1SC5B

Sigma-28(flia)/flgm complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
72
Chain Sequence
NRIELSRLIGLLLETKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor FliA
publication title Crystal structure of the flagellar sigma/anti-sigma complex sigma(28)/FlgM reveals an intact sigma factor in an inactive conformation.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 20
structure length 72
sequence length 86
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04316 FlgM Anti-sigma-28 factor, FlgM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1160 Mainly Alpha Orthogonal Bundle Helix Hairpins Anti-sigma-28 factor FlgM 1sc5B02
1RP3B 1SC5B
chains in the Genus database with same CATH superfamily
2ITDC 3ZX6A 2VQFB 4CS2A 3OAAG 3S3WA 3T1HB 3Q4HB 4DV6O 1R3LC 1VIBA 2CTQA 2EJ7A 4UCSA 4JI0B 5A2QN 1N0JA 4UVAA 4ZHQA 4D7SA 4Q20A 4K0KB 5LOVB 2KSDA 3CCUV 3ZHUA 3RN4A 2MK3A 2ZE5A 4DR6O 2OT5A 2EJRA 4A5UB 1QR9A 4LR3A 1EFRG 1IBKO 1YXBA 2YXYA 3SYAA 3HKCA 2V4DA 4FPPA 1XNQO 2YIAA 4PJ0Z 1KBHA 2KG7A 3ZRSA 4I4TA 2E5LO 2OCCB 4FZ1A 3STZC 2IU3A 4O2BA 4GX0A 1AI4A 1W0JG 1Q86W 3JD0A 5H9CA 3AG2B 3OMNB 3M99B 5HFMA 1WA8A 4FFKA 2PY5A 4LF6O 3QNEA 4XDJA 3O65A 4PDLA 1U96A 4TUYB 2QKSA 5KX5A 5GW7A 4X1IA 1NT2B 2IJIA 2OIEA 3FAVA 3H1IH 4JASA 1VQ4V 5EK0A 1Z2GA 2XOKG 3W7UA 1J5EB 4YY3B 4DR7O 4JTAB 3AG3B 5D5PA 5GTHZ 3CCQV 1PNLA 4LH6A 1DK1A 2GV9A 4DUZO 4UXNA 4O2AA 5KUKA 4KHPB 2ZE7A 3B8NA 1NTZH 5BMVB 2WLIA 3B09A 1G4YB 4YHHB 1K73W 1Q6HA 4RUFA 3BFRA 2HR3A 4MTOA 1PP9H 1IXBA 1D2DA 1SETA 4X20A 4YIPA 4OXSA 4X64B 2Y69B 3ABMC 5TISZ 5FPRA 3VQWA 2OTJV 2EILB 2Q7GA 3H1KH 1Q90D 2HHHO 2D3OW 1S5HC 2VS0A 3A0RA 5ITZB 2QTOA 2X7RB 2ILMA 1HR0O 4G28B 2VWJA 5KMGB 1BMFG 3RYHA 4KUMA 1W0KG 2CK3G 4JI1B 1Q3EA 3E22A 3CRCA 4JZ2A 3GWKC 3OMAB 4OX9B 4X88A 1OCRC 1YDXA 1ZL8B 5C93A 1B6QA 4DR4B 1S0VA 2A9HA 2P90A 4HZ3A 1K33A 4J41A 3K79A 1NQTA 1GTOA 4H33A 4OPAA 1YZBA 1VQNV 3JD1A 4ZI7A 2ZIMA 1KC8W 2GDSA 3SYCA 2R9AA 3JALA 1N34B 5AG2A 2Y4UA 1QBZA 4NXNB 3LSSA 2F4VO 4DYLA 2WLJA 4AILC 4B3MB 4UVBA 4LFAO 4GCZA 3TJTA 2ZM6B 1H2KA 1Y6XA 2QE7G 3LNNA 1K97A 1K7DA 4FJCC 1U97A 4I50B 2E3CA 1LUWA 1YJWV 1IVSA 2QWNB 1B04A 5EBLC 1HNXB 2WLLB 1KKDA 3QTCA 4X1YB 3AG1C 3B8MA 3HKBA 3G6BA 4FVMA 3S3XA 3BRCA 5JH7B 1HP8A 3BEHA 1XREA 3JATB 3JD3A 1F23A 5JJJB 3TETA 3K5LA 3LSUA 3WB0A 1D5AA 5JVDA 2PUSA 2XUMA 3SJQC 3P3NA 2PZSA 1FAFA 3AEIA 1OCCB 5KHGA 3CB2A 1K34A 2RNBA 1WP7A 5EYPB 2ARHA 3ZMSA 3HKDA 1COWG 2A06H 1NU1H 5LXTA 4XDLA 4DV3O 1YI2V 4WFBV 4I7ZB 1HNWO 1CXZB 3EFFK 1SQGA 1YF2A 3CRMA 1GK9A 3ICXA 4ASUG 4L8JA 2E76B 2JIZG 4DR1O 1FXKC 4B3RO 2Q7EA 4AHCA 1H8HG 3JCUZ 3DC5A 4WBNA 3ASOC 2DWDC 2YUAA 3TXQA 4BW9A 4GX2A 2ZCEA 5LMUO 5FL7G 4LWSB 3AG4B 3BCCH 2IJJA 1SQBH 3RYIA 5IYBO 4GX5A 2JGDB 1XUQA 1X59A 1N33O 2ETNA 2JS5A 5LHIA 1H2SB 1XI1A 4WCEV 2HG5C 4IYHA 1Q7YW 4LNUB 5LP6C 2P7TC 4F4LA 4JI7O 4R50A 1SC5B 3C3SA 1Q8IA 1WP8A 2IH1C 1PKXA 2CH7B 3WFVA 1OCOB 4LF5B 4BIUA 2Q8VA 1NVPB 2W0XA 2AZ0A 5DM6V 5GTIZ 3I56V 3RYFB 3CC7V 2UXNA 3KCXA 3SJAC 5EZYB 1AP5A 1PPJH 2AHZA 5J2UA 1XNRB 2BOCC 1T5EA 1THZA 4PA9A 4DV5O 1S72V 1H38A 4UB8Z 1KU9A 1Q5OA 4L87A 2UUCB 3N2GB 5KHJA 1FXKA 1FJGB 2DQ3A 3E8BA 2F93B 2EBOA 4K35A 3R66A 2MW2B 1H2NA 4FLTA 1P7BA 1Y66A 4DR3O 4LF8B 3A0HZ 4CS3A 1N32B 3SPCA 5IWAO 1NBMG 2ODMA 3K58A 1KECA 4I5SA 4LBEC 3SJBC 3IGAC 4GLXA 4C7UA 2QWPB 3U11A 3CCMV 1Q82W 1Z5WA 1GAXA 3ZRWB 5LP6A 4MVZA 1Y74A 1YTFB 1XQ8A 3ZEDA 1HNZB 5FNVB 4QE9A 4JV5B 3ASNB 2CGNA 1GM8A 5EBWC 1M90W 1NKDA 4B7KA 3GWOA 2Q69A 3VQXA 1PNKA 4HNAA 2OCCC 1KUQA 5LA6B 3THOA 3JASB 5LHGA 1SQPH 3AG2C 1ZLZA 4YJ2B 2WLNA 4DRXA 1OCZB 2F95B 1FFTB 3RW0A 2FL4A 3ZN1A 1VF6C 4Z2WA 3QF7A 1M4UA 2WLHA 4IHJB 4DW0A 2X0LA 4PV1B 2JRIA 2HEPA 2DWEC 3N2KA 3ABUA 1MNGA 2ZR2A 4DV0O 2ADQB 5IJ0A 2XAQA 2QWOB 1KQSU 3KG2A 4RO2A 4K3AA 5B1BB 5J9PC 1IURA 3A2FA 3AG3C 2UUAB 4AQYO 3ABTA 4DV1O 3OMIB 4GX1A 5LGTA 2CDYA 4GKKO 4ZOLB 5LMNB 4DK1A 3W7TA 4H0LB 1NH2B 1ENVA 4JI5O 1JA8A 3I55V 2QKCA 4BW5A 3K59A 1R6TA 1R3KC 2G38A 3FYIB 3U10A 3TCUA 1FFXA 5IYDO 3EVKA 2CUGA 2B9ZA 2Y69C 1YJ9V 4CH6A 2EILC 1I94O 4RQEA 2DYSB 4TUYA 1QVGU 3FB8C 1OV9A 1RSOB 4J10A 4G2KA 1V54B 3RT3C 5BXZA 1BT8A 1AI7A 4JI2B 1BS3A 4LF4B 3OTFA 4X62B 1AI5A 4TWKA 1VQMV 1R6NA 4DV6B 1WJZA 1VQPV 1L0NH 5B3SB 1UPGA 5JQGB 5LGNA 3UT5A 2P4VA 4EEQA 2LGWA 3P30A 4MVOA 2QSAA 4YJ3B 4DR6B 2A79B 1SS3A 3ZMVA 4FLWA 1WN7A 2DMXA 3DSQA 3OGIB 5BMVA 2A3QA 1BL8A 1RFYA 1IBKB 4MSWC 4IIJB 1XNQB 2RDCA 1K9MW 3ML0A 2AW9A 4UCVA 4LFCO 2E5LB 3H01A 3ZRVA 4WFFA 4HBNA 3SPGA 3BVOA 4DW1A 4DO2A 4FLZA 4LF6B 3B40A 5KA6A 3SPHA 3B2EE 4U7OA 3JAKA 3GVMA 2PI5A 2EX3A 1XHXA 5KMGA 5IJ9B 4B3TB 1DTOA 5B1AB 2CTRA 2P67A 4XBFA 2YC0A 1VQ9V 2QJ1A 2Q0OC 3MDSA 3BAAA 4X89A 3IC7A 4PA3A 1ZL8A 5LL6Y 4X66O 3ABKB 5CA0A 4JI8O 2EULA 4DUZB 1XMQO 4LP8A 1GN3A 4CH5A 2FYUH 3LDEA 3F5WC 5CN0A 2HP8A 1VMGA 2JDIG 2XAGA 1KP3A 1JFFB 2ZR3A 4GUNA 3EHBB 5JCOC 4E2LA 4F6EA 2YIDA 4LF7B 1OCCC 2IM9A 3H1HH 2R70A 1XHZA 5KUMA 1NTKH 1MOFA 2HHHB 3LNMB 5IE9A 2QKAA 4GZRB 4R8CA 3ZHRA 3ZHVA 2N74A 5L3GA 1VF5B 1HR0B 4DR2B 2EIMB 1E1QG 1R3JC 4JI0O 1N36B 4NB5A 4I50A 4LF9O 3BA9A 1H8EG 1BHBA 1XOUA 4BR6A 4X1YA 2NNUA 1FD9A 1QR8A 1Q43A 3CJHB 4H13B 4DV4O 1B06A 3PN1A 2X6CA 2IJHA 1PV0A 5JH7A 3JATA 4BWAA 3T1CA 1DGSA 1JQ0A 3SR2C 1AR5A 5JCOA 2IBZH 4O4HB 2AHYA 3LSQA 1Q6UA 4J7KA 1M56B 5EC2C 5CA1A 3OM3B 3R65A 1K4DC 1OCOC 1K5SA 5EYPA 4LF4O 2YDEA 3W7SA 3FKSG 2CTPA 3W7XA 2WLMA 4TQDA 3F5TA 1ZX3A 3G6EV 5H5NA 2YXLA 2F4VB 1A32A 5BY1A 3QG5A 3F7YC 4JF3A 1FYJA 3B77A 4LFAB 1K5QA 1BE3H 1J5EO 4BIOA 3FB6C 2VQEO 4RQFA 3A8TA 1ZWIC 2W6IG 4LWSA 4ZHQB 1Y76B 2O57A 3U0ZA 4N23A 2VWKA 2JGDA 3SYPA 5JJEB 3NR7A 1GN4A 4KHPO 2WSSG 4YHHO 4Q6GA 1JJ2U 2JEUA 4LNUA 1AB3A 4EFEA 1IZ3A 3D36C 1IBMO 5J2TB 1TVKA 5L3DA 4ZKIA 1BCCH 1DF4A 1JCHA 3ASNC 5DECA 4IL6Z 4WFAV 2W0FC 3JCZA 3AK2A 4UB6Z 3CP1A 3WB1A 3APOA 1WA8B 1HDJA 3WG7B 1LNQA 4U7NA 1NR7A 2P6JA 5C8YB 2N04A 3BHPA 5EZYA 2JJ2G 4EB6A 1SESA 4OGQB 1OCZC 1S3JA 1XDCA 5LHHA 1HNWB 1MZEA 3N2GA 3K04A 4LFBB 4NTWA 4IYIA 4PD4F 4JI1O 3FAVB 1K3EA 4NVPA 2GSMB 4DV2O 3QO7A 4DR5B 4MS2A 2B1GA 1XL6A 4B3RB 1YSCA 1EN6A 3SJCC 3CRRA 2Q73A 3TK1A 5B1BC 3E8GA 2HLDG 1CP9A 1N33B 1IBLO 4QPJA 1YITV 3MHSC 1PL0A 2XAHA 1Z5VA 3D36A 3CSXA 1KD1W 4HAMA 1LR1A 1K92A 2UXCO 5E1AC 3IC9A 3OE7G 4CC5A 4O4IB 2PYLA 3UCSC 1R3IC 4PI0A 1P7GA 1M9NA 1PL4A 3LDCA 2F66C 5LA6A 4UVCA 1SQXH 2F1MA 3E8HA 2LW7A 4CC6A 1YCIA 4FMTA 1XMOO 3ZHSA 2IJKA 3JARB 4GKJO 4YJ2A 4DV7B 1I08A 3CPWU 2ZM6O 3BY6A 3AK3A 4DV5B 1LUVA 4J9ZB 2DYSC 2GUZB 1S77D 3ZMZA 3ZHQA 4IHJA 4JI3B 4TV8B 3M7MX 1ROPA 4PDVA 4TOIA 1V54C 2B1IA 3VQYA 2OWOA 4NXMB 4DR3B 3ABLB 5IWAB 1VQ7V 5EIBC 3G67A 2ATKC 4JYCA 2F43G 2P06A 2EZPA 2GBOA 4F6RB 1JPXA 5B3SC 3CS5A 1L0LH 2WAMA 2Q7HA 2UXDO 4MVRA 3CCSV 5KA5A 4ZOLA 1JMKC 1W2BU 3W7WA 1QHTA 3SYOA 5L3EA 4NKGB 4XDKA 3CCVV 1GM7A 1JR9A 2PF4E 2V7QG 4IGGA 3APQA 1I5YA 1E1RG 2AXTZ 3CMAV 4KP4A 4FIPC 5LYJA 1VQ5V 4JYAB 2N05A 1NVPD 3UM7A 4QPKA 2P5OA 2OTLV 2M7WA 2CGOA 4I9QA 4P30A 3ZS8C 5KAIZ 1RSOA 2F23A 4JPRA 3UKMA 3C3TA 1ZSPA 3KCYA 1S5LZ 1SA0B 2QEXV 2K9PA 5B1AC 2ZXWB 1DF5A 2R9RB 4PA6A 1AJQA 4WFGA 5LGUA 3T4ZA 5HFLA 1KKCA 1TUBB 1M93A 3JYCA 1TGOA 4MVSA 3BABA 2QTSA 5JQGA 5BR8B 4MVMA 3IAYA 4AQYB 4DV1B 1R73A 3ABKC 3HPLC 4ZBMA 2Q0AA 4YJ3A 3G80A 2HKOA 2V1DA 3E35A 4GKKB 4DUYO 3M8AA 4LF5O 1AJNA 1YTFD 3UO2A 4UCOA 4IIJA 4TV9B 2D2CB 3FFQA 2ZKOA 3ZCCA 3DXRB 5LXTB 2RCVA 2ZE8A 1SKVA 3CRQA 1NR1A 4D6TH 3SDLA 3K06A 3E83A 1GH6A 1G6UA 3CC4V 2Y48A 4PI2A 2NN4A 1I94B 3QO8A 5L3CA 4P2ZA 3Q4HA 3CCEV 4CH3A 1ZAUA 2HVKC 5IJ9A 2ADPA 1YJNV 1N32O 1P4RA 5IY5B 2P22C 1PD3A 5CB4B 2YEVB 2EIMC 5LOVA 3K5MA 4IT5A 5LBQA 3BA8A 4FFBB 1QVFU 4I55B 1J95A 4KFMA 2LGQA 2KKWA 2BSKB 4EKWA 3SPIA 2BTQB 2VRZA 2B5UA 4G27B 1QLEB 4X65O 2LJ2A 1EN4A 2WA4A 2OIGA 1VEWA 1GN2A 4J9YB 4FM2A 1JFFA 4K8XA 1VF6A 2EIKB 3RYCB 2YICA 1M56C 3CYOA 2GTAA 3T2MA 1NH2D 4LFCB 4JI6B 5J2UB 2RMKB 4B3SB 3H1LH 3OT7A 5JJNB 1FXVA 3CHXA 2ZT9B 2DYRB 2AGAA 1H2LA 1RM1B 4UCTA 3T1YB 1XEQA 1QNMA 4O4JB 4FLYA 1F4NA 3I5DA 3J81N 4X1KB 2ZNJA 4QE7A 3FYEB 3HKEB 2Q67A 4D7TA 5IT9N 3RGBA 1MG1A 1W59A 2IH3C 4Z1VA 1G8MA 1Q6IA 4J11A 2UXBO 3FB5C 1US6A 1NS1A 2JS3A 4NTXA 3CJHA 5CBFA 4H44B 5B66Z 3ZHTA 4K8ZA 5DN6G 4BAYA 4JI8B 4O4LB 2UUBO 1E79G 3AG7A 4QGPA 4FZ0A 4TSFG 1V55B 2XASA 3FD9A 2ZE6A 3GB7C 2BTOA 2KB1A 2KQXA 1AJPA 5IYZB 5FPOA 3K57A 2DN9A 2QR4A 3OD4A 5BZBA 2FTKA 1S76D 2LQTA 3JSLA 1VQ6V 1GO3F 2DOSA 2DE0X 3RFRA 5ITZA 2FMLA 4MVQA 2M6YA 3OTOO 3WG7C 1AP6A 3KZIZ 3CXHF 3PJSK 2CTWA 3T4DA 1XBLA 5GONB 3P3PA 2JK5C 1F7YA 3CCRV 3N2KB 2R9IA 2UU9O 2LO1A 4P9PA 4DR7B 4X62O 3D8CA 1GN6A 3CWBH 3K0GA 3ZBHA 3ZIAG 2HJDA 1Y76A 4LF9B 1OHHG 4FM1A 1M1KW 3OFNG 5KLVH 2Z0AA 4U3JB 2WPDG 4MT8A 4DV4B 4JI4O 4JAVA 3J80N 5IYCO 1RPRA 2ZNIA 5J2TA 3J7AU 3KKYA 3UO3A 1SERA 3VOUA 1TAEA 1FFXB 5KHKA 2Q9LA 5CMUA 3ZJZA 5L3BA 4MTXA 1EM1A 2EINB 2GHYA 3G4SV 1EZJA 1DLBA 1Q81W 5L3FA 3OGCC 5C8YA 4WFHA 2VQFO 3CEIA 2IU0A 3T1HO 1FS0G 4B3TO 1AR1B 4J7ZA 2XTAA 2OYQA 1H2MA 2WLKA 4K0KO 3UQ8A 1MMMA 4RWUA 4R6ZA 2WLLA 3AG4C 3CMEV 4I0XB 1M57B 2VQEB 2IW5A 3DC6A 4MVUA 1I5XA 2WWWA 1F51A 3UT5B 3ABLC 3RWRD 3JAWB 1BQZA 1Y4MA 3OEHG 3X2QB 1OZ0A 2YXHA 1FXHA 2ZDIC 4PDMA 3CCJV 4I9WA 2EZOA 1SQFA 3JD4A 3ZN0A 2RJZA 3FB7C 1IBMB 4O4IA 4LF7O 3BPZA 4JYYA 2ITCC 3SGIA 4YXWG 2AZ2A 3L75H 4X9QA 1VQKV 1URFA 4LCUC 4KXRA 2PGGA 3DGEA 1I0HA 1F4MA 2BE3A 4TT3G 3ZRXA 3JARA 1VF7A 2QA4V 1JOYA 1YIJV 1JX9A 3L9DA 3WB2A 4YY3O 3JAKB 4DR2O 2GUZA 3DTUB 2PYJA 3L72H 1MA1A 3STLC 1N36O 1VQLV 4DV2B 4TV8A 5H6QA 4X8AA 1K8AW 2QWRB 2ZXWC 3CC2V 1SF9A 3HKCB 2XNDG 5CA0B 3OEEG 3OR7C 3RVZA 1PNMA 1V9PA 2KG7B 4F6RA 4I4TB 2ZDIA 3E8FA 2CH7A 2Q5ZA 4JYBA 3VQVA 4X64O 1WLEA 4O2BB 2CAZC 1OJHA 3RVYA 1RPOA 1IBLB 3CRAA 3ETGA 2A7WA 1Y67A 5EC1C 2QWQB 2UXCB 3RYFA 2H8PC 5EBMC 1TUEB 2LFRA 2PI4A 3ZMUA 4FM0A 4UCUA 5KX5B 1QLNA 4DV3B 4X1IB 5CA3A 2E74B 2EIJB 3CXCU 3K5NA 4JGSA 4NR1A 3ETEA 1XMOB 4JTCB 2BOBC 3K9AA 5B1NA 4GKJB 4GYCB 4OX9O 3VBBA 1GMGA 4DR1B 3B4SA 5D5QA 2DJVA 3JSNA 5LMUB 1MZFA 4YIOA 4DR4O 3AK1A 2Y0IA 1K4CC 1SA0A 3FX7A 3OR6C 4O2AB 5IY5C 3ETDA 1VP7A 1WPXA 3D3IA 3ZRWA 2ZINA 1TUBA 3O9OA 4FLUA 2WLIB 1XL4A 3A0BZ 1M5IA 3JD2A 4PA7A 1CEZA 5FNVA 4JI7B 5KHHA 2X6AA 3CE2A 4X20B 1BZKA 3LDDA 1N34O 2UXXA 1VARA 1SZTA 2UXDB 2Q68A 4NXNO 1D5NA 1QLEC 4PHZA 2JJ1G 3L74H 3JAMN 2W6JG 5CA1B 2DQ0A 3JASA 2GTSA 4B3MO 3HB3B 3CCLV 4TV9A 2A0LA 1AR4A 1N0NA 2X6BA 3L70H 2EIKC 2QM4A 3DXRA 3P32A 3RYHB 1XILA 3NXSA 4LFBO 2L6LA 2YIBA 3E22B 4TQFA 2P4KA 3G71V 1HNXO 4DR5O 2DYRC 3E2EA 1RM1C 2QM8A 4KL1A 4JZGA 4DK0A 1IDSA 5F2VO 5CB4A 2YEVA 1SQVH 1WAZA 3SYQA 4PDRA 4JAAA 2LP7A 1GM9A 5E79Z 4FFBA 4OPHA 1WPBA 3ZMTA 1PM9A 3MHHC 4I55A 1R1BA 4J42A 3IFXA 4WFEA 3K03A 1IX9A 1YEWA 3IJ4A 1KB9F 2XAFA 2XT9A 2BSKA 1O9GA 2Z5UA 2JGUA 2BTQA 3ABMB 4QJFB 1ZTEA 1TVKB 4JTDB 4ZI7B 4NYKA 1KP2A 3JALB 3CX5F 1UFIA 1V55C 1I7FA 4DUYB 1TA8A 2C2AA 1MSDA 3K08A 2HJFC 1H2GA 3WU2Z 3RYCA 1S5JA 2Q6AA 3OW2U 1X4TA 4DV7O 1MABG 3OUFA 5JWPA 1BSMA 1N4CA 4EB6B 2BCCH 1HW7A 3SPJA 1SZXA 4JI3O 4DV0B 4CBCA 1OCRB 5H2FZ 3QO5A 2QM7A 4O4JA 3K0DA 2JEXA 4X1KA 3HKBB 2K1EA 1QU7A 4NXMO 5K1XA 4E4EA 3HKEA 2Y0PA 2ZIOA 3MD0A 4GT1A 5CBHA 1AILA 4B7EA 1WB7A 3N27A 5JVDB 2LW1A 2WA3A 3F7VC 4LC1A 1ZUQA 2H94A 1YVWA 1NZ6A 1L1FA 4O4LA 4EFBA 3HKDB 4JI5B 1QQCA 4ZIBA 5FLXN 1SQQH 4X65B 2XAJA 3D3QA 1XNRO 2DW4A 2Y4TA 1AROP 5IYZA 4UFZA 3K3WA 2UUCO 4QIWF 4JYAO 2PTMA 4NTYA 4B08A 1FJGO 3ETQA 1GKFA 2QDOA 5B1OA 2EINC 4UV9A 4WBNB 4LF8O 4PELA 5DEDA 4MW3A 5GONA 4MTFA 5KHIA 3OUSA 3K9SA 1CPYA 3AG1B 2L35A 4UCRA 2YIBD 3RYIB 4P9OA 3TGUH 3TXSA 2Z3YA 1NJIW 4MTGA 1O9HA 3E86A 2FB5A 1AI6A 1FPOA 1P49A 4W4KA 1HNZO 4J7JA 1M57C 4JV5O 3K5OA 5BR8O 2NR5A 1VQ8V 1FKAO 3L73H 2XHBA 1P84F 1VQOV 2UXBB 2YS8A 4U3JA 1N8RW 3X2QC 1EBOA 4CH4A 5B5EZ 1YHQV 2QGNA 2ZQMA 3E89A 2UUBB 4W4LA 1NI8A 1R6KA 1G1XB 4Z1MG 1SRYA 1JVMA 5LYJB 1JJOA 4RAIA 4UUJC 4AI8A 1FXKB 5K1PA 2E75B 1GRJA 3ASOB 1B3QA 2LFSA 4RUEA 1ORQC 4DXWA 2OCHA 3HR0A 3OTOB 5KAFZ 1UJWB 1MSWD 4CZZA 3CD6V 1HWYA 4JAUA 2RQ6A 2JVDA 4BIZA 4ICGA 4PA4A 1RP3B 3QVNA 2UUAO 2YI9A 1KMIZ 2NLJC 2UU9B 2HVJC 4H37A 4J80A 2ZD9A 1BQ0A 1NTMH 5LP6B 4FK5C 4I0XA 2CE4A 3RBZA 5LMNO 5EIBD 1Y74B 4X66B 4FLVA 4HYOA 2YI8A 2Q4PA 1WNSA 3L71H 4LH7A 4R7CA 1XMQB 3JAWA 1AVMA 4QNHB 1BGYH 5CBGA 2FKXA 4MW8A 4CS4A 4WF9V 1QCEA 2HFEC 4O4HA 4HNAB 5IDJA 4FLXA 3LUTB 4UV8A 1IXMA 4JI4B 2YSUB 1KYOF 1L8DA 3MAQA 2H3OA 5H6RA 4DRXB 1EN5A 3EXAA 1WB8A 1BHAA 4JI6O 3H1JH 4B3SO 3H9VA 3C90A 2RN9A 2R72A 4JI2O 2EIJC 4ABMA 3T1YO 5A9GA 1EZVH 4U3FH 4N21A 5IJ0B
chains in the Genus database with same CATH topology
1RP3B 1SC5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RP3 B;  1SC5 B; 
#chains in the Genus database with same CATH topology
 2ITD C;  3ZX6 A;  2VQF B;  4CS2 A;  3OAA G;  3S3W A;  3T1H B;  3Q4H B;  4DV6 O;  1R3L C;  1VIB A;  2CTQ A;  2EJ7 A;  4UCS A;  4JI0 B;  5A2Q N;  1N0J A;  4UVA A;  4ZHQ A;  4D7S A;  4Q20 A;  4K0K B;  5LOV B;  2KSD A;  3CCU V;  3ZHU A;  3RN4 A;  2MK3 A;  2ZE5 A;  4DR6 O;  2OT5 A;  2EJR A;  4A5U B;  1QR9 A;  4LR3 A;  1EFR G;  1IBK O;  1YXB A;  2YXY A;  3SYA A;  3HKC A;  2V4D A;  4FPP A;  1XNQ O;  2YIA A;  4PJ0 Z;  1KBH A;  2KG7 A;  3ZRS A;  4I4T A;  2E5L O;  2OCC B;  4FZ1 A;  3STZ C;  2IU3 A;  4O2B A;  4GX0 A;  1AI4 A;  1W0J G;  1Q86 W;  3JD0 A;  5H9C A;  3AG2 B;  3OMN B;  3M99 B;  5HFM A;  1WA8 A;  4FFK A;  2PY5 A;  4LF6 O;  3QNE A;  4XDJ A;  3O65 A;  4PDL A;  1U96 A;  4TUY B;  2QKS A;  5KX5 A;  5GW7 A;  4X1I A;  1NT2 B;  2IJI A;  2OIE A;  3FAV A;  3H1I H;  4JAS A;  1VQ4 V;  5EK0 A;  1Z2G A;  2XOK G;  3W7U A;  1J5E B;  4YY3 B;  4DR7 O;  4JTA B;  3AG3 B;  5D5P A;  5GTH Z;  3CCQ V;  1PNL A;  4LH6 A;  1DK1 A;  2GV9 A;  4DUZ O;  4UXN A;  4O2A A;  5KUK A;  4KHP B;  2ZE7 A;  3B8N A;  1NTZ H;  5BMV B;  2WLI A;  3B09 A;  1G4Y B;  4YHH B;  1K73 W;  1Q6H A;  4RUF A;  3BFR A;  2HR3 A;  4MTO A;  1PP9 H;  1IXB A;  1D2D A;  1SET A;  4X20 A;  4YIP A;  4OXS A;  4X64 B;  2Y69 B;  3ABM C;  5TIS Z;  5FPR A;  3VQW A;  2OTJ V;  2EIL B;  2Q7G A;  3H1K H;  1Q90 D;  2HHH O;  2D3O W;  1S5H C;  2VS0 A;  3A0R A;  5ITZ B;  2QTO A;  2X7R B;  2ILM A;  1HR0 O;  4G28 B;  2VWJ A;  5KMG B;  1BMF G;  3RYH A;  4KUM A;  1W0K G;  2CK3 G;  4JI1 B;  1Q3E A;  3E22 A;  3CRC A;  4JZ2 A;  3GWK C;  3OMA B;  4OX9 B;  4X88 A;  1OCR C;  1YDX A;  1ZL8 B;  5C93 A;  1B6Q A;  4DR4 B;  1S0V A;  2A9H A;  2P90 A;  4HZ3 A;  1K33 A;  4J41 A;  3K79 A;  1NQT A;  1GTO A;  4H33 A;  4OPA A;  1YZB A;  1VQN V;  3JD1 A;  4ZI7 A;  2ZIM A;  1KC8 W;  2GDS A;  3SYC A;  2R9A A;  3JAL A;  1N34 B;  5AG2 A;  2Y4U A;  1QBZ A;  4NXN B;  3LSS A;  2F4V O;  4DYL A;  2WLJ A;  4AIL C;  4B3M B;  4UVB A;  4LFA O;  4GCZ A;  3TJT A;  2ZM6 B;  1H2K A;  1Y6X A;  2QE7 G;  3LNN A;  1K97 A;  1K7D A;  4FJC C;  1U97 A;  4I50 B;  2E3C A;  1LUW A;  1YJW V;  1IVS A;  2QWN B;  1B04 A;  5EBL C;  1HNX B;  2WLL B;  1KKD A;  3QTC A;  4X1Y B;  3AG1 C;  3B8M A;  3HKB A;  3G6B A;  4FVM A;  3S3X A;  3BRC A;  5JH7 B;  1HP8 A;  3BEH A;  1XRE A;  3JAT B;  3JD3 A;  1F23 A;  5JJJ B;  3TET A;  3K5L A;  3LSU A;  3WB0 A;  1D5A A;  5JVD A;  2PUS A;  2XUM A;  3SJQ C;  3P3N A;  2PZS A;  1FAF A;  3AEI A;  1OCC B;  5KHG A;  3CB2 A;  1K34 A;  2RNB A;  1WP7 A;  5EYP B;  2ARH A;  3ZMS A;  3HKD A;  1COW G;  2A06 H;  1NU1 H;  5LXT A;  4XDL A;  4DV3 O;  1YI2 V;  4WFB V;  4I7Z B;  1HNW O;  1CXZ B;  3EFF K;  1SQG A;  1YF2 A;  3CRM A;  1GK9 A;  3ICX A;  4ASU G;  4L8J A;  2E76 B;  2JIZ G;  4DR1 O;  1FXK C;  4B3R O;  2Q7E A;  4AHC A;  1H8H G;  3JCU Z;  3DC5 A;  4WBN A;  3ASO C;  2DWD C;  2YUA A;  3TXQ A;  4BW9 A;  4GX2 A;  2ZCE A;  5LMU O;  5FL7 G;  4LWS B;  3AG4 B;  3BCC H;  2IJJ A;  1SQB H;  3RYI A;  5IYB O;  4GX5 A;  2JGD B;  1XUQ A;  1X59 A;  1N33 O;  2ETN A;  2JS5 A;  5LHI A;  1H2S B;  1XI1 A;  4WCE V;  2HG5 C;  4IYH A;  1Q7Y W;  4LNU B;  5LP6 C;  2P7T C;  4F4L A;  4JI7 O;  4R50 A;  1SC5 B;  3C3S A;  1Q8I A;  1WP8 A;  2IH1 C;  1PKX A;  2CH7 B;  3WFV A;  1OCO B;  4LF5 B;  4BIU A;  2Q8V A;  1NVP B;  2W0X A;  2AZ0 A;  5DM6 V;  5GTI Z;  3I56 V;  3RYF B;  3CC7 V;  2UXN A;  3KCX A;  3SJA C;  5EZY B;  1AP5 A;  1PPJ H;  2AHZ A;  5J2U A;  1XNR B;  2BOC C;  1T5E A;  1THZ A;  4PA9 A;  4DV5 O;  1S72 V;  1H38 A;  4UB8 Z;  1KU9 A;  1Q5O A;  4L87 A;  2UUC B;  3N2G B;  5KHJ A;  1FXK A;  1FJG B;  2DQ3 A;  3E8B A;  2F93 B;  2EBO A;  4K35 A;  3R66 A;  2MW2 B;  1H2N A;  4FLT A;  1P7B A;  1Y66 A;  4DR3 O;  4LF8 B;  3A0H Z;  4CS3 A;  1N32 B;  3SPC A;  5IWA O;  1NBM G;  2ODM A;  3K58 A;  1KEC A;  4I5S A;  4LBE C;  3SJB C;  3IGA C;  4GLX A;  4C7U A;  2QWP B;  3U11 A;  3CCM V;  1Q82 W;  1Z5W A;  1GAX A;  3ZRW B;  5LP6 A;  4MVZ A;  1Y74 A;  1YTF B;  1XQ8 A;  3ZED A;  1HNZ B;  5FNV B;  4QE9 A;  4JV5 B;  3ASN B;  2CGN A;  1GM8 A;  5EBW C;  1M90 W;  1NKD A;  4B7K A;  3GWO A;  2Q69 A;  3VQX A;  1PNK A;  4HNA A;  2OCC C;  1KUQ A;  5LA6 B;  3THO A;  3JAS B;  5LHG A;  1SQP H;  3AG2 C;  1ZLZ A;  4YJ2 B;  2WLN A;  4DRX A;  1OCZ B;  2F95 B;  1FFT B;  3RW0 A;  2FL4 A;  3ZN1 A;  1VF6 C;  4Z2W A;  3QF7 A;  1M4U A;  2WLH A;  4IHJ B;  4DW0 A;  2X0L A;  4PV1 B;  2JRI A;  2HEP A;  2DWE C;  3N2K A;  3ABU A;  1MNG A;  2ZR2 A;  4DV0 O;  2ADQ B;  5IJ0 A;  2XAQ A;  2QWO B;  1KQS U;  3KG2 A;  4RO2 A;  4K3A A;  5B1B B;  5J9P C;  1IUR A;  3A2F A;  3AG3 C;  2UUA B;  4AQY O;  3ABT A;  4DV1 O;  3OMI B;  4GX1 A;  5LGT A;  2CDY A;  4GKK O;  4ZOL B;  5LMN B;  4DK1 A;  3W7T A;  4H0L B;  1NH2 B;  1ENV A;  4JI5 O;  1JA8 A;  3I55 V;  2QKC A;  4BW5 A;  3K59 A;  1R6T A;  1R3K C;  2G38 A;  3FYI B;  3U10 A;  3TCU A;  1FFX A;  5IYD O;  3EVK A;  2CUG A;  2B9Z A;  2Y69 C;  1YJ9 V;  4CH6 A;  2EIL C;  1I94 O;  4RQE A;  2DYS B;  4TUY A;  1QVG U;  3FB8 C;  1OV9 A;  1RSO B;  4J10 A;  4G2K A;  1V54 B;  3RT3 C;  5BXZ A;  1BT8 A;  1AI7 A;  4JI2 B;  1BS3 A;  4LF4 B;  3OTF A;  4X62 B;  1AI5 A;  4TWK A;  1VQM V;  1R6N A;  4DV6 B;  1WJZ A;  1VQP V;  1L0N H;  5B3S B;  1UPG A;  5JQG B;  5LGN A;  3UT5 A;  2P4V A;  4EEQ A;  2LGW A;  3P30 A;  4MVO A;  2QSA A;  4YJ3 B;  4DR6 B;  2A79 B;  1SS3 A;  3ZMV A;  4FLW A;  1WN7 A;  2DMX A;  3DSQ A;  3OGI B;  5BMV A;  2A3Q A;  1BL8 A;  1RFY A;  1IBK B;  4MSW C;  4IIJ B;  1XNQ B;  2RDC A;  1K9M W;  3ML0 A;  2AW9 A;  4UCV A;  4LFC O;  2E5L B;  3H01 A;  3ZRV A;  4WFF A;  4HBN A;  3SPG A;  3BVO A;  4DW1 A;  4DO2 A;  4FLZ A;  4LF6 B;  3B40 A;  5KA6 A;  3SPH A;  3B2E E;  4U7O A;  3JAK A;  3GVM A;  2PI5 A;  2EX3 A;  1XHX A;  5KMG A;  5IJ9 B;  4B3T B;  1DTO A;  5B1A B;  2CTR A;  2P67 A;  4XBF A;  2YC0 A;  1VQ9 V;  2QJ1 A;  2Q0O C;  3MDS A;  3BAA A;  4X89 A;  3IC7 A;  4PA3 A;  1ZL8 A;  5LL6 Y;  4X66 O;  3ABK B;  5CA0 A;  4JI8 O;  2EUL A;  4DUZ B;  1XMQ O;  4LP8 A;  1GN3 A;  4CH5 A;  2FYU H;  3LDE A;  3F5W C;  5CN0 A;  2HP8 A;  1VMG A;  2JDI G;  2XAG A;  1KP3 A;  1JFF B;  2ZR3 A;  4GUN A;  3EHB B;  5JCO C;  4E2L A;  4F6E A;  2YID A;  4LF7 B;  1OCC C;  2IM9 A;  3H1H H;  2R70 A;  1XHZ A;  5KUM A;  1NTK H;  1MOF A;  2HHH B;  3LNM B;  5IE9 A;  2QKA A;  4GZR B;  4R8C A;  3ZHR A;  3ZHV A;  2N74 A;  5L3G A;  1VF5 B;  1HR0 B;  4DR2 B;  2EIM B;  1E1Q G;  1R3J C;  4JI0 O;  1N36 B;  4NB5 A;  4I50 A;  4LF9 O;  3BA9 A;  1H8E G;  1BHB A;  1XOU A;  4BR6 A;  4X1Y A;  2NNU A;  1FD9 A;  1QR8 A;  1Q43 A;  3CJH B;  4H13 B;  4DV4 O;  1B06 A;  3PN1 A;  2X6C A;  2IJH A;  1PV0 A;  5JH7 A;  3JAT A;  4BWA A;  3T1C A;  1DGS A;  1JQ0 A;  3SR2 C;  1AR5 A;  5JCO A;  2IBZ H;  4O4H B;  2AHY A;  3LSQ A;  1Q6U A;  4J7K A;  1M56 B;  5EC2 C;  5CA1 A;  3OM3 B;  3R65 A;  1K4D C;  1OCO C;  1K5S A;  5EYP A;  4LF4 O;  2YDE A;  3W7S A;  3FKS G;  2CTP A;  3W7X A;  2WLM A;  4TQD A;  3F5T A;  1ZX3 A;  3G6E V;  5H5N A;  2YXL A;  2F4V B;  1A32 A;  5BY1 A;  3QG5 A;  3F7Y C;  4JF3 A;  1FYJ A;  3B77 A;  4LFA B;  1K5Q A;  1BE3 H;  1J5E O;  4BIO A;  3FB6 C;  2VQE O;  4RQF A;  3A8T A;  1ZWI C;  2W6I G;  4LWS A;  4ZHQ B;  1Y76 B;  2O57 A;  3U0Z A;  4N23 A;  2VWK A;  2JGD A;  3SYP A;  5JJE B;  3NR7 A;  1GN4 A;  4KHP O;  2WSS G;  4YHH O;  4Q6G A;  1JJ2 U;  2JEU A;  4LNU A;  1AB3 A;  4EFE A;  1IZ3 A;  3D36 C;  1IBM O;  5J2T B;  1TVK A;  5L3D A;  4ZKI A;  1BCC H;  1DF4 A;  1JCH A;  3ASN C;  5DEC A;  4IL6 Z;  4WFA V;  2W0F C;  3JCZ A;  3AK2 A;  4UB6 Z;  3CP1 A;  3WB1 A;  3APO A;  1WA8 B;  1HDJ A;  3WG7 B;  1LNQ A;  4U7N A;  1NR7 A;  2P6J A;  5C8Y B;  2N04 A;  3BHP A;  5EZY A;  2JJ2 G;  4EB6 A;  1SES A;  4OGQ B;  1OCZ C;  1S3J A;  1XDC A;  5LHH A;  1HNW B;  1MZE A;  3N2G A;  3K04 A;  4LFB B;  4NTW A;  4IYI A;  4PD4 F;  4JI1 O;  3FAV B;  1K3E A;  4NVP A;  2GSM B;  4DV2 O;  3QO7 A;  4DR5 B;  4MS2 A;  2B1G A;  1XL6 A;  4B3R B;  1YSC A;  1EN6 A;  3SJC C;  3CRR A;  2Q73 A;  3TK1 A;  5B1B C;  3E8G A;  2HLD G;  1CP9 A;  1N33 B;  1IBL O;  4QPJ A;  1YIT V;  3MHS C;  1PL0 A;  2XAH A;  1Z5V A;  3D36 A;  3CSX A;  1KD1 W;  4HAM A;  1LR1 A;  1K92 A;  2UXC O;  5E1A C;  3IC9 A;  3OE7 G;  4CC5 A;  4O4I B;  2PYL A;  3UCS C;  1R3I C;  4PI0 A;  1P7G A;  1M9N A;  1PL4 A;  3LDC A;  2F66 C;  5LA6 A;  4UVC A;  1SQX H;  2F1M A;  3E8H A;  2LW7 A;  4CC6 A;  1YCI A;  4FMT A;  1XMO O;  3ZHS A;  2IJK A;  3JAR B;  4GKJ O;  4YJ2 A;  4DV7 B;  1I08 A;  3CPW U;  2ZM6 O;  3BY6 A;  3AK3 A;  4DV5 B;  1LUV A;  4J9Z B;  2DYS C;  2GUZ B;  1S77 D;  3ZMZ A;  3ZHQ A;  4IHJ A;  4JI3 B;  4TV8 B;  3M7M X;  1ROP A;  4PDV A;  4TOI A;  1V54 C;  2B1I A;  3VQY A;  2OWO A;  4NXM B;  4DR3 B;  3ABL B;  5IWA B;  1VQ7 V;  5EIB C;  3G67 A;  2ATK C;  4JYC A;  2F43 G;  2P06 A;  2EZP A;  2GBO A;  4F6R B;  1JPX A;  5B3S C;  3CS5 A;  1L0L H;  2WAM A;  2Q7H A;  2UXD O;  4MVR A;  3CCS V;  5KA5 A;  4ZOL A;  1JMK C;  1W2B U;  3W7W A;  1QHT A;  3SYO A;  5L3E A;  4NKG B;  4XDK A;  3CCV V;  1GM7 A;  1JR9 A;  2PF4 E;  2V7Q G;  4IGG A;  3APQ A;  1I5Y A;  1E1R G;  2AXT Z;  3CMA V;  4KP4 A;  4FIP C;  5LYJ A;  1VQ5 V;  4JYA B;  2N05 A;  1NVP D;  3UM7 A;  4QPK A;  2P5O A;  2OTL V;  2M7W A;  2CGO A;  4I9Q A;  4P30 A;  3ZS8 C;  5KAI Z;  1RSO A;  2F23 A;  4JPR A;  3UKM A;  3C3T A;  1ZSP A;  3KCY A;  1S5L Z;  1SA0 B;  2QEX V;  2K9P A;  5B1A C;  2ZXW B;  1DF5 A;  2R9R B;  4PA6 A;  1AJQ A;  4WFG A;  5LGU A;  3T4Z A;  5HFL A;  1KKC A;  1TUB B;  1M93 A;  3JYC A;  1TGO A;  4MVS A;  3BAB A;  2QTS A;  5JQG A;  5BR8 B;  4MVM A;  3IAY A;  4AQY B;  4DV1 B;  1R73 A;  3ABK C;  3HPL C;  4ZBM A;  2Q0A A;  4YJ3 A;  3G80 A;  2HKO A;  2V1D A;  3E35 A;  4GKK B;  4DUY O;  3M8A A;  4LF5 O;  1AJN A;  1YTF D;  3UO2 A;  4UCO A;  4IIJ A;  4TV9 B;  2D2C B;  3FFQ A;  2ZKO A;  3ZCC A;  3DXR B;  5LXT B;  2RCV A;  2ZE8 A;  1SKV A;  3CRQ A;  1NR1 A;  4D6T H;  3SDL A;  3K06 A;  3E83 A;  1GH6 A;  1G6U A;  3CC4 V;  2Y48 A;  4PI2 A;  2NN4 A;  1I94 B;  3QO8 A;  5L3C A;  4P2Z A;  3Q4H A;  3CCE V;  4CH3 A;  1ZAU A;  2HVK C;  5IJ9 A;  2ADP A;  1YJN V;  1N32 O;  1P4R A;  5IY5 B;  2P22 C;  1PD3 A;  5CB4 B;  2YEV B;  2EIM C;  5LOV A;  3K5M A;  4IT5 A;  5LBQ A;  3BA8 A;  4FFB B;  1QVF U;  4I55 B;  1J95 A;  4KFM A;  2LGQ A;  2KKW A;  2BSK B;  4EKW A;  3SPI A;  2BTQ B;  2VRZ A;  2B5U A;  4G27 B;  1QLE B;  4X65 O;  2LJ2 A;  1EN4 A;  2WA4 A;  2OIG A;  1VEW A;  1GN2 A;  4J9Y B;  4FM2 A;  1JFF A;  4K8X A;  1VF6 A;  2EIK B;  3RYC B;  2YIC A;  1M56 C;  3CYO A;  2GTA A;  3T2M A;  1NH2 D;  4LFC B;  4JI6 B;  5J2U B;  2RMK B;  4B3S B;  3H1L H;  3OT7 A;  5JJN B;  1FXV A;  3CHX A;  2ZT9 B;  2DYR B;  2AGA A;  1H2L A;  1RM1 B;  4UCT A;  3T1Y B;  1XEQ A;  1QNM A;  4O4J B;  4FLY A;  1F4N A;  3I5D A;  3J81 N;  4X1K B;  2ZNJ A;  4QE7 A;  3FYE B;  3HKE B;  2Q67 A;  4D7T A;  5IT9 N;  3RGB A;  1MG1 A;  1W59 A;  2IH3 C;  4Z1V A;  1G8M A;  1Q6I A;  4J11 A;  2UXB O;  3FB5 C;  1US6 A;  1NS1 A;  2JS3 A;  4NTX A;  3CJH A;  5CBF A;  4H44 B;  5B66 Z;  3ZHT A;  4K8Z A;  5DN6 G;  4BAY A;  4JI8 B;  4O4L B;  2UUB O;  1E79 G;  3AG7 A;  4QGP A;  4FZ0 A;  4TSF G;  1V55 B;  2XAS A;  3FD9 A;  2ZE6 A;  3GB7 C;  2BTO A;  2KB1 A;  2KQX A;  1AJP A;  5IYZ B;  5FPO A;  3K57 A;  2DN9 A;  2QR4 A;  3OD4 A;  5BZB A;  2FTK A;  1S76 D;  2LQT A;  3JSL A;  1VQ6 V;  1GO3 F;  2DOS A;  2DE0 X;  3RFR A;  5ITZ A;  2FML A;  4MVQ A;  2M6Y A;  3OTO O;  3WG7 C;  1AP6 A;  3KZI Z;  3CXH F;  3PJS K;  2CTW A;  3T4D A;  1XBL A;  5GON B;  3P3P A;  2JK5 C;  1F7Y A;  3CCR V;  3N2K B;  2R9I A;  2UU9 O;  2LO1 A;  4P9P A;  4DR7 B;  4X62 O;  3D8C A;  1GN6 A;  3CWB H;  3K0G A;  3ZBH A;  3ZIA G;  2HJD A;  1Y76 A;  4LF9 B;  1OHH G;  4FM1 A;  1M1K W;  3OFN G;  5KLV H;  2Z0A A;  4U3J B;  2WPD G;  4MT8 A;  4DV4 B;  4JI4 O;  4JAV A;  3J80 N;  5IYC O;  1RPR A;  2ZNI A;  5J2T A;  3J7A U;  3KKY A;  3UO3 A;  1SER A;  3VOU A;  1TAE A;  1FFX B;  5KHK A;  2Q9L A;  5CMU A;  3ZJZ A;  5L3B A;  4MTX A;  1EM1 A;  2EIN B;  2GHY A;  3G4S V;  1EZJ A;  1DLB A;  1Q81 W;  5L3F A;  3OGC C;  5C8Y A;  4WFH A;  2VQF O;  3CEI A;  2IU0 A;  3T1H O;  1FS0 G;  4B3T O;  1AR1 B;  4J7Z A;  2XTA A;  2OYQ A;  1H2M A;  2WLK A;  4K0K O;  3UQ8 A;  1MMM A;  4RWU A;  4R6Z A;  2WLL A;  3AG4 C;  3CME V;  4I0X B;  1M57 B;  2VQE B;  2IW5 A;  3DC6 A;  4MVU A;  1I5X A;  2WWW A;  1F51 A;  3UT5 B;  3ABL C;  3RWR D;  3JAW B;  1BQZ A;  1Y4M A;  3OEH G;  3X2Q B;  1OZ0 A;  2YXH A;  1FXH A;  2ZDI C;  4PDM A;  3CCJ V;  4I9W A;  2EZO A;  1SQF A;  3JD4 A;  3ZN0 A;  2RJZ A;  3FB7 C;  1IBM B;  4O4I A;  4LF7 O;  3BPZ A;  4JYY A;  2ITC C;  3SGI A;  4YXW G;  2AZ2 A;  3L75 H;  4X9Q A;  1VQK V;  1URF A;  4LCU C;  4KXR A;  2PGG A;  3DGE A;  1I0H A;  1F4M A;  2BE3 A;  4TT3 G;  3ZRX A;  3JAR A;  1VF7 A;  2QA4 V;  1JOY A;  1YIJ V;  1JX9 A;  3L9D A;  3WB2 A;  4YY3 O;  3JAK B;  4DR2 O;  2GUZ A;  3DTU B;  2PYJ A;  3L72 H;  1MA1 A;  3STL C;  1N36 O;  1VQL V;  4DV2 B;  4TV8 A;  5H6Q A;  4X8A A;  1K8A W;  2QWR B;  2ZXW C;  3CC2 V;  1SF9 A;  3HKC B;  2XND G;  5CA0 B;  3OEE G;  3OR7 C;  3RVZ A;  1PNM A;  1V9P A;  2KG7 B;  4F6R A;  4I4T B;  2ZDI A;  3E8F A;  2CH7 A;  2Q5Z A;  4JYB A;  3VQV A;  4X64 O;  1WLE A;  4O2B B;  2CAZ C;  1OJH A;  3RVY A;  1RPO A;  1IBL B;  3CRA A;  3ETG A;  2A7W A;  1Y67 A;  5EC1 C;  2QWQ B;  2UXC B;  3RYF A;  2H8P C;  5EBM C;  1TUE B;  2LFR A;  2PI4 A;  3ZMU A;  4FM0 A;  4UCU A;  5KX5 B;  1QLN A;  4DV3 B;  4X1I B;  5CA3 A;  2E74 B;  2EIJ B;  3CXC U;  3K5N A;  4JGS A;  4NR1 A;  3ETE A;  1XMO B;  4JTC B;  2BOB C;  3K9A A;  5B1N A;  4GKJ B;  4GYC B;  4OX9 O;  3VBB A;  1GMG A;  4DR1 B;  3B4S A;  5D5Q A;  2DJV A;  3JSN A;  5LMU B;  1MZF A;  4YIO A;  4DR4 O;  3AK1 A;  2Y0I A;  1K4C C;  1SA0 A;  3FX7 A;  3OR6 C;  4O2A B;  5IY5 C;  3ETD A;  1VP7 A;  1WPX A;  3D3I A;  3ZRW A;  2ZIN A;  1TUB A;  3O9O A;  4FLU A;  2WLI B;  1XL4 A;  3A0B Z;  1M5I A;  3JD2 A;  4PA7 A;  1CEZ A;  5FNV A;  4JI7 B;  5KHH A;  2X6A A;  3CE2 A;  4X20 B;  1BZK A;  3LDD A;  1N34 O;  2UXX A;  1VAR A;  1SZT A;  2UXD B;  2Q68 A;  4NXN O;  1D5N A;  1QLE C;  4PHZ A;  2JJ1 G;  3L74 H;  3JAM N;  2W6J G;  5CA1 B;  2DQ0 A;  3JAS A;  2GTS A;  4B3M O;  3HB3 B;  3CCL V;  4TV9 A;  2A0L A;  1AR4 A;  1N0N A;  2X6B A;  3L70 H;  2EIK C;  2QM4 A;  3DXR A;  3P32 A;  3RYH B;  1XIL A;  3NXS A;  4LFB O;  2L6L A;  2YIB A;  3E22 B;  4TQF A;  2P4K A;  3G71 V;  1HNX O;  4DR5 O;  2DYR C;  3E2E A;  1RM1 C;  2QM8 A;  4KL1 A;  4JZG A;  4DK0 A;  1IDS A;  5F2V O;  5CB4 A;  2YEV A;  1SQV H;  1WAZ A;  3SYQ A;  4PDR A;  4JAA A;  2LP7 A;  1GM9 A;  5E79 Z;  4FFB A;  4OPH A;  1WPB A;  3ZMT A;  1PM9 A;  3MHH C;  4I55 A;  1R1B A;  4J42 A;  3IFX A;  4WFE A;  3K03 A;  1IX9 A;  1YEW A;  3IJ4 A;  1KB9 F;  2XAF A;  2XT9 A;  2BSK A;  1O9G A;  2Z5U A;  2JGU A;  2BTQ A;  3ABM B;  4QJF B;  1ZTE A;  1TVK B;  4JTD B;  4ZI7 B;  4NYK A;  1KP2 A;  3JAL B;  3CX5 F;  1UFI A;  1V55 C;  1I7F A;  4DUY B;  1TA8 A;  2C2A A;  1MSD A;  3K08 A;  2HJF C;  1H2G A;  3WU2 Z;  3RYC A;  1S5J A;  2Q6A A;  3OW2 U;  1X4T A;  4DV7 O;  1MAB G;  3OUF A;  5JWP A;  1BSM A;  1N4C A;  4EB6 B;  2BCC H;  1HW7 A;  3SPJ A;  1SZX A;  4JI3 O;  4DV0 B;  4CBC A;  1OCR B;  5H2F Z;  3QO5 A;  2QM7 A;  4O4J A;  3K0D A;  2JEX A;  4X1K A;  3HKB B;  2K1E A;  1QU7 A;  4NXM O;  5K1X A;  4E4E A;  3HKE A;  2Y0P A;  2ZIO A;  3MD0 A;  4GT1 A;  5CBH A;  1AIL A;  4B7E A;  1WB7 A;  3N27 A;  5JVD B;  2LW1 A;  2WA3 A;  3F7V C;  4LC1 A;  1ZUQ A;  2H94 A;  1YVW A;  1NZ6 A;  1L1F A;  4O4L A;  4EFB A;  3HKD B;  4JI5 B;  1QQC A;  4ZIB A;  5FLX N;  1SQQ H;  4X65 B;  2XAJ A;  3D3Q A;  1XNR O;  2DW4 A;  2Y4T A;  1ARO P;  5IYZ A;  4UFZ A;  3K3W A;  2UUC O;  4QIW F;  4JYA O;  2PTM A;  4NTY A;  4B08 A;  1FJG O;  3ETQ A;  1GKF A;  2QDO A;  5B1O A;  2EIN C;  4UV9 A;  4WBN B;  4LF8 O;  4PEL A;  5DED A;  4MW3 A;  5GON A;  4MTF A;  5KHI A;  3OUS A;  3K9S A;  1CPY A;  3AG1 B;  2L35 A;  4UCR A;  2YIB D;  3RYI B;  4P9O A;  3TGU H;  3TXS A;  2Z3Y A;  1NJI W;  4MTG A;  1O9H A;  3E86 A;  2FB5 A;  1AI6 A;  1FPO A;  1P49 A;  4W4K A;  1HNZ O;  4J7J A;  1M57 C;  4JV5 O;  3K5O A;  5BR8 O;  2NR5 A;  1VQ8 V;  1FKA O;  3L73 H;  2XHB A;  1P84 F;  1VQO V;  2UXB B;  2YS8 A;  4U3J A;  1N8R W;  3X2Q C;  1EBO A;  4CH4 A;  5B5E Z;  1YHQ V;  2QGN A;  2ZQM A;  3E89 A;  2UUB B;  4W4L A;  1NI8 A;  1R6K A;  1G1X B;  4Z1M G;  1SRY A;  1JVM A;  5LYJ B;  1JJO A;  4RAI A;  4UUJ C;  4AI8 A;  1FXK B;  5K1P A;  2E75 B;  1GRJ A;  3ASO B;  1B3Q A;  2LFS A;  4RUE A;  1ORQ C;  4DXW A;  2OCH A;  3HR0 A;  3OTO B;  5KAF Z;  1UJW B;  1MSW D;  4CZZ A;  3CD6 V;  1HWY A;  4JAU A;  2RQ6 A;  2JVD A;  4BIZ A;  4ICG A;  4PA4 A;  1RP3 B;  3QVN A;  2UUA O;  2YI9 A;  1KMI Z;  2NLJ C;  2UU9 B;  2HVJ C;  4H37 A;  4J80 A;  2ZD9 A;  1BQ0 A;  1NTM H;  5LP6 B;  4FK5 C;  4I0X A;  2CE4 A;  3RBZ A;  5LMN O;  5EIB D;  1Y74 B;  4X66 B;  4FLV A;  4HYO A;  2YI8 A;  2Q4P A;  1WNS A;  3L71 H;  4LH7 A;  4R7C A;  1XMQ B;  3JAW A;  1AVM A;  4QNH B;  1BGY H;  5CBG A;  2FKX A;  4MW8 A;  4CS4 A;  4WF9 V;  1QCE A;  2HFE C;  4O4H A;  4HNA B;  5IDJ A;  4FLX A;  3LUT B;  4UV8 A;  1IXM A;  4JI4 B;  2YSU B;  1KYO F;  1L8D A;  3MAQ A;  2H3O A;  5H6R A;  4DRX B;  1EN5 A;  3EXA A;  1WB8 A;  1BHA A;  4JI6 O;  3H1J H;  4B3S O;  3H9V A;  3C90 A;  2RN9 A;  2R72 A;  4JI2 O;  2EIJ C;  4ABM A;  3T1Y O;  5A9G A;  1EZV H;  4U3F H;  4N21 A;  5IJ0 B; 
#chains in the Genus database with same CATH homology
 1RP3 B;  1SC5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...