1SC3B

Crystal structure of the human caspase-1 c285a mutant in complex with malonate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Crystal structures of a ligand-free and malonate-bound human caspase-1: implications for the mechanism of substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2004-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1sc3B00
1IBCB 2QLJB 1RWXB 2C2OB 2H5IB 2CDRB 2XYPB 3GJQB 3GJRB 1PYOB 1BMQB 2QLBB 3GJTB 1GFWB 1SC4B 2C2MB 1SC3B 3D6HB 2QL9B 3R5JB 1RWMB 2HBZB 2XYHB 1I51B 3KJQB 3KJFB 3QNWB 4DCJB 2H4WB 2H51B 2H5JB 2H65B 2CJYB 2QL7B 5K20B 2CNLB 3R7SB 3IBFB 4ZVTB 2XZTB 1SC1B 3R7NB 1RHRB 1RWVB 2FQQB 1RHKB 4ZVUB 1RWWB 1PAUB 3P4UB 4DCPB 5IC6B 2XYGB 2H48B 1RWNB 2QLFB 2C2ZB 3SIPB 2DKOB 4JB8B 1QTNB 3P45B 2H54B 1QDUB 1RWKB 2HBYB 2CNKB 1RHJB 4ZVQB 3NS7B 1RHQB 3EDQB 1I3OB 1RE1B 2Y0BB 2HBRB 3R7BB 3IBCB 4ZVOB 3R6GB 2C2KB 3EDRB 2P2CB 1RHUB 1RWOB 1NMEB 1RHMB 2XZDB 1F9EB 2Y1LB 4ZVPB 4ZVSB 4LSZB 3D6MB 1ICEB 3GJSB 3RJMB 3KJNB 4ZVRB 2CNOB 3D6FB 2CJXB 1RWPB 2QL5B 4DCOB 3R6LB 2H4YB 5IC4B 2C1EB 2HBQB 2CNNB
chains in the Genus database with same CATH superfamily
2IPOB 3NS6A 2K06A 2VG6B 2AWZA 1AT1B 1Q8IA 4DV6J 5D4PA 1WD6A 3SQGA 3CCLS 4DZDA 3IR5B 4K4YA 3PYFA 3P49B 2F7VA 2AGQA 4F26A 4OX9J 2IYGA 1SQEA 2V67A 4HHHA 3EICA 5KFFA 2UXDJ 1Y11A 3KNGA 3PW2A 1UFKA 4I2PB 4EZ6A 3PR5B 2EK1A 4PWDA 5K8MA 3A12A 3CCJS 4A47A 3DDNA 1F2HA 1VLOA 2G1DA 4R25A 1RXOB 2UVVA 1C2PA 2DNPA 5B0BA 1H3DA 3BPDA 1ZM9A 3HULA 3QQCD 2DH8A 4LFBF 2V68A 3QFWA 1RKIA 3QIDA 2PI5A 3KMSA 2QA4G 4USKA 1ZAXA 1CULB 4ZVSB 1RKJA 4WU3A 3L7PA 3VWSA 5U47A 2Q6BA 3FSYA 3QJLA 2WSCC 3IS9A 4LT6A 1U6ZA 1RWXB 2R8IA 3CCRS 2W7AA 5IZHA 2ASJA 3MR2A 4NE9C 2N7CA 2FLOA 3KLIB 4B9NA 2VU5A 1WWHA 4NXMJ 3HT0A 1SPBP 2XC9A 2AD9A 3SDEA 2E66A 3H98A 3HHLA 1IBLF 4WIIA 1NSKL 3IAS9 1WTBA 2CJAA 4ED0A 4NLQA 3GSIA 4WWSA 1S1TB 4YFUA 2B3TB 4DV0F 2DNQA 1W7WA 1EARA 4DU8A 4OI0A 3FC9A 4ZVQB 5IT4A 5EHHA 2Z8QA 3MR6A 1R8BA 3IBCB 4UOGA 4K4TA 4RU2A 4ZIVA 3TWZA 2E7XA 2MZTA 1YKWA 3MMJA 2YQ1A 4FXDA 4Z2XA 4DSIA 2W2NP 4DMZA 1VDHA 4DCOB 3ISNC 4V19X 4LUBA 1YJRA 3O44A 1S77D 2FC9A 3FVYA 1BLUA 2CG8A 5L39A 1U45A 3SSRA 2Z58B 2AV5A 3L95X 4HVZA 2I0XA 3MUTP 4OYWA 2MKIA 1YJVA 4EGLA 4QWBA 2COLA 1SKSA 1Q78A 2WB1D 4YY3F 3FSXA 3FCHA 4WKRA 5KAKA 4AE5A 1AUDA 3P6YC 1OY6A 3T5JA 1KOOA 2R8GA 3MMBA 3DOLA 3IAM9 5MAOA 1RWNB 4DU7A 4JI8J 3SIPB 4DLEA 2F1FA 4I6WA 4C3MA 1YHQS 7FD1A 3HSJA 4NEZA 3HSDA 2KYZA 4KR0B 1TAQA 2KT5A 4C97A 4J9RA 4N76A 2CAJA 3D66A 4ZVHA 1MN7A 1UVJA 1QY7A 1P8GA 1DLOA 1WG5A 3TYTA 1SCJB 3RGIA 2PEHA 2J6UA 4PQUA 5HP1B 3MAQA 3DHWC 1R3NA 3KJVA 4Q5VA 3KUHA 4ECXA 4O44A 3W63A 1RB0A 5LSRA 4IRDA 4DBQA 3UNGC 2VKRA 4IO1A 2VIHA 1SL2A 2POKA 3FEYB 5C25B 4BC9A 4CO0A 2VQFF 2YKNB 2IA0A 3O5TB 1JLEB 4ZP6A 4YP3A 4CLYA 2BKPA 3IBWA 3VQTA 2VL1A 1HNXJ 5AE3A 1RWWB 3D54A 3CVKA 1FERA 5GADU 1TUGB 2DNZA 2IMWP 1FO1A 5JVGQ 2V50A 1KQFB 1RT2A 1SJ4P 2HHXA 3Q83A 2AJ2A 1ZH5A 1HWIA 2X51A 2OPPA 1OMSA 2HWIA 3LO3A 4A48A 1R8PA 3CEDA 3NWRA 3HT3A 3GONA 3D3CJ 2WVEA 4F25A 1REGX 2MLZA 2IBOA 5BR8J 4Q0BB 2LA6A 3H5SA 4K8RA 3U27A 3OFEA 1B0VA 5BYSA 4CYUA 5HMYA 2KRRA 2OPSA 3FUYA 3BH6B 3EXYA 4PQAA 4Q45A 3VAHA 4TY8B 5E33A 4MK8A 3IM9A 1TL4A 4LMZA 3BH7B 2IM3A 3T1YJ 3JS9A 4DV1J 3H4BA 2HVHA 2EBEA 1S1WB 5J2NB 2J76E 1H72C 2XYGB 4HKQA 4OI6A 2ZWOA 3D4JA 1GQEA 3IO1A 1WORA 2NZCA 4L3NA 1FJCA 3F44A 2ZM6F 5IT9U 1KLNA 3RBZA 2XS7A 4EYHB 2B9YA 1TL1B 5A8WA 5IT0A 3GIJA 5B0AA 2KFYA 3LP1A 3U1MA 3QZ7A 4Q8EA 2ZKUA 1VHFA 3MMAB 3DDIA 4PG8A 2K7KA 3CTRA 1N54B 2AQ4A 1YJ9S 4DX5A 4FS2A 1V5VA 2XGPA 4IQXA 1MMNA 2FZCB 3PZPA 3DMJB 3I9V9 3IC1A 2F63A 1T9VA 1UA0A 3D0HE 3PEJA 3BSCA 3Q23A 2P6TA 2XYHB 1X4DA 5CCLA 5JJBA 2DEJA 4KTQA 2VG6A 2BXJA 4JI6J 1S9GA 2FLNA 2HFZA 3CD5A 2ZH3A 2IVFB 3OVAA 1NKEA 2RHQB 4EK2A 2M8DB 2Y1JA 2YNHA 4C3LA 3GYXB 2UUTA 1WC3A 2QYGA 3C15B 2ZBQA 1HWUA 4P74A 3JTOA 5FLXU 3HK2A 3EUNA 4I4BA 1TR0A 3D28A 5IQQA 4R5PB 2QA2A 3W64A 3ENAA 1N33F 5KFAA 4BHQA 3QSIA 2ZD1B 2KT3A 3Q89A 3G6ES 4WE1B 4FS1A 2OP5A 1EHWA 4JV5J 4D3HA 2RB7A 2BQUA 2C3YA 2V8GA 4C6AA 4ZHRB 3L09A 1X4FA 1U49A 3KYLA 1CULA 3LAKA 1VQ8S 2PFFB 1RP5A 2QN6B 1FVSA 2BVZA 3UCZP 3HD2A 1RU2A 1YX2A 1LEOA 4B9UA 2VDIA 1AXQA 1GTEA 3PVXA 2G2YA 4NLGA 4B3RF 5LXRA 4HL9A 1M90T 2IAJB 4ITSA 3KLIA 2QV6A 1IJEB 1CC7A 4ZJLA 1KVKA 1XIQA 3SXLA 2B9XA 3TZZA 3PFEA 5HVGA 1XR5A 3N5BA 1PGZA 4ES2A 5C2GA 3DLJA 4MKBA 1P9YA 1NK6A 4PG5A 2L9NA 1GMUA 1S1TA 4QIGA 9RUBA 2ZH7A 4RPFA 1H98A 1HR0J 1WI6A 1PAEX 1ZYQA 3K5LA 3BQ2A 1FXRA 5H1SV 3OVBA 5KT3A 5IV3A 4GKJJ 2LXUA 2AT1B 4UY8T 2Z30B 2R7XA 4DR1F 4DN9A 1BQNB 4H4MB 3TAMB 1TKXB 2VOOA 3VVTA 3T9NA 3W66A 2D3ZA 1J5EJ 1F1BB 2ASLA 4P2MA 5KFIA 3KJQB 2FLLA 2LKZA 3DGPB 4D3GA 1XMBA 2VA2A 4RW4B 2R7WA 3M9MB 1QAXA 2I38A 1VQ4S 1UVMA 1K8AT 2HHWA 3K5OA 4IO9Q 4C8MA 4FXWA 2PN6A 3MDFA 4DR2F 3DN9A 2W2QP 3QPIA 5I42A 2RJZA 3H2UB 3HD1A 1G1XA 3T5HA 2WRMA 5CQGA 4Y34A 3PYDA 4USVA 1IM4A 3M30B 3VGVA 1FJEB 3RYLA 3M8QB 1NPPA 5LJ5Y 2J6SA 2N4DA 1WDTA 3RJMB 3AQOA 3OVSA 3H25A 1Q81T 1HW9A 1OPZA 4RR5A 1OWXA 4OI4A 3SI8A 3QT8A 3RR7A 2GVDB 5C5JA 4GO7X 2XYPB 2P9CA 5HP1A 3CCUS 2CQ1A 4GKKJ 4NI2B 3US5A 4QWAA 2DGOA 3TOQA 2UXDF 3BR8A 5KFXA 4DX6A 1P9QC 4P9SA 4IOBA 3KK3A 3MCOA 4I56A 1OSCA 5F8MA 3CDUA 2K2PA 1TTHB 2WW8A 5C25A 4Z37A 3OTDA 3W1YC 2YKNA 3SCIE 4F3QA 3BGFA 2ZUGA 2FVPA 5KFCA 3ZZUA 4NYOA 3ITHB 1VBKA 3Q24A 4IKAA 4YDXA 3R7BB 4HACB 3CCES 1J5OB 2ZH5A 4YOEA 3CMES 1NUEA 2HLUA 1HHQA 3R27A 2MKKA 2RILA 5DRKA 4ZVPB 4DI6A 2NXJA 2OTJS 3GR1A 3KK1B 4XIUA 4X64J 3OTEA 1GXUA 2FUG9 3FMWA 2E1MC 4NXMF 4JI3J 2QEXS 3S1TA 1LNQA 3LP0B 3GMGA 2BOAA 1ZTTA 3J80Y 3L3CA 5F0WA 4CNYA 4Q0BA 4Q43A 1ZOTA 5D15A 3KLHA 3SCKE 4OQJA 1CQMA 1GX5A 4K4XA 3OFGA 4XPEA 1VC0A 2KYXA 2W24A 3UD4P 4CQ1A 1A9NB 2Q6CA 2BYCA 5E3RA 2Q3PA 2FJWA 2A2CA 5I4MA 3THTA 2HHVA 2P6SA 2ZH2A 1F5CA 3J7YI 1S1WA 1WC5A 3I5BA 4A8QA 2JOQA 2A2DA 2CVEA 3AJ1A 3TZXA 2YKMB 4X2BA 1FNOA 1RWPB 2HFVA 2KHCA 3NGUA 3WIVA 1TL1A 4OYIA 1UW9A 4ECWA 4NPOA 3OL8A 2V2QA 3MMAA 1X5PA 4ZVFA 1RADB 3VZIA 4K5RA 3TJ8A 4URGA 4KE5A 1URRA 2DD8S 2B8QA 4DCJB 4F2RA 1P6TA 4DPTA 4P2FA 5LL6d 1SL1A 3R7NB 1YI2S 4NZ6A 4NEYA 4ENOA 2ZOMA 3VZHA 1T94A 3OLAA 2AYBA 3CSKA 1R6YA 3PX6A 3A8IA 4RNMA 4X4NA 3NGTA 3ZTQA 2FJVA 2RRNA 5AXKA 4P73A 2LU1A 3VTIA 1FWLA 1NJIT 1VR6A 2R2SA 2QMUB 2EC0A 2GQCA 2GIQA 2VICA 2YY3A 2U2FA 4DL0C 1CG2A 4O3NA 2HHTA 4URQU 3QRQA 2DK2A 2A3JA 3FMBA 3PDNA 3C15A 3UDEA 1B0PA 2HS3A 1FXDA 1MWQA 2IM2A 2C3PA 2FVCA 4DPUA 5ETNA 4C2MA 2ZD1A 3NEKA 4WE1A 3OD2A 4FF3A 5D8HB 1HNXF 5AE1A 3Q8QB 4LF7J 3ZFVA 1N0UA 1DJ0A 3PY8A 4O0IA 2PO4A 5DQIA 3T9ZA 4OYBA 2EPIA 3GILA 2ZBIA 3TO8A 5KT7A 1HMVB 3BQ0A 2XZTB 2DHGA 1E6VB 1R31A 1DQAA 2XO7A 1CJTB 3NCPA 2GFFA 2BW7A 2HWHA 4L75A 5H9EJ 3O3LA 1S1XB 4QU6A 1E6YA 3J81j 1RWKB 2J9EA 1RJJA 4KO0B 3HHLD 4F4AA 4U6PA 5IQ6A 2IAJA 2NXEA 5BR8F 2I6WA 2R4FA 1Q8KA 3V81B 4PYDA 4KY3A 2B4OA 1FKPB 2F4FA 2BMBA 2G2ZA 3EXCX 3M6WA 1VQKS 2ACYA 2W4PA 3U1LA 3PM9A 3T1HJ 4JP8A 4MYUA 3KFWX 2XS5A 4UY85 2QIFA 3DRRB 1HNIB 3TW0A 3T1YF 4DV1F 3TANA 1O51A 1PKUA 4YN3B 1R89A 5EWFA 3FK4A 2BOPA 3KLFB 4F50A 1MLAA 2JEGA 1BQNA 4PWWA 4H4MA 2HAFA 4DSJA 3MEKA 3TAMA 3CJ3A 3R5BA 2HVIA 4X62J 3AD8C 1CSJA 2XMUA 4J7CA 1HIYA 2OH2A 2GS8A 4OI1A 2MQOA 1RHKB 2OGUA 4X65J 1DRZA 4DOZA 2JNJA 1LWEB 2QA4S 3ZZYA 3ENVA 4P7VA 1NK8A 4UQGA 3DGPA 4RW4A 1KKHA 1UEUA 2YTCA 2O66A 4IG0B 4EMDA 5L1IA 4HI1A 4HHUA 4A8KA 4DQSA 1HHTP 3MURP 1HL6A 4IR1A 1PSDA 5ITHA 3MD3A 1HBOB 5KG5A 3CJQA 5D4LA 4JYAJ 4F4ZA 2KDOA 1UL3A 3M30A 4I67A 1RTZA 1XQIA 1JXVA 4NX9A 3PXGa 2ROPA 1B4SA 4HT7A 3FRZA 4DSKA 1LKZA 3H20A 3KLGB 3MOJB 1N0VC 3RB3A 2ZC4A 2WBMA 2QL9B 3OTCA 2BQRA 1S6UA 3D3BJ 1WEXA 3UDLA 2F8EX 4LF6J 1GAOA 2OIHA 4WYLA 4C8KA 2GVDA 4RJVA 4ZP8A 1KR4A 3IXQA 4DG1B 2JWNA 4FVCA 4NI2A 2GIRA 4TU7A 1FA0A 1O8BA 3NBPB 5E3PA 2C2RA 3GG0A 3W8GA 3L7UA 5IC6B 2V8PA 1O0PA 4HTIA 1XMQF 5CD4A 1FRHA 4JI7F 2E7VA 1QE1B 5K5MA 3N6MA 2FJBB 4WP9A 2EFNA 1FJGJ 3FBCA 2E5GA 4J91A 3OV7A 4RW9A 1B7FA 1JB0C 1JLAB 2DITA 1FJ7A 1WC6A 4MAKA 3RAQA 3QT5A 2KVQE 1AW0A 1UTAA 4F4KA 3MD1A 2CNOB 4HACA 2CQPA 1J5OA 3ZZZA 9ATCB 3PW4A 2YVSA 1FX4A 3W2VB 2CPEA 2RUSA 3FGVA 1J27A 3FFIB 1UPPA 3C19A 3S7RA 3KK1A 2DNKA 2ALZA 4K4VA 3IM8A 3KOAA 2ROGA 1TV6B 4Y3CA 4PXDA 2CZ9A 3LP0A 4IFVB 4DV4F 4RUHA 1WKJA 3LH2S 3H59A 1HR0F 4H4OB 4AXJA 2HFNA 3EYZA 3IRXA 3H5XA 4YR3A 2HQFA 4YDDB 4MKYA 3QT7A 3F56A 1OPIA 1G4CA 2HRTA 1KFSA 5C42A 4QJVA 4JI0F 5KFUA 4NWBA 3A3PB 1N5QA 1TK5A 1J5EF 2DNOA 2BDPA 2V8VA 4PPZA 2KM8B 1GMVA 2MY8A 2YKMA 3HPOA 2DH7A 1R43A 3PTWA 1P27B 4DQIA 1URNA 3MCSA 2ZH6A 1YG0A 3V6DB 1CJUA 2IMOA 1KFDA 3PRBA 3QWUA 1Y7PA 4FVMA 4QPTA 3GCWP 1U0SA 2B0GA 3JYTB 2CPYA 1DZ5A 3DDKA 4AT1B 2YKOA 4CH0S 3RB4A 1RWVB 3SZ2A 2JC1A 4Y00A 2H9ZA 1NPKA 2R7UA 3SV3A 2FHJA 1VRUB 3FRYA 4DUZJ 2RH3A 5CZXA 1EJ7L 3CPWR 3TX0A 3FZBA 3CB4A 2Z56B 3B82A 4P72A 3NS7B 2KVIA 4MKAA 1RBOB 5DETA 4CP5A 1WHXA 3B78A 1UCNA 3M4XA 2PI4A 3IR7B 1WOOA 2CJBA 1OY9A 4Y2AA 3EE3A 3JQJA 3QJPA 3MUMP 2YWKA 4GKKF 1M5SA 2DY9A 4DQRA 2NXUA 1YJUA 3KHHA 1N34F 2WW4A 2EFPA 4A8OA 3M6UA 1K73T 2H5IB 2BE2B 3DRSB 2Y9HA 3J7ZT 1FEEA 3CCWA 1RGVA 4IFYB 3J80U 5K14A 4C11B 3O6QA 4OZNA 4J9LA 2B5JB 4ECVA 3W9IA 2H51B 3CJTA 5A8KB 4NLUA 4DL5A 4DR5F 5DM7Q 1VGYA 3NWGA 1JX4A 4A8SA 1F0XA 4WK3A 1FWPA 3RAMA 3UCUP 1X4EA 3DOKB 2XHCA 3AFGA 2QLFB 2BJ1A 4B08A 1L3SA 2CPIA 1VQNS 1HMVA 3CCSS 3SSSA 2O5DA 1HQ2A 2RDIA 4MYTA 1RAOA 2DNYA 4R8UB 5D0RA 4WBFA 4X64F 2B51A 2V4JB 1WHVA 2D7SA 1S1XA 4JI3F 1VQMS 4KHRA 4K50A 2WK4A 2GHPA 4KO0A 1U1NA 1VBZA 4F3OA 4NXNF 4YR2A 2FJDB 4IH6A 3V81A 4PCQA 4NRTA 3P3DA 3I0SB 4HLBA 3SCLE 1VQ7S 1FKPA 3T6JA 4OX7A 2FZGB 2MQ8A 4FNIA 4QU7A 4DR6J 3TUPA 4QZVB 1RYRA 2L08A 1GX6A 3K5PA 5HANA 4ED5A 3H5YA 3H2VE 4G3IA 3ZTOA 2VFUA 2WHOA 5IXUA 1GMWA 3I31A 3DRRA 3LW5C 2UUWA 4LBHA 4ILLA 1HNIA 3FCWA 4DFPA 3KLFA 4JI4F 4QYRA 4ZCIA 1WG4A 3UD3P 3P5BP 3BKTA 2XEXA 3EM1A 4OMFG 2Y3YA 6FDRA 4A4JA 4Y0FA 1LWXA 5EUHA 5GAEI 3TX8A 2DIVA 1S9EB 2NCKL 4G65A 2Z0GA 1DFDA 4UOFA 1VYAA 4YB5A 2XZDB 1YZ6A 3MUVP 3WHIA 4BBYA 4IG0A 3FBEA 3LGNA 3R5DA 1NCLA 2IM0A 2OELA 4ICLA 3X3UA 1HARA 3LGHA 3GIIA 3MGJA 2Q43A 1DURA 3G2XA 4CLFA 4RNNA 4NLPA 2HS0A 1NPRA 2VJVA 1O5JA 1JJHA 4IR9A 3J7A1 1CJKB 2GMHA 4X4VA 2VDHA 3H5UA 1Y5IB 5LM7E 4M1KA 5I3PA 3H90A 4ERDA 4K4WA 2QL7B 2BV3A 1FKAF 1Z4UA 2PMZD 3KLGA 2BUNA 2ZHBA 1SJRA 4JI5J 4LF5J 4J9SA 1ELOA 1HNWJ 1XNRJ 3ZC4A 4ED3A 2FGCA 3PX0A 3VVUA 1SJFA 2GQ2A 4QWDA 1UVIA 4PKDB 3AT1B 4DG1A 5H9FJ 2JLFA 1D0EA 4OZLA 4OYXA 3NBPA 2CQ0A 3HHEA 4LF2A 2AJ4A 1LW2A 4HI2A 1NO8A 2CJ9A 1ACMB 3EJMA 1TZ0A 2IJFA 3OXGA 4XDCA 2VFRA 2CQ3A 3M6VA 1IKYB 3PNIA 2NUHA 2V94A 2Z2MA 2PE8A 2DGTA 1JNRB 1SKWA 5C24B 4CWBA 2LA4A 4LRBA 2JVOA 2ZUAA 2HBQB 1FTRA 1NSPA 3LUYA 5T7LA 2GVZA 3DXBA 2V2ZA 2VC1A 5ETSA 3V6JA 2XB2D 3DOMA 3HFZB 1H74A 4UOCA 1WHWA 3W2VA 3T3FA 2J8SA 3DRPA 4O3RA 3MM9B 3KG0A 4B9SA 2HW3A 2MZJA 3KWMA 3K5MA 3HZEA 2XSJB 1RABB 1WJ9A 3AB2B 4AUKA 3D67A 5KTQA 1VISA 4OL8A 3OQ2A 2BA9A 4K4ZA 1TV6A 2D74B 1JJ4A 2VFTA 3TVKA 2XMMA 4IFVA 4P75A 1X60A 1WKKA 3T1HF 2HRUA 1HQUB 4PYAA 4JBCA 3K8WA 2B4VA 1YSJA 4H4OA 1R0AB 3DGVA 1TVRB 4NLDA 3IGVA 4UQTA 2GC8A 4OHXA 5ETRA 3BN7A 2HYIB 1HW8A 1FRKA 3OBIA 3C46A 2HRYA 3C14B 1MW7A 4A8YA 4IG3B 4NL5A 4X62F 5AXLA 5F8JA 4JI1J 3MFIA 2BABA 1RT7B 1V3RA 2ZH9A 1RI7A 4QOTA 2J0XA 4X65F 5FJ4A 4NLWA 2I1RA 3T5KA 2I9SA 5B7WA 3B8HA 2QC3A 5KFSA 5C7PA 4OLOA 3PYEA 2WBRA 2UUBJ 4EBEA 2MHEA 3V6KA 3V6DA 5LOQA 1WKLA 1LK5A 2ABYA 2KI2A 2JRSA 3FBFA 1RSCA 1TK8A 2J9DA 2FDNA 5KFNA 4LSLA 1NHVA 4MK7A 3JYTA 4JYAF 2X3DA 1HHSA 1SH3A 2HQ3A 4K2JA 4DX8H 2BR0A 2PIIA 1JWWA 2WAQD 4CT8A 5F9NA 4ZP7A 4KB7A 4C8NA 4CH7A 2XNRA 3GFYA 4YMEA 2NSBA 2RSQA 4DJBA 4HH0A 5CYQB 4M95A 2WVCA 1C4CA 3PKYA 4LF6F 3KNAA 2GO9A 3HFKA 3KKFA 1D09B 2E9TA 1AROP 1RCOB 3CIMA 2J9CA 1NHUA 3DC2A 2GO8A 3G82B 2QO3A 2R2UA 4ZIWA 1FHTA 2JSXA 2IRUA 5K9FA 2HNYB 3RW7A 3J7Z5 5KT4A 2DCUB 2VKZG 3N4WA 2C28A 3BSOA 4J9QA 4ELUA 5J2QB 1YJTA 2BE2A 4YY3J 1U8WA 1FE0A 3W2WB 4Z7CA 3CC2S 2QFJA 1W25A 1QSSA 2UP1A 2L9DA 3BN4A 4IFYA 2J6TA 4C11A 2EC2A 1FJGF 5DZ6A 4ZA1A 2B9WA 2IBKA 1N36J 4DDFA 2C2EA 4RBUA 1NKCA 4FYWB 2RQCA 1U8SA 2PC6A 3MFHA 2XQCA 3GPAA 1WC1A 3NLCA 2DNLA 3DOKA 1HI1A 4M5GA 2HFOA 3BBBA 2CRLA 3UR3C 1IKVB 1QUVA 4R8UA 3R8YA 1HWJA 4NCGB 2IDLA 3LANA 2G2OA 4EUVA 2ZOFA 2XBPA 3W65A 1FTCA 2V4JA 5CAAA 1FEHA 1X5SA 4F0MA 2WVBA 4ZMMA 2YKPA 3BGUA 2BKOA 3SBMA 3WX8A 2B8PA 3DLEA 2NPIA 2UV8A 4OYAA 2B9EA 1VFJA 1Q5VA 3BGRA 3HM9A 4O3PA 3CO9A 2VPXB 3E8OA 3PJWA 3D9BA 3MR5A 3HVTB 1Y9OA 3KHGA 4GRSA 3FKBA 4JOUA 3QLHA 4GC6A 3T6BA 4DL7A 1VQPS 3LWLA 2V34A 2X1BA 1FESA 5DGBA 2ZZMA 3CGIA 4EO8A 4LQ3A 2BBEA 5HSPA 1MMDA 1IR2A 1REVA 5M2PA 1UFLA 4DX7A 3R5GA 1G7CB 3QRRA 2V8HA 5D0HA 4ED6A 1RHQB 2DGVA 3G6VA 2HNDA 3WZ0A 1CLFA 2XG8A 2F9JA 2HGLA 3NKYA 1K0TA 3GIKA 2KU7A 3Q86A 1WELA 2LEBA 3ZXWA 1QM9A 1FDAA 4OV1A 4KHPJ 4ZVRB 3CJSA 1D8ZA 1Y3KA 3WBZA 4EBDA 4TLRA 7AT1B 4AQYJ 3I4HX 2DVIA 1T3NA 3TEGA 3MECB 3BO2A 3LPEA 4B3TF 4ECTA 2CPFA 2DO4A 1PO6A 1RUSA 1M1GA 1PC5A 2VQEJ 4LRAA 5E5NA 2CYYA 3BEGB 1TP7A 4CTAB 4U8YA 3EVMA 3M8PB 1ZAWA 3TI0A 5HATA 2FY8A 4OZ0A 4DUZF 2MYFA 2GQQA 1AZSB 3EPIA 2CZVC 2GMLA 1U1KA 3TQEA 1CJKA 3D1OA 4X84A 1Y00A 2E5JA 3I32A 1WG1A 4LSNB 2W2OP 2O1PA 2J7KA 1QTNB 4UF4A 1JXEA 1RISA 3DU5A 1Y3JA 2BANB 2GCFA 3CF5Q 2BJDA 1BC6A 3TJAA 4KBIA 1SKRA 1UVLA 2YH1A 1GTHA 4FYVB 4LF9J 3VAKA 5AXMA 3UFCX 2ATCB 3DLKB 5GMEA 5B0FA 3VGUA 1FRXA 3MAAB 2Q1LA 2W9BB 4K4SA 3KTQA 4MIWA 1RT4B 4CRJA 3OL6A 4K2XA 2OEKA 1IKYA 2QA1A 4RL1A 3GJQB 1T11A 1YGYA 2MKJA 2AZ1A 1RTHB 1PBUA 3EVWA 2WONB 2XTJP 2RAQA 2JVRA 2LU2A 3NY0A 3K58A 5A8RB 1NJWA 2V63A 4KV8B 1HA1A 4OI3A 2MQPA 4N8OA 4J9VA 5HQLA 2Y0SD 4AL6A 2E7WA 3BGLA 3IWXA 2MHNA 3ETOA 1EP4A 2VG7B 2OUGA 5J1NA 2UVWA 1NKBA 5JVHQ 3W5ZA 1CVJA 3JSMB 3I0RB 2XSJA 1SQGA 3FBBA 5KT5A 1SC6A 3K5NA 5H9EK 1FRIA 1D3WA 1ZM4A 2VPWB 5D3GB 2EFVA 3C16B 4DPWA 2CQGA 1F5AA 2KXHA 4KGZB 5AE2A 2HIQA 4WU2A 1Q1KA 1R0AA 4M8LA 1C1BA 1TVRA 2X3GA 1KTQA 1FVQA 1I6JA 3M9NB 1H2VZ 2AW0A 2OPQA 2CVIA 2ZE2B 1K0VA 4MKVA 2F40A 4QR0A 1VI7A 3C14A 5E3QA 1VQSA 4DS4A 1WOPA 2AJQA 1RT5A 3UR0A 3RW6A 3EGVA 3AH6A 5HQMA 1RT7A 5KG0A 4DS5A 3VCDA 4B17A 2EK6A 2PD1A 1Q79A 3QRPA 1MU2A 4MFBB 2LFVA 2P9GA 2E9RX 4WYWA 3PJ9A 1KONA 2IA6A 3ZTPA 1FDNA 2F3JA 2ZDPA 4YHHJ 1EAYC 1F9HA 3LA0A 2DGUA 3CT9A 4CDIA 1VBXA 1S1UB 3I96A 4M5MA 2FHJD 3R2DJ 4LR8A 4TNOA 5KFLA 4ZS6A 2AEMA 1TFYA 4LBPA 2FJAB 4DR1J 2EKYA 2E29A 3RRGA 1RAGB 1XNQJ 3MMCA 3E2EA 4KHMA 5GMDA 1FDBA 5D0EA 4OYPA 1EZZB 1UA1A 3HVAA 5CYQA 1AFIA 4LF5F 2NZ4A 1U48A 1HNWF 1XNRF 3MM8A 5KG1A 4XK8C 3MPUB 4YS2A 4F4YA 4Q2MA 1U6BA 4W4MA 4DR2J 3G82A 2YX4A 4ECQA 4LF8J 2HNYA 1H2TZ 2JH3A 2VHGA 2PFDA 2G0JA 3W2WA 1S6QB 3D1HA 2HNZB 4ZVOB 1Q8BA 3IGNA 2VB6A 2RF2B 2V4RA 3QYYA 2CFXA 3N79A 2XI2A 4RX6A 3SV4A 3NGDA 1LW0B 4DV2F 2CJXB 3KDNA 4Y2MA 4K0KF 1WUUA 2PGCA 2XWXA 4E98A 3ZNUA 1RT3A 4Y65A 1IKVA 2CQIA 2CG4A 4ZKAA 5BYRA 4YQWA 2YNFA 4AYBD 3CJRA 2UXCJ 1GEHA 3PHEA 2FHOB 4G1QA 3PW0A 3AA8A 4KIAA 1WSVA 4L74A 2VBWA 1Y4ZB 1L3UA 2HQCA 4QCLA 4LF1A 1T05A 3HVRA 3HVTA 1QVGR 1GMWD 1VIXA 1JLQB 4AFFA 2G9OA 3Q2SC 1Z2LA 1KOHA 3AJ2A 1ZETA 1RWOB 2ZJQQ 1HYSB 1S76D 4MIBA 3CC7S 4JI1F 5GAHI 2AZ3A 3GSDA 4ED1A 4NCBA 4DV7F 1NSAA 3AY0A 3V4IA 1NXIA 1T03B 2YQ0A 1B70B 2J8AA 2EFOA 2KFNA 3I55S 2YNIB 1N8RT 2UUBF 2XMWA 1LWFB 4RBTA 4ZLJA 1X9WA 1T7PA 3RBDA 1SQFA 2RQ4A 1H7WA 3LF0A 4CH1A 1F9FA 2HVEA 2Q66A 1FFWB 4E8UA 3PIOQ 3B6BA 1VOMA 1CBKA 3BB5A 3RAXA 2OFHX 4MTPA 3UDCA 4CTAA 2OI2A 2HHHF 3TP2A 3GV7B 2V6AA 1AB8A 1AZSA 1S4EA 1H73A 2GJ2A 5B0DA 2AYGA 3MTJA 3VR1A 3MCMA 1OSDA 2W4DA 2N3LA 2CPZA 5KG4A 3TEHB 4O4GB 4EFAC 5DG8A 3TZWA 4LSNA 2HK2A 4MJKA 3BBCA 2KN4A 2G4BA 2RVJA 3AOCA 5KG7A 2DISA 4UZCA 1KBRA 2CQDA 3KJNB 2VOPA 3HHNB 2A18A 4CO4A 4USWA 2MZRA 2VA3A 1A7GE 1RZMA 3MAAA 3E3XA 5IWAF 2W9BA 1NDPA 1RT4A 2HSEB 2ZOGA 3TRGA 1U1RA 2ZH8A 2ERRA 3KUGA 4DSFA 1N36F 3MR7A 3QNWB 1TMMA 1S6OA 2N82B 2XCAA 4FF4A 4DN0A 2IJRA 1RTHA 4NMXA 2BE9B 4OJ1A 2VBXA 2WONA 1NZAA 2OEJA 3IA0A 4U7UD 1W2BR 2DHSA 2RU3A 3QMQA 1M5OC 4LFAJ 3TA0A 3H8YA 3G6YA 2MJNA 4KV8A 1BUXA 3BF4A 3KLEB 1S59A 2HBRB 4KPYA 1TUWA 1YRTA 1JLBB 2QYCA 1TQLA 3ONQA 4NRUA 2DPIA 2IIHA 4XO0A 2W7PA 1KQKA 5MLCV 1SH2A 3JSMA 4CO1A 1X4HA 3K89A 2XCPA 4OJHA 2C1EB 2CZ4A 1V6HA 1JXLA 5FDLB 1S6PB 4U95A 4DZ6A 5D3GA 3C16A 1BMQB 3CWJA 3JQMA 2ZBCA 2HGMA 2W9CB 4PZVA 2C3UA 3QO9B 5HROB 4I6YA 3OR2B 1HNVB 1VQOS 3OT9A 3K8VA 3W61A 1X0PA 2JX2A 2LEAA 2W4CA 1PC4A 2N7YA 4Y2CA 1IQTA 4J9NA 2ZE2A 2GJIA 1UFWA 2M3DA 3M2UB 2V2VA 5B0GA 2B7CB 4RNFA 2RIJA 1NHKL 4W98A 2PT0A 2UV8G 1X9MA 1UPMB 4KHPF 4N41A 1CJVA 1NU4A 2AMCB 2XHWA 1N48A 4MFBA 2GZOA 3AA9A 3IFEA 3HXMA 2L48A 4AQYF 4GVLA 4C0BA 3ICLA 3GV5B 2VQEF 1S1UA 4DQPA 2SXLA 2AHOB 4WF9Q 2JLGA 4J37A 4RO0A 1FNXH 1FI4A 2ZNZA 4EO6A 3UO0A 3KJFB 2QG9B 2D9OA 4DUTA 1XERA 4PG4A 1IKXA 2NPFA 3N5FA 3M8WA 1XEZA 4XPCA 1RLCL 5CHCB 1T9WA 5DM6Q 2GMJA 1X5OA 3CJKB 1ZPWX 2MJUA 4LF9F 2NXCA 4L3KA 2R2RA 1AUSL 1OQ6A 2R7RA 2MQQA 3PKMA 1MG7A 3TUJC 1TKZB 2UZAA 3HDSA 4Q44A 3ULHA 2ZKTA 1KDNA 2QFIA 1V3ZA 4HTJA 3BS9A 3L4BC 3F0NA 4H4KC 1S48A 1VQLS 1F60B 1S6QA 1M5VC 3N6LA 1S49A 3QAUA 1C1CB 5HBMB 2RF2A 2MKHA 3GWCA 3R1HA 3P96A 1KHWA 4ED2A 4WK1A 2P8IA 3MEEB 4USTA 2BJ7A 1HKAA 1LW0A 3BGOP 1QTMA 2LECA 4N7TA 4X4QA 1HNZJ 3H42A 4CLTA 4K7QA 1EETB 4ZLNA 2RE1A 4CLKA 2HZAA 2DTJA 4QW8A 2EW9A 3JB9k 3H7HB 4C7QA 3AOAA 2OD4A 1XMQJ 4I2PA 2QE5A 3Q8VA 4KFBB 4JI7J 4NLVA 4MIAA 2ZVIA 3AODA 3M6XA 1UW4A 4NZ0A 4FP9A 4LF4J 3I9ZA 5L1LA 2YH0A 2CWXA 2XI3A 5IFMA 2APOA 2HQGA 3OL9A 3ZTSA 1JNZB 5IC4B 3IRWP 5DGAA 2LVWA 1SJQA 1OS5A 3HJFA 1S7HA 1K1SA 3PYGA 1TK0A 3MEGB 3POTB 1WDDA 4RU9A 3SFUA 2JZ5A 4CIOA 4OYOA 1BWEA 3PIPQ 4DPXA 5C2CA 5DQGA 3I5AA 1T03A 1Q5YA 1KWMA 3Q8RB 2YNIA 4DV4J 2MZ1A 4YHHF 1LWFA 1PIEA 4ZVUB 1SB6A 4U96A 2DH9A 1HI0P 3T41A 5LMUJ 5JUMA 1NNDA 3FEXB 4USMA 2AIRB 1KVIA 1XNQF 3OSPA 2M7SA 4LR9A 1JK9B 2EFQA 1NDLA 5KFRA 4JI0J 2H1YA 4O4GA 3BKFA 3G71S 5E7OB 3Q2TC 1U1QA 4TVAB 1KEKA 1QAIA 1QJHA 2QZ8A 2CQHA 5IM0B 1BD6A 3I5CA 3D2WA 4LF8F 4CLPA 1WOSA 2CPDA 3UWTA 5M2UA 2R7VA 5D78A 1BWVA 4F8RA 1N5VA 2RUGA 1DAXA 4NYZA 2ZJPQ 4QIFA 5DS7A 3CC4S 5HLFB 2HAIA 2WB4A 3DU6A 1DARA 5KOXA 4KGVB 3MMBB 1KD1T 2ZHAA 3QIPB 2DHAA 2VONA 3KMQA 1UKUA 3E01B 4WFBQ 5KFZA 4RUBA 4XDDA 1UWAA 2VC0A 4ED7A 2NXNA 1JMTA 4QWCA 3DXSX 3EDRB 2OAUA 2ZC3A 2KTQA 4X4TA 4R0JA 2DYAA 1K47A 3D6FB 3GR0A 2VJUA 2UXCF 1JLBA 1N34J 3ILOA 3DRYA 4JUZA 2J0WA 4FPRA 1JIHA 4O44B 1D1UA 4Z7YA 4RWWA 3OL7A 2MLXA 1LOUA 4J9KA 3R5JB 3I4PA 4I6AA 1OIAA 5A6PA 2ZWPA 3PO5A 1JLEA 1KSPA 2CWKA 2LLZA 1S6PA 2HG4A 3PACA 4DR5J 4X4OA 3AQPA 4CLUA 3LQVA 2OD6A 1RHRB 2BZ2A 3PHTA 4OZ2A 2W9CA 3HLUA 1MN9A 2FD2A 5HROA 1I5OB 4NA1A 1HNVA 2LCWA 3GZ7A 4KGKA 1HWLA 2Y1RI 2BQ3A 4USHA 1MNEA 3EDQB 2KXNB 3BR9A 4OX8A 3EZUA 3M2UA 2OSRA 2WVDA 3J7YU 4OZ5A 1RU1A 3UI3A 2L41A 2F4VJ 2L9WA 2DY1A 4LSZB 1IWAA 4NXNJ 1PILA 4YB1P 4FBUA 2G1HA 2YPYA 3R1LA 1S0MA 2HZVA 3S8SA 4PAAA 4V1Ak 1APSA 3GIMA 4H4KA 4OV6A 2VV5A 2QJ3A 1HBMB 1PJ7A 3GJRB 1ZS6A 2OPSB 1KTVA 1B7YB 5LMNJ 3I82A 4C98A 4TY8A 3D6TB 2HVZA 4F3MA 1SIWB 2IC3B 2EVZA 1DQ9A 4OI2A 5J2NA 4JI4J 2M4MA 3SSQA 1XJWB 3P4UB 5L8RC 2LQ5A 1U1PA 2MLYA 4B9VA 4TY9A 2KJWA 1Y5LB 3OXFA 1VRTB 2ZHOA 4UT4A 4OZ1A 3QFHA 3CJKA 2DNNA 1RHUB 5J1PA 4WTOB 5A8WB 4DLGA 5F8HA 4E0DA 1TKZA 1NK9A 1DTTB 1EKRA 2JLEA 5SZTA 3QGIA 2NS1B 4RW7B 4LIRA 3DRXA 4MMOA 1RT1B 2GA7A 2DIUA 2KKHA 3DMJA 2E5HA 1UZDA 3NCRA 2HKEA 2D69A 1C1CA 5HBMA 3AXKA 4I1TA 4WTYA 3ET6B 3BV8A 4L73A 2C42A 1IR0A 1K1QA 3D68A 3MEEA 4LFAF 2I5JB 3K0JA 3R7SB 3Q8UA 3CJ2A 3LGMA 1S9GB 1SJ1A 4L6V3 3G8SA 2H48B 1RAIB 3BSAA 3NGRA 1EETA 2NYHA 2YNHB 3M32B 2ZBRA 4LR7A 3DYAB 3QWPA 5A2QY 3SQOP 1X31C 3NS5A 4FNHA 2JFDA 3CCZA 4BWJA 4R5PA 3UD5A 2HURA 2OPRB 1KQSR 4WFYA 1RTJB 2RMLA 5DDPC 1Q0NA 4KFBA 3GE9A 4DV5J 2YKAA 4QQBA 3E51A 4OJ3A 1DTQB 4ID8A 4DUYJ 2NSCA 4RNOA 1IBKF 1M5KC 2NR0A 1N5SA 1LFPA 3HCXA 3UN3A 4ZHRA 3IN5A 5L1JA 4HT5A 2RDJA 1NM2A 4R0EA 2HPUA 3OLBA 4N47A 1MMLA 2DGXA 1JLCB 2AX0A 3G8QA 2FZKB 2HEKA 4OYMA 5HQ8A 1YTYA 1C0UB 2CNLB 1T9YA 3MEGA 3POTA 1T02A 1L5UA 1QAYA 3CNQP 4CLSA 2V69A 3C6UB 2OFGX 2DKOB 2WSFC 2O67A 2EWHA 3CDWA 5DDOC 4LVNP 3CJ5A 3OSNA 1NLKL 4ZVGA 1TUVA 4BCAA 4O3QA 1VQ6S 3C6TB 1VQ5S 1L3VA 2E1CA 2JC0A 4P2SA 5IS2A 3W8PA 3NXZA 2FJEB 4B9MA 1HPZB 3OW2R 3CCQS 1TKXA 3AOBA 2A6MA 1Y5NB 4F02A 3G8TA 2Y1IA 2C2OB 1X9SA 1R0CB 3H2LA 4YUDA 1FF2A 3ENWA 1H2UX 5DDQC 5ETMA 4JV2A 2IY5B 5KFPA 3TNVA 2MQNA 4B02A 2R7SA 4OX6A 2K1RB 5IM0A 4B9LA 2X1FA 3RRHA 2NLWA 2BJ9A 2EFGA 2MKSA 1EB0A 4DEZA 3OFFA 4ES1A 1RDRA 3P5TL 1G2EA 2LYVA 5I42B 3DLHA 4ANEA 3G6XA 1S0VA 5HLFA 2YWHA 4M5NA 1NJXA 2Z2LA 4DL6A 3M8QA 4KYZA 2XY6A 3K59A 2ZVSA 3QIPA 3E01A 4QW9A 1T8EA 2ROEA 3BYPA 4EBCA 3NNHA 4AXIA 4C8YA 2AU0A 5F8LA 1RA6A 1HNZF 1IKWB 2XGQA 2ACMA 2FLPA 3TAQA 4UOHA 1ZBTA 1FFGB 3OTOJ 4ES3A 2GIFA 4LRCA 1I51B 2D9PA 3GG1A 3N6NA 1NZ8A 4F04B 3KK3B 2RS2A 4TU8A 4IQMA 4QIEA 1U1MA 2IVMA 3KDOA 3O8WA 4ER8A 4ZDNA 4LF4F 5F0UA 4ILRA 3UVJB 3ITHA 4U9RA 1YZ7A 1VQYA 4M5IA 1FD8A 2OLWA 1N6QB 2CDQA 5CYMB 3TUZC 2KZMA 4DSLA 1XMOF 4ZP9A 3FCVA 4FZVA 4PEOA 4OFZA 2K8GA 5E2QA 4KAIA 1S72S 5KG2A 1KS2A 3MPWA 4QYZJ 2XLJA 3HP6A 4I0WA 3HHKA 2DR5A 3M2VB 3NOGA 5F3ZA 2O3DA 2XO6A 4HR2A 5LMUF 3KLHB 4DV3J 2QMXA 1HBMA 3CD0A 5GADI 2BKNA 4CLLA 2IVYA 3CJ4A 2QSWA 2CUYA 3NNAA 2IRYA 3GFHA 3BO4A 1QLNA 5ETKA 2IC3A 3GCXP 5KFDA 4JB8B 3DHXA 1MROB 5ETQA 2CIMA 4TLQA 4A8XA 2C22A 2HIYA 2B6AB 4K59A 3VQSA 1BQMB 1PYSB 1GNKA 2CKWA 1BHNA 1VRTA 1J2VA 1LXNA 4X4SA 2XMJA 3GTYX 3W9HA 1Q7LB 1HD1A 2QSFA 3QBCA 3W9JA 1R27B 1X7VA 4KH0B 1M1KT 4B3TJ 3EGZA 4RUAA 1KNZA 1DTTA 1XR6A 3D6HB 2UU9J 5DZ7A 3A8EA 3DLGB 4JI2J 1RTIB 4WKYA 4RW7A 5D4OA 4ILMA 1RT1A 4YR0A 5A6WA 2RT3A 1T95A 2XULA 3R2CJ 5HK4A 3MI7X 2DGQA 1U2RA 2KXFA 4RKUC 3DI6B 3EGWB 3MPDA 3JAMY 1VHIA 2W2MP 3SCJE 4A8MP 3GU0A 3ET6A 3CMAS 1YLXA 3EVOA 1FK9B 2YX1A 3HI9A 2I5JA 1OY8A 1S79A 2XMTA 3CJ8A 4B3MJ 4RLEA 1WI8A 2PMHA 1BE4A 3NP5A 4ECYA 1AYEA 2B4UA 4I7FB 1BGXT 2KM8C 3A8KA 3AB4B 5E3CA 3M32A 2GGPB 2C3MA 1RYSA 3DYAA 4QBUA 1MSWD 4G6VB 4ALZA 5L9NA 3CUNA 4RW6B 3JXOA 2OPRA 4WXWA 1ROFA 2LQ8A 3HVWA 2Z57B 1RTJA 1FX2A 2MY7A 3CCMS 3KK2B 4RNHA 5F9LA 4KC5A 1DTQA 1OYDA 4LRFA 3PFOA 2AJ0A 1SIZA 5DJBA 1B99A 1S1VB 5K8PA 2QTWA 2E9ZA 2XMAA 2FB0A 2IRXA 2DXDA 2YNGB 5HN0A 5D77A 3BBFA 1E6VA 4WP8A 1JLCA 2J0QD 1SC1B 4S0MA 5B08A 1UEKA 3CD6S 1CJTA 1ZA1B 4X66F 1Q16B 5CH7B 5D4NA 4NMLA 5HMZA 2NQPA 3FQLA 1M1HA 4PG6A 1U1OA 2F4VF 1E6YB 1C0UA 2MXYA 4EEYA 1XTZA 3NCQA 5ETPA 2XM3A 1UVKA 4G1PA 2HGNA 4ZPAA 3V6HA 3KG1A 4IH7A 2Y8YA 4ECZA 5GAEU 3JTPA 3C6UA 1RHMB 4PUOB 2DR8A 5KT6A 1HD0A 3M8SA 1YBUA 3RR8A 3PEHA 2HVDA 2D3OR 1U26A 4ZPCA 5LMNF 2Z4PA 1LFWA 4QR1A 3Q8PB 4PXBA 3C6TA 1IVZA 3A13A 5BXIA 3VAGA 2RKIB 3VAMA 2FGOA 1B3TA 1HPZA 2FVSA 2G13A 1IBMJ 1BQXA 3IMQJ 1VRQC 3LPYA 5CCMA 2DGSA 2BM1A 1KHVA 3U1NA 1S57A 1VK8A 3LWMA 4AL5A 3NRBA 2YWWA 4AD6A 1CC8A 3R97A 2LQ9A 4O0NA 1LWEA 2AJFE 2BRKA 1C0TB 3MTKA 5JMNA 4J9MA 3FNNA 8RUCA 3ZO7A 2VASA 3WDOA 2K1RA 5DQHA 1H6KX 3HKZD 5FD1A 5A2QU 2P2CB 2M0GB 3A3OB 1HBOA 1PCAA 1F9EB 1KQGB 2KH9A 2RD5C 2CJKA 1TL5A 2M88A 2RQMA 2HWTA 3FEZA 1FXLA 3MWBA 3PRVA 4JV0A 4NYPA 5IOLA 1IBCB 4DR3J 2EI5A 2E5LJ 3U02A 1GH8A 3M05A 1S9FA 4IOCQ 2GAHC 3VAIA 4DV6F 1GFWB 1B64A 4U7CA 1TL7B 4ETZA 3G4SS 4C8OA 4RZRA 4ANDA 3AHPA 1JJCB 4E2FB 3FSIA 1IKWA 1D9FA 3SEOA 1RACB 2F8HA 2J5AA 3VALA 4OX9F 4FDFA 3QZ8A 5B0CA 3IWNC 4UW2A 3WC0A 1UMJA 1K44A 1WF2A 2WZ1A 2Z2YB 2IFXA 4DPOA 2OHDA 2W8KA 2R2TA 1HBNB 2VD3A 2ZH4A 3N28A 4HEA9 4DV5F 1VS3A 1QE1A 3RZAA 2DCLA 4I64A 2PA3A 5J2MB 1JKHB 4O23A 1U09A 4DUYF 3G87A 1RAEB 2M52A 5L38A 3MM5B 4C8ZA 1U47A 5J2PB 1JLAA 4RW9B 5KFMA 4PWUA 5KFVA 1HLWA 3UVJA 2VH7A 2E1AA 3UW1A 1SXLA 1U24A 3OUYB 4DV2J 1F5BA 5CXTA 2EG2A 4K0KJ 3O2IA 5EN1A 1Y0HA 1KRPA 2DO0A 1NK4A 2CNNB 2E44A 1N6QA 4CO5A 1UVNA 1BXNA 2M2BA 1V5IB 5CYMA 3X1LB 3FFIA 2DR9A 2R7QA 2NREA 3OR1B 2DXFA 1Q82T 2RDDA 3BM7A 1VJWA 4F4WA 4LIWA 7FDRA 2ZFHA 2KRBA 4UUWA 1A6LA 3MHYA 2KO1A 3BJYA 4Q2LA 5HMXA 1JLFB 2OSQA 3LP2B 4ECSA 1K9MT 1XR7A 1N52B 2YBVA 3M2VA 3NMAA 3I56S 4DWIA 4TQRA 3UCGA 3RBEA 1TKDA 3IRXB 3J7AN 3CXCR 5I3QA 4LREA 2Y0BB 1R6VA 1ZTWA 3QGPA 4LJMA 2A1BA 1ZZNA 2YWFA 2AF6A 2WSEC 1MROA 5C42B 1X4BA 2V9WA 5LSOA 3HSZA 4DV7J 4DHVA 1F3VA 3VGSA 4U67Q 5GMKa 2WTFA 3PW7A 2B6AA 4RWXA 1BQMA 4ECRA 1N32J 3M9OB 1JJ2R 4I69A 2ALYB 1WTFA 1SC4B 5LXYA 4C4WA 4WZQA 4ANCA 3BPSP 4FF1A 1CJUB 2JEIA 5BJRA 1YIJS 3UNYA 4P7TA 2MZQA 4LRDA 1S5ZA 1RLDA 3NOCA 5KG3A 4OHVA 3P8BB 2DPJA 2EKNA 1R8AA 2HK3A 4B9TA 4ZPWR 1NB2A 1VRUA 1NBEB 1YWXA 2Y8WA 1M0SA 2CPJA 4KGMA 3DLGA 3QAEA 4DCPB 2HHHJ 4B3OB 1NB7A 1RTIA 4KQZA 2A0FB 1CEZA 3CW2C 3H4DA 4JI8F 2J0SD 2H54B 3W62A 3NAHA 4P10A 1VIOA 3A8JA 3DI6A 2W01A 3OXLA 1RBAA 5RUBA 4Y2IA 3ZZ0A 4KT0C 3R5CA 3K17A 4B3SJ 2KZZA 2FVQA 1TELA 4NCAA 2QMWA 1FK9A 2XMKA 1Z1ZA 2X7IA 3OTOF 1TL3B 5KFYA 2BRLA 2J9DE 3R6LB 4I7FA 1ZPVA 4ZCMA 4NA3A 1KVJA 1YVFA 3RB0A 2GGPA 2BX6A 3DRSA 5IWAJ 2CXEA 1DY3A 1QSYA 4RW6A 1RA7A 2M8HA 1RWMB 1WF0A 5K14B 1L3TA 1NK7A 2B5JA 5AXNA 3KK2A 5EDWA 5A8KA 4Y28C 4WXOA 1N5YB 2G0CA 3PJXA 2N4CA 3M8RA 1S1VA 2R8KA 1R8HA 2YNGA 3AJDA 4LQ9A 3KG4A 4NLSA 3NG8A 2JJ4D 1NEEA 3C66A 3GQCA 4A46A 6FD1A 3NAIA 2B4PA 1BY9A 2Q79A 4DR4J 5LJ3Y 2DB1A 3RRKA 1EKSA 2DR6A 1D8YA 2LDYA 2YWGA 2ILZA 3I0SA 1QAJA 1VCTA 1GT8A 2DNHA 4PUOA 3MCNA 3M2RB 3BQ1A 4P52A 4DV3F 2QLXA 4C0OC 3JTNA 1EQ0A 3DFEA 4CO3A 4DQQA 1T9UA 2HBZB 2WCXA 3M8ZA 1X5TA 1S97A 1D9AA 4OIXA 2V0NA 2ZZNA 4DF4A 2RKIA 2DRBA 2BEFA 1H0HB 5EWGA 1HFEL 1PAUB 1UP1A 5CABA 5BYQA 4QIWD 2UXBJ 3WX4A 3JAMU 1T3OA 4I2QB 2CQCA 5DLFA 3LOUA 2ADCA 3A1YG 5KFQA 5EGYA 1S9EA 2MEWA 1I3OB 1C0TA 3I87A 4M5DB 2E1PA 5KOWA 3PV8A 5GAGU 2PEBA 4FKYA 4A8WA 1UAWA 4HDHA 1NSQA 5ETLA 1ITPA 4MK9A 3W3SA 2FHKA 4GVBB 3J81Y 5HI7A 2UU9F 4Q7AA 3VGTA 2JHEA 4ICLB 4JI2F 3CCVS 2K7JA 2WOMB 2KG0A 2QLJB 2AEJA 3CCTA 2DT9A 4M5JA 2DNGA 4IYQA 3MR3A 1PG5B 3QATA 1JLGB 3PRDA 5THWA 4P2XA 2YPZA 4O3SA 4NLXA 4HHJA 4N77A 3NGKA 3KHLA 5L1KA 3UN2A 2P9EA 1S4FA 1P1LA 4JI6F 4ZVTB 4B3MF 1WACA 1TL7A 1UETA 3BREA 2B56A 3N0VA 1U0HB 2JEJA 3F73A 2AEFA 4PPDA 1OYEA 3CO0P 2HFSA 4OJGA 4K5SA 5HAOA 3P45B 5KFGA 4OLPA 2V2KA 5KFHA 1RTDB 2CA9A 4ZCKA 4F2SA 2DEIA 2AKWB 3EGNA 4WFXA 1LW2B 1YITS 1YDLA 1HBNA 3V4MA 2Y1LB 5L9XA 3MM7B 4OHZA 5J2MA 2OO4A 1JKHA 1U25A 4JV5F 4CLWA 5C24A 4XAKA 4FYYB 2KJVA 3MM5A 3QGHA 1SI9A 2V9KA 5J2PA 5AJ3J 4WCEQ 1H7XA 2ASYA 5T7LB 2GVZB 4CM0A 4CLZA 3TVZA 2DGWA 3DOMB 3OUYA 2HS4A 4HH1A 1W26A 5HO4A 3CDBA 1SH0A 2XS2A 3MM9A 1UJ6A 2HHPA 3DRPB 2H5JB 3OR1A 3D0GE 1KC8T 5G4DA 5SUHA 3N9UC 2MB0B 1TAUA 2DHHA 2C2ZB 2JEFA 4F0KA 4ZJQA 2HBYB 2MPUA 1RBLA 5DG9A 1JLFA 4XTTA 3ZNJ1 2NUUG 3LP2A 1HQUA 2K3KA 2XLKA 4USJC 2DHXA 1CS4B 2I8EA 2HMIB 3WIUA 1LQ9A 4ELTA 1UWBB 1FRLA 4ZPTR 3UE2A 2M70A 5KG6A 3PX4A 4GKJF 1Z2ZA 3D1QA 2VFSA 1DBDA 5DO2A 4DR7J 4OHYA 2P5VA 3H0PA 2KL8A 5AT1B 1IBMF 4NLTA 3PW5A 4IG3A 5HJYA 3TA2A 1TFWA 3TJ9A 2IJNA 4ETXA 2QLBB 2J7WA 2B7BB 3RU0A 3GV8B 2K3IA 3O1LA 2D41A 3D7SB 3Q22A 1Y10A 4I68A 1ZA2B 1X4CA 1Q86T 4F36A 3EZOA 3Q0AA 4DSEA 4C0HA 1HQEB 3QJJA 3DM2B 4WFAQ 1KN6A 4LSLB 1EX8A 4ZN3A 4JV1A 4CZCA 4M63A 1SJ3P 3BDEA 5KFOA 2EEYA 3ILLA 5I3UB 1UZHA 4NLOA 3MPVA 3R6GB 4B3OA 3Q8SB 4UUXA 4C8LA 2MZSA 4DR3F 1PJ6A 2E5LF 1NH8A 2W1BA 3C2PA 3NL0A 2MGZB 5M2RA 4BS2A 2GAGC 2W25A 2QT7A 2KB2A 2IHR1 2DRAA 3FJ2A 4CI0B 3AD9C 3TA1A 3N01A 2ZNYA 3PR4A 3HO1A 1X0FA 1XC9A 3LTOA 3UDVA 1TL3A 2OMOA 2U1AA 1U6FA 2E1RA 4KKOB 4RBVA 3VAJA 2YX7A 1FWKA 2FHMA 5B0EA 5J2QA 2H4WB 5G0RB 5DDRC 4BC7A 4WFNQ 1X8DA 3HKWA 2C3OA 2XY7A 4X4PA 1X4AA 2FPHX 1TKTB 4ZK7M 2MKCA 2V8DA 1PYTA 1MWZA 4Q8FA 1N5YA 4K4UA 4FBTA 1X4GA 5KFWA 1CQNA 1IUJA 1NH7A 5B09A 5EWEA 4Y6IA 2AGPA 3ETMA 4DPYA 3ISND 5KFKA 4GMKA 2X1AA 4TYAA 4NZ7A 2YQ3A 4NCGA 4WPAA 3H40A 5IV4A 4PABA 1N4LA 1QVFR 2CJQA 2FYXA 4C3KA 1LK7A 5GAHU 2HLTA 3KUEA 3HJVA 2AP6A 4USUA 4ZOSA 2AJ1A 3DLEB 1R0BG 2HHSA 3RUBL 4EWTA 4LBIA 2DNMA 3ZZRA 3BGRB 3W5YA 2GX8A 5F3TA 4TQSA 3M2RA 1ULRA 1N56A 3R9LA 2GNKA 1YJNS 1ZM3A 4MT1A 3KHRA 2UUCJ 3QLHB 4QYZK 1V3SA 3VHQA 1FCAA 3OJUA 1V9OA 3IG1B 4OHWA 1I1GA 3F41A 2KG1A 1REVB 4LFCJ 2CQBA 3TR5A 1U2CA 4GC7A 2J7UA 3SMZA 1RE1B 2UVRA 2XZWA 2CADA 2YXLA 2HNDB 3V2UC 1RAFB 4WFZA 2D3O1 5DLGA 3EX7B 1N32F 4I2QA 1I94J 4QIVA 2BJEA 1W2IA 2A6OA 4O3OA 3ILJA 1P1TA 3DLBA 2DRDA 4M5DA 4ZLLA 4J9UE 2VG5B 2X1GA 2C2NA 3MECA 1KLMB 4LVOP 2UUAJ 2VFVA 2HHQA 2OJ3A 2F65A 4OZJA 5KFTA 4GVBA 4J90A 1VQ9S 1MWYA 1T9TA 1IWGA 4RW8B 3VV2B 3M8PA 2ILYA 3BDPA 2WOMA 3C3LA 3A4TA 2RRBA 4O4RA 4OYZA 3ZZOA 2RRAA 1IJFB 2R9LA 4ED8A 4NLRA 3BKUA 3AXMA 3ZZTA 1JLGA 4L72B 4WIQA 1QSLA 2JFKA 3UQSA 5F8NA 1YBTA 1XN9A 3HX9A 1TMJA 4B3SF 4TU9A 3R5AA 1U02A 2VZ9A 2BANA 4HYKA 4CCHA 4V19J 1U0HA 3CJ0A 4CM2A 1G3OA 2L3MA 2C2KB 1NDCA 3JSRA 3TQ1A 3MEDB 5ETVA 1NDKA 3SFGA 3DLKA 2AYMA 2BM0A 3B54A 1TU0B 2H3EB 2M5YA 4PG7A 1F2GA 4BWMA 1Q53A 1IN0A 1RTDA 4QWEA 4IH5A 4ZPBA 4ZCLA 1RAHB 2NYIA 2WVFA 3M1VB 4NA2A 4TYBA 4UTGA 3MM7A 3MF5A 4BDPA 1PYOB 5D0GA 1SC3B 2VF3A 4DF8A 3B4MA 4LF7F 5EX3A 3HHDA 3W5XA 3ELHA 2QX0A 2VBZA 3EWGA 1VC5A 3CD7A 2JDJA 5K20B 2EG1A 1ZAVA 5A8RA 4N56A 4KH1B 4U7UK 1YK9A 2MQLA 1RCXB 1SKUB 1Q7YT 3GFZA 4IRCA 5CZVA 3M7VA 5D6GA 4DR4F 3THPA 3TARA 1WF1A 1NAQA 2ZZTA 3GYGA 4L76A 1UJ4A 2R42A 2EXUA 2VG7A 4F0HA 1EP4B 2MKYA 5E3AA 3QGGA 3T5LA 3HF5A 4IOAQ 3I0RA 1SUQB 3ZTRA 4HDGA 2C2DA 2ZH1A 5J1EB 1QD1A 3D6MB 1RWUA 2IYIA 2XSFA 4J9PA 1IBKJ 2MSSA 1S99A 4TN2A 4ZN1A 1CS4A 2QL5B 3IWLA 2HMIA 4LFBJ 1UWBA 3J81U 3BO3A 4F67A 1C1BB 1VBYA 1JQGA 4P71A 3GJTB 3B4DA 1OQ3A 2OPQB 1M5HA 2LMIA 2E5IA 1RAJA 3MZIA 2FTRA 2G0IA 2F5GA 4WJBA 2PA8D 4WZMA 4IDKB 5CD4H 2UXBF 1PBAA 2MMYA 4YB6A 2DNRA 4DXLA 1RT5B 4YEAA 2CJYB 2QRRA 2RQKA 5KT2A 1UJ5A 3IBFB 3HMJG 4URSA 2UVUA 5F8IA 2VPYB 5LT5A 3ZZPA 4ATNA 5HMWA 2QGFB 1MU2B 2R8HA 1IBLJ 2RNEA 3EZ5A 1NJZA 3OJSA 1SVDA 4M5KA 1T0TV 4NOHA 4M5LA 1HQEA 3EPGA 4IUFA 3PO4A 2CPHA 3DM2A 4DV0J 1XBWA 2ZDOA 1NMEB 3AAWB 3GLJA 2PMWA 5A0YB 5LSLA 3CIZA 3FZ2A 1C4AA 4NLYA 5ETTA 1ICEB 3EMTA 5GVQA 4F4XA 5F41A 4DL2A 5I3UA 3UPFA 2XNQA 3C8YA 3KXDA 4P6QA 3MMCB 3JSBA 2PDAA 1VC6A 2MDAA 3HSGA 3G96A 1N88A 5HVHA 2MGZA 2BJ8A 2YWEA 2HFUA 2GHVC 1HBUB 1R7IA 1GXTA 4ELVA 3MM8B 3SYZA 2GV1A 5L46A 4DL3A 4J9OA 1RK8A 1SBRA 3MM6B 4KKOA 1XWLA 2XWYA 4DL4A 2LP4A 2KFZA 3THVA 1SV5B 2BE7D 1YJWS 4A8FA 5G0RA 2F9DA 1ZZFA 4ID5B 1RT6B 1RHJB 3TVYA 1S7IA 5H9FK 2V5HG 1LWCB 2HNZA 2EBGA 2W8LA 1FKOB 1FFSB 3QT6A 2R8JA 1TKTA 5HJXA 3L7OA 5AJ3F 2A10A 4CT9A 4H54A 3D0IE 4FKXA 4FF2A 1WNEA 2N3OA 3SQGB 1SL0A 3T19A 3IR6B 1GK8A 5HVFA 1H38A 3LAMA 3TUIC 2CDRB 2M9KA 1RT3B 1AA1B 2XLIA 3WQPA 4F7VA 3BSNA 1AFJA 5ETOA 2GW8A 1F6TA 2LQBA 2YNFB 1WEZA 1WC4A 2OKQA 2AGOA 1NK5A 2ZJRQ 4G1QB 4QR2A 3NMRA 1NK0A 2ZEJA 4PWDB 1O6XA 2HQDA 4EI2A 2FQQB 2R3VA 4KSEB 4PR6A 2W2PP 3CDEA 2FVRA 3IP0A 2VQFJ 1YQHA 1D9DA 1FNMA 4PRFA 4W92B 1T05B 2ASDA 1JLQA 1FRMA 4KRWA 4DR7F 3ILIA 5JXSA 1NJYA 1FDDA 3GFXA 4EU0A 5E0OA 2FJXA 3Q8YA 3VF0B 4RUCA 3MPYA 3IG1A 4ZLPA 4ED4A 8ATCB 3G86A 5T14A 3IS9B 2LQJA 1HYSA 4C9DA 1FT8A 2W9AA 3PG9A 1PJ5A 1FRJA 3GJSB 3HFVA 1EIYB 1OJ4A 1DQ8A 2BW2A 1XMOJ 2ZITA 1UEVA 3FQKA 3V4IB 3L9ZA 3AD7C 4UZBA 1S12A 3SDEB 5KFBA 1F3FA 2RS8A 4NASA 1IXKA 3W7BA 3HHLB 2MSTA 6AT1B 3UN5A 3R3TA 1FE4A 4PXCA 3U7JA 2ADBA 4CNZA 4M94A 5KFJA 2VG5A 1KLMA 2RU9A 2DXEA 2XMVA 2H65B 4U8VA 1LV5A 3RG6A 3OPKA 1XK8A 4RW8A 1IM6A 3RB6A 1RAAB 3OFHA 2OTLS 2YKQA 3D5MA 2PSZA 3K57A 2FC8A 4FN5A 2LXFA 3QSYB 4IRKA 1U2FA 4EZ9A 3OTBA 4KGXB 2R7TA 3I6PA 1HI8A 1YRUA 3BYRA 1WEYA 1OO0B 3NGSA 3KLVA 2FY1A 2ZM6J 1WSRA 1Q95G 5GAGI 2GHWA 2H4YB 2HHUA 5HL7Q 3MEDA 1R8CA 4QPXA 2ZBPA 4ZITA 3K2YA 3WC2A 1GXLA 3HHLC 3GP9A 3MOZA 2RHSB 2C2MB 4AL7A 2LXIA 2W7OA 3DOLB 3M1VA 5DG7A 4PXEA 4FPIA 3FDSA 4ZVEA 3VAFA 1IQZA 1YRXA 2D1CA 4DFKA 1WC0A 2KT2A 4EYIB 1QDUB 1DLOB 1Q8LA 4ZPDA 1EQMA 4PQUB 5IT9Y 3MXHP 5T41A 3W60A 3KLEA 2VBYA 3T1AA 5K8NA 5F8GA 3KJVB 3NNCA 2HZCA 4W90B 1Q4RA 3V5RA 1M5PC 3TAPA 1SUQA 3GIRA 1YBAA 1HWKA 4ECUA 2OEMA 4DFJA 2JL9A 5FDLA 5FIIA 4MH8A 2VUGA 1N33J 2OMLA 5J1EA 2XY5A 4DR6F 1DHMA 2CPXA 4DFMA 2UUCF 3QO9A 3JSYA 3OR2A 1L3KA 4M5HA 4G1IA 2V4QA 2VPZB 5KFEA 1S0OA 3ISZA 3DNCA 1B0TA 5CYJA 3S6EA 1KP6A 4LFCF 1S10A 1RT2B 2DJWA 4X66J 4YB7A 4ZPVR 1VK3A 2Z2ZA 4IDKA 3LALA 2OPPB 2LEPA 1FD2A 4TKTA 1I94F 5FLXY 4FYDA 2BACA 4X4UA 4GO5X 4X4RA 2CNKB 5A76A 4B3RJ 1CJVB 3JQKA 3K7RA 8AT1B 5EX0A 5CA5A 2IM1A 3DLLQ 2UUAF 2BJ3A 2DBBA 4CYUB 2H5EA 4ZJOA 2MQMA 4FXVA 4FYXB 3G9CA 5E41A 3OHAA 1VMBA 1NRKA 4Y2KA 2LDIA 5A0YA 3MAHA 3ENQA 2D3UA 3PCOB 3GB0A 1A0OB 5K8OA 2CQ4A 4TXSA 2VODA 3M8YA 1G6BA 2MTLA 4C48A 2R7OA 1CPZA 3S01A 2HQIA 1IR1A 1IKXB 2CQ2A 4N5SA 1QUPA 2QLWA 1RQ0A 3TZYA 2AX1A 4JI5F 4BLGA 1U1LA 3DCAA 1HBUA 2B43A 3RTVA 3CE8A 2O01C 5ADZA 4WP3A 3A3NB 3CMQA 3HZGA 4KPCA 3GYNA 3LP1B 4USIA 4N8NA 1U4BA 3CDAA 3DKDA 1YJ7A 2F8MA 3BZQA 2AYEA 2IDEA 3MM6A 1WHYA 4KJIA 4OZ3A 1T9XA 1LXJA 1ZM2A 1SV5A 2DR7A 4CO2A 3CULA 4ID5A 1RT6A 3ADAC 1U7LA 1S0NA 1N5TA 1VJQA 1LWCA 3OHBA 4J5OA 2GJFA 1VLYA 1FKOA 2ATLA 2I2YA 2FIUA 2KHDA 3RBXA
chains in the Genus database with same CATH topology
1IBCB 2QLJB 1RWXB 2C2OB 2H5IB 2CDRB 2XYPB 3GJQB 3GJRB 1PYOB 1BMQB 2QLBB 3GJTB 1GFWB 1SC4B 2C2MB 1SC3B 3D6HB 2QL9B 3R5JB 1RWMB 2HBZB 2XYHB 1I51B 3KJQB 3KJFB 3QNWB 4DCJB 2H4WB 2H51B 2H5JB 2H65B 2CJYB 2QL7B 5K20B 2CNLB 3R7SB 3IBFB 4ZVTB 2XZTB 1SC1B 3R7NB 1RHRB 1RWVB 2FQQB 1RHKB 4ZVUB 1RWWB 1PAUB 3P4UB 4DCPB 5IC6B 2XYGB 2H48B 1RWNB 2QLFB 2C2ZB 3SIPB 2DKOB 4JB8B 1QTNB 3P45B 2H54B 1QDUB 1RWKB 2HBYB 2CNKB 1RHJB 4ZVQB 3NS7B 1RHQB 3EDQB 1I3OB 1RE1B 2Y0BB 2HBRB 3R7BB 3IBCB 4ZVOB 3R6GB 2C2KB 3EDRB 2P2CB 1RHUB 1RWOB 1NMEB 1RHMB 2XZDB 1F9EB 2Y1LB 4ZVPB 4ZVSB 4LSZB 3D6MB 1ICEB 3GJSB 3RJMB 3KJNB 4ZVRB 2CNOB 3D6FB 2CJXB 1RWPB 2QL5B 4DCOB 3R6LB 2H4YB 5IC4B 2C1EB 2HBQB 2CNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBC B;  2QLJ B;  1RWX B;  2C2O B;  2H5I B;  2CDR B;  2XYP B;  3GJQ B;  3GJR B;  1PYO B;  1BMQ B;  2QLB B;  3GJT B;  1GFW B;  1SC4 B;  2C2M B;  1SC3 B;  3D6H B;  2QL9 B;  3R5J B;  1RWM B;  2HBZ B;  2XYH B;  1I51 B;  3KJQ B;  3KJF B;  3QNW B;  4DCJ B;  2H4W B;  2H51 B;  2H5J B;  2H65 B;  2CJY B;  2QL7 B;  5K20 B;  2CNL B;  3R7S B;  3IBF B;  4ZVT B;  2XZT B;  1SC1 B;  3R7N B;  1RHR B;  1RWV B;  2FQQ B;  1RHK B;  4ZVU B;  1RWW B;  1PAU B;  3P4U B;  4DCP B;  5IC6 B;  2XYG B;  2H48 B;  1RWN B;  2QLF B;  2C2Z B;  3SIP B;  2DKO B;  4JB8 B;  1QTN B;  3P45 B;  2H54 B;  1QDU B;  1RWK B;  2HBY B;  2CNK B;  1RHJ B;  4ZVQ B;  3NS7 B;  1RHQ B;  3EDQ B;  1I3O B;  1RE1 B;  2Y0B B;  2HBR B;  3R7B B;  3IBC B;  4ZVO B;  3R6G B;  2C2K B;  3EDR B;  2P2C B;  1RHU B;  1RWO B;  1NME B;  1RHM B;  2XZD B;  1F9E B;  2Y1L B;  4ZVP B;  4ZVS B;  4LSZ B;  3D6M B;  1ICE B;  3GJS B;  3RJM B;  3KJN B;  4ZVR B;  2CNO B;  3D6F B;  2CJX B;  1RWP B;  2QL5 B;  4DCO B;  3R6L B;  2H4Y B;  5IC4 B;  2C1E B;  2HBQ B;  2CNN B; 
#chains in the Genus database with same CATH topology
 2IPO B;  3NS6 A;  2K06 A;  2VG6 B;  2AWZ A;  1AT1 B;  1Q8I A;  4DV6 J;  5D4P A;  1WD6 A;  3SQG A;  3CCL S;  4DZD A;  3IR5 B;  4K4Y A;  3PYF A;  3P49 B;  2F7V A;  2AGQ A;  4F26 A;  4OX9 J;  2IYG A;  1SQE A;  2V67 A;  4HHH A;  3EIC A;  5KFF A;  2UXD J;  1Y11 A;  3KNG A;  3PW2 A;  1UFK A;  4I2P B;  4EZ6 A;  3PR5 B;  2EK1 A;  4PWD A;  5K8M A;  3A12 A;  3CCJ S;  4A47 A;  3DDN A;  1F2H A;  1VLO A;  2G1D A;  4R25 A;  1RXO B;  2UVV A;  1C2P A;  2DNP A;  5B0B A;  1H3D A;  3BPD A;  1ZM9 A;  3HUL A;  3QQC D;  2DH8 A;  4LFB F;  2V68 A;  3QFW A;  1RKI A;  3QID A;  2PI5 A;  3KMS A;  2QA4 G;  4USK A;  1ZAX A;  1CUL B;  4ZVS B;  1RKJ A;  4WU3 A;  3L7P A;  3VWS A;  5U47 A;  2Q6B A;  3FSY A;  3QJL A;  2WSC C;  3IS9 A;  4LT6 A;  1U6Z A;  1RWX B;  2R8I A;  3CCR S;  2W7A A;  5IZH A;  2ASJ A;  3MR2 A;  4NE9 C;  2N7C A;  2FLO A;  3KLI B;  4B9N A;  2VU5 A;  1WWH A;  4NXM J;  3HT0 A;  1SPB P;  2XC9 A;  2AD9 A;  3SDE A;  2E66 A;  3H98 A;  3HHL A;  1IBL F;  4WII A;  1NSK L;  3IAS 9;  1WTB A;  2CJA A;  4ED0 A;  4NLQ A;  3GSI A;  4WWS A;  1S1T B;  4YFU A;  2B3T B;  4DV0 F;  2DNQ A;  1W7W A;  1EAR A;  4DU8 A;  4OI0 A;  3FC9 A;  4ZVQ B;  5IT4 A;  5EHH A;  2Z8Q A;  3MR6 A;  1R8B A;  3IBC B;  4UOG A;  4K4T A;  4RU2 A;  4ZIV A;  3TWZ A;  2E7X A;  2MZT A;  1YKW A;  3MMJ A;  2YQ1 A;  4FXD A;  4Z2X A;  4DSI A;  2W2N P;  4DMZ A;  1VDH A;  4DCO B;  3ISN C;  4V19 X;  4LUB A;  1YJR A;  3O44 A;  1S77 D;  2FC9 A;  3FVY A;  1BLU A;  2CG8 A;  5L39 A;  1U45 A;  3SSR A;  2Z58 B;  2AV5 A;  3L95 X;  4HVZ A;  2I0X A;  3MUT P;  4OYW A;  2MKI A;  1YJV A;  4EGL A;  4QWB A;  2COL A;  1SKS A;  1Q78 A;  2WB1 D;  4YY3 F;  3FSX A;  3FCH A;  4WKR A;  5KAK A;  4AE5 A;  1AUD A;  3P6Y C;  1OY6 A;  3T5J A;  1KOO A;  2R8G A;  3MMB A;  3DOL A;  3IAM 9;  5MAO A;  1RWN B;  4DU7 A;  4JI8 J;  3SIP B;  4DLE A;  2F1F A;  4I6W A;  4C3M A;  1YHQ S;  7FD1 A;  3HSJ A;  4NEZ A;  3HSD A;  2KYZ A;  4KR0 B;  1TAQ A;  2KT5 A;  4C97 A;  4J9R A;  4N76 A;  2CAJ A;  3D66 A;  4ZVH A;  1MN7 A;  1UVJ A;  1QY7 A;  1P8G A;  1DLO A;  1WG5 A;  3TYT A;  1SCJ B;  3RGI A;  2PEH A;  2J6U A;  4PQU A;  5HP1 B;  3MAQ A;  3DHW C;  1R3N A;  3KJV A;  4Q5V A;  3KUH A;  4ECX A;  4O44 A;  3W63 A;  1RB0 A;  5LSR A;  4IRD A;  4DBQ A;  3UNG C;  2VKR A;  4IO1 A;  2VIH A;  1SL2 A;  2POK A;  3FEY B;  5C25 B;  4BC9 A;  4CO0 A;  2VQF F;  2YKN B;  2IA0 A;  3O5T B;  1JLE B;  4ZP6 A;  4YP3 A;  4CLY A;  2BKP A;  3IBW A;  3VQT A;  2VL1 A;  1HNX J;  5AE3 A;  1RWW B;  3D54 A;  3CVK A;  1FER A;  5GAD U;  1TUG B;  2DNZ A;  2IMW P;  1FO1 A;  5JVG Q;  2V50 A;  1KQF B;  1RT2 A;  1SJ4 P;  2HHX A;  3Q83 A;  2AJ2 A;  1ZH5 A;  1HWI A;  2X51 A;  2OPP A;  1OMS A;  2HWI A;  3LO3 A;  4A48 A;  1R8P A;  3CED A;  3NWR A;  3HT3 A;  3GON A;  3D3C J;  2WVE A;  4F25 A;  1REG X;  2MLZ A;  2IBO A;  5BR8 J;  4Q0B B;  2LA6 A;  3H5S A;  4K8R A;  3U27 A;  3OFE A;  1B0V A;  5BYS A;  4CYU A;  5HMY A;  2KRR A;  2OPS A;  3FUY A;  3BH6 B;  3EXY A;  4PQA A;  4Q45 A;  3VAH A;  4TY8 B;  5E33 A;  4MK8 A;  3IM9 A;  1TL4 A;  4LMZ A;  3BH7 B;  2IM3 A;  3T1Y J;  3JS9 A;  4DV1 J;  3H4B A;  2HVH A;  2EBE A;  1S1W B;  5J2N B;  2J76 E;  1H72 C;  2XYG B;  4HKQ A;  4OI6 A;  2ZWO A;  3D4J A;  1GQE A;  3IO1 A;  1WOR A;  2NZC A;  4L3N A;  1FJC A;  3F44 A;  2ZM6 F;  5IT9 U;  1KLN A;  3RBZ A;  2XS7 A;  4EYH B;  2B9Y A;  1TL1 B;  5A8W A;  5IT0 A;  3GIJ A;  5B0A A;  2KFY A;  3LP1 A;  3U1M A;  3QZ7 A;  4Q8E A;  2ZKU A;  1VHF A;  3MMA B;  3DDI A;  4PG8 A;  2K7K A;  3CTR A;  1N54 B;  2AQ4 A;  1YJ9 S;  4DX5 A;  4FS2 A;  1V5V A;  2XGP A;  4IQX A;  1MMN A;  2FZC B;  3PZP A;  3DMJ B;  3I9V 9;  3IC1 A;  2F63 A;  1T9V A;  1UA0 A;  3D0H E;  3PEJ A;  3BSC A;  3Q23 A;  2P6T A;  2XYH B;  1X4D A;  5CCL A;  5JJB A;  2DEJ A;  4KTQ A;  2VG6 A;  2BXJ A;  4JI6 J;  1S9G A;  2FLN A;  2HFZ A;  3CD5 A;  2ZH3 A;  2IVF B;  3OVA A;  1NKE A;  2RHQ B;  4EK2 A;  2M8D B;  2Y1J A;  2YNH A;  4C3L A;  3GYX B;  2UUT A;  1WC3 A;  2QYG A;  3C15 B;  2ZBQ A;  1HWU A;  4P74 A;  3JTO A;  5FLX U;  3HK2 A;  3EUN A;  4I4B A;  1TR0 A;  3D28 A;  5IQQ A;  4R5P B;  2QA2 A;  3W64 A;  3ENA A;  1N33 F;  5KFA A;  4BHQ A;  3QSI A;  2ZD1 B;  2KT3 A;  3Q89 A;  3G6E S;  4WE1 B;  4FS1 A;  2OP5 A;  1EHW A;  4JV5 J;  4D3H A;  2RB7 A;  2BQU A;  2C3Y A;  2V8G A;  4C6A A;  4ZHR B;  3L09 A;  1X4F A;  1U49 A;  3KYL A;  1CUL A;  3LAK A;  1VQ8 S;  2PFF B;  1RP5 A;  2QN6 B;  1FVS A;  2BVZ A;  3UCZ P;  3HD2 A;  1RU2 A;  1YX2 A;  1LEO A;  4B9U A;  2VDI A;  1AXQ A;  1GTE A;  3PVX A;  2G2Y A;  4NLG A;  4B3R F;  5LXR A;  4HL9 A;  1M90 T;  2IAJ B;  4ITS A;  3KLI A;  2QV6 A;  1IJE B;  1CC7 A;  4ZJL A;  1KVK A;  1XIQ A;  3SXL A;  2B9X A;  3TZZ A;  3PFE A;  5HVG A;  1XR5 A;  3N5B A;  1PGZ A;  4ES2 A;  5C2G A;  3DLJ A;  4MKB A;  1P9Y A;  1NK6 A;  4PG5 A;  2L9N A;  1GMU A;  1S1T A;  4QIG A;  9RUB A;  2ZH7 A;  4RPF A;  1H98 A;  1HR0 J;  1WI6 A;  1PAE X;  1ZYQ A;  3K5L A;  3BQ2 A;  1FXR A;  5H1S V;  3OVB A;  5KT3 A;  5IV3 A;  4GKJ J;  2LXU A;  2AT1 B;  4UY8 T;  2Z30 B;  2R7X A;  4DR1 F;  4DN9 A;  1BQN B;  4H4M B;  3TAM B;  1TKX B;  2VOO A;  3VVT A;  3T9N A;  3W66 A;  2D3Z A;  1J5E J;  1F1B B;  2ASL A;  4P2M A;  5KFI A;  3KJQ B;  2FLL A;  2LKZ A;  3DGP B;  4D3G A;  1XMB A;  2VA2 A;  4RW4 B;  2R7W A;  3M9M B;  1QAX A;  2I38 A;  1VQ4 S;  1UVM A;  1K8A T;  2HHW A;  3K5O A;  4IO9 Q;  4C8M A;  4FXW A;  2PN6 A;  3MDF A;  4DR2 F;  3DN9 A;  2W2Q P;  3QPI A;  5I42 A;  2RJZ A;  3H2U B;  3HD1 A;  1G1X A;  3T5H A;  2WRM A;  5CQG A;  4Y34 A;  3PYD A;  4USV A;  1IM4 A;  3M30 B;  3VGV A;  1FJE B;  3RYL A;  3M8Q B;  1NPP A;  5LJ5 Y;  2J6S A;  2N4D A;  1WDT A;  3RJM B;  3AQO A;  3OVS A;  3H25 A;  1Q81 T;  1HW9 A;  1OPZ A;  4RR5 A;  1OWX A;  4OI4 A;  3SI8 A;  3QT8 A;  3RR7 A;  2GVD B;  5C5J A;  4GO7 X;  2XYP B;  2P9C A;  5HP1 A;  3CCU S;  2CQ1 A;  4GKK J;  4NI2 B;  3US5 A;  4QWA A;  2DGO A;  3TOQ A;  2UXD F;  3BR8 A;  5KFX A;  4DX6 A;  1P9Q C;  4P9S A;  4IOB A;  3KK3 A;  3MCO A;  4I56 A;  1OSC A;  5F8M A;  3CDU A;  2K2P A;  1TTH B;  2WW8 A;  5C25 A;  4Z37 A;  3OTD A;  3W1Y C;  2YKN A;  3SCI E;  4F3Q A;  3BGF A;  2ZUG A;  2FVP A;  5KFC A;  3ZZU A;  4NYO A;  3ITH B;  1VBK A;  3Q24 A;  4IKA A;  4YDX A;  3R7B B;  4HAC B;  3CCE S;  1J5O B;  2ZH5 A;  4YOE A;  3CME S;  1NUE A;  2HLU A;  1HHQ A;  3R27 A;  2MKK A;  2RIL A;  5DRK A;  4ZVP B;  4DI6 A;  2NXJ A;  2OTJ S;  3GR1 A;  3KK1 B;  4XIU A;  4X64 J;  3OTE A;  1GXU A;  2FUG 9;  3FMW A;  2E1M C;  4NXM F;  4JI3 J;  2QEX S;  3S1T A;  1LNQ A;  3LP0 B;  3GMG A;  2BOA A;  1ZTT A;  3J80 Y;  3L3C A;  5F0W A;  4CNY A;  4Q0B A;  4Q43 A;  1ZOT A;  5D15 A;  3KLH A;  3SCK E;  4OQJ A;  1CQM A;  1GX5 A;  4K4X A;  3OFG A;  4XPE A;  1VC0 A;  2KYX A;  2W24 A;  3UD4 P;  4CQ1 A;  1A9N B;  2Q6C A;  2BYC A;  5E3R A;  2Q3P A;  2FJW A;  2A2C A;  5I4M A;  3THT A;  2HHV A;  2P6S A;  2ZH2 A;  1F5C A;  3J7Y I;  1S1W A;  1WC5 A;  3I5B A;  4A8Q A;  2JOQ A;  2A2D A;  2CVE A;  3AJ1 A;  3TZX A;  2YKM B;  4X2B A;  1FNO A;  1RWP B;  2HFV A;  2KHC A;  3NGU A;  3WIV A;  1TL1 A;  4OYI A;  1UW9 A;  4ECW A;  4NPO A;  3OL8 A;  2V2Q A;  3MMA A;  1X5P A;  4ZVF A;  1RAD B;  3VZI A;  4K5R A;  3TJ8 A;  4URG A;  4KE5 A;  1URR A;  2DD8 S;  2B8Q A;  4DCJ B;  4F2R A;  1P6T A;  4DPT A;  4P2F A;  5LL6 d;  1SL1 A;  3R7N B;  1YI2 S;  4NZ6 A;  4NEY A;  4ENO A;  2ZOM A;  3VZH A;  1T94 A;  3OLA A;  2AYB A;  3CSK A;  1R6Y A;  3PX6 A;  3A8I A;  4RNM A;  4X4N A;  3NGT A;  3ZTQ A;  2FJV A;  2RRN A;  5AXK A;  4P73 A;  2LU1 A;  3VTI A;  1FWL A;  1NJI T;  1VR6 A;  2R2S A;  2QMU B;  2EC0 A;  2GQC A;  2GIQ A;  2VIC A;  2YY3 A;  2U2F A;  4DL0 C;  1CG2 A;  4O3N A;  2HHT A;  4URQ U;  3QRQ A;  2DK2 A;  2A3J A;  3FMB A;  3PDN A;  3C15 A;  3UDE A;  1B0P A;  2HS3 A;  1FXD A;  1MWQ A;  2IM2 A;  2C3P A;  2FVC A;  4DPU A;  5ETN A;  4C2M A;  2ZD1 A;  3NEK A;  4WE1 A;  3OD2 A;  4FF3 A;  5D8H B;  1HNX F;  5AE1 A;  3Q8Q B;  4LF7 J;  3ZFV A;  1N0U A;  1DJ0 A;  3PY8 A;  4O0I A;  2PO4 A;  5DQI A;  3T9Z A;  4OYB A;  2EPI A;  3GIL A;  2ZBI A;  3TO8 A;  5KT7 A;  1HMV B;  3BQ0 A;  2XZT B;  2DHG A;  1E6V B;  1R31 A;  1DQA A;  2XO7 A;  1CJT B;  3NCP A;  2GFF A;  2BW7 A;  2HWH A;  4L75 A;  5H9E J;  3O3L A;  1S1X B;  4QU6 A;  1E6Y A;  3J81 j;  1RWK B;  2J9E A;  1RJJ A;  4KO0 B;  3HHL D;  4F4A A;  4U6P A;  5IQ6 A;  2IAJ A;  2NXE A;  5BR8 F;  2I6W A;  2R4F A;  1Q8K A;  3V81 B;  4PYD A;  4KY3 A;  2B4O A;  1FKP B;  2F4F A;  2BMB A;  2G2Z A;  3EXC X;  3M6W A;  1VQK S;  2ACY A;  2W4P A;  3U1L A;  3PM9 A;  3T1H J;  4JP8 A;  4MYU A;  3KFW X;  2XS5 A;  4UY8 5;  2QIF A;  3DRR B;  1HNI B;  3TW0 A;  3T1Y F;  4DV1 F;  3TAN A;  1O51 A;  1PKU A;  4YN3 B;  1R89 A;  5EWF A;  3FK4 A;  2BOP A;  3KLF B;  4F50 A;  1MLA A;  2JEG A;  1BQN A;  4PWW A;  4H4M A;  2HAF A;  4DSJ A;  3MEK A;  3TAM A;  3CJ3 A;  3R5B A;  2HVI A;  4X62 J;  3AD8 C;  1CSJ A;  2XMU A;  4J7C A;  1HIY A;  2OH2 A;  2GS8 A;  4OI1 A;  2MQO A;  1RHK B;  2OGU A;  4X65 J;  1DRZ A;  4DOZ A;  2JNJ A;  1LWE B;  2QA4 S;  3ZZY A;  3ENV A;  4P7V A;  1NK8 A;  4UQG A;  3DGP A;  4RW4 A;  1KKH A;  1UEU A;  2YTC A;  2O66 A;  4IG0 B;  4EMD A;  5L1I A;  4HI1 A;  4HHU A;  4A8K A;  4DQS A;  1HHT P;  3MUR P;  1HL6 A;  4IR1 A;  1PSD A;  5ITH A;  3MD3 A;  1HBO B;  5KG5 A;  3CJQ A;  5D4L A;  4JYA J;  4F4Z A;  2KDO A;  1UL3 A;  3M30 A;  4I67 A;  1RTZ A;  1XQI A;  1JXV A;  4NX9 A;  3PXG a;  2ROP A;  1B4S A;  4HT7 A;  3FRZ A;  4DSK A;  1LKZ A;  3H20 A;  3KLG B;  3MOJ B;  1N0V C;  3RB3 A;  2ZC4 A;  2WBM A;  2QL9 B;  3OTC A;  2BQR A;  1S6U A;  3D3B J;  1WEX A;  3UDL A;  2F8E X;  4LF6 J;  1GAO A;  2OIH A;  4WYL A;  4C8K A;  2GVD A;  4RJV A;  4ZP8 A;  1KR4 A;  3IXQ A;  4DG1 B;  2JWN A;  4FVC A;  4NI2 A;  2GIR A;  4TU7 A;  1FA0 A;  1O8B A;  3NBP B;  5E3P A;  2C2R A;  3GG0 A;  3W8G A;  3L7U A;  5IC6 B;  2V8P A;  1O0P A;  4HTI A;  1XMQ F;  5CD4 A;  1FRH A;  4JI7 F;  2E7V A;  1QE1 B;  5K5M A;  3N6M A;  2FJB B;  4WP9 A;  2EFN A;  1FJG J;  3FBC A;  2E5G A;  4J91 A;  3OV7 A;  4RW9 A;  1B7F A;  1JB0 C;  1JLA B;  2DIT A;  1FJ7 A;  1WC6 A;  4MAK A;  3RAQ A;  3QT5 A;  2KVQ E;  1AW0 A;  1UTA A;  4F4K A;  3MD1 A;  2CNO B;  4HAC A;  2CQP A;  1J5O A;  3ZZZ A;  9ATC B;  3PW4 A;  2YVS A;  1FX4 A;  3W2V B;  2CPE A;  2RUS A;  3FGV A;  1J27 A;  3FFI B;  1UPP A;  3C19 A;  3S7R A;  3KK1 A;  2DNK A;  2ALZ A;  4K4V A;  3IM8 A;  3KOA A;  2ROG A;  1TV6 B;  4Y3C A;  4PXD A;  2CZ9 A;  3LP0 A;  4IFV B;  4DV4 F;  4RUH A;  1WKJ A;  3LH2 S;  3H59 A;  1HR0 F;  4H4O B;  4AXJ A;  2HFN A;  3EYZ A;  3IRX A;  3H5X A;  4YR3 A;  2HQF A;  4YDD B;  4MKY A;  3QT7 A;  3F56 A;  1OPI A;  1G4C A;  2HRT A;  1KFS A;  5C42 A;  4QJV A;  4JI0 F;  5KFU A;  4NWB A;  3A3P B;  1N5Q A;  1TK5 A;  1J5E F;  2DNO A;  2BDP A;  2V8V A;  4PPZ A;  2KM8 B;  1GMV A;  2MY8 A;  2YKM A;  3HPO A;  2DH7 A;  1R43 A;  3PTW A;  1P27 B;  4DQI A;  1URN A;  3MCS A;  2ZH6 A;  1YG0 A;  3V6D B;  1CJU A;  2IMO A;  1KFD A;  3PRB A;  3QWU A;  1Y7P A;  4FVM A;  4QPT A;  3GCW P;  1U0S A;  2B0G A;  3JYT B;  2CPY A;  1DZ5 A;  3DDK A;  4AT1 B;  2YKO A;  4CH0 S;  3RB4 A;  1RWV B;  3SZ2 A;  2JC1 A;  4Y00 A;  2H9Z A;  1NPK A;  2R7U A;  3SV3 A;  2FHJ A;  1VRU B;  3FRY A;  4DUZ J;  2RH3 A;  5CZX A;  1EJ7 L;  3CPW R;  3TX0 A;  3FZB A;  3CB4 A;  2Z56 B;  3B82 A;  4P72 A;  3NS7 B;  2KVI A;  4MKA A;  1RBO B;  5DET A;  4CP5 A;  1WHX A;  3B78 A;  1UCN A;  3M4X A;  2PI4 A;  3IR7 B;  1WOO A;  2CJB A;  1OY9 A;  4Y2A A;  3EE3 A;  3JQJ A;  3QJP A;  3MUM P;  2YWK A;  4GKK F;  1M5S A;  2DY9 A;  4DQR A;  2NXU A;  1YJU A;  3KHH A;  1N34 F;  2WW4 A;  2EFP A;  4A8O A;  3M6U A;  1K73 T;  2H5I B;  2BE2 B;  3DRS B;  2Y9H A;  3J7Z T;  1FEE A;  3CCW A;  1RGV A;  4IFY B;  3J80 U;  5K14 A;  4C11 B;  3O6Q A;  4OZN A;  4J9L A;  2B5J B;  4ECV A;  3W9I A;  2H51 B;  3CJT A;  5A8K B;  4NLU A;  4DL5 A;  4DR5 F;  5DM7 Q;  1VGY A;  3NWG A;  1JX4 A;  4A8S A;  1F0X A;  4WK3 A;  1FWP A;  3RAM A;  3UCU P;  1X4E A;  3DOK B;  2XHC A;  3AFG A;  2QLF B;  2BJ1 A;  4B08 A;  1L3S A;  2CPI A;  1VQN S;  1HMV A;  3CCS S;  3SSS A;  2O5D A;  1HQ2 A;  2RDI A;  4MYT A;  1RAO A;  2DNY A;  4R8U B;  5D0R A;  4WBF A;  4X64 F;  2B51 A;  2V4J B;  1WHV A;  2D7S A;  1S1X A;  4JI3 F;  1VQM S;  4KHR A;  4K50 A;  2WK4 A;  2GHP A;  4KO0 A;  1U1N A;  1VBZ A;  4F3O A;  4NXN F;  4YR2 A;  2FJD B;  4IH6 A;  3V81 A;  4PCQ A;  4NRT A;  3P3D A;  3I0S B;  4HLB A;  3SCL E;  1VQ7 S;  1FKP A;  3T6J A;  4OX7 A;  2FZG B;  2MQ8 A;  4FNI A;  4QU7 A;  4DR6 J;  3TUP A;  4QZV B;  1RYR A;  2L08 A;  1GX6 A;  3K5P A;  5HAN A;  4ED5 A;  3H5Y A;  3H2V E;  4G3I A;  3ZTO A;  2VFU A;  2WHO A;  5IXU A;  1GMW A;  3I31 A;  3DRR A;  3LW5 C;  2UUW A;  4LBH A;  4ILL A;  1HNI A;  3FCW A;  4DFP A;  3KLF A;  4JI4 F;  4QYR A;  4ZCI A;  1WG4 A;  3UD3 P;  3P5B P;  3BKT A;  2XEX A;  3EM1 A;  4OMF G;  2Y3Y A;  6FDR A;  4A4J A;  4Y0F A;  1LWX A;  5EUH A;  5GAE I;  3TX8 A;  2DIV A;  1S9E B;  2NCK L;  4G65 A;  2Z0G A;  1DFD A;  4UOF A;  1VYA A;  4YB5 A;  2XZD B;  1YZ6 A;  3MUV P;  3WHI A;  4BBY A;  4IG0 A;  3FBE A;  3LGN A;  3R5D A;  1NCL A;  2IM0 A;  2OEL A;  4ICL A;  3X3U A;  1HAR A;  3LGH A;  3GII A;  3MGJ A;  2Q43 A;  1DUR A;  3G2X A;  4CLF A;  4RNN A;  4NLP A;  2HS0 A;  1NPR A;  2VJV A;  1O5J A;  1JJH A;  4IR9 A;  3J7A 1;  1CJK B;  2GMH A;  4X4V A;  2VDH A;  3H5U A;  1Y5I B;  5LM7 E;  4M1K A;  5I3P A;  3H90 A;  4ERD A;  4K4W A;  2QL7 B;  2BV3 A;  1FKA F;  1Z4U A;  2PMZ D;  3KLG A;  2BUN A;  2ZHB A;  1SJR A;  4JI5 J;  4LF5 J;  4J9S A;  1ELO A;  1HNW J;  1XNR J;  3ZC4 A;  4ED3 A;  2FGC A;  3PX0 A;  3VVU A;  1SJF A;  2GQ2 A;  4QWD A;  1UVI A;  4PKD B;  3AT1 B;  4DG1 A;  5H9F J;  2JLF A;  1D0E A;  4OZL A;  4OYX A;  3NBP A;  2CQ0 A;  3HHE A;  4LF2 A;  2AJ4 A;  1LW2 A;  4HI2 A;  1NO8 A;  2CJ9 A;  1ACM B;  3EJM A;  1TZ0 A;  2IJF A;  3OXG A;  4XDC A;  2VFR A;  2CQ3 A;  3M6V A;  1IKY B;  3PNI A;  2NUH A;  2V94 A;  2Z2M A;  2PE8 A;  2DGT A;  1JNR B;  1SKW A;  5C24 B;  4CWB A;  2LA4 A;  4LRB A;  2JVO A;  2ZUA A;  2HBQ B;  1FTR A;  1NSP A;  3LUY A;  5T7L A;  2GVZ A;  3DXB A;  2V2Z A;  2VC1 A;  5ETS A;  3V6J A;  2XB2 D;  3DOM A;  3HFZ B;  1H74 A;  4UOC A;  1WHW A;  3W2V A;  3T3F A;  2J8S A;  3DRP A;  4O3R A;  3MM9 B;  3KG0 A;  4B9S A;  2HW3 A;  2MZJ A;  3KWM A;  3K5M A;  3HZE A;  2XSJ B;  1RAB B;  1WJ9 A;  3AB2 B;  4AUK A;  3D67 A;  5KTQ A;  1VIS A;  4OL8 A;  3OQ2 A;  2BA9 A;  4K4Z A;  1TV6 A;  2D74 B;  1JJ4 A;  2VFT A;  3TVK A;  2XMM A;  4IFV A;  4P75 A;  1X60 A;  1WKK A;  3T1H F;  2HRU A;  1HQU B;  4PYA A;  4JBC A;  3K8W A;  2B4V A;  1YSJ A;  4H4O A;  1R0A B;  3DGV A;  1TVR B;  4NLD A;  3IGV A;  4UQT A;  2GC8 A;  4OHX A;  5ETR A;  3BN7 A;  2HYI B;  1HW8 A;  1FRK A;  3OBI A;  3C46 A;  2HRY A;  3C14 B;  1MW7 A;  4A8Y A;  4IG3 B;  4NL5 A;  4X62 F;  5AXL A;  5F8J A;  4JI1 J;  3MFI A;  2BAB A;  1RT7 B;  1V3R A;  2ZH9 A;  1RI7 A;  4QOT A;  2J0X A;  4X65 F;  5FJ4 A;  4NLW A;  2I1R A;  3T5K A;  2I9S A;  5B7W A;  3B8H A;  2QC3 A;  5KFS A;  5C7P A;  4OLO A;  3PYE A;  2WBR A;  2UUB J;  4EBE A;  2MHE A;  3V6K A;  3V6D A;  5LOQ A;  1WKL A;  1LK5 A;  2ABY A;  2KI2 A;  2JRS A;  3FBF A;  1RSC A;  1TK8 A;  2J9D A;  2FDN A;  5KFN A;  4LSL A;  1NHV A;  4MK7 A;  3JYT A;  4JYA F;  2X3D A;  1HHS A;  1SH3 A;  2HQ3 A;  4K2J A;  4DX8 H;  2BR0 A;  2PII A;  1JWW A;  2WAQ D;  4CT8 A;  5F9N A;  4ZP7 A;  4KB7 A;  4C8N A;  4CH7 A;  2XNR A;  3GFY A;  4YME A;  2NSB A;  2RSQ A;  4DJB A;  4HH0 A;  5CYQ B;  4M95 A;  2WVC A;  1C4C A;  3PKY A;  4LF6 F;  3KNA A;  2GO9 A;  3HFK A;  3KKF A;  1D09 B;  2E9T A;  1ARO P;  1RCO B;  3CIM A;  2J9C A;  1NHU A;  3DC2 A;  2GO8 A;  3G82 B;  2QO3 A;  2R2U A;  4ZIW A;  1FHT A;  2JSX A;  2IRU A;  5K9F A;  2HNY B;  3RW7 A;  3J7Z 5;  5KT4 A;  2DCU B;  2VKZ G;  3N4W A;  2C28 A;  3BSO A;  4J9Q A;  4ELU A;  5J2Q B;  1YJT A;  2BE2 A;  4YY3 J;  1U8W A;  1FE0 A;  3W2W B;  4Z7C A;  3CC2 S;  2QFJ A;  1W25 A;  1QSS A;  2UP1 A;  2L9D A;  3BN4 A;  4IFY A;  2J6T A;  4C11 A;  2EC2 A;  1FJG F;  5DZ6 A;  4ZA1 A;  2B9W A;  2IBK A;  1N36 J;  4DDF A;  2C2E A;  4RBU A;  1NKC A;  4FYW B;  2RQC A;  1U8S A;  2PC6 A;  3MFH A;  2XQC A;  3GPA A;  1WC1 A;  3NLC A;  2DNL A;  3DOK A;  1HI1 A;  4M5G A;  2HFO A;  3BBB A;  2CRL A;  3UR3 C;  1IKV B;  1QUV A;  4R8U A;  3R8Y A;  1HWJ A;  4NCG B;  2IDL A;  3LAN A;  2G2O A;  4EUV A;  2ZOF A;  2XBP A;  3W65 A;  1FTC A;  2V4J A;  5CAA A;  1FEH A;  1X5S A;  4F0M A;  2WVB A;  4ZMM A;  2YKP A;  3BGU A;  2BKO A;  3SBM A;  3WX8 A;  2B8P A;  3DLE A;  2NPI A;  2UV8 A;  4OYA A;  2B9E A;  1VFJ A;  1Q5V A;  3BGR A;  3HM9 A;  4O3P A;  3CO9 A;  2VPX B;  3E8O A;  3PJW A;  3D9B A;  3MR5 A;  3HVT B;  1Y9O A;  3KHG A;  4GRS A;  3FKB A;  4JOU A;  3QLH A;  4GC6 A;  3T6B A;  4DL7 A;  1VQP S;  3LWL A;  2V34 A;  2X1B A;  1FES A;  5DGB A;  2ZZM A;  3CGI A;  4EO8 A;  4LQ3 A;  2BBE A;  5HSP A;  1MMD A;  1IR2 A;  1REV A;  5M2P A;  1UFL A;  4DX7 A;  3R5G A;  1G7C B;  3QRR A;  2V8H A;  5D0H A;  4ED6 A;  1RHQ B;  2DGV A;  3G6V A;  2HND A;  3WZ0 A;  1CLF A;  2XG8 A;  2F9J A;  2HGL A;  3NKY A;  1K0T A;  3GIK A;  2KU7 A;  3Q86 A;  1WEL A;  2LEB A;  3ZXW A;  1QM9 A;  1FDA A;  4OV1 A;  4KHP J;  4ZVR B;  3CJS A;  1D8Z A;  1Y3K A;  3WBZ A;  4EBD A;  4TLR A;  7AT1 B;  4AQY J;  3I4H X;  2DVI A;  1T3N A;  3TEG A;  3MEC B;  3BO2 A;  3LPE A;  4B3T F;  4ECT A;  2CPF A;  2DO4 A;  1PO6 A;  1RUS A;  1M1G A;  1PC5 A;  2VQE J;  4LRA A;  5E5N A;  2CYY A;  3BEG B;  1TP7 A;  4CTA B;  4U8Y A;  3EVM A;  3M8P B;  1ZAW A;  3TI0 A;  5HAT A;  2FY8 A;  4OZ0 A;  4DUZ F;  2MYF A;  2GQQ A;  1AZS B;  3EPI A;  2CZV C;  2GML A;  1U1K A;  3TQE A;  1CJK A;  3D1O A;  4X84 A;  1Y00 A;  2E5J A;  3I32 A;  1WG1 A;  4LSN B;  2W2O P;  2O1P A;  2J7K A;  1QTN B;  4UF4 A;  1JXE A;  1RIS A;  3DU5 A;  1Y3J A;  2BAN B;  2GCF A;  3CF5 Q;  2BJD A;  1BC6 A;  3TJA A;  4KBI A;  1SKR A;  1UVL A;  2YH1 A;  1GTH A;  4FYV B;  4LF9 J;  3VAK A;  5AXM A;  3UFC X;  2ATC B;  3DLK B;  5GME A;  5B0F A;  3VGU A;  1FRX A;  3MAA B;  2Q1L A;  2W9B B;  4K4S A;  3KTQ A;  4MIW A;  1RT4 B;  4CRJ A;  3OL6 A;  4K2X A;  2OEK A;  1IKY A;  2QA1 A;  4RL1 A;  3GJQ B;  1T11 A;  1YGY A;  2MKJ A;  2AZ1 A;  1RTH B;  1PBU A;  3EVW A;  2WON B;  2XTJ P;  2RAQ A;  2JVR A;  2LU2 A;  3NY0 A;  3K58 A;  5A8R B;  1NJW A;  2V63 A;  4KV8 B;  1HA1 A;  4OI3 A;  2MQP A;  4N8O A;  4J9V A;  5HQL A;  2Y0S D;  4AL6 A;  2E7W A;  3BGL A;  3IWX A;  2MHN A;  3ETO A;  1EP4 A;  2VG7 B;  2OUG A;  5J1N A;  2UVW A;  1NKB A;  5JVH Q;  3W5Z A;  1CVJ A;  3JSM B;  3I0R B;  2XSJ A;  1SQG A;  3FBB A;  5KT5 A;  1SC6 A;  3K5N A;  5H9E K;  1FRI A;  1D3W A;  1ZM4 A;  2VPW B;  5D3G B;  2EFV A;  3C16 B;  4DPW A;  2CQG A;  1F5A A;  2KXH A;  4KGZ B;  5AE2 A;  2HIQ A;  4WU2 A;  1Q1K A;  1R0A A;  4M8L A;  1C1B A;  1TVR A;  2X3G A;  1KTQ A;  1FVQ A;  1I6J A;  3M9N B;  1H2V Z;  2AW0 A;  2OPQ A;  2CVI A;  2ZE2 B;  1K0V A;  4MKV A;  2F40 A;  4QR0 A;  1VI7 A;  3C14 A;  5E3Q A;  1VQS A;  4DS4 A;  1WOP A;  2AJQ A;  1RT5 A;  3UR0 A;  3RW6 A;  3EGV A;  3AH6 A;  5HQM A;  1RT7 A;  5KG0 A;  4DS5 A;  3VCD A;  4B17 A;  2EK6 A;  2PD1 A;  1Q79 A;  3QRP A;  1MU2 A;  4MFB B;  2LFV A;  2P9G A;  2E9R X;  4WYW A;  3PJ9 A;  1KON A;  2IA6 A;  3ZTP A;  1FDN A;  2F3J A;  2ZDP A;  4YHH J;  1EAY C;  1F9H A;  3LA0 A;  2DGU A;  3CT9 A;  4CDI A;  1VBX A;  1S1U B;  3I96 A;  4M5M A;  2FHJ D;  3R2D J;  4LR8 A;  4TNO A;  5KFL A;  4ZS6 A;  2AEM A;  1TFY A;  4LBP A;  2FJA B;  4DR1 J;  2EKY A;  2E29 A;  3RRG A;  1RAG B;  1XNQ J;  3MMC A;  3E2E A;  4KHM A;  5GMD A;  1FDB A;  5D0E A;  4OYP A;  1EZZ B;  1UA1 A;  3HVA A;  5CYQ A;  1AFI A;  4LF5 F;  2NZ4 A;  1U48 A;  1HNW F;  1XNR F;  3MM8 A;  5KG1 A;  4XK8 C;  3MPU B;  4YS2 A;  4F4Y A;  4Q2M A;  1U6B A;  4W4M A;  4DR2 J;  3G82 A;  2YX4 A;  4ECQ A;  4LF8 J;  2HNY A;  1H2T Z;  2JH3 A;  2VHG A;  2PFD A;  2G0J A;  3W2W A;  1S6Q B;  3D1H A;  2HNZ B;  4ZVO B;  1Q8B A;  3IGN A;  2VB6 A;  2RF2 B;  2V4R A;  3QYY A;  2CFX A;  3N79 A;  2XI2 A;  4RX6 A;  3SV4 A;  3NGD A;  1LW0 B;  4DV2 F;  2CJX B;  3KDN A;  4Y2M A;  4K0K F;  1WUU A;  2PGC A;  2XWX A;  4E98 A;  3ZNU A;  1RT3 A;  4Y65 A;  1IKV A;  2CQI A;  2CG4 A;  4ZKA A;  5BYR A;  4YQW A;  2YNF A;  4AYB D;  3CJR A;  2UXC J;  1GEH A;  3PHE A;  2FHO B;  4G1Q A;  3PW0 A;  3AA8 A;  4KIA A;  1WSV A;  4L74 A;  2VBW A;  1Y4Z B;  1L3U A;  2HQC A;  4QCL A;  4LF1 A;  1T05 A;  3HVR A;  3HVT A;  1QVG R;  1GMW D;  1VIX A;  1JLQ B;  4AFF A;  2G9O A;  3Q2S C;  1Z2L A;  1KOH A;  3AJ2 A;  1ZET A;  1RWO B;  2ZJQ Q;  1HYS B;  1S76 D;  4MIB A;  3CC7 S;  4JI1 F;  5GAH I;  2AZ3 A;  3GSD A;  4ED1 A;  4NCB A;  4DV7 F;  1NSA A;  3AY0 A;  3V4I A;  1NXI A;  1T03 B;  2YQ0 A;  1B70 B;  2J8A A;  2EFO A;  2KFN A;  3I55 S;  2YNI B;  1N8R T;  2UUB F;  2XMW A;  1LWF B;  4RBT A;  4ZLJ A;  1X9W A;  1T7P A;  3RBD A;  1SQF A;  2RQ4 A;  1H7W A;  3LF0 A;  4CH1 A;  1F9F A;  2HVE A;  2Q66 A;  1FFW B;  4E8U A;  3PIO Q;  3B6B A;  1VOM A;  1CBK A;  3BB5 A;  3RAX A;  2OFH X;  4MTP A;  3UDC A;  4CTA A;  2OI2 A;  2HHH F;  3TP2 A;  3GV7 B;  2V6A A;  1AB8 A;  1AZS A;  1S4E A;  1H73 A;  2GJ2 A;  5B0D A;  2AYG A;  3MTJ A;  3VR1 A;  3MCM A;  1OSD A;  2W4D A;  2N3L A;  2CPZ A;  5KG4 A;  3TEH B;  4O4G B;  4EFA C;  5DG8 A;  3TZW A;  4LSN A;  2HK2 A;  4MJK A;  3BBC A;  2KN4 A;  2G4B A;  2RVJ A;  3AOC A;  5KG7 A;  2DIS A;  4UZC A;  1KBR A;  2CQD A;  3KJN B;  2VOP A;  3HHN B;  2A18 A;  4CO4 A;  4USW A;  2MZR A;  2VA3 A;  1A7G E;  1RZM A;  3MAA A;  3E3X A;  5IWA F;  2W9B A;  1NDP A;  1RT4 A;  2HSE B;  2ZOG A;  3TRG A;  1U1R A;  2ZH8 A;  2ERR A;  3KUG A;  4DSF A;  1N36 F;  3MR7 A;  3QNW B;  1TMM A;  1S6O A;  2N82 B;  2XCA A;  4FF4 A;  4DN0 A;  2IJR A;  1RTH A;  4NMX A;  2BE9 B;  4OJ1 A;  2VBX A;  2WON A;  1NZA A;  2OEJ A;  3IA0 A;  4U7U D;  1W2B R;  2DHS A;  2RU3 A;  3QMQ A;  1M5O C;  4LFA J;  3TA0 A;  3H8Y A;  3G6Y A;  2MJN A;  4KV8 A;  1BUX A;  3BF4 A;  3KLE B;  1S59 A;  2HBR B;  4KPY A;  1TUW A;  1YRT A;  1JLB B;  2QYC A;  1TQL A;  3ONQ A;  4NRU A;  2DPI A;  2IIH A;  4XO0 A;  2W7P A;  1KQK A;  5MLC V;  1SH2 A;  3JSM A;  4CO1 A;  1X4H A;  3K89 A;  2XCP A;  4OJH A;  2C1E B;  2CZ4 A;  1V6H A;  1JXL A;  5FDL B;  1S6P B;  4U95 A;  4DZ6 A;  5D3G A;  3C16 A;  1BMQ B;  3CWJ A;  3JQM A;  2ZBC A;  2HGM A;  2W9C B;  4PZV A;  2C3U A;  3QO9 B;  5HRO B;  4I6Y A;  3OR2 B;  1HNV B;  1VQO S;  3OT9 A;  3K8V A;  3W61 A;  1X0P A;  2JX2 A;  2LEA A;  2W4C A;  1PC4 A;  2N7Y A;  4Y2C A;  1IQT A;  4J9N A;  2ZE2 A;  2GJI A;  1UFW A;  2M3D A;  3M2U B;  2V2V A;  5B0G A;  2B7C B;  4RNF A;  2RIJ A;  1NHK L;  4W98 A;  2PT0 A;  2UV8 G;  1X9M A;  1UPM B;  4KHP F;  4N41 A;  1CJV A;  1NU4 A;  2AMC B;  2XHW A;  1N48 A;  4MFB A;  2GZO A;  3AA9 A;  3IFE A;  3HXM A;  2L48 A;  4AQY F;  4GVL A;  4C0B A;  3ICL A;  3GV5 B;  2VQE F;  1S1U A;  4DQP A;  2SXL A;  2AHO B;  4WF9 Q;  2JLG A;  4J37 A;  4RO0 A;  1FNX H;  1FI4 A;  2ZNZ A;  4EO6 A;  3UO0 A;  3KJF B;  2QG9 B;  2D9O A;  4DUT A;  1XER A;  4PG4 A;  1IKX A;  2NPF A;  3N5F A;  3M8W A;  1XEZ A;  4XPC A;  1RLC L;  5CHC B;  1T9W A;  5DM6 Q;  2GMJ A;  1X5O A;  3CJK B;  1ZPW X;  2MJU A;  4LF9 F;  2NXC A;  4L3K A;  2R2R A;  1AUS L;  1OQ6 A;  2R7R A;  2MQQ A;  3PKM A;  1MG7 A;  3TUJ C;  1TKZ B;  2UZA A;  3HDS A;  4Q44 A;  3ULH A;  2ZKT A;  1KDN A;  2QFI A;  1V3Z A;  4HTJ A;  3BS9 A;  3L4B C;  3F0N A;  4H4K C;  1S48 A;  1VQL S;  1F60 B;  1S6Q A;  1M5V C;  3N6L A;  1S49 A;  3QAU A;  1C1C B;  5HBM B;  2RF2 A;  2MKH A;  3GWC A;  3R1H A;  3P96 A;  1KHW A;  4ED2 A;  4WK1 A;  2P8I A;  3MEE B;  4UST A;  2BJ7 A;  1HKA A;  1LW0 A;  3BGO P;  1QTM A;  2LEC A;  4N7T A;  4X4Q A;  1HNZ J;  3H42 A;  4CLT A;  4K7Q A;  1EET B;  4ZLN A;  2RE1 A;  4CLK A;  2HZA A;  2DTJ A;  4QW8 A;  2EW9 A;  3JB9 k;  3H7H B;  4C7Q A;  3AOA A;  2OD4 A;  1XMQ J;  4I2P A;  2QE5 A;  3Q8V A;  4KFB B;  4JI7 J;  4NLV A;  4MIA A;  2ZVI A;  3AOD A;  3M6X A;  1UW4 A;  4NZ0 A;  4FP9 A;  4LF4 J;  3I9Z A;  5L1L A;  2YH0 A;  2CWX A;  2XI3 A;  5IFM A;  2APO A;  2HQG A;  3OL9 A;  3ZTS A;  1JNZ B;  5IC4 B;  3IRW P;  5DGA A;  2LVW A;  1SJQ A;  1OS5 A;  3HJF A;  1S7H A;  1K1S A;  3PYG A;  1TK0 A;  3MEG B;  3POT B;  1WDD A;  4RU9 A;  3SFU A;  2JZ5 A;  4CIO A;  4OYO A;  1BWE A;  3PIP Q;  4DPX A;  5C2C A;  5DQG A;  3I5A A;  1T03 A;  1Q5Y A;  1KWM A;  3Q8R B;  2YNI A;  4DV4 J;  2MZ1 A;  4YHH F;  1LWF A;  1PIE A;  4ZVU B;  1SB6 A;  4U96 A;  2DH9 A;  1HI0 P;  3T41 A;  5LMU J;  5JUM A;  1NND A;  3FEX B;  4USM A;  2AIR B;  1KVI A;  1XNQ F;  3OSP A;  2M7S A;  4LR9 A;  1JK9 B;  2EFQ A;  1NDL A;  5KFR A;  4JI0 J;  2H1Y A;  4O4G A;  3BKF A;  3G71 S;  5E7O B;  3Q2T C;  1U1Q A;  4TVA B;  1KEK A;  1QAI A;  1QJH A;  2QZ8 A;  2CQH A;  5IM0 B;  1BD6 A;  3I5C A;  3D2W A;  4LF8 F;  4CLP A;  1WOS A;  2CPD A;  3UWT A;  5M2U A;  2R7V A;  5D78 A;  1BWV A;  4F8R A;  1N5V A;  2RUG A;  1DAX A;  4NYZ A;  2ZJP Q;  4QIF A;  5DS7 A;  3CC4 S;  5HLF B;  2HAI A;  2WB4 A;  3DU6 A;  1DAR A;  5KOX A;  4KGV B;  3MMB B;  1KD1 T;  2ZHA A;  3QIP B;  2DHA A;  2VON A;  3KMQ A;  1UKU A;  3E01 B;  4WFB Q;  5KFZ A;  4RUB A;  4XDD A;  1UWA A;  2VC0 A;  4ED7 A;  2NXN A;  1JMT A;  4QWC A;  3DXS X;  3EDR B;  2OAU A;  2ZC3 A;  2KTQ A;  4X4T A;  4R0J A;  2DYA A;  1K47 A;  3D6F B;  3GR0 A;  2VJU A;  2UXC F;  1JLB A;  1N34 J;  3ILO A;  3DRY A;  4JUZ A;  2J0W A;  4FPR A;  1JIH A;  4O44 B;  1D1U A;  4Z7Y A;  4RWW A;  3OL7 A;  2MLX A;  1LOU A;  4J9K A;  3R5J B;  3I4P A;  4I6A A;  1OIA A;  5A6P A;  2ZWP A;  3PO5 A;  1JLE A;  1KSP A;  2CWK A;  2LLZ A;  1S6P A;  2HG4 A;  3PAC A;  4DR5 J;  4X4O A;  3AQP A;  4CLU A;  3LQV A;  2OD6 A;  1RHR B;  2BZ2 A;  3PHT A;  4OZ2 A;  2W9C A;  3HLU A;  1MN9 A;  2FD2 A;  5HRO A;  1I5O B;  4NA1 A;  1HNV A;  2LCW A;  3GZ7 A;  4KGK A;  1HWL A;  2Y1R I;  2BQ3 A;  4USH A;  1MNE A;  3EDQ B;  2KXN B;  3BR9 A;  4OX8 A;  3EZU A;  3M2U A;  2OSR A;  2WVD A;  3J7Y U;  4OZ5 A;  1RU1 A;  3UI3 A;  2L41 A;  2F4V J;  2L9W A;  2DY1 A;  4LSZ B;  1IWA A;  4NXN J;  1PIL A;  4YB1 P;  4FBU A;  2G1H A;  2YPY A;  3R1L A;  1S0M A;  2HZV A;  3S8S A;  4PAA A;  4V1A k;  1APS A;  3GIM A;  4H4K A;  4OV6 A;  2VV5 A;  2QJ3 A;  1HBM B;  1PJ7 A;  3GJR B;  1ZS6 A;  2OPS B;  1KTV A;  1B7Y B;  5LMN J;  3I82 A;  4C98 A;  4TY8 A;  3D6T B;  2HVZ A;  4F3M A;  1SIW B;  2IC3 B;  2EVZ A;  1DQ9 A;  4OI2 A;  5J2N A;  4JI4 J;  2M4M A;  3SSQ A;  1XJW B;  3P4U B;  5L8R C;  2LQ5 A;  1U1P A;  2MLY A;  4B9V A;  4TY9 A;  2KJW A;  1Y5L B;  3OXF A;  1VRT B;  2ZHO A;  4UT4 A;  4OZ1 A;  3QFH A;  3CJK A;  2DNN A;  1RHU B;  5J1P A;  4WTO B;  5A8W B;  4DLG A;  5F8H A;  4E0D A;  1TKZ A;  1NK9 A;  1DTT B;  1EKR A;  2JLE A;  5SZT A;  3QGI A;  2NS1 B;  4RW7 B;  4LIR A;  3DRX A;  4MMO A;  1RT1 B;  2GA7 A;  2DIU A;  2KKH A;  3DMJ A;  2E5H A;  1UZD A;  3NCR A;  2HKE A;  2D69 A;  1C1C A;  5HBM A;  3AXK A;  4I1T A;  4WTY A;  3ET6 B;  3BV8 A;  4L73 A;  2C42 A;  1IR0 A;  1K1Q A;  3D68 A;  3MEE A;  4LFA F;  2I5J B;  3K0J A;  3R7S B;  3Q8U A;  3CJ2 A;  3LGM A;  1S9G B;  1SJ1 A;  4L6V 3;  3G8S A;  2H48 B;  1RAI B;  3BSA A;  3NGR A;  1EET A;  2NYH A;  2YNH B;  3M32 B;  2ZBR A;  4LR7 A;  3DYA B;  3QWP A;  5A2Q Y;  3SQO P;  1X31 C;  3NS5 A;  4FNH A;  2JFD A;  3CCZ A;  4BWJ A;  4R5P A;  3UD5 A;  2HUR A;  2OPR B;  1KQS R;  4WFY A;  1RTJ B;  2RML A;  5DDP C;  1Q0N A;  4KFB A;  3GE9 A;  4DV5 J;  2YKA A;  4QQB A;  3E51 A;  4OJ3 A;  1DTQ B;  4ID8 A;  4DUY J;  2NSC A;  4RNO A;  1IBK F;  1M5K C;  2NR0 A;  1N5S A;  1LFP A;  3HCX A;  3UN3 A;  4ZHR A;  3IN5 A;  5L1J A;  4HT5 A;  2RDJ A;  1NM2 A;  4R0E A;  2HPU A;  3OLB A;  4N47 A;  1MML A;  2DGX A;  1JLC B;  2AX0 A;  3G8Q A;  2FZK B;  2HEK A;  4OYM A;  5HQ8 A;  1YTY A;  1C0U B;  2CNL B;  1T9Y A;  3MEG A;  3POT A;  1T02 A;  1L5U A;  1QAY A;  3CNQ P;  4CLS A;  2V69 A;  3C6U B;  2OFG X;  2DKO B;  2WSF C;  2O67 A;  2EWH A;  3CDW A;  5DDO C;  4LVN P;  3CJ5 A;  3OSN A;  1NLK L;  4ZVG A;  1TUV A;  4BCA A;  4O3Q A;  1VQ6 S;  3C6T B;  1VQ5 S;  1L3V A;  2E1C A;  2JC0 A;  4P2S A;  5IS2 A;  3W8P A;  3NXZ A;  2FJE B;  4B9M A;  1HPZ B;  3OW2 R;  3CCQ S;  1TKX A;  3AOB A;  2A6M A;  1Y5N B;  4F02 A;  3G8T A;  2Y1I A;  2C2O B;  1X9S A;  1R0C B;  3H2L A;  4YUD A;  1FF2 A;  3ENW A;  1H2U X;  5DDQ C;  5ETM A;  4JV2 A;  2IY5 B;  5KFP A;  3TNV A;  2MQN A;  4B02 A;  2R7S A;  4OX6 A;  2K1R B;  5IM0 A;  4B9L A;  2X1F A;  3RRH A;  2NLW A;  2BJ9 A;  2EFG A;  2MKS A;  1EB0 A;  4DEZ A;  3OFF A;  4ES1 A;  1RDR A;  3P5T L;  1G2E A;  2LYV A;  5I42 B;  3DLH A;  4ANE A;  3G6X A;  1S0V A;  5HLF A;  2YWH A;  4M5N A;  1NJX A;  2Z2L A;  4DL6 A;  3M8Q A;  4KYZ A;  2XY6 A;  3K59 A;  2ZVS A;  3QIP A;  3E01 A;  4QW9 A;  1T8E A;  2ROE A;  3BYP A;  4EBC A;  3NNH A;  4AXI A;  4C8Y A;  2AU0 A;  5F8L A;  1RA6 A;  1HNZ F;  1IKW B;  2XGQ A;  2ACM A;  2FLP A;  3TAQ A;  4UOH A;  1ZBT A;  1FFG B;  3OTO J;  4ES3 A;  2GIF A;  4LRC A;  1I51 B;  2D9P A;  3GG1 A;  3N6N A;  1NZ8 A;  4F04 B;  3KK3 B;  2RS2 A;  4TU8 A;  4IQM A;  4QIE A;  1U1M A;  2IVM A;  3KDO A;  3O8W A;  4ER8 A;  4ZDN A;  4LF4 F;  5F0U A;  4ILR A;  3UVJ B;  3ITH A;  4U9R A;  1YZ7 A;  1VQY A;  4M5I A;  1FD8 A;  2OLW A;  1N6Q B;  2CDQ A;  5CYM B;  3TUZ C;  2KZM A;  4DSL A;  1XMO F;  4ZP9 A;  3FCV A;  4FZV A;  4PEO A;  4OFZ A;  2K8G A;  5E2Q A;  4KAI A;  1S72 S;  5KG2 A;  1KS2 A;  3MPW A;  4QYZ J;  2XLJ A;  3HP6 A;  4I0W A;  3HHK A;  2DR5 A;  3M2V B;  3NOG A;  5F3Z A;  2O3D A;  2XO6 A;  4HR2 A;  5LMU F;  3KLH B;  4DV3 J;  2QMX A;  1HBM A;  3CD0 A;  5GAD I;  2BKN A;  4CLL A;  2IVY A;  3CJ4 A;  2QSW A;  2CUY A;  3NNA A;  2IRY A;  3GFH A;  3BO4 A;  1QLN A;  5ETK A;  2IC3 A;  3GCX P;  5KFD A;  4JB8 B;  3DHX A;  1MRO B;  5ETQ A;  2CIM A;  4TLQ A;  4A8X A;  2C22 A;  2HIY A;  2B6A B;  4K59 A;  3VQS A;  1BQM B;  1PYS B;  1GNK A;  2CKW A;  1BHN A;  1VRT A;  1J2V A;  1LXN A;  4X4S A;  2XMJ A;  3GTY X;  3W9H A;  1Q7L B;  1HD1 A;  2QSF A;  3QBC A;  3W9J A;  1R27 B;  1X7V A;  4KH0 B;  1M1K T;  4B3T J;  3EGZ A;  4RUA A;  1KNZ A;  1DTT A;  1XR6 A;  3D6H B;  2UU9 J;  5DZ7 A;  3A8E A;  3DLG B;  4JI2 J;  1RTI B;  4WKY A;  4RW7 A;  5D4O A;  4ILM A;  1RT1 A;  4YR0 A;  5A6W A;  2RT3 A;  1T95 A;  2XUL A;  3R2C J;  5HK4 A;  3MI7 X;  2DGQ A;  1U2R A;  2KXF A;  4RKU C;  3DI6 B;  3EGW B;  3MPD A;  3JAM Y;  1VHI A;  2W2M P;  3SCJ E;  4A8M P;  3GU0 A;  3ET6 A;  3CMA S;  1YLX A;  3EVO A;  1FK9 B;  2YX1 A;  3HI9 A;  2I5J A;  1OY8 A;  1S79 A;  2XMT A;  3CJ8 A;  4B3M J;  4RLE A;  1WI8 A;  2PMH A;  1BE4 A;  3NP5 A;  4ECY A;  1AYE A;  2B4U A;  4I7F B;  1BGX T;  2KM8 C;  3A8K A;  3AB4 B;  5E3C A;  3M32 A;  2GGP B;  2C3M A;  1RYS A;  3DYA A;  4QBU A;  1MSW D;  4G6V B;  4ALZ A;  5L9N A;  3CUN A;  4RW6 B;  3JXO A;  2OPR A;  4WXW A;  1ROF A;  2LQ8 A;  3HVW A;  2Z57 B;  1RTJ A;  1FX2 A;  2MY7 A;  3CCM S;  3KK2 B;  4RNH A;  5F9L A;  4KC5 A;  1DTQ A;  1OYD A;  4LRF A;  3PFO A;  2AJ0 A;  1SIZ A;  5DJB A;  1B99 A;  1S1V B;  5K8P A;  2QTW A;  2E9Z A;  2XMA A;  2FB0 A;  2IRX A;  2DXD A;  2YNG B;  5HN0 A;  5D77 A;  3BBF A;  1E6V A;  4WP8 A;  1JLC A;  2J0Q D;  1SC1 B;  4S0M A;  5B08 A;  1UEK A;  3CD6 S;  1CJT A;  1ZA1 B;  4X66 F;  1Q16 B;  5CH7 B;  5D4N A;  4NML A;  5HMZ A;  2NQP A;  3FQL A;  1M1H A;  4PG6 A;  1U1O A;  2F4V F;  1E6Y B;  1C0U A;  2MXY A;  4EEY A;  1XTZ A;  3NCQ A;  5ETP A;  2XM3 A;  1UVK A;  4G1P A;  2HGN A;  4ZPA A;  3V6H A;  3KG1 A;  4IH7 A;  2Y8Y A;  4ECZ A;  5GAE U;  3JTP A;  3C6U A;  1RHM B;  4PUO B;  2DR8 A;  5KT6 A;  1HD0 A;  3M8S A;  1YBU A;  3RR8 A;  3PEH A;  2HVD A;  2D3O R;  1U26 A;  4ZPC A;  5LMN F;  2Z4P A;  1LFW A;  4QR1 A;  3Q8P B;  4PXB A;  3C6T A;  1IVZ A;  3A13 A;  5BXI A;  3VAG A;  2RKI B;  3VAM A;  2FGO A;  1B3T A;  1HPZ A;  2FVS A;  2G13 A;  1IBM J;  1BQX A;  3IMQ J;  1VRQ C;  3LPY A;  5CCM A;  2DGS A;  2BM1 A;  1KHV A;  3U1N A;  1S57 A;  1VK8 A;  3LWM A;  4AL5 A;  3NRB A;  2YWW A;  4AD6 A;  1CC8 A;  3R97 A;  2LQ9 A;  4O0N A;  1LWE A;  2AJF E;  2BRK A;  1C0T B;  3MTK A;  5JMN A;  4J9M A;  3FNN A;  8RUC A;  3ZO7 A;  2VAS A;  3WDO A;  2K1R A;  5DQH A;  1H6K X;  3HKZ D;  5FD1 A;  5A2Q U;  2P2C B;  2M0G B;  3A3O B;  1HBO A;  1PCA A;  1F9E B;  1KQG B;  2KH9 A;  2RD5 C;  2CJK A;  1TL5 A;  2M88 A;  2RQM A;  2HWT A;  3FEZ A;  1FXL A;  3MWB A;  3PRV A;  4JV0 A;  4NYP A;  5IOL A;  1IBC B;  4DR3 J;  2EI5 A;  2E5L J;  3U02 A;  1GH8 A;  3M05 A;  1S9F A;  4IOC Q;  2GAH C;  3VAI A;  4DV6 F;  1GFW B;  1B64 A;  4U7C A;  1TL7 B;  4ETZ A;  3G4S S;  4C8O A;  4RZR A;  4AND A;  3AHP A;  1JJC B;  4E2F B;  3FSI A;  1IKW A;  1D9F A;  3SEO A;  1RAC B;  2F8H A;  2J5A A;  3VAL A;  4OX9 F;  4FDF A;  3QZ8 A;  5B0C A;  3IWN C;  4UW2 A;  3WC0 A;  1UMJ A;  1K44 A;  1WF2 A;  2WZ1 A;  2Z2Y B;  2IFX A;  4DPO A;  2OHD A;  2W8K A;  2R2T A;  1HBN B;  2VD3 A;  2ZH4 A;  3N28 A;  4HEA 9;  4DV5 F;  1VS3 A;  1QE1 A;  3RZA A;  2DCL A;  4I64 A;  2PA3 A;  5J2M B;  1JKH B;  4O23 A;  1U09 A;  4DUY F;  3G87 A;  1RAE B;  2M52 A;  5L38 A;  3MM5 B;  4C8Z A;  1U47 A;  5J2P B;  1JLA A;  4RW9 B;  5KFM A;  4PWU A;  5KFV A;  1HLW A;  3UVJ A;  2VH7 A;  2E1A A;  3UW1 A;  1SXL A;  1U24 A;  3OUY B;  4DV2 J;  1F5B A;  5CXT A;  2EG2 A;  4K0K J;  3O2I A;  5EN1 A;  1Y0H A;  1KRP A;  2DO0 A;  1NK4 A;  2CNN B;  2E44 A;  1N6Q A;  4CO5 A;  1UVN A;  1BXN A;  2M2B A;  1V5I B;  5CYM A;  3X1L B;  3FFI A;  2DR9 A;  2R7Q A;  2NRE A;  3OR1 B;  2DXF A;  1Q82 T;  2RDD A;  3BM7 A;  1VJW A;  4F4W A;  4LIW A;  7FDR A;  2ZFH A;  2KRB A;  4UUW A;  1A6L A;  3MHY A;  2KO1 A;  3BJY A;  4Q2L A;  5HMX A;  1JLF B;  2OSQ A;  3LP2 B;  4ECS A;  1K9M T;  1XR7 A;  1N52 B;  2YBV A;  3M2V A;  3NMA A;  3I56 S;  4DWI A;  4TQR A;  3UCG A;  3RBE A;  1TKD A;  3IRX B;  3J7A N;  3CXC R;  5I3Q A;  4LRE A;  2Y0B B;  1R6V A;  1ZTW A;  3QGP A;  4LJM A;  2A1B A;  1ZZN A;  2YWF A;  2AF6 A;  2WSE C;  1MRO A;  5C42 B;  1X4B A;  2V9W A;  5LSO A;  3HSZ A;  4DV7 J;  4DHV A;  1F3V A;  3VGS A;  4U67 Q;  5GMK a;  2WTF A;  3PW7 A;  2B6A A;  4RWX A;  1BQM A;  4ECR A;  1N32 J;  3M9O B;  1JJ2 R;  4I69 A;  2ALY B;  1WTF A;  1SC4 B;  5LXY A;  4C4W A;  4WZQ A;  4ANC A;  3BPS P;  4FF1 A;  1CJU B;  2JEI A;  5BJR A;  1YIJ S;  3UNY A;  4P7T A;  2MZQ A;  4LRD A;  1S5Z A;  1RLD A;  3NOC A;  5KG3 A;  4OHV A;  3P8B B;  2DPJ A;  2EKN A;  1R8A A;  2HK3 A;  4B9T A;  4ZPW R;  1NB2 A;  1VRU A;  1NBE B;  1YWX A;  2Y8W A;  1M0S A;  2CPJ A;  4KGM A;  3DLG A;  3QAE A;  4DCP B;  2HHH J;  4B3O B;  1NB7 A;  1RTI A;  4KQZ A;  2A0F B;  1CEZ A;  3CW2 C;  3H4D A;  4JI8 F;  2J0S D;  2H54 B;  3W62 A;  3NAH A;  4P10 A;  1VIO A;  3A8J A;  3DI6 A;  2W01 A;  3OXL A;  1RBA A;  5RUB A;  4Y2I A;  3ZZ0 A;  4KT0 C;  3R5C A;  3K17 A;  4B3S J;  2KZZ A;  2FVQ A;  1TEL A;  4NCA A;  2QMW A;  1FK9 A;  2XMK A;  1Z1Z A;  2X7I A;  3OTO F;  1TL3 B;  5KFY A;  2BRL A;  2J9D E;  3R6L B;  4I7F A;  1ZPV A;  4ZCM A;  4NA3 A;  1KVJ A;  1YVF A;  3RB0 A;  2GGP A;  2BX6 A;  3DRS A;  5IWA J;  2CXE A;  1DY3 A;  1QSY A;  4RW6 A;  1RA7 A;  2M8H A;  1RWM B;  1WF0 A;  5K14 B;  1L3T A;  1NK7 A;  2B5J A;  5AXN A;  3KK2 A;  5EDW A;  5A8K A;  4Y28 C;  4WXO A;  1N5Y B;  2G0C A;  3PJX A;  2N4C A;  3M8R A;  1S1V A;  2R8K A;  1R8H A;  2YNG A;  3AJD A;  4LQ9 A;  3KG4 A;  4NLS A;  3NG8 A;  2JJ4 D;  1NEE A;  3C66 A;  3GQC A;  4A46 A;  6FD1 A;  3NAI A;  2B4P A;  1BY9 A;  2Q79 A;  4DR4 J;  5LJ3 Y;  2DB1 A;  3RRK A;  1EKS A;  2DR6 A;  1D8Y A;  2LDY A;  2YWG A;  2ILZ A;  3I0S A;  1QAJ A;  1VCT A;  1GT8 A;  2DNH A;  4PUO A;  3MCN A;  3M2R B;  3BQ1 A;  4P52 A;  4DV3 F;  2QLX A;  4C0O C;  3JTN A;  1EQ0 A;  3DFE A;  4CO3 A;  4DQQ A;  1T9U A;  2HBZ B;  2WCX A;  3M8Z A;  1X5T A;  1S97 A;  1D9A A;  4OIX A;  2V0N A;  2ZZN A;  4DF4 A;  2RKI A;  2DRB A;  2BEF A;  1H0H B;  5EWG A;  1HFE L;  1PAU B;  1UP1 A;  5CAB A;  5BYQ A;  4QIW D;  2UXB J;  3WX4 A;  3JAM U;  1T3O A;  4I2Q B;  2CQC A;  5DLF A;  3LOU A;  2ADC A;  3A1Y G;  5KFQ A;  5EGY A;  1S9E A;  2MEW A;  1I3O B;  1C0T A;  3I87 A;  4M5D B;  2E1P A;  5KOW A;  3PV8 A;  5GAG U;  2PEB A;  4FKY A;  4A8W A;  1UAW A;  4HDH A;  1NSQ A;  5ETL A;  1ITP A;  4MK9 A;  3W3S A;  2FHK A;  4GVB B;  3J81 Y;  5HI7 A;  2UU9 F;  4Q7A A;  3VGT A;  2JHE A;  4ICL B;  4JI2 F;  3CCV S;  2K7J A;  2WOM B;  2KG0 A;  2QLJ B;  2AEJ A;  3CCT A;  2DT9 A;  4M5J A;  2DNG A;  4IYQ A;  3MR3 A;  1PG5 B;  3QAT A;  1JLG B;  3PRD A;  5THW A;  4P2X A;  2YPZ A;  4O3S A;  4NLX A;  4HHJ A;  4N77 A;  3NGK A;  3KHL A;  5L1K A;  3UN2 A;  2P9E A;  1S4F A;  1P1L A;  4JI6 F;  4ZVT B;  4B3M F;  1WAC A;  1TL7 A;  1UET A;  3BRE A;  2B56 A;  3N0V A;  1U0H B;  2JEJ A;  3F73 A;  2AEF A;  4PPD A;  1OYE A;  3CO0 P;  2HFS A;  4OJG A;  4K5S A;  5HAO A;  3P45 B;  5KFG A;  4OLP A;  2V2K A;  5KFH A;  1RTD B;  2CA9 A;  4ZCK A;  4F2S A;  2DEI A;  2AKW B;  3EGN A;  4WFX A;  1LW2 B;  1YIT S;  1YDL A;  1HBN A;  3V4M A;  2Y1L B;  5L9X A;  3MM7 B;  4OHZ A;  5J2M A;  2OO4 A;  1JKH A;  1U25 A;  4JV5 F;  4CLW A;  5C24 A;  4XAK A;  4FYY B;  2KJV A;  3MM5 A;  3QGH A;  1SI9 A;  2V9K A;  5J2P A;  5AJ3 J;  4WCE Q;  1H7X A;  2ASY A;  5T7L B;  2GVZ B;  4CM0 A;  4CLZ A;  3TVZ A;  2DGW A;  3DOM B;  3OUY A;  2HS4 A;  4HH1 A;  1W26 A;  5HO4 A;  3CDB A;  1SH0 A;  2XS2 A;  3MM9 A;  1UJ6 A;  2HHP A;  3DRP B;  2H5J B;  3OR1 A;  3D0G E;  1KC8 T;  5G4D A;  5SUH A;  3N9U C;  2MB0 B;  1TAU A;  2DHH A;  2C2Z B;  2JEF A;  4F0K A;  4ZJQ A;  2HBY B;  2MPU A;  1RBL A;  5DG9 A;  1JLF A;  4XTT A;  3ZNJ 1;  2NUU G;  3LP2 A;  1HQU A;  2K3K A;  2XLK A;  4USJ C;  2DHX A;  1CS4 B;  2I8E A;  2HMI B;  3WIU A;  1LQ9 A;  4ELT A;  1UWB B;  1FRL A;  4ZPT R;  3UE2 A;  2M70 A;  5KG6 A;  3PX4 A;  4GKJ F;  1Z2Z A;  3D1Q A;  2VFS A;  1DBD A;  5DO2 A;  4DR7 J;  4OHY A;  2P5V A;  3H0P A;  2KL8 A;  5AT1 B;  1IBM F;  4NLT A;  3PW5 A;  4IG3 A;  5HJY A;  3TA2 A;  1TFW A;  3TJ9 A;  2IJN A;  4ETX A;  2QLB B;  2J7W A;  2B7B B;  3RU0 A;  3GV8 B;  2K3I A;  3O1L A;  2D41 A;  3D7S B;  3Q22 A;  1Y10 A;  4I68 A;  1ZA2 B;  1X4C A;  1Q86 T;  4F36 A;  3EZO A;  3Q0A A;  4DSE A;  4C0H A;  1HQE B;  3QJJ A;  3DM2 B;  4WFA Q;  1KN6 A;  4LSL B;  1EX8 A;  4ZN3 A;  4JV1 A;  4CZC A;  4M63 A;  1SJ3 P;  3BDE A;  5KFO A;  2EEY A;  3ILL A;  5I3U B;  1UZH A;  4NLO A;  3MPV A;  3R6G B;  4B3O A;  3Q8S B;  4UUX A;  4C8L A;  2MZS A;  4DR3 F;  1PJ6 A;  2E5L F;  1NH8 A;  2W1B A;  3C2P A;  3NL0 A;  2MGZ B;  5M2R A;  4BS2 A;  2GAG C;  2W25 A;  2QT7 A;  2KB2 A;  2IHR 1;  2DRA A;  3FJ2 A;  4CI0 B;  3AD9 C;  3TA1 A;  3N01 A;  2ZNY A;  3PR4 A;  3HO1 A;  1X0F A;  1XC9 A;  3LTO A;  3UDV A;  1TL3 A;  2OMO A;  2U1A A;  1U6F A;  2E1R A;  4KKO B;  4RBV A;  3VAJ A;  2YX7 A;  1FWK A;  2FHM A;  5B0E A;  5J2Q A;  2H4W B;  5G0R B;  5DDR C;  4BC7 A;  4WFN Q;  1X8D A;  3HKW A;  2C3O A;  2XY7 A;  4X4P A;  1X4A A;  2FPH X;  1TKT B;  4ZK7 M;  2MKC A;  2V8D A;  1PYT A;  1MWZ A;  4Q8F A;  1N5Y A;  4K4U A;  4FBT A;  1X4G A;  5KFW A;  1CQN A;  1IUJ A;  1NH7 A;  5B09 A;  5EWE A;  4Y6I A;  2AGP A;  3ETM A;  4DPY A;  3ISN D;  5KFK A;  4GMK A;  2X1A A;  4TYA A;  4NZ7 A;  2YQ3 A;  4NCG A;  4WPA A;  3H40 A;  5IV4 A;  4PAB A;  1N4L A;  1QVF R;  2CJQ A;  2FYX A;  4C3K A;  1LK7 A;  5GAH U;  2HLT A;  3KUE A;  3HJV A;  2AP6 A;  4USU A;  4ZOS A;  2AJ1 A;  3DLE B;  1R0B G;  2HHS A;  3RUB L;  4EWT A;  4LBI A;  2DNM A;  3ZZR A;  3BGR B;  3W5Y A;  2GX8 A;  5F3T A;  4TQS A;  3M2R A;  1ULR A;  1N56 A;  3R9L A;  2GNK A;  1YJN S;  1ZM3 A;  4MT1 A;  3KHR A;  2UUC J;  3QLH B;  4QYZ K;  1V3S A;  3VHQ A;  1FCA A;  3OJU A;  1V9O A;  3IG1 B;  4OHW A;  1I1G A;  3F41 A;  2KG1 A;  1REV B;  4LFC J;  2CQB A;  3TR5 A;  1U2C A;  4GC7 A;  2J7U A;  3SMZ A;  1RE1 B;  2UVR A;  2XZW A;  2CAD A;  2YXL A;  2HND B;  3V2U C;  1RAF B;  4WFZ A;  2D3O 1;  5DLG A;  3EX7 B;  1N32 F;  4I2Q A;  1I94 J;  4QIV A;  2BJE A;  1W2I A;  2A6O A;  4O3O A;  3ILJ A;  1P1T A;  3DLB A;  2DRD A;  4M5D A;  4ZLL A;  4J9U E;  2VG5 B;  2X1G A;  2C2N A;  3MEC A;  1KLM B;  4LVO P;  2UUA J;  2VFV A;  2HHQ A;  2OJ3 A;  2F65 A;  4OZJ A;  5KFT A;  4GVB A;  4J90 A;  1VQ9 S;  1MWY A;  1T9T A;  1IWG A;  4RW8 B;  3VV2 B;  3M8P A;  2ILY A;  3BDP A;  2WOM A;  3C3L A;  3A4T A;  2RRB A;  4O4R A;  4OYZ A;  3ZZO A;  2RRA A;  1IJF B;  2R9L A;  4ED8 A;  4NLR A;  3BKU A;  3AXM A;  3ZZT A;  1JLG A;  4L72 B;  4WIQ A;  1QSL A;  2JFK A;  3UQS A;  5F8N A;  1YBT A;  1XN9 A;  3HX9 A;  1TMJ A;  4B3S F;  4TU9 A;  3R5A A;  1U02 A;  2VZ9 A;  2BAN A;  4HYK A;  4CCH A;  4V19 J;  1U0H A;  3CJ0 A;  4CM2 A;  1G3O A;  2L3M A;  2C2K B;  1NDC A;  3JSR A;  3TQ1 A;  3MED B;  5ETV A;  1NDK A;  3SFG A;  3DLK A;  2AYM A;  2BM0 A;  3B54 A;  1TU0 B;  2H3E B;  2M5Y A;  4PG7 A;  1F2G A;  4BWM A;  1Q53 A;  1IN0 A;  1RTD A;  4QWE A;  4IH5 A;  4ZPB A;  4ZCL A;  1RAH B;  2NYI A;  2WVF A;  3M1V B;  4NA2 A;  4TYB A;  4UTG A;  3MM7 A;  3MF5 A;  4BDP A;  1PYO B;  5D0G A;  1SC3 B;  2VF3 A;  4DF8 A;  3B4M A;  4LF7 F;  5EX3 A;  3HHD A;  3W5X A;  3ELH A;  2QX0 A;  2VBZ A;  3EWG A;  1VC5 A;  3CD7 A;  2JDJ A;  5K20 B;  2EG1 A;  1ZAV A;  5A8R A;  4N56 A;  4KH1 B;  4U7U K;  1YK9 A;  2MQL A;  1RCX B;  1SKU B;  1Q7Y T;  3GFZ A;  4IRC A;  5CZV A;  3M7V A;  5D6G A;  4DR4 F;  3THP A;  3TAR A;  1WF1 A;  1NAQ A;  2ZZT A;  3GYG A;  4L76 A;  1UJ4 A;  2R42 A;  2EXU A;  2VG7 A;  4F0H A;  1EP4 B;  2MKY A;  5E3A A;  3QGG A;  3T5L A;  3HF5 A;  4IOA Q;  3I0R A;  1SUQ B;  3ZTR A;  4HDG A;  2C2D A;  2ZH1 A;  5J1E B;  1QD1 A;  3D6M B;  1RWU A;  2IYI A;  2XSF A;  4J9P A;  1IBK J;  2MSS A;  1S99 A;  4TN2 A;  4ZN1 A;  1CS4 A;  2QL5 B;  3IWL A;  2HMI A;  4LFB J;  1UWB A;  3J81 U;  3BO3 A;  4F67 A;  1C1B B;  1VBY A;  1JQG A;  4P71 A;  3GJT B;  3B4D A;  1OQ3 A;  2OPQ B;  1M5H A;  2LMI A;  2E5I A;  1RAJ A;  3MZI A;  2FTR A;  2G0I A;  2F5G A;  4WJB A;  2PA8 D;  4WZM A;  4IDK B;  5CD4 H;  2UXB F;  1PBA A;  2MMY A;  4YB6 A;  2DNR A;  4DXL A;  1RT5 B;  4YEA A;  2CJY B;  2QRR A;  2RQK A;  5KT2 A;  1UJ5 A;  3IBF B;  3HMJ G;  4URS A;  2UVU A;  5F8I A;  2VPY B;  5LT5 A;  3ZZP A;  4ATN A;  5HMW A;  2QGF B;  1MU2 B;  2R8H A;  1IBL J;  2RNE A;  3EZ5 A;  1NJZ A;  3OJS A;  1SVD A;  4M5K A;  1T0T V;  4NOH A;  4M5L A;  1HQE A;  3EPG A;  4IUF A;  3PO4 A;  2CPH A;  3DM2 A;  4DV0 J;  1XBW A;  2ZDO A;  1NME B;  3AAW B;  3GLJ A;  2PMW A;  5A0Y B;  5LSL A;  3CIZ A;  3FZ2 A;  1C4A A;  4NLY A;  5ETT A;  1ICE B;  3EMT A;  5GVQ A;  4F4X A;  5F41 A;  4DL2 A;  5I3U A;  3UPF A;  2XNQ A;  3C8Y A;  3KXD A;  4P6Q A;  3MMC B;  3JSB A;  2PDA A;  1VC6 A;  2MDA A;  3HSG A;  3G96 A;  1N88 A;  5HVH A;  2MGZ A;  2BJ8 A;  2YWE A;  2HFU A;  2GHV C;  1HBU B;  1R7I A;  1GXT A;  4ELV A;  3MM8 B;  3SYZ A;  2GV1 A;  5L46 A;  4DL3 A;  4J9O A;  1RK8 A;  1SBR A;  3MM6 B;  4KKO A;  1XWL A;  2XWY A;  4DL4 A;  2LP4 A;  2KFZ A;  3THV A;  1SV5 B;  2BE7 D;  1YJW S;  4A8F A;  5G0R A;  2F9D A;  1ZZF A;  4ID5 B;  1RT6 B;  1RHJ B;  3TVY A;  1S7I A;  5H9F K;  2V5H G;  1LWC B;  2HNZ A;  2EBG A;  2W8L A;  1FKO B;  1FFS B;  3QT6 A;  2R8J A;  1TKT A;  5HJX A;  3L7O A;  5AJ3 F;  2A10 A;  4CT9 A;  4H54 A;  3D0I E;  4FKX A;  4FF2 A;  1WNE A;  2N3O A;  3SQG B;  1SL0 A;  3T19 A;  3IR6 B;  1GK8 A;  5HVF A;  1H38 A;  3LAM A;  3TUI C;  2CDR B;  2M9K A;  1RT3 B;  1AA1 B;  2XLI A;  3WQP A;  4F7V A;  3BSN A;  1AFJ A;  5ETO A;  2GW8 A;  1F6T A;  2LQB A;  2YNF B;  1WEZ A;  1WC4 A;  2OKQ A;  2AGO A;  1NK5 A;  2ZJR Q;  4G1Q B;  4QR2 A;  3NMR A;  1NK0 A;  2ZEJ A;  4PWD B;  1O6X A;  2HQD A;  4EI2 A;  2FQQ B;  2R3V A;  4KSE B;  4PR6 A;  2W2P P;  3CDE A;  2FVR A;  3IP0 A;  2VQF J;  1YQH A;  1D9D A;  1FNM A;  4PRF A;  4W92 B;  1T05 B;  2ASD A;  1JLQ A;  1FRM A;  4KRW A;  4DR7 F;  3ILI A;  5JXS A;  1NJY A;  1FDD A;  3GFX A;  4EU0 A;  5E0O A;  2FJX A;  3Q8Y A;  3VF0 B;  4RUC A;  3MPY A;  3IG1 A;  4ZLP A;  4ED4 A;  8ATC B;  3G86 A;  5T14 A;  3IS9 B;  2LQJ A;  1HYS A;  4C9D A;  1FT8 A;  2W9A A;  3PG9 A;  1PJ5 A;  1FRJ A;  3GJS B;  3HFV A;  1EIY B;  1OJ4 A;  1DQ8 A;  2BW2 A;  1XMO J;  2ZIT A;  1UEV A;  3FQK A;  3V4I B;  3L9Z A;  3AD7 C;  4UZB A;  1S12 A;  3SDE B;  5KFB A;  1F3F A;  2RS8 A;  4NAS A;  1IXK A;  3W7B A;  3HHL B;  2MST A;  6AT1 B;  3UN5 A;  3R3T A;  1FE4 A;  4PXC A;  3U7J A;  2ADB A;  4CNZ A;  4M94 A;  5KFJ A;  2VG5 A;  1KLM A;  2RU9 A;  2DXE A;  2XMV A;  2H65 B;  4U8V A;  1LV5 A;  3RG6 A;  3OPK A;  1XK8 A;  4RW8 A;  1IM6 A;  3RB6 A;  1RAA B;  3OFH A;  2OTL S;  2YKQ A;  3D5M A;  2PSZ A;  3K57 A;  2FC8 A;  4FN5 A;  2LXF A;  3QSY B;  4IRK A;  1U2F A;  4EZ9 A;  3OTB A;  4KGX B;  2R7T A;  3I6P A;  1HI8 A;  1YRU A;  3BYR A;  1WEY A;  1OO0 B;  3NGS A;  3KLV A;  2FY1 A;  2ZM6 J;  1WSR A;  1Q95 G;  5GAG I;  2GHW A;  2H4Y B;  2HHU A;  5HL7 Q;  3MED A;  1R8C A;  4QPX A;  2ZBP A;  4ZIT A;  3K2Y A;  3WC2 A;  1GXL A;  3HHL C;  3GP9 A;  3MOZ A;  2RHS B;  2C2M B;  4AL7 A;  2LXI A;  2W7O A;  3DOL B;  3M1V A;  5DG7 A;  4PXE A;  4FPI A;  3FDS A;  4ZVE A;  3VAF A;  1IQZ A;  1YRX A;  2D1C A;  4DFK A;  1WC0 A;  2KT2 A;  4EYI B;  1QDU B;  1DLO B;  1Q8L A;  4ZPD A;  1EQM A;  4PQU B;  5IT9 Y;  3MXH P;  5T41 A;  3W60 A;  3KLE A;  2VBY A;  3T1A A;  5K8N A;  5F8G A;  3KJV B;  3NNC A;  2HZC A;  4W90 B;  1Q4R A;  3V5R A;  1M5P C;  3TAP A;  1SUQ A;  3GIR A;  1YBA A;  1HWK A;  4ECU A;  2OEM A;  4DFJ A;  2JL9 A;  5FDL A;  5FII A;  4MH8 A;  2VUG A;  1N33 J;  2OML A;  5J1E A;  2XY5 A;  4DR6 F;  1DHM A;  2CPX A;  4DFM A;  2UUC F;  3QO9 A;  3JSY A;  3OR2 A;  1L3K A;  4M5H A;  4G1I A;  2V4Q A;  2VPZ B;  5KFE A;  1S0O A;  3ISZ A;  3DNC A;  1B0T A;  5CYJ A;  3S6E A;  1KP6 A;  4LFC F;  1S10 A;  1RT2 B;  2DJW A;  4X66 J;  4YB7 A;  4ZPV R;  1VK3 A;  2Z2Z A;  4IDK A;  3LAL A;  2OPP B;  2LEP A;  1FD2 A;  4TKT A;  1I94 F;  5FLX Y;  4FYD A;  2BAC A;  4X4U A;  4GO5 X;  4X4R A;  2CNK B;  5A76 A;  4B3R J;  1CJV B;  3JQK A;  3K7R A;  8AT1 B;  5EX0 A;  5CA5 A;  2IM1 A;  3DLL Q;  2UUA F;  2BJ3 A;  2DBB A;  4CYU B;  2H5E A;  4ZJO A;  2MQM A;  4FXV A;  4FYX B;  3G9C A;  5E41 A;  3OHA A;  1VMB A;  1NRK A;  4Y2K A;  2LDI A;  5A0Y A;  3MAH A;  3ENQ A;  2D3U A;  3PCO B;  3GB0 A;  1A0O B;  5K8O A;  2CQ4 A;  4TXS A;  2VOD A;  3M8Y A;  1G6B A;  2MTL A;  4C48 A;  2R7O A;  1CPZ A;  3S01 A;  2HQI A;  1IR1 A;  1IKX B;  2CQ2 A;  4N5S A;  1QUP A;  2QLW A;  1RQ0 A;  3TZY A;  2AX1 A;  4JI5 F;  4BLG A;  1U1L A;  3DCA A;  1HBU A;  2B43 A;  3RTV A;  3CE8 A;  2O01 C;  5ADZ A;  4WP3 A;  3A3N B;  3CMQ A;  3HZG A;  4KPC A;  3GYN A;  3LP1 B;  4USI A;  4N8N A;  1U4B A;  3CDA A;  3DKD A;  1YJ7 A;  2F8M A;  3BZQ A;  2AYE A;  2IDE A;  3MM6 A;  1WHY A;  4KJI A;  4OZ3 A;  1T9X A;  1LXJ A;  1ZM2 A;  1SV5 A;  2DR7 A;  4CO2 A;  3CUL A;  4ID5 A;  1RT6 A;  3ADA C;  1U7L A;  1S0N A;  1N5T A;  1VJQ A;  1LWC A;  3OHB A;  4J5O A;  2GJF A;  1VLY A;  1FKO A;  2ATL A;  2I2Y A;  2FIU A;  2KHD A;  3RBX A; 
#chains in the Genus database with same CATH homology
 1IBC B;  2QLJ B;  1RWX B;  2C2O B;  2H5I B;  2CDR B;  2XYP B;  3GJQ B;  3GJR B;  1PYO B;  1BMQ B;  2QLB B;  3GJT B;  1GFW B;  1SC4 B;  2C2M B;  1SC3 B;  3D6H B;  2QL9 B;  3R5J B;  1RWM B;  2HBZ B;  2XYH B;  1I51 B;  3KJQ B;  3KJF B;  3QNW B;  4DCJ B;  2H4W B;  2H51 B;  2H5J B;  2H65 B;  2CJY B;  2QL7 B;  5K20 B;  2CNL B;  3R7S B;  3IBF B;  4ZVT B;  2XZT B;  1SC1 B;  3R7N B;  1RHR B;  1RWV B;  2FQQ B;  1RHK B;  4ZVU B;  1RWW B;  1PAU B;  3P4U B;  4DCP B;  5IC6 B;  2XYG B;  2H48 B;  1RWN B;  2QLF B;  2C2Z B;  3SIP B;  2DKO B;  4JB8 B;  1QTN B;  3P45 B;  2H54 B;  1QDU B;  1RWK B;  2HBY B;  2CNK B;  1RHJ B;  4ZVQ B;  3NS7 B;  1RHQ B;  3EDQ B;  1I3O B;  1RE1 B;  2Y0B B;  2HBR B;  3R7B B;  3IBC B;  4ZVO B;  3R6G B;  2C2K B;  3EDR B;  2P2C B;  1RHU B;  1RWO B;  1NME B;  1RHM B;  2XZD B;  1F9E B;  2Y1L B;  4ZVP B;  4ZVS B;  4LSZ B;  3D6M B;  1ICE B;  3GJS B;  3RJM B;  3KJN B;  4ZVR B;  2CNO B;  3D6F B;  2CJX B;  1RWP B;  2QL5 B;  4DCO B;  3R6L B;  2H4Y B;  5IC4 B;  2C1E B;  2HBQ B;  2CNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...