3OPNA 4L8YA 3RTEA 4DNQA 4DZRA 4HV4A 3MTJA 1QBGA 4LXIA 5I9IA 1EFVB 4CEJA 1RLIA 1VCHA 3KC2A 4NQZA 3LBIA 2AFIA 4Q4AA 1DOHA 2PLNA 3HI4A 4DQUA 1Z2EA 1GL3A 2VF2A 2WT4A 4H2DA 3TVDA 1YQWA 3ZR4B 3L7DA 5F1KA 4OL0A 1U8CB 2W90A 5EJ5A 1YUMA 4C0KA 4H1HA 4XUCA 3WLNA 4HKTA 2QVCA 4LXHA 1DOAA 3Q1KA 5CLGA 2VZ8A 2OVFA 2OFXA 5H5JA 3SSMA 5JEEA 1T6ZA 3V1MA 1A9XA 3KYCB 3P9KA 1T9DA 3OJXA 3TTVA 3NDRA 1GUYA 5AW5A 1XXLA 2FEAA 2D59A 3WLIA 1WMDA 3L8HA 3UCXA 1BXKA 2VP0A 3JQFC 5JBIA 5DYIA 4OK3A 2XB6A 1PW5A 1HQKA 2FOIA 4YMIA 3DDZX 1IY9A 4YUYA 3V5NA 1CCWA 1L6IA 2PBRA 3EAQA 4KJZA 5B7GA 1NJSA 1KAOA 3TZQA 4C9BA 3DCIA 3HJUA 3EVDA 1ICEA 3MERA 1QG4A 2AJ8A 3G85A 3KHUA 1NI3A 5LL6P 1MQ9A 4KNYA 2FMIA 3WMXA 1BC5A 3PC3A 5AKLA 1I6WA 4W99A 5DTEA 3HM9A 1QIGA 4H4DA 5FTMA 1E1KA 5JHGB 1TFUA 2J9FB 3RWBA 1SZDA 1V7CA 5E1DA 3QX9A 2KB0A 1EB8A 2RIRA 4LJ6A 2IHBA 5K3CA 3NW9A 3NB0A 4GECA 3U6BA 4H1UA 3UG7A 2VUIB 3T94A 4WA7A 1HFEL 2BFCB 5CNKA 4BO9A 1KAQA 4RS4A 5EFOA 5JYEA 2HSGA 1G6OA 3BULA 5CURA 2RMKA 1UBGA 3B5EA 1OXTA 5D86A 1ZOPA 1G1MA 2A78A 3ZI7A 4BGDA 4MAFA 3IHWA 1LKZA 2X77A 4ZT2A 1LB1B 1HDRA 3NC0C 5ESXA 1TJ5A 3AVYA 1ZW6A 1E5TA 4NFHA 3CKYA 4UHHA 3LX8A 1ZINA 5B57C 4UQPA 2FMUA 4Y2VA 2QG4A 3W79A 1I3CA 3GWGA 3UTDA 3BRCA 5T4HA 5E9AA 2O8CA 2HPHA 4LSZA 2JJ2A 1YDWA 4O8ZA 3DLHA 3RRYA 4D3FA 5ADHA 3ETLA 2YY5A 4MINA 5EZYA 5AHKA 4RPKA 4P9NA 4LFCB 2FLWA 3R7BA 4BJHB 5DK6A 4FBGA 2C8LA 1IOZA 4QFDA 1X19A 2HWKA 4MVJI 1AK1A 4DMFA 4BCBA 2QJOA 1MB3A 4F2HA 2J0QA 1TF5A 5TJHA 5IRCD 3L06A 4M0FA 2B92A 5B1IA 3NDPA 4QOFA 2M6KA 3PDIA 2NPIA 1T6YA 3ENQA 1ZJZA 4WNIA 2CKDA 2PKRA 5MGNA 4P7BA 4L5JA 1D3AA 3GRZA 3I30X 1M6VA 1U7PA 2H8KA 2QL9A 1TADA 1X7YB 4WK6A 3AR6A 5DH9A 3KUDA 3O8RA 2V5AA 1MG5A 2O07A 2WSLA 1JLSA 2GN0A 5EY5B 4QU9A 1SCIA 1LI7A 2IUFA 3DEJA 3H5NA 1ATZA 1R8XA 4HB0A 4LJ8A 2JAOA 1KQPA 4WBSA 1Q20A 2IX3A 1WZ2A 1Z73A 1EWTA 3GRKA 5BV7A 4CGZA 4FGUA 1H6BA 1V1RA 4GZLA 3D6MA 3GT4A 3AR2A 3INYA 3N8KA 1TO1E 2QEQA 2V0NA 2C00A 2EX0A 3IHLA 1G7RA 2R1UA 3ICOA 4XR9A 4G0NA 4MS4A 5JJKA 3VA7A 2ECQA 3HG7A 1URPA 2E6KA 4WESB 2DB3A 1E3LA 3GVPA 2J5BA 1G7CA 1YR9A 3WMFA 3HDYA 1B42A 2EWWA 2WVHA 3E61A 2V97A 1YJXA 4KPUA 3IXMA 4KBGA 1VPTA 3K0EA 1YNOA 3QIVA 5GZ6A 1QX3A 3N3BC 4PFKA 3UWMA 3C6XA 2RGUA 5KYUA 1EZ1A 2OXIA 4B75A 3C1UA 4CL8A 5HTOA 2J07A 4AZ3A 4I8XA 5AOAA 3MHPA 4TLBA 1IMOA 1FNSA 5JATA 4TMYA 4Z1OA 3GNSA 1HL7A 1YRLA 4IJ5A 1I24A 4G8JA 3Q85A 1DBRA 1OIWA 3M6LA 4MKFA 4O5OA 4F84A 1XJ0A 1SRRA 1M1UA 1V7QA 1Y3BE 4J49A 4RJIA 2GERA 2A5YB 4INZA 3DJYA 4XX0B 3HDHA 4DXAA 5BNIA 3DOUA 1O94A 2CMKA 3GLUA 2F48A 3VJKA 1RZUA 4YLYA 4L3VA 2W2QA 2VDUE 4I3FA 4JQYA 4LKOA 4MUIA 5EQTA 3IBYA 4W5WA 4D8VA 1V3UA 2ZG6A 3A4VA 4O29A 1NVKA 4J0HA 2IHKA 3WLSA 4AZWA 5EKTA 2G1PA 4I4TB 4XD2A 1NWCA 4Z2AA 5H59A 1PJSA 3HFGA 1M73E 4ZYTA 2CHUA 2JB9A 2QM7A 4QL3A 4DDMA 2QTZA 1T3TA 3A05A 5D7BA 1YS4A 2A59A 3WVNA 2Y1GA 3N9IA 1NF2A 4QYXA 1CS0A 2BFMA 4U3JB 3OFSA 1QO0D 2PQ0A 4UEOA 3VVLA 5MDHA 4RZHA 1VMDA 2Q5QA 1X7GA 4GWLA 1IONA 1J4AA 1L5SA 4LQ4A 4Y7CA 4PW0A 4B7ZA 4UTNA 2F43B 4X1OA 5K05A 5KWEA 3IP7A 2VL7A 1CE8A 1AQNA 4YN3A 1LDGA 3KYBA 4Y2JA 3GOQA 1CR0A 3SC3A 3FUXA 1M7HA 3ZHOA 2HY7A 3B60A 3HCAA 5LZ8A 4G5HA 5CXUA 2Q2WA 4HLUA 4PZYA 4WCVA 2J6HA 4A15A 2JLCA 2M1XA 3E5HA 4OGFA 1HNXB 3QU4A 1E2NA 1OI7A 1YT5A 1NTRA 1C1HA 4L8LA 1UAYA 4AF7A 4WXHA 1Q12A 1E9VA 3FVWA 4Y6GB 2EWMA 4ME6A 1PFGA 5BSVA 2WJYA 3E15A 3EPHA 3ZNQA 1ZP6A 4IM7A 4KMMA 3R7NA 1U0JA 1NVFA 3HYSA 5EG5A 4DBLC 3B51X 4J90A 4BWFB 4QM6A 3EB9A 4DIUA 5DNYB 4MR9A 1NX6A 3HSSA 2G76A 1I9GA 2GPWA 4P4GA 3D64A 1V45E 2XOEA 2V03A 3RREA 2Y92A 4CTOA 1XRPA 1NFRA 1XWFA 1Z08A 2O7SA 4D25A 1NBAA 2WSYB 1DSSG 3ANLA 4UHCA 3ROXA 4AUEA 2IDZA 5IAGA 2HNAA 4LOJA 1P91A 1RQRA 1XTTA 2DFNA 2WK1A 1FMJA 4M8SA 3AKEA 2DY0A 3O1LA 1BU8A 4F9GA 4M0KA 1U2EA 3AETA 2C83A 4MDYA 5L3QB 2PT6A 1P2UA 2QRMA 3B6KA 3GDHA 4B3XA 4CM5A 4RMNA 4KQHA 1KVTA 4M98A 2X14A 3NALA 1BRMA 1EUCA 3ZWQA 3ADBA 3BXPA 1A8PA 5FEMA 4JB8A 4D4LA 2IYNA 1PV4A 5F3WB 3S8YA 3DYVA 4K6HA 1X6VA 1P1RA 4KNWA 4MV4A 2BP7A 4XYEA 5FBWB 3T5CA 2RC5A 3ZHQA 1PZMA 1KZ6A 4DV0B 4JR2A 1ZI9A 4PC3A 5H3CA 5TNXA 3VR5H 5I4CA 1A0OA 3ICEA 4CDMA 4MA0A 2G9UA 2B8TA 3Q5DA 3TKLA 4CLOB 4DXDA 1AKTA 1LDNA 3ROTA 1GZ6A 5BSMA 1BVUA 2CMHA 3AHJA 1ST2A 2EVWX 1EEXB 1ZRSA 1YZNA 2IA5A 3NTVA 4ND2A 2BHNA 2B4YA 2H54A 2YV1A 1YI1A 2A1UB 1OGIA 4U7FA 4DWVA 1MGPA 2HBQA 4HLCA 1UR5A 2NPFA 4A6PA 5ICMA 2AMVA 2Q28A 4RTKA 4C0LA 3GU3A 4PS1A 1Q0UA 3PFNA 4IR7A 2EW1A 4XJSA 3D6JA 1TYEB 2HIMA 4KIFA 4PGGA 2VDWB 5CDFA 3RROA 5BSRA 3EODA 2KMLA 3JQ9A 3ZUPA 3SR0A 4HGNA 5LZ4A 4CYMA 5KJ6A 1SVIA 2JA2A 5KOJA 1XA3A 3AI2A 3IQFA 4ZT6A 4H1WA 4RK0A 5CEFA 2YJ3A 3MWFA 1D0SA 3G5AA 1OXVA 3QXJA 2OAEA 4KXUA 3QUTA 2RK6A 4MWZA 4S24A 2XTZA 3ZZ0A 2A9QA 5AD1A 4IDPA 3EZ6A 1Z2NX 4YP6A 2D7DA 1JR3A 1FDIA 3A4IA 2V6GA 3P4XA 1MO6A 4MQ4A 4UE2A 2Q5JA 2H2HA 1VRCA 3UGJA 2WPNA 3D8RA 1XMVA 1WD5A 4RM3A 5DEOA 3ZX5A 4KDEA 4Z0TA 2C7OA 1N1DA 1KEZA 3C8UA 5AVZA 5CTJA 3WMRA 2WWRA 1LBQA 4NE9A 4HNAB 4IFEA 5THKA 3CVWA 5TQ2B 2GHTA 2IPOA 5AK6A 3DZCA 4NNOA 1SHUX 1AXEA 3U40A 1A8SA 1P8JA 2AW3A 1BCRA 1XDBA 2PMDA 1X77A 3AYXB 4TUYF 2ID9A 3PEEA 3D8SA 2AF4C 4C87A 1QF6A 1CR2A 1E1RD 1OU0A 2J1LA 1ANKA 3LUHA 4JVMA 3JWIA 1WDMA 5JALA 4FT4A 1TLFA 1WE2A 4F8JA 4LY0A 2QBYB 2R6ZA 3SHQA 2D4AA 4NE2A 4L78A 4B5KA 4FFSA 4Q37A 5KDDA 4OV6B 3EPLA 1X1SA 3N7TA 3QKRB 3CX4A 4B6OA 4KRGA 4LHXA 1WW2A 1NQTA 2O20A 2D2IA 3HBAA 4K9KA 2VPYA 5DCUA 10MHA 2ZSHA 5MN6A 1GTSA 4MEJA 2OKGA 2HEIA 1T4CA 3E03A 1ADFA 1BZYA 1ZEMA 4G37A 4R8KA 1SMKA 3FKQA 3OZIA 4RGVA 5ICGA 1P33A 2Q8QA 1IVSA 3FIUA 4ZAVA 1SQ0A 4XWKA 2ZSKA 3QP9A 4ZMSA 2EJVA 3AEUA 2QAGA 4D92A 5IKEA 1A9TA 3B8EA 5AVUA 2R8ZA 2HJWA 1Y7PA 4JBGA 2ZFUA 4OEHA 4OQPA 3RRMA 5EIEA 2BBSA 5JCXA 2W71A 2Z5GA 1C7ZA 3ANYB 3BIOA 5LKAA 1ZICA 4A6DA 1U9CA 3I83A 4G0XA 2X0EA 4GSYA 1O97D 1USVA 1VRWA 4Y6PA 4AJJA 1YB4A 4MP8A 2XZOA 2GQ0A 1CDZA 1Q7EA 1U2PA 3DMDA 5MGBA 1XDZA 2FETA 4B31A 1QRTA 4MVYA 4CLHA 4FMDF 1BWQA 3CKMA 2ZS7A 5KTOA 4MUAA 5JS7A 5L9AA 1P2FA 5ILOA 4HAZA 1ACJA 1MQAA 1YE8A 3P9NA 4LJ7A 4NARA 4ZYZA 3FY4A 1VL8A 3OLZA 5FL3A 3SM9A 1G5RA 2ZBRA 3IDAA 3M1IA 5C3UA 3I42A 1QC5A 1YK1A 3U5TA 4U6QA 2P27A 3OESA 1SUAA 3ANSA 1TGVA 1W59A 2F00A 3O4HA 4ESOA 1F8UA 1WVMA 3AB8A 2PWBA 4IRXA 1EFRD 4GYKA 4A92A 3B5IA 2GJKA 4OA8A 5HUQA 3GY0A 3W1VA 3AKCA 4J3JA 1E7SA 2VT2A 4YJDA 4E3ZA 4EITA 4MOWA 4LN1A 3KL2A 4HNGA 1GA1A 2BFNA 1RYNA 2FV8A 2PS1A 3C4QA 4UKDA 1ZK3A 4C0HA 4ZVLA 4XWWA 4XQGA 4JLBA 5CAEA 1D2EA 3DKVA 1DPFA 3ZHSA 3LQRA 2I03A 2QJFA 2V3WA 1GQRA 1KJJA 2MSDB 2YL2A 4RMJA 4CKBB 2WD8A 3DZDA 3OCCA 4YEDA 3LX4A 1FP6A 4GM4A 1CUGA 1KK0A 5JS1A 3OU2A 3DV0A 1N9GA 1YAJA 3D3EA 2C84A 3T7KA 4HGYA 3QA9A 1UMCA 1XSEA 5A4DA 5TPWB 1L4MA 1JT2A 3B5JA 2G4LA 1H9BA 1HXHA 2VT6A 2W6JD 4N8SA 5I7VA 4EB0A 2CV2A 2HW8A 3I8XA 3HZHA 1T36A 1RZVA 3QVTA 1L4FA 4M8LA 3A3NA 3PIRA 3UFXA 5HJ5A 3PHIA 3DLPX 2E55A 3T7IA 1AQYA 4LPKA 4D3YA 2HUNA 4LJ5A 1QPZA 4AWAA 1HSOA 1U6KA 2H8GA 5L4NA 4X95A 3RC1A 1GDHA 3ETJA 2NN3C 2OP0A 4I0WB 2ZYRA 4NENB 3UK1A 4ZCLA 1MX5A 2DH5A 1BE0A 1UMBB 2BCJQ 4JEIA 5HM8A 4MI1A 2VP9A 2XD9A 3R4VA 2WSSA 4DT1B 3JQFA 4XQCA 3LY8A 3WI7A 2GX6A 5I7EA 1NMQA 2GPBA 4DLPA 1HRKA 3BS4A 1VE1A 4NZNA 4FINA 4M0EA 3HWSA 2C94A 3RLFA 2P3OA 3M5DA 1U4SA 1I9CA 3PRYA 4ID3A 4RVGA 5AIBA 4HL6A 2XCOA 3NP7A 3SN6A 1NE7A 1U9IC 5JAPA 5ER9A 2GKOA 1SCKA 4LWZA 2YCBA 4JQSA 3ANMA 3BFPA 3R0ZA 4ARSA 4URFA 3BE4A 3FKSD 1FUEA 4Z54A 3ZWAA 2R7NA 3WK4A 4EMBA 4F3YA 1YS7A 2F1IA 1OWNA 3V3TA 2H6EA 3ZY3A 3EXAA 1K1EA 1RC8A 4IXNA 1ADBA 1D2MA 3N6XA 3R3ZA 3I2JA 4F11A 1X39A 2WYVA 3HP4A 4N5MA 3CNOA 4M36A 5L53A 1X80B 1V8FA 1V6CA 2G77B 4OK5A 1ZGBA 2W2MA 1GNLA 4XVUA 3CH6A 1CBUA 3I9KA 4UU8A 2G5TA 1BA2A 4ZGGA 5M04A 1QUEA 3D43A 4GBGA 3QPDA 5K6AA 1XRQA 2EU8A 1E6WA 2G5GX 2IK8A 2CZGA 3R7WA 2CWDA 3G1TA 4AYWA 2NZXA 2PCLA 2FUG6 3DCJA 3ELWA 2VJBA 1DUVG 1T29A 1CC1S 6PFKA 1J1UA 3BK2A 4LYHA 1N2SA 3L7YA 3T1YB 1IY1A 1IZ8A 4M0UA 4AUKA 1QHFA 2NW6A 2PZJA 1KEPA 1QAOA 4BJ5A 2EFGA 1IHXA 3FLBA 4O02B 5K0FA 1BHQ1 2JASA 4IO1A 1SHKA 5J1TB 1U8YA 1XWIA 3E2PA 1BMFD 4L1KA 5GOTA 3TW6A 1FYFA 1P2VA 3L18A 3NDIA 3ZE7A 1T1RA 2DUWA 4HR7A 4YIKA 2OCPA 1JWBB 5JT1A 5JG7A 4B3SB 5JYDA 1EBUA 1XCBA 2I4NA 3GCZA 2I34A 3B6IA 3GK3A 2LZ0A 2OENG 3AOGA 2HRRA 1L3CA 4BNFA 3IILA 5H81A 4X85A 5JD3A 3OAAA 2Y1DA 1FSGA 4UNQA 3AVPA 2QJRA 3TLYA 4W5RA 1RABA 1DAOA 3QLVC 4MWEA 4P34A 1TZJA 1H2AS 2O19A 1Q2XA 3M9WA 3H5IA 1LJUA 5JWHA 5ALIA 1QAMA 4ETWA 1JE0A 3PLNA 1BXGA 2VH5R 1G5HA 4AF8A 4BFTA 4DYVA 3ZIUA 3I2HA 1E2HA 4OJTA 2HV9A 2KW5A 3EGOA 2HREA 1F6BA 1WWKA 3HLTA 3MFQA 4QNMA 3HVJA 2VH2A 1KY4A 4TTRA 2CNWA 1BXRA 2R8OA 1NP7A 4HRYA 4RZXA 4ZPXA 3X2SA 1NBMD 3JXEA 1NQ5A 3NVDA 1Z47A 2VHWA 3E9CA 1IIBA 4ZOLF 2YMLA 1KVSA 2F1OA 3SXPA 3U3DA 3BH7A 2VJKA 4B8WA 1B15A 5JCOC 4LZWA 4ALNA 3AR5A 3OCUA 1EHCA 3X2EA 1CRQA 4RPIA 3RSLA