1SCKA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetone
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-acetone-cyanohydrin lyase
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 99
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sckA00
1HLGA 4X71A 3AFIA 4A16A 1XQXA 1W75A 2Z3WA 2GBGA 4WY5A 3ZPXA 3AZQA 2W6CX 5ESRA 4AN1A 1XQYA 4C87A 4V2IA 5AK6A 1Y7HA 2XMCA 3BF8A 4KE7A 5AKHA 2QJWA 3LP5A 5DNVA 1E89A 1BRTA 5I7UA 1X2BA 2JEYA 1F0PA 2QR5A 2QXTA 5ALMA 5AH0A 2Z8XA 4FWBA 5AM5A 1NU8A 3MVEA 3R3UA 4OYYA 3VKFA 3BDIA 1A8QA 3GELA 1QIFA 4PNZA 2Y6UA 1O6FA 3E4DA 3I2IA 2VJDA 4UPDA 3C45A 1XRPA 2O2GA 4BVKA 4NS4A 4ZXFA 4ZI5A 5HQ3A 2ACEA 4UBNA 1WCYA 5ALEA 2CJPA 2QUAA 3C5VA 4H7EA 3WK4A 4PF1A 4X93A 1KU0A 3V1LA 2XUOA 4X6YA 1WPXA 4J3JA 3L1JA 3W9BA 2WHQA 2WTMA 5BOVA 1BN6A 4C6HA 2AXEA 1GPKA 4EY4A 2WUDA 3HZOA 4OPMA 1XRLA 3EQ9A 5AOBA 2H9YA 5HK9A 5JYCA 1I6WA 2Z5GA 4OSEA 4BP8A 1CRLA 2HM7A 1B41A 2ES4A 3PDCA 1DWOA 2C0QA 4B84A 1LBTA 4KACA 5EHNA 3R3YA 2PX6A 3H2GA 2ZSHA 4AO6A 2VJAA 2FJPA 3IDAA 1H23A 3GROA 2OGZA 3KOOA 1VXRA 5CTAA 1VA4A 3FYUB 4CIBA 4BBZA 2XMDA 2RGUA 1AUOA 3E0XA 3I2HA 2XMGA 2CKMA 2IITA 5ALYA 2XUIA 4JYPA 3HRHA 3HJUA 1CUBA 3WWEA 2WUGA 3R0VA 3IA2A 1YAHA 3V1MA 3H2KA 1MX9A 1G42A 1CQWA 2OPHA 5LZ4A 1WB6A 2XQGA 2WHPB 2WLSA 1CQZA 4BB0A 2JEZA 3WIBA 3SC2A 4EY6A 3G0BA 4JYMA 3M3DA 2H7CA 3SK0A 2XI4A 4INZA 5CRIA 5HK8A 3FYUC 2ZJ7A 2WFLB 1LPMA 2AJCA 4KJXA 1P0PA 4LYEA 2I03A 3WK6A 3AJAA 4B0OA 2HA5A 1FFCA 3WL8A 5AM1A 4Y2VA 4X85A 3TGLA 2ONCA 1XQWA 1FSSA 1VLQA 4ITVA 1H2XA 1UKCA 3BXPA 2V9ZA 4CI9A 3PF8A 4G8BA 1ETHA 1W52X 4G4IA 1YS1X 4Y2JA 2JGFA 2EEPA 4AQDA 4AO7A 1CUGA 2DR0A 4FBMA 4K5QA 1G4HA 3A70A 2HIHA 4G9EA 2I78A 4FNMA 1E8MA 4M0EA 1VE7A 2JIDA 2P8SA 3U1TA 3ANSA 5FV4A 3H17A 1Q84A 4AXBA 1GPNA 4B83A 2ZYHA 2JF0A 4G4JA 4M0FA 3O4HA 2WG0A 3OM8A 4UHFA 5EHXA 4G5XA 1NU6A 3GA7A 3R3VA 2DCMA 4K6GA 3A6ZA 3HC7A 3H18A 4UBLA 5E4TA 3R3ZA 1ACLA 2XUHA 3O0DA 2J4CA 3F97A 1JU4A 5AI0A 3LS2A 3GFFA 4H7DA 1U4NA 3AIOA 4UBJA 5FRDA 2HDWA 4QA9A 3ZV7A 4DLNA 1VA5A 3A2LA 4GXNA 3CCCA 3I6MA 5DTIA 4UFPA 1YR2A 2CUTA 1QLWA 4KE6A 3H1AA 4Y9SA 1LZLA 3DOHA 4UBIA 4FFWA 5IVDA 3YASA 4YPVA 4GDMA 5LZ5A 5CXUA 3DD5A 3B12A 3DDUA 5A71A 1QIKA 4X6XA 3WQHA 4IQ4A 3ICVA 1TCBA 3QM1A 5DTJA 3VDXA 2QXUA 1CUSA 2G63A 3STVA 3KD2A 4J0DA 1W76A 3G7NA 3MGAA 2C5FA 4L72A 5AO9A 4HRXA 1J2EA 5K3AA 3R40A 3S2ZA 2RONA 2LIPA 4KRYA 5ALGA 4AZ0A 2R8BA 5ALZA 3I2FA 3C43A 4RPCA 1XQVA 3Q0TA 1L7QA 1FFBA 4KAJA 1Y7IA 4BTVA 3W9UA 2RAUA 2WSLA 2XE4A 1ZD4A 4X6UA 2BAGA 2OCIA 4CIAA 1UKAA 2VT6A 2WQZA 5YASA 5JATA 1EI9A 3L1HA 4GI1A 3STUA 4CCYB 1T4MA 4JNCA 3G8YA 1SCQA 1A8UA 2VQ6A 5JZSA 2PSDA 3JWEA 5JZ9A 3ESAA 2RHTA 4Y2QA 2HRQA 5I8PA 4DMFA 2OG1A 2G5PA 4BCDA 1XRMA 2XQIA 1PFQA 3AUKA 3D0KA 3CCBA 4EY8A 1XZEA 4WY8A 3R3WA 4IO0A 5F4ZA 4CCWA 1F8UA 5SYMA 3KWJA 1SCKA 4YASA 2HRRA 2XUJA 1DWPA 3LIIA 3C6YA 3C6ZA 4EY7A 1U2EA 5HCUA 5C8XA 1BROA 5K3EA 4QDZA 2B61A 1DQZA 1THGA 1R1DA 4WFJA 5AI9A 2BGRA 1K63A 1XLWA 2VT7A 4I4CA 5AK4A 1CUVA 1OILA 3WKEA 3KDAA 1THTA 5CH8A 4Y7DA 3WWOA 5ALUA 1ZI8A 4Q1VA 3OC0A 1KEZA 1Q0ZA 2DQYA 3KXPA 4P93A 2QOEA 1T2NA 1R50A 1H2YA 2C4HA 1K4YA 2BUAA 4KR0A 1UK8A 4DGQA 5E4YA 4AMZA 4H77A 4Q82A 5AM3A 5LP1A 4EA6A 4QDOA 3DOIA 5I9IA 4HVTA 4QDUA 3LIPA 5DNUA 1UFOA 3KWFA 4ZV7A 3GBSA 1GQRA 3M82A 1QGED 4B9AA 4OB8A 4W9RA 2O7RA 3I2KA 2Y6VA 4RE6A 1ZJ4A 1MAAA 3ZLVA 1ODCA 1JT2A 5AHXA 3IBTA 2WUFA 2XQFA 3CN9A 2WUEA 4Y2PA 4U2FA 2HFJA 5A7GA 2HHAA 4AB1A 3DLTA 4LKOA 2EDCA 2JGJA 1XLUA 1XKLA 4P92A 4L3WA 1OXMA 2O7VA 4X91A 3WZLA 4C01A 5LZ9A 3WI7A 4OD0A 4U2DA 3QYJA 1Z68A 2PU5A 3WJ2A 4FTWA 2WFZA 3EF3A 2QVBA 2JGEA 3DYVA 1EXWA 3ZI7A 1J06A 1DX4A 4BZWA 5ALLA 3WA6A 4GW3A 4UHDA 1FFDA 2BUCA 5C8ZA 2RI6A 4PSDA 1E3QA 1UT6A 1BEZA 5CT5A 1XZBA 4B82A 1EX9A 1YB7A 7YASA 3WWDA 4PSUA 1HBJA 2HA0A 5HQ3B 3BWXA 5DJ5A 1N5MA 1K8QA 3I2JA 3H1BA 1CEXA 2XMRA 5CT9A 4K6HA 1PV1A 4BRSA 3HSSA 4W1RA 3A2MA 1CUUA 1ZOIA 4FLFA 3NUZA 3FVTA 1QTIA 4MEBA 4J03A 2AJDA 1GKKA 5D7BA 4ZREA 5HKAA 3IUMA 4A23A 1VZ2A 4BCCA 3W05A 3OTQA 4XIIA 4MWSA 5K3BA 2DHCA 4N5HX 1QFMA 3FCYA 1DT5A 2G4LA 4NVRA 2HU7A 2Y1KA 2HL6A 3I6ZA 1MNAA 1JMKC 4G8DA 3W04A 3G0DA 1XKTA 1R9NA 3VJMA 3F98A 2ACKA 1S8OA 1SC9A 3D4LA 4AZ3A 4DM7A 5AOAA 4W1PA 4FMPA 3H19A 1LPNA 3H0CA 2WIDA 3BDVA 4E15A 3FLAA 3FCXA 3OOSA 3ILSA 1QONA 2WIGA 4MEAA 5CH3A 4PW0A 2IX9A 2XB6A 3HLKA 3VVLA 1FFAA 4C88A 3BL8A 5FP0A 2XDWA 1GPLA 3PE6A 1VKHA 1QJ4A 4KE9A 2WG1A 1EH5A 1F0NA 2J4FA 1JJIA 4OCZA 5D3KA 1RYYA 4W63A 2J3DA 5JAPA 2W22A 5K3FA 2OQIA 5LIPA 1CUYA 2JBWA 4N5IX 1RP1A 5DLPA 4CG2A 1H22A 4C4ZA 1ZD5A 4XVCA 1MAHA 3M81A 3STYA 3QZUA 2QTBA 2WU4A 5LKAA 2OAGA 5KBYA 4N8SA 4Q34A 4QWWA 3G0IA 4B0PA 5A2GA 4BTLA 3FOBA 4QDTA 2WTNA 1BN7A 5ALVA 2XMZA 3T4UA 3IUNA 1DINA 4ETWA 4BAUA 5JD6A 1TIBA 3STTA 5EIHA 5AIBA 3W2TA 1BCRA 4LIPD 4H7FA 1JI3A 4BC0A 2ECFA 4BDTA 4QDXA 3ZLTA 1E5TA 3V9AA 1QE3A 3D7RA 1EDDA 4S0XA 1E8DA 1UXOA 3V48A 5ALKA 4FLEA 4F0JA 4X97A 2WIFA 4BE9A 3C5WP 5LKRA 4GWLA 1Q0RA 2PKYX 3WYNA 4Y2YA 1IZ8A 3D2AA 3WYDA 4RNCA 2DSNA 3P2MA 2J3QA 5LLSA 1YCDA 1CUZA 4O08A 1EVEA 2DHDA 5ALJA 2ZYRA 3U0VA 4QZVA 2GBCA 2OGTA 4AX4A 1QIMA 4X90A 2XQKA 5KWIA 3E1GA 1MO2A 3RARA 4E14A 1NX9A 4GBGA 3ANTA 2Y2VA 1DWQA 5A7HA 1N5RA 1QIIA 1EB9A 1HQDA 3AILA 1ZI6A 3STWA 1YASA 3DKRA 1IVYA 4J7AA 3G9XA 3K2IA 3ED1A 3WL5A 4FBLA 1LPPA 4N8DA 3VJKA 5C8VA 1LPAB 1EB8A 2WKWA 4QEKA 3SWWA 3UMJA 4CFSA 4B9EA 4D9JA 4RGYA 3QH4A 4G8CA 3G0GA 1U65A 4Y2XA 4X94A 2VSQA 1X70A 4OB7A 5ALWA 1YS2X 4U2EA 1CUXA 5BWBA 4C4YA 5D6OA 3FSGA 1YA8A 2V98A 1W6RA 1B6GA 4MYSA 5LZ7A 4J0HA 3BIWA 3HACA 4LXHA 5FUMA 1YA4A 1Y37A 4GECA 3EQ8A 1MX5A 3D3NA 6YASA 1HDEA 4ROTA 5CH5A 1LGYA 5FPQA 3RKSA 5CT8A 4DSZA 4DMCA 2HADA 5JD4A 3K9BA 1XZKA 4BATA 3F96A 4NZZA 3F9CA 4BP9A 3PF9A 3KSRA 1ODTC 2YYSA 5IKXA 3WL7A 1H2WA 2QS9A 1TKRA 3WWCA 2V96A 5HFNA 5JAUA 2WFMA 3FLEA 2OAEA 5JANA 4WDRA 4FLMA 1CFJA 4HAIA 4UBOA 4MWTA 3WK8A 5ALQA 3MUOA 1GQSA 1IUNA 4XJVA 1MX1A 1IUOA 5AIAA 4MJ3A 2GYUA 3G0CA 1ISPA 4UHHA 3DL7A 2XMBA 2BUBA 4BAGA 5ALNA 3H2IA 4C89A 2QMQA 3QBJA 3HYSA 5AI5A 2C58A 4PO3X 5EHZA 2WIKA 2XUDA 2ZJFA 5ALTA 5A7FA 3VVMA 4DNOA 1HL7A 2D0DA 5IVIA 1CUCA 1FJ2A 4ARAA 2ZYSA 1ORVA 4BDSA 4AO8A 2AJBA 1GKLA 2EDAA 1CUEA 4B85A 4JEIA 1LLFA 1GGVA 2HA3A 4HRYA 2VAVA 4QLOA 3LLCA 1XZJA 2OXEA 3V1KA 5AKIA 5K5EA 2WJ6A 1EK2A 4YX9A 1AC5A 2QT9A 1VJ5A 1TCCA 4Q05A 2FX5A 4MQLA 2HFKA 3QPCA 4J0KA 1QZ3A 3JW8A 1CUHA 5T4HA 1WB4A 1UK9A 4P08A 5JARA 3L1IA 1GT6A 1ODSA 4WFKA 2RHWA 2RIPA 2XMSA 3TRDA 1P0IA 5AM0A 1YB6A 4QWMA 1WM1A 2R11A 2PSJA 4BCBA 4Z49A 5AI6A 4BVLA 5EGNA 5AKLA 2XT0A 2O2IA 5T4FA 2HU8A 4W1QA 3JYHA 4OB6A 5J3JA 4WDQA 2AJ8A 5EHQA 3IVMA 2WJ3A 4UFOA 4PSCA 4EBBA 3H2HA 2BFNA 4QNNA 5ALHA 5H3HA 2CB9A 1XZHA 2OQVA 2VA9A 3R41A 4H7KA 2Q0XA 1XRNA 3S8YA 2Y2UA 3B3QA 3BJMA 1PJAA 4G1FA 4FKBA 4U2CA 4Y2TA 1DQYA 5AI4A 4K2AA 3PUIA 1DTEA 3RM3A 2C5GA 5AKKA 1R9MA 2V97A 3IB3A 2QJRA 2XUAA 1QIJA 2PUJA 4TPKA 4UBKA 4Y2RA 3EBLA 4KRXA 3A2NA 5AKJA 2HA2A 5FKJA 4IH9A 4OUKX 5KWJA 2XUPA 1QIDA 1ZGCA 3QPDA 1RWQA 4B6GA 3NGMA 1Q83A 3HI4A 5ALSA 2VF2A 3WKBA 3G02A 4DSAA 3BE8A 4UHCA 4WJLA 5D3ZA 4FOLA 4UUQA 3QITA 1CUIA 3IUQA 3I6YA 4HXEB 2FJ0A 2QUBA 2I3DA 3DJYA 1UK6A 3H04A 3X3HA 3PUHA 1QOZA 4G4GA 3F8SA 5KREA 2YXPX 5K3DA 5AKGA 5A62A 5CBKA 3GUUA 3O4JA 1P0MA 4IH1A 2OCKA 4ZGBA 1UOQA 3I2GA 3WZMA 4GEGA 1L7AA 3ESDA 2VEOA 1R3DA 1U8EA 1YSCA 1LPSA 1QIHA 4HXFB 3G9TA 3R3XA 1LNSA 5E4JA 4B81A 5HZGA 5JALA 1XRQA 1WB5A 5AICA 3TEJA 1ACJA 4X95A 3RK4A 1VXOA 1AURA 4IH4A 3FVRA 4B80A 1ZD2P 1GZ7A 1EK1A 1OCEA 5JD5A 5AK5A 3UUFA 4I19A 3RLIA 5CURA 4H7HA 3DKKA 4NMWA 2OCLA 2X76A 3FAKA 4X7BA 2XMQA 1XZCA 1HKHA 2QZPA 4L9AA 1ZI9A 4MQMA 3GZJA 5AM4A 2BCEA 5ALFA 3IURA 4TGLA 4EB0A 4FDMA 5K3FB 4DNPA 1AQLA 4BE4A 3FBWA 3NOXA 5AOCA 5LZ8A 1AMNA 1QIGA 4JUIA 2VAXA 3C70A 4E46A 1CUJA 1TRHA 1TQHA 4E11A 3G9UA 4DNQA 1C7JA 3PFBA 2JGLA 2PM8A 3FLBA 1UWCA 3Q8WA 5ALOA 1CUDA 1XZAA 5EI5A 1ZGBA 3O4IA 5JZBA 5EIEA 1CR6A 3WKCA 1ZD3A 1AKNA 3PI6A 3PICA 3NWOA 3O9VA 1CUWA 5HFAA 5SYNA 4K6KA 4UHBA 4B7ZA 3VXKA 1MT3A 1R4ZA 2GZSA 2VJCA 1MTZA 3QPAA 1IMJA 5FOQA 2AJLI 4X92A 3HEAA 2ROQA 5FDFA 1W1IA 5DWDA 3WIOA 2HU5A 1QO9A 4ARBA 1LPOA 2K2QB 3QMVA 4ZV9A 5EIAA 2DHEA 3IUJA 4BZZA 3WK7A 1DU4A 3BIXA 1XFDA 1XZGA 1GXSA 1JJFA 5JAHA 2PSHA 4BAZA 3T52A 3O9MA 3D2BA 5IVKA 2X8BA 2CMFA 2PSEA 1BEEA 4KEAA 4DTCA 4L0CA 1FFEA 1CVLA 3WA7A 4KYVA 1A88A 5T4EA 4RE5A 5ALPA 5ALRA 1QIEA 2WILA 2WIJA 3QVMA 5HF5A 2GYWA 1MJ5A 1EA5A 2XUGA 3W06A 3FNBA 1JJBA 1WHTA 2JGIA 3VISA 1XZLA 1XRRA 3HABA 1K6EA 5DNWA 2UZ0A 3QMMA 2QKYA 1CUFA 4AMYA 3FYUA 5FLKA 1UK7A 5BV7A 3D2CA 4FFVA 4DYHA 2DFPA 5C7YA 2OLEA 2I3ZA 1UZAA 4M0MA 2B20A 2PSFA 4F21A 5AKZA 3I1IA 1QTRA 5HF9A 4J0JA 5E2IA 1DT3A 4XX1A 3AIMA 1TK3A 2WHPA 2PBLA 3C8HA 4I3FA 3C8DA 1USWA 2PUHA 1WHSA 1XZMA 5LYYA 1N8SA 4QE3A 4YK7A 4H18A 3TJMA 2GBFA 3DNMA 4WFIA 4EUSA 5CW2A 1UOOA 3PFCA 1D07A 4KE8A 2WFLA 1A7UA 3CN7A 4DIUA 1A8SA 3HXKA 4Q3KA 1C4XA 5T4BA 1X2EA 1KU6A 1CIJA 2E3JA 3FSGD 3IULA 1LBSA 3DYIA 1JKMA 1LPBB 3ICWA 3F67A 3N2ZB 5EFZA 1P0QA 4OU4A 3B5EA 1L7RA 2CZQA 1VZ3A 4C4XA 4H7JA 5DYWA 2C0PA 4F60A 4A5SA 1N1MA 4H35A 3N0TA 5JASA 1SOMA 2BJHA 4HS9A 3QMWA 2FUKA 3O95A 4JH0A 3LCRA 5DYTA 1JFRA 1WOMA 4P9NA 1CV2A 2BGNA 3I1YA 3I28A 3E3AA 4LXGA 3ESCA 3WK5A 4Y2UA 4GHWA 4PV7A 3V1NA 4U2BA 2WG2A 1JU3A 3AINA 3WL6A 2D5LA 4Y2SA 5C81A 2PL5A 3DL4A 3WKAA 4F5ZA 3ZWQA 4MYDA 3MUNA 1TCAA 3VJLA 5IH7A 1ZICA 2XUKA 4J0CA 5ALXA 1E8NA 3O4GA 2G5TA 1MU0A 1J07A 4H7IA 3ZLUA 1MN6A 1XZDA 1IZ7A 1EDEA 2WM2A 4ZWNA 5AJHA 2QM0A 5CXXA 5HKBA 4ZRDA 1G66A 5AP9A 3D5EA 2HA6A 2JGKA 3H2JA 5AKXA 1J1IA 1O6GA 2XLCA 4EY5A 4AN0A 4WCVA 3UUEA 1XLVA 4U2GA 3WWPA 2BKLA 1H2ZA 1QO7A 1W4LA 1ZIYA 2GYVA 1JMYA 1G5FA 2H7YA 2PVSA 5K3CA 2CEKA 3BJRA 1YAJA 1BCSA 4CG3A 1VE6A 4LHEA 5AK3A 1DX6A 3WK9A 4FHZA 1XZIA 5ALDA 2HA7A 5FPPA 4FNGA 2Z8ZA 4OU5A 3AIKA 4HXGA 5HF6A 1ORWA 2XQJA 4X3CA 4Q3LA 1BU8A 4KAFA 2QRUA 4PQEA 2WJ4A 4BYMA 5AI8A 5AKEA 1WPRA 5JIBA 2C7BA 4X00A 1UKBA 1K5PA 2ZYIA 4CCYA 3AZPA 3DEAA 4HZGA 4J0GA 2WU3A 4DMHA 2B9VA 5BWCA 4Q3OA 4N8EA 2H7XA 1CPYA 1E66A 2XUFA 3FYTA 1HPLA 1R88A 4DMKA 2B4KA 4W1SA 3D59A 3STXA 1ZJ5A 1XROA 1EHYA 1CUAA 2OGSA 1IUPA 2ZSIA 1XZFA 5DYYA 2CBGA 2X5XA 4EZIA 1CLEA 5IVHA 3OPMA 2XLBA 4LXIA 2VJBA 4TVKA 1AGYA 1BE0A 2WHRA 1M33A 1ZIXA 1SFRA 3C87A 5AM2A 1F6WA 3DQZA 5LZ2A 2GBIA 2JGMA 2PU7A 4BC1A 5ALIA 1TAHA 4UBMA 2O2HA 2HA4A 5CMLA 5JAOA 4UFNA 3EQ7A 1LZKA 3OURA 2YH2A 3FWHA 3DCNA 2OCGA 2Z3ZA 1EDBA 4MXDA 4XWGA 1MNQA 5A6VA 4OYLA 2GZRA 4CG1A 2PPLA 4IHAA 3AZOA 4H0CA 3C6XA 4J0IA 5JADA 3WMRA 5CT6A 1AX9A 1EVQA 5AKYA 3K6KA 3C6BA 3SX4A 3DS8A 1AZWA 2ZVDA 4BVJA 4EHBA 3WKDA 4DNFA 1MPXA 5ISMA 1SCIA 1C7IA 1QFSA 1VOTA 5HF8A 4GLBA 4KAAA 3WJ1A 3WLAA 3G9ZA 2DQZA 2H1IA 4LYDA 2ORYA 4UHEA 3CXUA 4G9GA 2NW6A 2IIVA 3M83A 4QLAA 5CT4A 1UOPA 3BF7A 3ESBA 1EINA 1BS9A 2YASA 2ZJ6A 3EIOA 3IIIA 3OG9A 4BRZA 2VATA 2XUQA 4HTAA 2VTVA 5FXMA
chains in the Genus database with same CATH superfamily
4I55A 2YN0A 2IPLA 4YI3A 3AFIA 4JVSB 4POAA 5JZVA 2Z4TA 2D2EA 5HIIA 3RQIA 4N5DA 5WRFA 2GVZC 4QQKA 1EDZA 2DUUA 3VR6D 3WQRA 3TNJA 4WY5A 4QYIA 4KXXA 3KOZA 1PJLA 2ZBEA 2OHGA 4AN1A 5A0TA 3Q3IA 2X5JO 2CFIA 2Q3CA 1ADGA 3BFKA 4MVJF 3TB6A 2R79A 3UJ8A 4V2IA 2FQXA 4ZK2A 1D2MA 3GVIA 3BF8A 3AO0B 4KE7A 1O0SA 2QJWA 3VR6A 5KDDA 1VCOA 1J6UA 3D8BA 2ZULA 3AJDA 3H3JA 5DNVA 1E89A 2HRZA 2YXDA 1OH7A 1HZZA 1D9ZA 1BRTA 3UO8B 3D6MA 1LF5A 3CINA 5EA2A 1X2BA 3WLFA 2JEYA 1JEYA 4ZPXA 2ODAA 1ND6A 2GAAA 3OCVA 1QBKC 1XE3A 4JOQA 5JI3E 4YGYA 1AQUA 2DWUA 3KUUA 4QFCA 4X44A 4ZYZA 5FYQA 3PPVA 1AXEA 2HMAA 3MVEA 1Q1BA 3R3UA 4IEIA 4KQCA 5D00A 5G4KA 4I1YA 4A8TA 2RGCA 4BRWA 2W4QA 1KZ6A 5ENDA 5TLSA 1QIFA 3DAGA 2ZR7A 4PNZA 3N74A 4XUCA 2YUIA 1HY3A 2L69A 3VC1A 1A9TA 2VH1A 1ANKA 4L50A 1TM2A 5J5VA 3I2IA 1JVNA 1QJCA 2VJDA 3EBOA 3GFVA 3QFFA 2HI0A 4UU7A 1MZVA 4YJFA 3ZCRA 2Q3LA 4EHHA 5IAJA 4DW8A 3RYHA 2QL5A 1UJMA 2IF2A 2Y05A 4ZI5A 4KHZA 2ACEA 5K0GA 1RADA 1KJQA 4CF5A 5ALEA 2Y1XA 2ZT7A 2ID8A 1VBFA 1PW5A 2QUAA 3K8QA 4H7EA 4HLUC 5A9TA 3ZY3A 3F2IA 4X93A 5ERXA 1W30A 4UXJA 1X13A 4WESB 1VG0B 2PA0A 2XUOA 3GLGE 4F6RA 2BFCB 1WPXA 2O3QA 2RIRA 3I34X 2Q41A 4AIRA 5BPFA 1JTEA 5LQAA 2O2YA 1PYDA 1ISHA 1ZAYA 2EBWA 3FGOA 1GCGA 4B4VA 1Z75A 3BJIC 2GK3A 3M6LA 3MMZA 4BBAA 3W9BA 1USVA 1QAOA 3JVEA 4XRRA 1Q7RA 2JL1A 4ZO9A 1A2QA 4QXOA 5CD1A 1P4AA 2WTMA 5EZQA 3URKA 4D81A 2XZOA 1SKQA 3S4YA 4F04A 2PFGA 1Z0IA 4R9VA 1L4MA 4C22A 1ZMOA 2PG3A 1GCAA 3HZOA 8AT1A 1O94D 4K9PA 4OPMA 4G97A 2AIRA 2XT6A 4WCFC 3UENA 3KKMA 1WVGA 3T5PA 7AT1A 2XAUA 2COEA 1MMFB 3FB1A 3EXEA 4GPAA 5EWLB 2FWIA 4F4FA 5A3RA 1TVKB 3P0FA 1XD2B 4HHEA 4XR9A 5K8TA 5HK9A 5JYCA 2P4SA 3SQXA 4PYQA 4AAYA 4KMOA 1S2MA 1O94A 4MLCA 2Z5GA 4BP8A 3DZIA 2ES4A 3NS7A 3IUBA 1JQ3A 1J4AA 3G6KA 4JZKA 4KSYA 5FAKA 1W4CA 3M5PA 1LBTA 3NHJA 5C8YB 4FIDA 1FUKA 2G82A 1S3GA 2O20A 1DAFA 2VJAA 4QOEA 4ALKA 4B3SB 3FOWA 3GROA 1V11A 4Z86A 4RSHA 1QWOA 2YFHA 1G2OA 3TTYA 1F2DA 3AEQA 4CLOA 4BVGA 3U6KA 5F1OA 3UGTA 1IN8A 5CTAA 2O5VA 1VA4A 4I1IA 4CIBA 1Z18A 1FP1D 2XMDA 2YZ2A 4DCOA 5L4LA 5TV2A 4HOYA 4RH1A 3MQFA 2YJ6A 3E0XA 2JJ1D 1DC5A 5CPFA 1VCMA 3FFXA 2QPOA 1W93A 2XMGA 4HN2A 3W8FA 1CJMA 1NASA 1NVTA 3EFBA 3GFTA 3KFVA 5K0ZA 5EJ8A 1GKIA 3HJRA 4NAVA 1T5DX 3JV7A 2GN8A 2H4HA 5KNCD 1OOEA 3IHWA 2I67A 2YZMA 3EIWA 3L07A 3Q6MA 3SIXA 4DYVA 2QMEA 3G8BA 3DLBA 2JJ1A 1MJFA 1SQGA 4N0QA 1J2YA 3O91A 1YAHA 3T9FA 4FWIB 2W90A 1ADJA 3ULKA 4B6RA 3GD5A 5KU1A 4RZ3A 1N3IA 1L4FA 5CNJA 2C4UA 4PX5A 5LZ4A 1GILA 2A5YB 4MWGA 5KNCA 4DDHA 2WJWA 2WBLC 3ACCA 2D5AA 5BRJA 2WHPB 3GLGB 3U1BA 1CQZA 2DJIA 3TR5A 1DIAA 2I91A 1IZ9A 2WHXA 3C3XA 1SKUA 3N28A 4D9EA 3A04A 4V2UA 1A9ZA 4G89A 3EVZA 4LMRA 1DG9A 1E98A 1G8KA 4WKCA 5I9SA 5B1DA 2VDWB 5JJCA 2B0CA 3AR9A 4HDQB 2ZFUA 4YCJA 1L1QA 1ZHOA 2XNSA 3AVXA 4HB2A 3QKIA 4JYMA 3KHTA 5BVHA 5B1SA 4NHOA 2H7CA 5JJLA 4RANA 3L84A 4OMCA 1KZ1A 1RAAA 4R7TA 5HBGA 1Z9BA 3SJBA 1RI2A 1TAQA 1RWBA 1XNJA 2A0YA 5LQNA 2CHGA 5C1OA 1WBBA 1P0PA 3KJGA 4AULA 2W7TA 4RGBA 4IX9A 1KZ4A 5DBIA 3U4QB 3EEIA 1IU9A 1YCFA 1CRPA 3TAUA 1FLNA 1K97A 2ZAIA 4Y0AA 1PFVA 2W37A 3GA0A 4U7WA 3JQQA 2QIOA 3S68A 4ZDWA 3Q87B 1URPA 1AKQA 1WUIS 5KNBD 4LSWA 3SI7A 1GUAA 3ENWA 3MS7A 2RMKA 4KGZA 4W7IA 3TOXA 4AI6A 1Y3DE 2GZHA 3AETA 1NR5A 4RV4A 1C2TA 2BSAA 3HXTA 4EKDA 3WL8A 2FPPA 1QYDA 1M66A 5AM1A 4ZZ2A 2HLDD 3A6KA 4MTCA 3IEPA 3QLVC 1H9BA 3TGLA 2XTZA 1FSSA 1WDMA 3GJ3A 3L0CA 4FUTA 3BGSA 2RK4A 4OQQA 4PR0A 4S1WA 4AP5A 4C07A 1TIKA 2CJXA 4KKVA 4L78A 1Y98A 4QAQA 2WPNA 5ECGC 1EM8A 4YAEA 1FPMA 3MQ4A 1ONBA 4J3FA 4HYEA 5EL0A 3P2EA 5TJHA 1JIIA 6LDHA 1EYZA 2HLDA 3P19A 2FRVA 3VPXA 4YXWD 3IAUA 4OI1A 4U4AA 3AHEA 2I6XA 4NYMQ 5EPUA 1T13A 4O0MA 3CLVA 5CW1A 5D3MA 1WCXA 3LM8A 3NDRA 3OIUA 1K7YA 4S24A 4KAXA 1W52X 5DX8A 4P3PA 1AUPA 3HB7A 1MVNA 2SKCA 1U0EA 4CKWB 3HGMA 1T1RA 3LL7A 4PYJA 4YCMA 4FT2A 4YXWA 1X1EA 3F9RA 1FLDA 1M2GA 4E09A 3D1JA 3NALA 1RQRA 4XWKA 1YR8A 4O8ZA 4OGLA 4IKEA 2JD2A 4FGJA 4YRKA 5KVSA 4YP1A 1XTUA 4K5QA 2H3EA 1ISFA 2GD2A 1E4EA 1G4HA 3KTFA 3TPCA 3QWFA 1JEJA 1F5NA 3ET5A 4FDAA 4YNBA 5KTOA 1XU9A 2HPVA 2OOKA 3E61A 4FNMA 1E8MA 4JOSA 2GFHA 2IHVA 1NVFA 4WIAA 5LJLA 4BNDB 3TD6A 4E4YA 3U60B 3NB0A 2UUBB 2H07A 3PIDA 5FV4A 3OTOB 4BMNA 3MTAA 3MW8A 1ISIA 2WZQA 1I7QB 2HMYB 2VWPA 3KFLA 3L7CA 4G4JA 3UB3A 4JFAA 2CLLB 3ZEAA 1E2NA 2FOIA 4UDOA 2JANA 1JLMA 4WACA 4UE2A 4UNIA 4E21A 1QYRA 1N1EA 1A9PA 4K6OA 4WZBE 2E82A 4FEGA 5M7EA 3IHTA 5CYOA 1NU6A 3GA7A 1M74A 4IIYA 2H2GA 1QHHB 3FUWA 1UDAA 2YWGA 1PDOA 4WXYB 2ZBFA 4PZAA 2I80A 1X3SA 1Q95A 4HY3A 4KFTA 3ZYZA 2MSKA 3MF4A 4B3XA 4URWR 5KNLA 5KHAA 2VHJA 1PU2A 1ACLA 3DMFA 4FQ7A 1SUEA 3MAAC 1EEHA 1HI9A 1P8AA 2OHIA 5AI0A 3K0FB 3K8YA 1II9A 4D8VA 1RDFA 5LMNB 4HDKA 4DPLA 1SUDA 3DOJA 1U4NA 3AIOA 4FE7A 4YRFA 2XVAA 2ZYDA 4UBJA 621PA 1Z29A 4MW5A 4AVYA 2OD9A 4P34A 2Z56A 4W6ZA 3AI1A 5FI1B 1NNEA 4PBTA 4QOFA 1K9VF 3DUWA 3ZV7A 1VA5A 1VG8A 2DBZA 2EV9A 1XMJA 2IELA 1C81A 1DXYA 4JP5A 3UJ9A 2VPIA 4A6DA 1B0ZA 3ANLA 4WN3A 5H82A 2BSXA 2VZLA 1Y4ZA 2IPXA 1CRQA 5DTIA 3JALA 1SU7A 4QU8A 1K7CA 2FE1A 2ZBQA 5CA1B 1KVSA 1XUOA 1YR2A 2M6RA 1CZRA 2V74B 5B30A 2ZXUA 4Z4QA 3OZBA 4KMSA 5EXSA 4Z4FA 4KE6A 3FKJA 1N33B 5BN3A 5DXAA 1A69A 2YKGA 4PZZA 4FFWA 1XAGA 1N2GA 3YASA 2Z9BA 5BNWA 1ZZGA 1RLUA 2P75A 2HX1A 3EH2A 4NBLA 4PRZA 3TB4A 3B12A 5CXUA 3DDUA 5KX5F 4BIIA 3HXMA 4M7RA 1SGWA 4X6XA 4OMUA 5FJJA 3AEYA 2KMLA 3WQHA 4AS3A 1IZYA 1PJ2A 1VJRA 1T2VA 3PFWO 3KTAA 1QH0A 1TK9A 3HJHA 4B5LA 2DFDA 2GKGA 3H5OA 3AHFA 4LHVA 5JDCA 2H16A 1FDWA 1BJTA 1R5NA 1O96A 1W76A 2BH2A 3AV0B 3G7NA 3H5NA 1L1EA 4FHCA 2DQ4A 2IHZA 5EJGA 5I9MA 421PA 3PP8A 1DFHA 2EFGA 1FMTA 5AO9A 3VU8A 1AUXA 4HRXA 3EXG2 3K0EA 3RAEC 4DR7B 4PYMA 4DCGA 1SRRA 3V8MA 4MCIA 1QYVA 4PYOA 3SNHA 1NF8A 3OU2A 3R40A 4RHTA 1R5JA 5EVJA 3ZK7A 2VOJA 4TQGA 1SCUA 1MQSA 3HKCA 5FBZA 4KRYA 3A58B 2YWFA 3LPLA 1PO7A 1HA3A 1ZUWA 4RLHA 1M54A 3BPSA 1XL0A 3LQFA 4MOWA 2VP2A 3HA3A 4RPCA 4EY3A 4UQOA 2XW6A 4F4JA 2VNIA 1DV1A 1ADFA 2YHBA 4K86A 1RAIA 5DB4A 1EUDA 3T5TA 4WZBB 2PGDA 4CDMA 3KVRA 3PC6A 3QWAA 1IN6A 3B9RA 4IFBA 1NW7A 4MVJP 2NQ2C 2XGGA 1FFBA 1LC0A 1IEVA 1Y1PA 1M2OB 3DUFB 2FP4A 3JAKB 4BTVA 3V2IA 4UNRA 5BSEA 2PWPA 4R9UC 1E7WA 2UVPA 2WSLA 5IF9A 3HL4A 3GJ7A 4B4WA 2BAGA 1OFTA 1VRWA 1Z2CA 2OCIA 3R4CA 4NTZA 1GPMA 4R5MA 5FUWA 4OHPA 5B37A 4D4JA 4OXXA 4PC2A 3WFIA 5KVAA 4C0LA 4MUAA 2OGUA 2NNLD 5YASA 1MENA 2FEAA 3E2IA 3EVEA 4UEKA 5JEDA 1YK0A 4RUKA 2CVFA 1KYQA 3ILXA 4OQZA 1IOVA 2X6RA 5EMHA 4S2UA 2KPOA 4OP2A 3OQMA 3KUKA 1EM6A 3IMKA 1F0YA 2DY0A 2RJNA 3STUA 2OUIA 3F4KA 2OXCA 4JNCA 4CCYB 3M6XA 3MTJA 1YDFA 2ASVA 4CR6A 4Q3BA 2VWQA 1W9HA 4IF4A 1CF4A 1FVFA 2NYUA 4Q9DA 3P20A 4RL4A 1A8UA 3G23A 2AN4A 3PPYA 4A0FA 3JWEA 4Z7JA 3MFQA 1A97A 2ZE7A 5JZ9A 3ZLJA 1BSVA 1XJQA 2QPAA 3CEJA 2G07A 3P2OA 2AG0A 3DAOA 4IFIA 3KYDA 5I8PA 1PSDA 2OG1A 5TPZD 3UV3A 4BCDA 3KOWA 2EFEB 3KM0A 4TMYA 2JAPA 2VFAA 2XF8A 4OMFG 6GPBA 3H99A 2LGJA 3D0KA 1XZEA 3TLXA 1JWLA 3BGOS 1DKMA 2VUSA 4R5HA 1JH8A 5TGTA 2VH2A 1IONA 1V25A 3UICA 4B47A 2DVMA 3DB1A 4UW9A 5TPZA 5LU8A 1M34E 3OQIA 3ON5A 2WTAA 4FFOA 2V55B 4DLLA 1UJ6A 1F8UA 1RTTA 3A6LA 1A4XA 3K94A 3OF5A 3NONA 3PNYA 4M2LA 4P36A 2CFOA 3JVDA 5B1IA 2E48A 3IVCA 3L6EA 4Q24A 2IDMA 3GG9A 4ZT7A 4DABA 1SCKA 2AUNA 2WSIA 4KWCA 4OJQA 4LYYA 5KYUA 2G5GX 3EG5A 4ARIA 3GAMA 2A2ZA 1B15A 1XMXA 1YCGA 3ZWNA 3VU9B 1SZPA 3UT5B 3UGKA 4A2CA 8OHMA 3QF4A 3K4PA 3C6ZA 3ZH2A 1W96A 1JIKA 3L1UA 1CETA 3DDWA 5JHHB 4ZP1A 5KU7A 3COYA 1H4VB 4WSOA 1U2EA 1I4OA 2XYGA 5EOVA 5HCUA 5C8XA 1BROA 3L9XA 3MWEB 2WOJA 2DFKB 3OZTA 2PSSA 5KYTA 2JHGA 4JNKA 4WFJA 3W2HA 1LDNA 1O2DA 1CHDA 1ZMBA 3NKFA 4EB8A 1HE3A 5D3QA 4CHGA 1NJGA 3L8MA 5ESDA 4EKEA 4ALMA 4X0EA 5CP8A 1R3UA 3A31A 4I4CA 3GB9A 3MCTA 5AK4A 1PUIA 2CL5A 4N49A 3SHFA 4Y0VA 4ENTA 2IZOA 2GZ3A 2Z04A 3C7KA 3CEMA 4L9RA 2CLSA 3KDAA 1ZMXA 1J8YF 3PA6A 4DLUA 4OHVA 3CLHA 3D43A 4US2R 3VYTB 3DMDA 1Z6YA 5HSGA 4QICA 1KQOA 1U8ZA 1MX3A 4I8DA 2WNHA 3E0QA 4MDYA 3D9QX 1FS5A 2QMUA 4BNFA 1N25A 2PMDA 5GOTA 1KYTA 3BHIA 3RG8A 1TCVA 4OF4A 4AKIA 3D4PA 3T0FA 3REGA 5F7JA 3VSBA 2BUAA 2ZBPA 2WE8A 4KR0A 5MFZA 4TMZA 1KQPA 1Y9EA 1YKGA 4H77A 4ZMRA 2BP7B 4TWBA 3WGOA 4TXMA 3ROKA 3FZQA 2REQB 1MXFA 1EG7A 1YQTA 1SCNE 2EZ4A 3DOIA 4HGOA 2PUGA 2VN8A 4HVTA 2OBXA 4RFSB 3W5HA 5E6RA 1YL7A 1QQ6A 4QM7A 2ZRDA 5G3ZA 2G5CA 2HF8A 3BGVA 3GBSA 3KOYA 3M82A 2P0AA 1B3BA 1QGED 3PU6A 3QVSA 4L76A 2GFQA 4W9RA 3NHRA 3JTEA 2O7RA 5DEOA 3H2ZA 2J9RA 2Y6VA 3I2KA 1MAAA 2FK7A 5FTKA 1C3JA 1WW8A 4N54A 2PQ0A 3PHBE 3ZLVA 1G4AE 3KE8A 2QUJA 2J0UB 3SYLA 4MYUA 3SEZA 3O73A 4UE6A 3PXGA 1U8FO 3O6VA 2AN5A 1ODCA 1JT2A 4CCAA 3EMBA 4BGDA 5HFJA 4BNIA 1M34B 5EJ4A 3LT0A 4G07A 4F2GA 5TJ9A 5EUBA 3TEFA 4MS3B 4INPA 5JS1A 1BXRA 3WLEA 1L7PA 5HKLA 1US8B 4JAVC 4L6AA 1G19A 2J9GA 4MIEA 3ZVLA 4LKOA 2I7XA 3JQGA 1ZH0A 2A35A 2JGJA 1IY2A 1UP6A 1SXJE 2AOUB 4O2LA 4W8OA 5DYIA 3WNVA 4EJFA 4LXQA 3NRCA 3HPRA 3TE7A 8ATCA 1KI1A 4PGGA 1GPUA 4P92A 4LF7B 4EFDA 4P6VF 5A6SA 3WLLA 4PZDA 3KUXA 2VJKA 2WF7A 1E20A 2PLAA 5TRTA 3MBKA 1NI3A 4INAA 2V9CA 4PSVA 3TQIA 4TYNA 1TO1E 4HQRA 4QUDA 2FMUA 3VI4B 3AKCA 4MK4A 3W2GA 5F7OA 1UJCA 3PPWA 3WZLA 3LW8A 2R5FA 3IO3A 4RD4A 1E4YA 4CFYA 4IJVA 3IAFA 4C01A 1U6JA 5E2AA 1JKJA 2GZ1A 3WI7A 3AFGA 1E2LA 4NCBA 3K8OE 1KQGA 3VPFA 3MTDA 3W2IA 1FSFA 3WRWA 1TMOA 1M1NB 1PDWA 2BHRA 2FFAA 3FNQA 4R54A 4RY9A 2OXTA 1U0TA 2QW1A 4O2BF 4G0PA 4IXWA 5K8VA 4I5FA 4ER7A 2X8AA 3ER9A 2CYAA 4DLWA 5JTUA 2JBAA 4G1UC 2ZJAA 5HJ5A 1I33A 1KAHA 1NBAA 3WJ2A 5L51A 3LSTA 1HR0B 2QVBA 2FZKA 3KALA 1NG9A 1MHTA 2HW8A 1OX6A 1PL6A 2IYLD 1QVZA 3RJMA 3IV6A 5DCYA 3ZI7A 5IKMA 2B8WA 1J06A 1PVVA 3ME5A 4TV9B 3T34A 3DZKA 4GW3A 4H0FA 4LNHA 1H0RA 2R751 5LUAA 1MR3F 1FFDA 1XVUA 1PFYA 5BNFA 4W5OA 2X6QA 3DE6X 4JQOA 4U02A 3PR1A 4D9MA 5C8ZA 2HYDA 3LF1A 3LF2A 3TPZA 3IQDB 2G4VA 1RRVA 3DR5A 3WGIA 3MCAA 2DULA 1Z7EA 3JS5A 3TLZA 1UT6A 3GP8A 1AKUA 2BE7A 1XZNA 4KN8A 1SJ9A 5FOUA 4ID9A 1D1QA 3P9QA 3TVYA 1K4MA 1JMVA 3IMGA 1PJ4A 3B2NA 3E6AA 3RIGA 3JCZA 4B82A 4F56A 1EGVB 1RQGA 2WYHA 4RVOA 4Z53A 5CDYA 3KVOA 1JBQA 3WWDA 2B9EA 5AMXA 4RKRA 4IDHA 3WGNA 4BMDA 5AUNB 2OFOA 1JHPA 3QG5A 9ABPA 1X19A 4NEHB 2A6PA 1XB2A 5DJ5A 5BR4A 1HG1A 2AK2A 4M1OA 4DN6A 3I2JA 5TX7A 3U7FB 4FYIA 1P7VA 1EGQA 3G1UA 2BONA 4G5RA 3UKDA 5CT9A 3GGOA 3LTEA 1W46A 2GEFA 1X8XA 4R1LA 3A2MA 4C30A 3I6QA 5BNTA 1XPOA 4BZQA 1ZOIA 1VHQA 1YHZA 2R66A 2QVLA 3FPEA 3BHJA 1D2EA 3JSAA 4FR2A 3RRNA 3NUZA 4G0UA 4JQZA 1V1MB 3FCOA 3FVTA 4MKIA 4LS3A 3EEFA 5KSOA 4QJIA 2IBMA 4L8VA 1XKXA 1VMEA 4MEBA 3DDHA 1RWVA 1WDKA 4IMRA 4EP1A 3QVLA 4HYQA 1CSEE 3E7WA 1HZZC 2Q5HA 4J03A 1LRJA 1YACA 4DL9A 2QTVA 5LWQA 1UBUS 4MDHA 3IP8A 2WP0A 5D7BA 1U98A 2JFZA 1I6LA 2IVZA 3IUMA 4ZREA 2RI0A 2QTAA 3OPNA 1ZX1A 2I6SA 5M04A 3RROA 3I4FA 3HKDA 1AKWA 5AW6A 2VP3A 3UBMA 3UUWA 1E96A 2I8AA 3AONB 1NRIA 4MVYA 2YHIB 3OZCA 3LVRE 3MOSA 3O93A 1SEVA 2G6BA 2HZ7A 3DCJA 3C6MA 2QMHA 4KPUB 3F3YA 1XLTA 2EZ9A 3FCYA 1DAMA 3IE2A 2E18A 4CWAA 5BUSA 3EUEA 2WY2D 3QEJA 2G4LA 5JMPA 3PITA 3FZEA 2IIPA 3B89A 3LUHA 2G70A 4NVRA 3VFDA 2E4XA 1OBVA 1ZGAA 2RD2A 1TFRA 2OO5C 1X80A 3SQNA 1MAWA 3FKQA 4QUJA 3GJ5A 4RKFA 4TX1A 3V8RA 4WNCA 3WLHA 3IBYA 1H05A 2WK1A 4H1HA 3WP1B 1KEEA 3G0DA 1FDVA 2XY4A 3C1AA 3VJMA 1QV6A 3LDHA 1DARA 2ACKA 3N7UA 4GE0A 1T4CB 2V7VA 3B3JA 4LC0A 4Z0NA 1FF9A 1MIOB 5HIAA 1SC9A 3D4LA 4ND6A 4U00A 4ZKEA 2V8OA 3UWOA 4AZ3A 4F7DA 5BV1A 5FHQA 5IARA 3A6PC 2CT8A 1ZJYA 5JD3A 3MJ4A 4U9IS 3TQCA 2ZT8A 1CZLA 1YUBA 2AT1A 2WIDA 3BDVA 3TM5A 2FEOA 3UAOA 3OOSA 4JJFA 4Y1RB 4NV1A 2EARA 3TEMA 3VPHA 2X4IA 2ZZKA 2HDOA 4CU2A 4GP6A 5EC8A 3ILSA 3R6DA 4BFLA 3FSJX 4MGIR 3EJ6A 4MEAA 4UVIA 5CH3A 4Z9YA 1R0WA 1GPBA 4BFCA 3ICOA 5JXGA 5TQ2A 2AI2A 3NGXA 2JPDA 1YQQA 3EIFA 4QJ4A 2XWJI 1LD3A 2FWMX 2ZIFA 1N9GA 1XCLA 8ABPA 1BDHA 3QBEA 4WI1A 4C88A 1TCUA 2BFMA 4D0RA 3ZJ4A 2CHUA 3F7TA 5A5EA 5CG2A 1IXYA 1H42A 3OAAD 1O94C 1OZ0A 1KFBB 2R1TA 3SIWA 1XTBA 3TJZA 4E3WA 1TAUA 2P9ZA 4KE9A 2OSBA 3DEYX 2WG1A 2FFRA 3QSGA 2I2BA 1F0NA 1KETA 2Q4RA 1JHXA 2YFYA 3G1WA 1AO0A 1EQAA 3H4MA 4A8HA 1UKYA 2DKNA 3CEAA 1V16A 4JT2A 4KQIA 4P4SA 2VZ0A 4Q01A 5JSYA 5BMVA 3AP3A 4YO8A 5F23A 1G17A 2J3DA 1JEQA 1YVRA 1E9DA 1ZS9A 2NQTA 1HETA 3GUZA 3OAAA 4KIUA 4D9GA 4EX7A 5JAPA 4AJ1A 2ZS7A 1POXA 4IGKA 3FMPB 5K3FA 1ZVKA 4JZYA 3SEAA 5ARBA 3CUVA 4MPJA 4LOAA 4M76B 4AF8A 4YACA 3RRFA 4FINA 4IG9A 1UPUA 4C7OB 1H22A 3F7OA 4G1CA 1UJ2A 2ET6A 1KK0A 2NYAA 4D8TA 3JU3A 1BVRA 1GUDA 2BFDB 5BORA 1E0KA 2VTBA 4QSMA 5EG5A 2FPOA 1MOSA 1SK9A 5HE8A 2JFPA 4DCJA 2NU8B 1MJGM 1R5BA 4Z54A 3WADA 2OAGA 2GD1O 4KXNA 1ZEJA 2IEIA 1X9IA 4QWWA 4B0PA 5A2GA 4QU9A 4COKA 1GRQA 4CDNA 4B46A 2JAXA 1YD7A 2WTNA 2GAIA 3GP5A 4LZJA 3S8MA 1JDJA 2FSGA 3I9FA 4MI9A 1GSOA 1HGXA 2A1TS 2I71A 2BFCA 3FCAA 4F9GA 1ESDA 3QTTA 1XCBA 1DL5A 1T35A 2EYUA 2ZQZA 3K1ZA 3TLAA 4R7ZA 5ALVA 3PQ8A 3T4UA 2AMFA 2Z8YM 3IUNA 2XXJA 4PZLA 1Z35A 2DBYA 4LWOA 5EP4A 4TYWA 1EBFA 2E9SA 1DINA 3DTVD 4ETWA 3T06B 4DCNA 1E3SA 1XDBA 2L17A 1RRFA 4BAUA 3EE6A 5JD6A 5EP2A 4LZLA 1TIBA 2H4ZA 2C3MA 2ONZA 1TNDA 1SCJA 2II6A 1W36B 3L8DA 3KSMA 2F62A 3TW6A 2PXXA 1Y9JA 1EP9A 5AIBA 3DTVA 4BMZA 1BCRA 3DWIA 2OZVA 4GOOD 5BQ3A 1JI3A 2QK4A 3L0BA 4OGFA 4B09A 2QE6A 2A0XA 4DEVA 2PJDA 1EP1B 1U7PA 3TKYA 3OOWA 2GF2A 2IYPA 4PGFA 3KZVA 3GLIE 2X2FA 3DHYA 3QUAA 3ZGLA 2IV3A 1PJRA 5JOQA 1O77A 1L8QA 4TZTA 1L8OA 1H1DA 1R8SA 4YHHB 3U4AA 4QTYA 4ZVLA 1QE3A 4M21A 4DWOA 4N0MA 2J08A 3D7RA 3ZW9A 3CH5A 2NUBA 4GSLA 2O1SA 4JI4B 4JXXA 5LYJA 1UXOA 4M89A 1Q1GA 3V48A 3UG6A 1G6OA 5CFRA 3S2GA 3VNSA 1QRRA 1NBMA 2OE2A 1N7GA 1ZEMA 4J9UE 3CQ9A 2WIFA 4N7RA 4X97A 4XWAA 5MGNA 2AQ8A 5IG2A 1IN7A 4CEJB 3TZHA 2XEDA 1Q0RA 2E5WA 2C98A 1DELA 3WYNA 2I1VB 2O3UA 3A7DA 2DU8A 2RARA 4DJDC 2XDQB 1SCDA 1T0UA 4TTQA 3KEFA 4BN0A 4FJ2A 4Q4DA 5EXPA 4NU5A 1BFUA 1IZ8A 4GMHA 4OEHA 3HUDA 1DJLA 3ZQ6A 4F1JA 4PS1A 4ZC1A 2VHXA 4PFJA 5A3JA 1XYYA 2J3QA 1S4MA 4N03A 4DCMA 4F45A 1CUZA 4YCLA 1TYBE 4EZEA 5IJ0B 1QG6A 2D8AA 1T2CA 4HPJB 5I45A 2OB2A 3OD1A 4BO0A 1N2CA 4GBED 2JDID 1PLKA 1STOA 2IU3A 1E92A 2PWYA 3OPYA 3V3TA 1N5OX 2ZYRA 1NAIA 2R2AA 4C21A 4E5UA 2EF0A 1Z4QA 1F48A 4NBKA 4AX4A 4TKMA 4HZIA 1ZW1A 3RU7A 2FETA 2P5UA 3E1GA 3U7EB 2GN6A 1IZZA 2O0MA 3KYBA 4RJIA 1M2KA 2MYNA 2JDIA 4GBGA 3U7QB 4DE5A 4G63A 2WYVA 1T2UA 4TWZA 5IAAA 1OTYA 2RHBA 2UAGA 1R6XA 3NDPA 1DWQA 4PQYA 1FUIA 5A7HA 3RIXA 1N5RA 4OGWA 4P4TA 4MQ6A 3UXHA 4EHLA 2C4MA 4MRAA 2NVUB 3X1MA 3AILA 4R3WA 3NWEA 3STWA 1TA9A 1H0SA 4JBGA 3LVQE 4MQUA 3KR2A 4Z99A 1BXZA 4YRDA 4C43A 1DBSA 3P26A 1RCTE 1M76A 3D8NA 3G9XA 4LF6B 3E70C 5FWAA 2HHHB 5DBOA 5IXJA 5JH7A 1X15A 2C9ZA 2CVZA 2X0EA 4FMCB 3HU3A 4ZANA 1LBQA 1ZVJA 3WL5A 4QGBA 1LPPA 2GESA 3DM5A 4OBWA 4WKOA 1MEEA 4RHFA 3VJKA 1L7OA 2RSLA 4FD3A 1EB8A 3LUPA 2FCAA 2WKWA 3FWYA 3KKNA 4MUIA 4B9EA 4PAQA 1H65A 2JGRA 1PGJA 2IW3A 3GUHA 3V8QA 3G0GA 5K2MA 1ESEA 1U65A 2GZMA 3IHLA 4OHFA 4Y2XA 5KOIA 4GLFA 3BD6A 4RTNA 2BGTA 1P9RA 2ZTLA 5B1YA 1XHLA 4DDTA 4RX1A 1ZRSA 2I6GA 2FWNA 3Q7IA 4ON9A 2QX4A 1YS2X 4WOKA 1N6OA 3PRJA 1EJ2A 2G88A 1DCKA 3HEBA 3RYCB 3WMWA 1K98A 4EMTA 2HDHA 3O2JA 3AH8A 3FSGA 4O4LA 5D84A 2BEUB 1AV6A 2C9OA 1PJ8A 1FPQA 3TMYA 1QDLB 3JQ7B 3NUGA 1YA8A 2J5RA 2WNIA 3L6UA 2VAMA 4IZ6A 4MYSA 5IBRA 4AZ0B 3NBKA 4NX2A 5FBVB 3RVPA 1YV9A 1DRVA 3Q3JB 7MHTA 4JELA 1T15A 4HBGA 1E1CB 3H3XA 3HACA 3ZIUA 1NJ8A 5J43A 2CZCA 1EQUA 4RS4A 4UDNA 3ZCTA 4CL2A 1YS7A 4BX0A 2ZUEA 1OD6A 1A8PA 2G9VA 1ESZA 3PDJA 1YA4A 2QY6A 2C96A 5ICCA 4GECA 4NSNA 3SC4A 2CEAA 2ZI6A 4B17A 4YJ3B 1Q0SA 1TAGA 2Q4TA 3N58A 4ZVUA 1KIMA 4UJ3A 6YASA 1XWFA 4PICA 5HX7A 1UZUA 4GOKA 4QL3A 5CH5A 3EA0A 3RKSA 5FPQA 2HCTA 2X0NA 2P11A 1V8ZA 3TZEA 2GXQA 1NJSA 5CNMA 4UZSA 3LHFA 4M4SA 1ZH2A 1ZUIA 5JXJA 1XZKA 3PNSA 4BATA 3EGOA 4NZZA 3K1AA 5KVQA 4UNPA 5A5GA 4BP9A 1PFKA 4WAUA 5JDCC 1XMSA 1NDQA 3S2YA 4N12A 3WGHA 2HMUA 2G1UA 2MHCA 3KSRA 2Q45A 1ODTC 2YYSA 3KAQA 1PFWA 3BMCB 3TG8A 5JS8A 3OPXA 4U7HA 3T9CA 1FYEA 1TKRA 2HRDA 2R7LA 1I2DA 1PZMA 2WB4A 1P19A 2ZSDA 3K92A 2CXPA 2QL7A 3PVCA 4MW6A 5IKOA 4JBYA 1YB4A 2WM3A 4BNDA 5JAUA 3DFKA 4RFVA 1KY4A 3AX6A 3HVUA 4XKJA 5BR1A 3RS9A 1NVWQ 1NFRA 4ZOQI 2JKYA 2PGAA 4YLYA 3CHYA 1IC6A 3HO6A 2OAEA 2FW7A 4AUEA 3TF5A 2HT1A 1BH6A 4WDRA 5FFFA 1CFJA 1RRPA 3ZWXA 4UBOA 1NBHA 1ZLYA 4JOBA 3A32A 1N5DA 2CE2X 4J9VA 1HDOA 4L9WA 2ETVA 3G3EA 2J3MA 4ADSG 3I1FA 5EE1A 4WNYA 1O5IA 1XN1A 1MX1A 5AIAA 2VF7A 3OKAA 3TNFA 2CUNA 1LDYA 1VL5A 2PJZA 5JAMA 1JJAA 4PZEA 3HY3A 1GZ4A 1WW2A 1WY7A 1E7SA 3E58A 3S1AA 3LLUA 1TTQB 1N7HA 4BAGA 4PG8A 5EE3A 3H0EA 3QOYA 3UHAA 4LZWA 2AFHE 3KKLA 3OQ6A 3QBJA 1EUCB 2A0WA 4IWXA 1PR9A 1TM1E 3HYSA 4QFMA 4U3JB 5JC8A 3NNDA 2FSUA 4KX5A 3Q5EA 5EHZA 1V3VA 1HT3A 4NFYA 5KHLB 1TT5B 3OIGA 2XSZD 3TW8B 3TQSA 4YJKA 1YR9A 1UP4A 5LBTA 2XUDA 1H6CA 4LXYA 4EECA 3AYZB 4JT8A 5ALTA 4HX5A 3ISVA 2OXFA 4JJKA 3VVCA 3H1EA 3VVMA 5A7FA 5FEUA 2AC4A 3FNIA 4US1R 2QP4A 2CDAA 5TS2A 2NYRA 3I9KA 1C0KA 4FN4A 5IVIA 1IM8A 3ITKA 2QZ4A 5CA1A 2XSZA 1M6NA 1SOUA 3GK3A 3IPRA 1CY7A 1W88A 4AO8A 4Y9UA 1FX1A 3OLVA 2EHJA 3G13A 1O6CA 4P3OA 1CUEA 4LW8A 1KAMA 1RI4A 1LLFA 1F9AA 2EF1A 1ODKA 4GKBA 4H1VA 4E3ZA 1NNUA 8MHTA 4E08A 4KQ2A 4QLOA 3G8CA 2XNHA 3DDZX 1UZLA 3I72A 3T0IA 1XZJA 3WISA 2C2GA 4ES6A 1T3GA 1O9HA 2H48A 1QV9A 1RWMA 4QXMA 3A28A 3W5IA 2P69A 4BMVA 2VQFB 1YF3A 4UPEA 3NFYA 1JQKA 1EGHA 4X20B 1KSGA 3QLUA 1RRKA 2I6UA 1TTTA 5IBCA 1M1UA 2VF4X 4B6OA 5JQGF 4NENA 3GZNA 3P0HA 5LOVF 3QP9A 4AY3A 2PYZA 4OQPA 1JZSA 1TCCA 2AJTA 4RH0A 4YAFA 2G1PA 1WX1A 3HGQA 1FRVA 4MQLA 4ARUA 3OETA 4QJ3A 4GLLA 2ZIZA 2FHSA 3GT0A 4J0KA 1O8BA 1DAEA 5EQTA 5IT9A 3D7KA 2AKAB 5CM9C 4EHIA 4RTSA 1IN1A 1WB4A 3IAEA 5JARA 5KTYA 3BK1A 3L1IA 1S8NA 1ZK1A 2GR9A 2RHWA 1OLUB 2GARA 2XMSA 4UATA 3BYZA 4FSDA 4W6QA 5EHIA 2XXAA 4KN5A 4YC7A 3AHDA 4D1YA 3SZOA 3X1DA 2FWRA 5GVSA 4NE9A 2L42A 1KY5A 1WM1A 3DUFA 3ZW8A 4BEBA 3UZUA 1FMFA 2R11A 1A5BB 2VRCD 2Y1EA 3U31A 3SF8B 1UXHA 3AVOA 3LC0A 1Y5RA 3THRA 2P3QA 2W0SA 3K09C 2GD0A 2XT0A 5CLLA 5E7JA 5A05A 3T12A 4BX9A 2C31A 2GT1A 3AJ9A 3GOHA 2VA8A 3IS3A 2AFHB 5K9ZA 4M22A 2OVBA 2HU8A 1QOQB 2P35A 3AF0A 4OB6A 1Z3CA 5J3JA 2JAQA 3IJ5A 3RKUA 3U4MA 1CNEA 4Q0MA 1JX6A 1VLZA 2VRCA 3VDMA 4I36A 4N0PA 2KLHA 1DC4A 2PL1A 5C37A 2JIRA 3NHMA 1QVAA 2VRWA 3GRUA 1SZJG 1T0BA 1DUSA 4YJGB 4E7PA 1RXYA 1OI2A 1AA9A 1Y8AA 2QP9X 2VA9A 3V7WA 4M7OA 3MINB 4PZUA 3F5QA 1UQTA 4XSVA 3MWDA 3VTAA 3NBYC 3PGMA 1QHYA 2BM1A 3HV0A 1TO2E 4Z8XA 5K3OA 2ZBUA 4HDAA 4IICA 2Y2UA 4F84A 3HU5A 4G1FA 4FKBA 5FPTA 3A9RA 2FQQA 4K2AA 2O0JA 2K2WA 2X0RA 4K9KA 5JPIA 3T1VA 4EB3A 2W42A 1O9GA 1NN0A 1DTEA 1J09A 1UJNA 2R97A 4P3NA 1VMDA 2C5GA 4R1SA 5HKAA 2DUMA 1TLTA 3DPSA 2V97A 2O8BB 1UKEA 3IB3A 2QJRA 1QGDA 3AMVA 2J41A 1V9CA 3DL2A 1QIJA 3BQNB 4I4TB 1VM6A 3UM9A 1ABBA 1E3TA 3BQMB 4CETA 1Z62A 4K88A 1RQPA 3M5CA 1OA0A 2AW5A 4WLFA 3ZQUA 3IVAA 1D09A 4GOJA 4NICA 4QC2A 3AEZA 3AKEA 1H94A 4HNQA 3ZG6A 2QPLA 1RWNA 4RM2A 1K3UB 1XA4A 4XGRA 2HA2A 2PCJA 3UKOA 3BZWA 4JXKA 4TS9A 4QVKA 3EZ2A 2XUPA 4AD8A 5L4NA 1YTLA 2C4VA 3TZLA 5EZYB 3QPDA 1G5QA 3ETJA 1XZ8A 2QRNA 5TR9A 1PUJA 4MEJA 4MVJE 3CPJB 4YAIA 2PZFA 2P3LA 4L2IA 1TUIA 1XTIA 2VF2A 2IKQA 3TNLA 4D82A 5GGYA 1PEYA 2WVHA 4RWEA 4YAWA 3H83A 3B9BA 5F35A 2PANA 4TRRA 1H1LB 1EE1A 3QKWA 3H3FA 3KE9A 4M0PA 3QNUA 3VH3A 1QK4A 1Z12A 3I04M 2XTJA 2ZI9A 3A4LA 4ND1A 4FEEA 4PAOA 3T9BA 3CH6A 2VP6A 4BQEA 3RBAA 4L0MA 2PYIA 3PJGA 3RS2A 2YIJA 5C7IO 5JWRA 4OK6A 1NVDA 1I9CA 2OLJA 4HXEB 1EHCA 5C1BA 4KLNA 3Q8XB 4F2HA 1KZGB 4DV7B 1TU3A 2B1RA 4XSGA 4I55F 4WJKB 2QUBA 4OQEA 5GM1A 2GK4A 3E9QA 4RZHA 2I65A 4RIFA 1JHUA 2C5AA 1UK6A 2Y4NA 3C8UA 3E27A 3NVAA 3JYNA 5AW7A 4LFCB 3NR2A 5KTKA 3KSAC 3UJ6A 3PUHA 2YRFA 1PR4A 1IATA 3F8SA 2YXPX 4CCSA 1BMDA 1E18A 3ZOZA 3BMNB 3F5DA 3B3FA 1NLYA 3LFUA 5A3QA 3EGXB 4ZODA 3EZ7A 1JZTA 4FS8A 5CBKA 5JBIA 5AJTA 3GUUA 2CMDA 2W58A 4IPTA 2B30A 1KHHA 2F1OA 4DHWA 2RGDA 4Q37A 2JFFA 4IYRA 3FNGA 2IVFA 4WH0A 1J8DA 4ND2A 4TXNA 3W8RA 1LK7A 1P1CA 3AEUB 4JUAA 2FV8A 4IH1A 1ZUNA 1U7XA 4L3OA 2A5GA 3RYFB 2WAOA 4KMRA 1T5HX 3KL2A 3RU9A 4GAEA 2FZLA 3U7RA 3ASZA 5JVDA 5FLXA 1Z16A 3BQ9A 1P44A 3I2GA 1KMMA 4DSNA 2QVZX 4WHMA 1L7AA 2JI4A 2A0FA 3ESDA 1NP3A 4MMZB 4OLFA 2VEOA 2BJWA 3V8NA 1YSCA 4Y30A 1Y8RB 4J2TA 2HHCA 4IRUB 5TQ0B 1QB7A 3QTLA 4WLVA 1XF1A 4IVNA 3A11A 3OEYA 5AHKA 3P9XA 1W73A 1TE2A 2DLDA 2J85A 2ZKIA 1TT7A 1YZQA 2PS9A 3LA8A 3ORYA 3UC5A 4PN3A 1ABFA 3B1FA 3NO4A 1DOAA 2AZDA 4J94A 1IY9A 2DT8A 3O4RA 1C9NA 3BBPA 4KI0A 1G16A 1TC2A 4MYRA 3RK4A 1I3NA 3UW3A 4IH4A 3EXHB 1V7CA 2XKBA 3UAWA 3BN3A 2HQ1A 3FVRA 3HRIA 4MV7A 3UQZA 2OFPA 3ZY5A 4JA2A 4FYJA 2QD5A 1APBA 4YBZA 1XIVA 1XMVA 4HRVA 7REQA 1E7YA 1EFPA 3IGFA 2ANCA 3L7YA 1ZMTA 1VSVA 2D13A 3DEIA 5AK5A 1L7MA 5HRUA 4JI5B 1M1NA 4YT2A 3RLIA 3A3PA 3B6IA 5CURA 4I2VA 4HAXA 4PXSA 2BZ0A 2ZLBA 4ZVTA 3LXXA 2O07A 3SOPA 1XYGA 3DGEC 1DSSG 1QHFA 4IFTA 2H06A 2J09A 2X1MA 1PE0A 2ZI3A 4TTIA 1Z13A 4X1YA 3WLSA 3ND5A 2BZGA 1U2PA 4QECA 5KYWB 2AQIA 4CQMD 1IBCA 2AN9A 3CFYA 1S7CA 4L9AA 1ZI9A 1YTUA 4MQMA 5BXQC 1F8FA 3AESB 5EMKA 3O1HB 3A3YA 3FUCA 4R9RA 4YCCA 4TGLA 2ZXEA 4BKOA 4EB0A 4XQ0A 1BWPA 1VE5A 4W5JA 3ZKWB 3ENKA 3H05A 4CQMA 1AQLA 2F64A 1KORA 2EQAA 3DNPA 4X84A 4YV0A 2QTRA 1QIGA 5DNCA 4JUIA 2VAXA 3C70A 4ZICA 2KBFA 2EX0A 4RSGA 2KS6A 2FSFA 1N0HA 3BFVA 3P5BA 1NUTA 1JDZA 2XV1A 3Q1KA 5DIZA 1KC3A 3IT3A 4Z9BA 1DKQA 1TRHA 3O84A 2P4QA 2Q29A 3ZXXA 4KTVE 1RI3A 4DNQA 1Z6GA 4UD6A 1J5XA 4OBEA 2HCBA 2IHTA 1Q12A 3PFBA 3UYKA 2I4RA 1DAHA 1Y3HA 4FSXA 4MITA 3SX0A 4ZPJA 3PGA1 2KQUA 3CB4A 4BO5A 5A4KA 2VOEA 2F2TA 2X41A 4MYTA 2DUWA 2C5LA 3LVFO 4YRRA 3ROEA 5K6RA 2PUBA 1JA1A 4PHFA 1C3VA 1N6LA 3L0OA 4OGGA 1NXTA 1N0VC 4TOIA 4X1IA 3SG0A 1F2UA 1H5UA 1C29B 3T3PB 1ZD3A 2C4KA 2RBKA 1NQUA 3PXAA 4JLPA 1X8LA 3PI6A 1Y5MA 3WY9A 1FY2A 3CW9A 1U3CA 2CDBA 3ES9A 2RJOA 3NWOA 1M6HA 3G2PA 4EMSA 1G6KA 1IY8A 1P2TA 3CSSA 1NMYA 4QM6A 1REQB 1Y5LA 1YB2A 2HJVA 3C1OA 3B78A 1I4WA 3RK1A 2IXEA 4E32A 2CJFA 2IU6A 4S35A 5JSQA 4OQNA 5ADVA 1N6KA 1MT3A 3A4YA 4JBNA 4XTRA 1R4ZA 3T1HB 2ZUFA 2QJTA 4JP2A 3K1YA 1PSZA 3QU9A 4WZAE 1W7AA 2VJCA 3BFPA 2NUPB 3GVHA 3AL3A 3KHKA 4KWIA 5AK0A 5C53B 4X92A 1ZJWA 3ZU6A 1LB1B 3UJNA 2ROQA 4PFSA 3LPNA 4INOA 5DWDA 2HXSA 2NO0A 3OTHA 4BEJA 5B36A 1UJ5A 2QYHA 1UMDB 2HU5A 1L7DA 3LHIA 3LKBA 1QGOA 4D02A 1X39A 4CKCB 4XCXA 2HNAA 2X77A 3PDUA 2BIFA 5EIAA 2DHEA 3IPXA 4YMVA 4GX0A 1OIVA 5BOSA 4ZCMA 3MWFA 2V59A 1DU4A 5IVPA 2LDXA 3L8HA 4CM1A 4LHZA 1UZMA 5EERA 3JVVA 4M87A 4RKYA 5LN1A 3W78A 3M6VA 2V7PA 4BP1A 5I51A 3NKLA 4M1QA 4ZIRB 1GXSA 3NIDB 1RHQA 1L5SA 2H1WA 5CGZA 2RC5A 4U8GA 5FA8A 5ELLA 4OIFA 2V54A 1E59A 4ZN6A 2XVZA 4PO9A 4BAZA 1MIOA 3SZRA 3OLXA 3H5VA 2BDTA 2IPOA 2OUKA 3HYCA 3P9YA 4YRMA 1BEEA 1JAZA 1FTNA 3PDIA 1XF9A 4QELA 4U5XA 4L74A 1XEAA 2BI4A 2Z5LA 4DEXA 2QUHA 2Z4SA 4RDCA 3DF9A 3ORFA 4EPYA 3F7MA 1W49A 4DTCA 1AKEA 5ICFA 2HOQA 4XPIA 2W48A 4YV2A 5FO1A 3ESYA 3WBJA 3B2QA 5F4BA 5IDYA 3NKVA 2PQMA 1MQ9A 4XGNA 3WSTA 2QG4A 1LWOA 1A04A 3WIUA 1UAYA 4RE5A 2FR0A 1U2TA 2B1GA 3AYXB 4IBOA 4D0SA 4TLAA 4KZPA 5ALRA 3F8WA 3WLOA 1N5LA 1DFGA 1EFDN 1MFPA 3EEYA 4IRMA 1T8TA 1YRBA 2RHLA 1CY1A 2WIJA 3AXTA 5I7SA 1FVXA 3F9IA 4HLDA 4F9TA 1PZFA 4IJQA 4JDPA 4ND3A 1TYAE 2L19A 4NS1A 4HUQB 2NPFA 1OAOC 4IOJA 4EKGA 4NCXA 5CFLA 4EPTA 5T64A 1PR2A 1HFKA 2E4WA 4N5MA 4KR2A 1EA5A 1Q5PA 3LLSA 4MCJA 1G7TA 4DCTA 3FNBA 3ZI4A 1VB5A 2CCJA 5AQ1A 3N7AA 4MDEA 1IYZA 2D1RA 1U1GA 3F46A 4YT5A 5JPCA 1NVVQ 2FDCA 1C3XA 2FEPA 2JGNA 5JO0A 4HNAA 5F12A 1XRJA 4YMSA 2RGAA 2C5BA 2I4IA 4DSOA 4KVZA 4ETMA 2IHNA 1XRRA 4Q4HA 1J99A 3R5JA 1K6EA 1SBTA 2UZ0A 4PXYA 3WLNA 1XCOA 2QQGA 2QKYA 3S0JA 1C8LA 3BXZA 3UAYA 3OWXA 4AMYA 4MRPA 4FHEA 3GPBA 3KTDA 1XPJA 2HMWA 4WZAB 5F52A 4DCPA 3VZRA 1TYZA 2JFVA 4ZEOA 3KNZA 3KV1A 5LP6C 3DXZA 3P0EA 1M72A 1T43A 5FBRB 4HMOA 2FWBA 3FYUA 5EQDA 3D8HA 1M5RA 3CNHA 1VTKA 4PWZA 4FFVA 4FQ5A 3DC7A 4NYMR 2DFPA 1XXHE 1GPH1 1K8ZB 1AQNA 1BYIA 2VDOB 2EATA 1BE6A 4HZUA 2MSLA 3PUVA 1UP7A 2ZRGA 1RLMA 2V5VA 3UFXA 3MAGA 2VCYA 2GD6A 4KTTE 3QPUA 4UARA 5AKZA 2X9LA 2VZ8A 4FGLA 5H59A 2JH8A 1U7OA 4J91A 3GLHE 4IWNA 2HUPA 2C04A 1E0DA 3I9OA 1NWHA 2Q5CA 3R0JA 3KO8A 5C1PA 2OAP1 1O97C 3MBOA 4HWTA 4YA6A 1DAIA 1RZVA 3IOEA 4Q1AA 4R3NA 3E9EA 1OR8A 3T5DA 4D56A 2XD4A 1GA4A 3PUKA 2PBLA 4PLVA 3C8HA 4I3FA 2G67A 3OA0A 1PGNA 1PL7A 1D0SA 1G3IA 2KLBA 3CLSD 2Q6OA 3T8YA 2PKCA 1CF9A 1MQ8B 1C3LA 1WHSA 1G20E 2QG9A 2XX3A 3A9SA 1VGRA 4MX8A 4FDUA 3MD0A 3NWJA 5F1PA 1PNVA 1CRWG 3K9CA 3OQJA 3TJMA 2XIJA 5E7QA 5CEEA 2CN1A 1Q0LA 4I1RA 4XX0B 1W4ZA 3ZHTA 3KZXA 5FQOA 5J2TB 3DNMA 4LDQA 5EP1A 1OLOA 5CW2A 2H1FA 2E37A 3V1TC 1Z56C 1W1WA 3R6LA 1KIAA 1KWGA 1D07A 4C0JA 4IF6A 1QANA 1DIRA 1RQ2A 5IBQA 2WFLA 3U40A 1A3CA 1FQJA 1JBEA 5CA0A 1WXGA 3QUQA 1WD5A 1OH8A 2Q3DA 1QO0D 2XCQA 4Q3KA 3I5XA 1IJKA 4PVDA 1S2LA 3I64A 5JNUA 4WXRA 4KDEA 1L4YA 1RR6A 2QDXA 5GPBA 3TGPA 1D0IA 3TDMA 1Z25A 5H9WA 4HEA1 1M75A 1QZXA 2G28A 2ATEA 1JKMA 4KNVA 2P0EA 5LU9A 5K8JB 4NZPA 3ZNNA 1QO0A 1VYTA 1PQWA 4DMLA 1T6NA 3ZX4A 3OFND 4YRTA 1VJDA 3D6NB 3LBFA 3KV3O 3FLMA 3UMYA 1KOFA 1E9EA 4OU4A 2PX0A 4E30A 5B6JA 2PDAA 4KXQA 2A5DA 3RTDA 1XWWA 2UYHA 3H11A 2P77A 1DGQA 1IWPB 3B3AA 3T95A 3WO0A 1KTIA 3KZMA 4HL6A 4KOEC 4H1TA 2B1IA 2IPMA 4AYTA 4BBZA 4I1OA 6ADHA 4UASA 3OFNA 4ZRNA 5GZ3A 2XNCA 1KO4A 3ONFA 1Q1AA 1YL5A 3D81A 5DXJA 4ZJZA 2W2VA 5C31A 4FJ1A 1W8DA 3RREA 4PGHA 1KKUA 1BKYA 3OMXA 1E7RA 3ILYA 4ZU1X 4EAAA 1Y33E 2QRGA 1R4AA 2PHZA 2QN1A 2OTCA 2P6OA 2QB5A 1ODIA 1RBMA 3JY6A 4QBIA 1GPJA 4RVFA 3ZWPA 1W5AA 3AR8A 4IVRA 3BBLA 1SOMA 5JSKA 4F97A 3PFNA 3AW8A 5TEWA 2QV7A 3KPYA 3GLHB 5BYBA 3DMHA 4PQGA 5A0FA 1RJ9B 1B8PA 3EMKA 5HGXA 2AHOA 5HDBB 3WICA 3SU8A 1MVOA 2XXBA 3KCQA 2CSXA 4OHXA 4AKSA 2FUKA 3E05A 4M8NE 4F8JA 3O95A 2FR1A 1B8UA 2ECKA 4I8XA 1B8NA 5KX5B 3DDNA 8GPBA 1Z2NX 3DOEA 4DJAA 1JFRA 2BEWB 1AU9A 1PWEA 4WNAB 2HRBA 1CV2A 1FXWA 1T1IA 2QYTA 2WJGA 2PXCA 1IY1A 5EJIA 2BGNA 5G0WA 1G20B 3LX6A 3E3AA 3I9V6 3OZEA 3JATA 3D8TA 4HDOB 3ZCXA 1DPFA 1R6UA 2DWOA 2JHAA 2OFXA 2VKTA 4KI7A 1P29A 4Y2UA 5CJPA 3SDZA 1Z39A 4BB5A 1T5SA 4U2BA 4RVCA 2WG2A 3AINA 4H9GA 5CITA 1N5IA 1H8ED 3ROZA 3WL6A 2B4TO 2FUNB 4AC9A 3TQOA 4A2QA 3Q8MA 1KGSA 1ZQ1A 4TMXA 2RAVA 5A9RA 5I7FA 3FGNA 1YQDA 4XIGS 4YMUA 2IP1A 4Y2SA 3FCSB 4BPBA 2Y9MB 1JDVA 3PNVA 3DL4A 4WK2B 5I9NA 3NYIA 3K31A 4GOND 5ICSA 2A9RA 2HTEA 3C16C 3MUNA 1H8EA 4M88A 3OCZA 1U0SY 1GRRA 2IUYA 3ILHA 3LBAA 4EVRA 5U1PA 5JR3A 3JR3A 1OGJA 4ED9A 5IH7A 3WIVA 4NH4A 4WNIA 1TU4A 4J0CA 3WDLA 3WNQA 5AVVA 3SDBA 1YJBA 3NJ4A 5KSPA 5EJMA 3R7WA 2ZCJA 2H65A 1BW9B 3BVPA 4RPGA 2BEUA 5ALXA 1ORTA 2BFBB 1LS1A 4EPVA 4MAFA 1JNYA 4JL5A 3IAXA 3ZXYA 1YFZA 3P2YA 3P9KA 1YRYE 4H7IA 4Y2GA 3T4PA 4CKBB 1PI3A 2H0QA 2NACA 3EZ6A 3NBAA 4O0LA 2FG7C 5A3SA 4KK4A 4WLEA 1EDEA 4TYQA 3K72B 3RSOA 3FOCA 5JS2A 3UBTA 1VPWA 4PX2A 3DTTA 4Q3EA 1CFZA 3TH5A 3T3EA 2KX7A 4XB1A 2M98A 5B4UA 5B6IA 3IPCA 1QQBA 1TPYA 1UBMS 2G9QA 2O19A 3HB1A 1HKUA 5AP9A 2D54A 3F71A 3WHKA 3FDIA 1LTQA 1ZD8A 4LYAA 4OOFA 1U2DC 5CDUA 1CDDA 3MZ0A 4H60A 4UOQA 5EFOA 3H2JA 1J8MF 2ZSFA 1NQTA 1G8AA 1ZHHA 2QAGB 5AKXA 2Z2IA 5GV7A 3TKLA 3VQTA 4DDUA 3TTXA 1GCOA 1OTHA 4JT4A 1MLDA 4KXUA 3K6JA 4WCVA 1LX6A 2XNJA 2NT3A 2OPBA 4GH5A 4MW4A 4PAMA 3ZTYA 3RCBA 2BKLA 4E0BA 1QO7A 2DXIA 3A1EA 3OZRA 1NMQA 4OHOA 3QLUC 2Q1XA 4L57A 3FETA 1WVIA 3HPQA 3R6WA 5KIAA 1DB3A 5BW6B 3AK4A 1IUKA 5JQWA 2ZUUA 1BIFA 3CW2A 1BCSA 1M7HA 2VQSA 3I45A 1SC6A 2OV6A 2PR2A 3ESZA 3H9GA 4ZVQA 3GD7A 4DJEC 1SQFA 1M2JA 2VNJA 4RZSA 5D1HA 1WV0A 3TYXA 3VNBA 1E3LA 1EFCA 2BZSA 2C1XA 1RJEA 2JKVA 4KQGA 3CVUA 4CLXA 4X1KA 1Z34A 2OLKA 4H2DA 4MLZA 4GUAA 5ALDA 2HA7A 2CD9A 4DC0A 5C3MA 5GIOE 2G71A 3OKFA 3UMBA 4OX9Y 1WTCA 2YXLA 2Z8ZA 4IDCA 1C1HA 3BEOA 1CBUA 3FF1A 5B12A 1YZGA 3U4GA 2G08A 1C1XA 2N0SA 1ORWA 3JXEA 1X42A 3NBZC 3W5JA 3H5WA 2QENA 3KL4A 1TXGA 2A86A 4MJ7A 4GNKA 1II8A 3TBFA 3NHKA 1G3RA 4OJKA 4NWIA 4Z3DA 2F67A 1TGYA 4Q3LA 1Z73A 4ER5A 3AFNA 3V6MA 3VYSB 5K0EA 1CLUA 3DO8A 3LDGA 3I39X 4KAFA 1NPDA 1U4OA 1DLJA 3KCNA 3NNNA 1RQXA 2ZPAA 1Z5WA 3QPVA 5FOXA 3R74A 4XWTA 2HV9A 2WJ4A 1X77A 3R3JA 3QEAZ 4R1UA 3RS7A 4BPRA 4K8RB 3UK6A 3FPSA 1OPRA 2C7BA 3UATA 5ELXA 3IAHA 1EIWA 1IXRC 1ZSVA 1UKBA 1T9ZA 2DTEA 2CD7A 5LBUA 4ZHQA 5HYVA 3A1DA 2JI7A 3AL0C 5AVKA 2ZYIA 4FUQA 5C18A 2L82A 3EEOA 4PFQA 1Y7TA 4BUJA 4LHSA 1LNQA 2QN3A 2WU3A 3HLTA 4J0GA 4F71A 1R0XA 3D4OA 2V6JA 2IYNA 2SKDA 5I7AA 4ER0A 5K3CA 3RVBA 4FB4A 1PNTA 4N8EA 1KBQA 1UMCB 1ENPA 1VBNA 3G2IA 2LCQA 2P9YA 1VJGA 4FEYA 1E66A 1PYGA 3FJOA 5B7NA 4DRXB 2G06A 2YHSA 3TCKA 1Z5VA 4Y6RA 3HXPA 4TM8A 4I1PA 1G55A 2GO7A 5KHOC 1X6VA 4YMGA 5DHRA 2PUTA 3G5AA 1YWGO 4F6LA 2VT3A 4D7AA 5JLJA 3AUAA 1U04A 2FXIA 1PR3A 3O82A 4PZ9A 1PIWA 2R8YA 3BB4A 4JB2A 1WMAA 10MHA 1PNOA 2OHJA 3AM3A 4NK4A 2HLPA 5KMGA 1NBIA 4WFQA 1CLEA 4FXPA 2ORWA 4KXFB 2QT1A 5CDSA 3LZCA 4R2KA 3H86A 3G5LA 1CS0B 2Q49A 4TVKA 1G7SA 2QJFA 5HMLA 5AW9A 5HUJA 3ODGA 2ERXA 4CM4B 4RJLA 3FDZA 4WUTA 5AM2A 2YC2C 2GN1A 4YJHB 4BLTA 4EI8A 5H8WA 4ZK6A 2W2MA 3MGCA 1FQOA 1S4QA 4K9SA 4M9UA 2AE1A 2YYAA 1DDOA 3JD4A 1OWNA 2PU7A 4NEGA 3V9PA 4BQSA 1TC1A 5LM3A 3NX4A 5CMLA 2H1OA 1JKFA 5JAOA 4ME6A 1NMSA 1TUBB 1FYDA 4AJOA 1WUJS 2H4FA 3BDAA 4RLQA 2PUDA 2YN2A 1RYHA 5FWDA 2ZZMA 3OJEA 4JJAA 3AF4A 2RK6A 1YQGA 2BKXA 2PA3A 3GLKA 1ATZA 4MXDA 4RA6B 4V0SA 4DY4A 4RA9B 1DIGA 3A8TA 3ZQJA 3G49A 5ABPA 3S29A 2KSQA 1MNQA 4FOPA 3RFFA 4XH9B 2HSJA 4BFZA 4LQLA 1QHGA 4IGAA 3I83A 2NO7A 4EG7A 4RETA 3V46A 2XNKA 3MJDA 4CG1A 5KAMA 1CQXA 3PL1A 5TVKA 4IWYA 3TCXB 2FN3A 3DBRA 1PKXA 1SPXA 1GZ5A 1P62B 3W3ZB 2C54A 4QNRA 4Z4CA 5IX8A 4CI0B 3VM6A 1KR5A 2YN4A 3EHDA 4LNAA 4O2BB 2B94A 3Q4GA 4H3VA 5ES4B 4AJEA 1PBNA 3Q0EA 3NC1C 2PXHA 2VYCA 1VPEA 1D1SA 2DPGA 2W4IA 5E3HA 3BWEA 3T5CA 1EVQA 2Y8EA 4N3BA 2WJPA 1SRQA 3MGKA 2NSJA 1GUFA 2Q9BA 2AVDA 1ULZA 3ROXA 2H7VA 4YMTA 2I0FA 1DJQA 3NG1A 4LY0A 1TQ2A 4D6YA 2GCOA 5EE9A 4M86A 5J47A 1AZWA 3ICEA 4E5MA 4XGIA 1MKYA 2DUJA 4TTPA 1O87A 1W87A 3WKDA 1EXVA 1F60A 3IAAA 2C5HA 4NE7A 4UM9B 5EJ6A 1RXWA 3KQQA 5ISMA 1VLJA 4JR1A 3SVTA 1TZKA 4B40A 4Z0PA 3ZQKA 1Q6ZA 1QC5B 3HMKA 4GLBA 1K2WA 1X7YA 1M8JA 4B32A 1GAJA 2QRVB 2Q6VA 4HDSB 5K51A 1U3FA 4Z1MD 5B58C 3L8FA 1X1QA