1SCKA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetone
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 99
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sckA00
1YR2A 1BROA 3WWOA 1XLWA 1GPNA 1XQVA 3O4IA 2OGSA 3PICA 4G1FA 4F21A 3I1YA 2OCIA 2OLEA 5CT4A 1ZIXA 3R41A 4H0CA 2XMSA 3H2GA 4J3JA 4EY8A 3R40A 5FPQA 3DLTA 5BWCA 3ZI7A 4Y2PA 5T4FA 3V48A 4AQDA 4Y2SA 5EHZA 1A8UA 1R3DA 2HM7A 3S2ZA 1JI3A 1I6WA 2JGJA 5A6VA 4K6HA 4L72A 4INZA 3K2IA 5C8XA 3F9CA 1BE0A 5EI5A 3IB3A 2AJ8A 3WWEA 1Q0ZA 3H1BA 4ZRDA 4EB0A 1NU6A 1R9NA 3WK7A 1EINA 4CCYA 3R3UA 2YASA 4DLNA 2AJBA 1TCBA 4P92A 3WI7A 2QTBA 2DQYA 4H7KA 1QIMA 3C45A 3C6ZA 4DMHA 3RLIA 2ZVDA 5EHQA 1F0PA 2B61A 3EQ8A 1MN6A 2NW6A 5FRDA 3WK6A 1XZFA 4A23A 2O7VA 4X94A 3V9AA 2JBWA 1DINA 3AZPA 5FDFA 4GHWA 4PSCA 2PM8A 4AX4A 3M81A 4X85A 4Y2QA 2ONCA 5DNWA 3C70A 2HL6A 1SFRA 3ICWA 2JIDA 5JZ9A 2Y1KA 5ISMA 1P0MA 3CCCA 4BE9A 2BJHA 3DKKA 1USWA 4L9AA 4BZZA 3K9BA 5DLPA 4UHHA 5FP0A 1WM1A 3H2IA 1PV1A 5JD4A 4OCZA 2DFPA 4EBBA 5ALDA 2WUDA 5AK6A 2RI6A 1WOMA 1OCEA 4NVRA 4HRXA 4FMPA 3AUKA 5T4BA 3PFCA 3BJRA 5AICA 3I28A 2WTNA 4DSZA 1JJFA 3VJLA 1XRNA 4Y2VA 2JGLA 1YASA 3L1HA 1YB6A 4IH1A 1M33A 3PUHA 4UHCA 3IIIA 3FAKA 2JGEA 3FSGD 5C8VA 3B12A 5F4ZA 1AGYA 3OPMA 2GZSA 2AJLI 3WKAA 1THGA 1CIJA 2ORYA 3Q8WA 1MT3A 1K5PA 5AP9A 4G5XA 1ETHA 3DOHA 1XQYA 1EK2A 1CUEA 1E89A 1BS9A 4KE8A 5FPPA 2XI4A 2VT6A 4HAIA 5LZ4A 3IUNA 2XUOA 3GFFA 3H19A 1ZD5A 3D7RA 3D3NA 3FYUB 4ZWNA 3W05A 4DYHA 1QIIA 3WL6A 1SC9A 5ALYA 1Q0RA 2B20A 3U0VA 1TAHA 4QLOA 5JALA 3KD2A 4C6HA 1UK9A 5AKYA 1MTZA 5DNUA 1C4XA 1UK6A 1LPPA 1XZEA 4DMFA 1XZIA 2ACKA 3G0CA 5K3FA 1QIFA 4Q05A 4UFOA 5CTAA 4AO7A 2R11A 3SWWA 4DIUA 1AQLA 4B6GA 2JGIA 1WHSA 3I6MA 3ILSA 5CT8A 3YASA 4OYLA 4ZREA 4Q1VA 2XUFA 2O2IA 3ICVA 5I9IA 2WG0A 1H2ZA 5KBYA 4BVJA 4ZV7A 2ZYIA 3OM8A 4X92A 3BDVA 1CUHA 4QWWA 3E4DA 4WFJA 1IVYA 4UHFA 5AK3A 2HU8A 4JUIA 3UMJA 4G9GA 5EIAA 4OPMA 1R4ZA 2HA0A 4CG3A 4IH4A 3OG9A 5AM3A 1EH5A 1CRLA 1UOOA 2HRQA 4FNMA 4L3WA 5CT9A 4AO8A 4OUKX 5DWDA 3EBLA 3GA7A 2XUQA 3QPCA 5JZSA 1B6GA 2WJ3A 2WUFA 1JFRA 3BXPA 4FLMA 1THTA 1YS1X 1QJ4A 4Y2RA 5AKJA 4BTLA 5JAPA 3QMVA 4FWBA 1K63A 4AZ0A 3HEAA 2GZRA 3DQZA 3NUZA 4KE9A 1P0QA 1QZ3A 1XRMA 4YPVA 1BCSA 2OCLA 4FTWA 1BN6A 2CZQA 1OILA 4TVKA 1CPYA 1CUUA 1WB6A 3IUJA 2WUEA 4K5QA 1AUOA 1J1IA 3FLEA 3WWDA 2DR0A 1Q84A 1UKAA 4CG1A 2I78A 3DKRA 5SYMA 3S8YA 1QOZA 5SYNA 4J7AA 1N1MA 4UBNA 2RHTA 3STUA 4Y9SA 5AH0A 4FOLA 3F67A 1TKRA 1W76A 2XUKA 1CUJA 5JARA 1ZI8A 5H3HA 3BF7A 5E2IA 2WG1A 1P0IA 4BCCA 5AIAA 5JD5A 1VKHA 1LLFA 2CKMA 1H2WA 2Q0XA 4L0CA 3ZLTA 3O0DA 1JKMA 4FBMA 5AI4A 4DNQA 3IA2A 1MPXA 1TIBA 1CUZA 1X70A 5ALQA 4TPKA 1IUNA 1YB7A 3QH4A 3UUFA 5ALWA 4ZXFA 3WA6A 3WK8A 4PV7A 3DYIA 5AHXA 4MQLA 2HRRA 3PF8A 2XQJA 2LIPA 4DTCA 2WHQA 5JASA 2C0QA 2EDCA 1BCRA 1RP1A 4FFVA 2WIKA 1ZD3A 5FLKA 3R3VA 4JYMA 5EIHA 1GPLA 3HLKA 1AZWA 2HU7A 1DX4A 5DTIA 4XJVA 5AKXA 2XLCA 3HSSA 3HACA 3IUQA 1LZLA 5CH5A 4KE6A 4C4YA 5LP1A 1FFAA 3WK5A 4U2FA 5CT5A 4BTVA 1QIGA 1MU0A 2WILA 2XUIA 3I2HA 5CXXA 1MAHA 2WFMA 3F8SA 4XWGA 3E1GA 2XUPA 4IHAA 4F5ZA 3GUUA 1ACJA 5AI8A 5IVDA 5DTJA 3I2KA 3MVEA 1VLQA 5DYYA 2OGTA 1UOPA 3FYUC 3NOXA 2OGZA 2WUGA 3TJMA 2W6CX 1DQYA 3T4UA 4FBLA 3QBJA 3FCXA 4UFNA 4KEAA 3QYJA 1CUFA 2QUBA 2VATA 4GXNA 1HPLA 2PSDA 2HA3A 2BCEA 3EQ7A 1CUYA 1MX1A 3WL5A 4B0OA 3H18A 2QOEA 3G9ZA 4KYVA 1ZICA 4Y2TA 1GZ7A 4PNZA 3B3QA 3G0BA 4BYMA 5D3KA 1EB8A 3PDCA 2HU5A 4W9RA 4BRSA 5IVKA 1G42A 1BEZA 2X8BA 5AM4A 4HZGA 2VEOA 4EHBA 4BAUA 2VJBA 2WIFA 4JNCA 1Y7HA 3LLCA 4X6UA 1YS2X 2XLBA 1QO7A 1UFOA 1SOMA 1TQHA 1DU4A 3HI4A 5LZ2A 5K3AA 2DHEA 3BDIA 2C5GA 2CEKA 1G5FA 2QM0A 2WFLA 4DM7A 5J3JA 2BFNA 3WKEA 2PSEA 3WYNA 2IIVA 3NWOA 1ODCA 1WB5A 5EGNA 1WHTA 2G5TA 2PPLA 1ZD2P 3H17A 3L1IA 4H18A 3R0VA 3O9MA 1IUOA 4M0EA 2C0PA 2PU5A 5AKGA 3AFIA 3TEJA 4KRYA 3DD5A 3WQHA 1C7JA 3BIWA 1XLVA 4BATA 4WY5A 3I2FA 2VJCA 2J3DA 4MYSA 2ZYSA 3DCNA 1G4HA 1VZ2A 3H2HA 3I6YA 3GBSA 2XUDA 4QLAA 5HF9A 4GLBA 1CQZA 4J0IA 2OG1A 1ZIYA 2VJDA 4C89A 2GBIA 5K3CA 4I19A 1HKHA 5T4EA 1Y37A 1TCCA 3A70A 4B85A 3C5VA 1PFQA 5HCUA 2WG2A 3E0XA 5ALLA 2WKWA 5ALEA 3WIBA 3EQ9A 3W9UA 3W04A 3GROA 1J06A 1QIEA 3DOIA 3V1MA 4U2GA 1EVQA 4Y2UA 1H22A 1QIHA 4LYEA 3FLBA 1CFJA 2X76A 4KR0A 1RYYA 2QXUA 5E4JA 3FYTA 3PE6A 3RM3A 4NZZA 4F60A 4KJXA 1XZDA 2ES4A 1O6FA 3KXPA 2BKLA 4PF1A 3DL7A 5I8PA 3H1AA 1E8DA 4FLFA 1ZJ4A 4GBGA 5IH7A 3O4HA 5AI5A 2QT9A 1L7AA 4E46A 2GYWA 2VAVA 3QPDA 3KSRA 2WJ4A 4KAJA 1B41A 2WU4A 1XZBA 2BUCA 2QZPA 4CCYB 1R88A 1U2EA 4N5HX 4CCWA 5ALHA 5AJHA 2VA9A 5K3FB 3H04A 4AMYA 4FKBA 5CMLA 1XZMA 5LLSA 1KU6A 4E14A 3PF9A 5IVIA 2PU7A 3V1NA 4AN1A 1XKLA 2D0DA 2QUAA 4J0JA 4QE3A 4MQMA 3KDAA 5ALFA 4BP9A 1U4NA 1MNQA 3F96A 3FVTA 4UUQA 4Y2YA 4N8DA 3P2MA 1DWPA 4HRYA 1E5TA 1AURA 3R3XA 1CUXA 5AI9A 2B4KA 3WJ1A 4FLEA 4BZWA 1ZGBA 4B84A 3HXKA 1W52X 2QR5A 4GDMA 3R3YA 4NS4A 2CBGA 2WLSA 2ZJ6A 2I3ZA 1UKCA 1LZKA 2XUAA 4LXHA 1IZ7A 2JGFA 4QA9A 1QLWA 3IUMA 1SCQA 3AILA 1CLEA 4CFSA 4LKOA 4UHDA 3F98A 4LXIA 5ALOA 4U2CA 4FDMA 3D5EA 4C87A 3DS8A 2Z8XA 1O6GA 2O7RA 3H0CA 1Y7IA 2PBLA 1W6RA 4J0CA 3QITA 4A5SA 3CN9A 5A2GA 3WWCA 5LZ5A 4H7IA 3N2ZB 2Z8ZA 5HF6A 1JJIA 5CH8A 2RAUA 4KAFA 4K6KA 1QTRA 2GBCA 5FXMA 5LKRA 2D5LA 4H7JA 3Q0TA 3WL8A 5JATA 1Q83A 2ZYRA 3JW8A 1YA4A 4X97A 3WLAA 4Y2XA 1TCAA 2C5FA 1UXOA 1EDDA 4AZ3A 2V98A 2XMBA 4JH0A 5DNVA 1XZAA 4BDSA 4HS9A 4RPCA 5JD6A 1XQWA 4OB6A 2PUJA 4EY5A 4WDRA 1Z68A 3QPAA 1LPOA 3EF3A 1N5MA 3STYA 3FBWA 1W1IA 4YX9A 2H7YA 3O4JA 1IMJA 1VJ5A 3G0GA 3ZLUA 4CG2A 5A62A 2XMDA 3C87A 4QDOA 5E4YA 2HHAA 4RE5A 2V96A 3ZWQA 1DX6A 3I2JA 4HVTA 4X3CA 2E3JA 4Q3OA 1EHYA 3RK4A 1VOTA 2HFKA 5A7HA 2Z5GA 4GEGA 4N8SA 3D2CA 5AK5A 2DHDA 2QS9A 1T2NA 1MJ5A 3C8DA 3VVLA 3R3WA 2HA5A 4AO6A 3FSGA 4BAZA 5AOAA 2CMFA 4Q3LA 1QGED 3ED1A 5YASA 4BP8A 5CXUA 4ETWA 1K6EA 3JWEA 2P8SA 1UWCA 2HIHA 4M0MA 4JEIA 4MWSA 3O95A 5FOQA 3WJ2A 3WKDA 3KOOA 3M82A 5A7FA 5BV7A 3C6XA 4J0GA 4MEBA 4GW3A 4N8EA 5AKHA 3G0DA 4H7EA 5K3DA 1GT6A 4X00A 5LZ9A 4IH9A 4EA6A 2YH2A 2C7BA 5AK4A 2X5XA 1YAHA 1FFBA 5ALRA 4XX1A 2Y6VA 4UFPA 1FJ2A 4OU4A 1F6WA 5A71A 1BN7A 1CUBA 1S8OA 4B82A 1AKNA 1E66A 3IVMA 3F97A 3OC0A 1UOQA 4LXGA 3STVA 1HL7A 4FHZA 1XQXA 5HFNA 3BE8A 2JGMA 2I3DA 5K5EA 1L7RA 3E3AA 2G63A 2XUJA 5AM0A 4BRZA 2FUKA 2WU3A 2WFLB 2VJAA 3QVMA 1DTEA 5DYTA 4E15A 5JAOA 4PO3X 3ESDA 4YK7A 1SCIA 5HF8A 2QJWA 2AXEA 5HF5A 4P93A 4DMCA 1G66A 3AZQA 2XB6A 3N0TA 1LNSA 3AZOA 4WJLA 1FSSA 3C6BA 4IQ4A 5AKLA 3ESAA 4BVKA 1ZI6A 2QMQA 1H23A 1W4LA 5LYYA 4EUSA 3ZV7A 4HTAA 4J0KA 4W1SA 2B9VA 4UBIA 2Z3ZA 1EX9A 1H2XA 2XQIA 4AB1A 4P9NA 2HADA 4BC1A 4ZV9A 4CIBA 3FWHA 4I3FA 3L1JA 4LIPD 4M0FA 1UK7A 1P0PA 4MJ3A 1BRTA 3HJUA 1LPBB 1ISPA 1SCKA 2G4LA 3WKBA 5AKKA 3DYVA 2HA2A 3PUIA 4C4XA 1DT5A 3G9TA 4B83A 2XQKA 3VDXA 3WK4A 3SC2A 3I2IA 2WFZA 1EDBA 3H2KA 4UBLA 3AIOA 1XFDA 4W1QA 4V2IA 2CUTA 1JMKC 2XMGA 5D7BA 1IZ8A 1FFDA 4UPDA 5K3BA 1PJAA 1XZHA 1X2EA 1FFEA 5E4TA 4ROTA 2H7XA 4BE4A 2BAGA 3U1TA 3A6ZA 5HKAA 3M83A 2C4HA 4B80A 1RWQA 3BL8A 3ESBA 3R3ZA 2J3QA 1XRLA 5KWJA 2ZYHA 3DNMA 2RIPA 3QMMA 4UBOA 3ZLVA 5HQ3B 1CQWA 3FLAA 1GPKA 3LCRA 5ALMA 3I2GA 1C7IA 4X6XA 4QDXA 4WY8A 4EY6A 2CJPA 2YXPX 5A7GA 2QKYA 1VE7A 3VXKA 3OURA 1LBTA 1CUCA 5BOVA 4ZI5A 1ZD4A 4Q34A 3W2TA 5C8ZA 4B0PA 4KAAA 4DMKA 2FX5A 2DSNA 2WIJA 3I1IA 3OTQA 4H35A 1KEZA 3O4GA 1EI9A 5JAUA 1CV2A 1MO2A 3EIOA 2OCKA 3VISA 5EFZA 3IULA 2JEYA 1AX9A 2J4FA 1ACLA 5ALZA 5BWBA 5AI6A 4EZIA 2ACEA 1J2EA 5D3ZA 1J07A 3TRDA 3STXA 1CUGA 1MX5A 2ZJ7A 4N5IX 1XRRA 3WWPA 3A2NA 4PSDA 4B9AA 4O08A 3HZOA 2PSFA 4BC0A 3DJYA 2JEZA 1A88A 5LKAA 3C8HA 4H7HA 1GKLA 1XZJA 5HK8A 1CUIA 5EIEA 2VTVA 3H2JA 4PW0A 1A7UA 4KRXA 2DQZA 3G7NA 5JANA 1MAAA 5EHXA 2PL5A 4XVCA 2VF2A 2PSJA 3X3HA 4C01A 1QFMA 1K4YA 4DNFA 5ALNA 5FKJA 3AJAA 1LPMA 4OYYA 2RGUA 2Y2UA 1XLUA 5ALKA 2HA6A 1GKKA 5ESRA 5HFAA 4X93A 2V97A 3FVRA 2HFJA 2QJRA 4WFKA 3B5EA 4UHEA 3C6YA 3G0IA 3FOBA 1E8MA 4W63A 3FNBA 2YYSA 3LS2A 2K2QB 1JMYA 1JT2A 3CN7A 3D4LA 2WIGA 4I4CA 2O2HA 3FCYA 1AMNA 2XMCA 4OD0A 3VJKA 3LP5A 5AIBA 4DSAA 3BF8A 4WDQA 5JAHA 4BCDA 3A2MA 1TRHA 1ZOIA 3STTA 3MUOA 4UBJA 4PQEA 2DCMA 4X90A 1XZCA 4NMWA 1HBJA 5IKXA 1HDEA 4GI1A 1R1DA 4GWLA 5C7YA 3D2BA 2DHCA 3C43A 3NGMA 1XZKA 1WPXA 4FNGA 2O2GA 1ZI9A 1CUAA 2V9ZA 5HK9A 5FV4A 1VXRA 1QONA 5ALIA 3W06A 2IX9A 2VAXA 3WMRA 6YASA 3DDUA 1L7QA 1EVEA 2EEPA 1DT3A 4X6YA 3G02A 2BGNA 4RGYA 1QIJA 3M3DA 1H2YA 1LPSA 1E8NA 2C58A 4OB8A 2RONA 3BWXA 3FYUA 4ZGBA 3ANTA 4UHBA 3HABA 3LIPA 2PVSA 2Y2VA 2I03A 2QVBA 1W75A 5DJ5A 4IO0A 2WM2A 3RARA 2WQZA 2XQGA 5AO9A 2J4CA 4QWMA 2OAGA 1UK8A 1AC5A 3VVMA 2OQVA 4CIAA 1JJBA 1N5RA 2XMQA 3BJMA 2OAEA 4TGLA 3OOSA 5ALPA 5JADA 3V1LA 5LZ8A 2WSLA 1QIDA 5CH3A 2GBFA 4AN0A 4HXGA 4XIIA 3DL4A 2GYVA 4MYDA 5LZ7A 3IURA 1A8SA 1BU8A 4H77A 3TGLA 1CUWA 1WCYA 5AM1A 4BVLA 4QNNA 3VJMA 1GXSA 2OCGA 4B7ZA 5JIBA 4LHEA 2OPHA 1R50A 5ALUA 4AMZA 5KWIA 3STWA 1XZGA 4HXEB 2CB9A 3SX4A 4DNPA 4G8DA 4KACA 4K2AA 4WCVA 3O9VA 3ESCA 1HQDA 4C4ZA 4B9EA 1JU3A 1EDEA 5CT6A 2XMZA 2R8BA 2Y6UA 3SK0A 2PSHA 1UT6A 4QEKA 1VA5A 1EK1A 3KWJA 4U2BA 4F0JA 2BUAA 3G9UA 3G9XA 3QZUA 3V1KA 2EDAA 4EY7A 1VZ3A 1CUDA 1UZAA 5CURA 4HXFB 2H7CA 3AIMA 4J0DA 4RE6A 5HZGA 1VE6A 1XZLA 1GGVA 4U2EA 3WZMA 2Z3WA 1CVLA 2WIDA 5AOBA 4YASA 4K6GA 5AM5A 1DWQA 5HKBA 1QE3A 1N8SA 1XRQA 1KU0A 1ZGCA 2AJDA 1MX9A 4DNOA 1XRPA 3AINA 1ODSA 1FFCA 4OU5A 3D0KA 5ALSA 4D9JA 5JYCA 1WB4A 1TK3A 1OXMA 5KREA 2H1IA 2XDWA 1CEXA 2XUGA 4QDUA 7YASA 5CRIA 1QTIA 2PUHA 3MGAA 4MEAA 5AOCA 1YAJA 3ZPXA 1ORVA 5C81A 4G8CA 1LBSA 2GBGA 2HA7A 4G4IA 4BAGA 5ALTA 3AIKA 4AXBA 1VXOA 3HYSA 2H9YA 1NX9A 3D59A 1UKBA 2OXEA 1U8EA 2FJ0A 4C88A 4OB7A 4J0HA 1YCDA 4Q3KA 4BCBA 5I7UA 5IVHA 3WL7A 3A2LA 3W9BA 2BUBA 2XMRA 5ALXA 3D2AA 2ECFA 4G4JA 2AJCA 4X95A 3WK9A 1CUVA 2XE4A 4Q82A 4QDZA 1LPAB 3G8YA 3DEAA 4A16A 4QZVA 5K3EA 4MXDA 2PX6A 4B81A 3T52A 1E3QA 3IDAA 5ALVA 2XUHA 1MNAA 3HC7A 4X71A 1WPRA 5CW2A 3QMWA 4BDTA 1QFSA 1YSCA 4G9EA 1F0NA 5CBKA 5AKEA 1EXWA 3WYDA 2W22A 2JGKA 3IBTA 3PFBA 3K6KA 4WFIA 1HLGA 4LYDA 2VSQA 2VT7A 5FUMA 3LIIA 2XQFA 3CXUA 3VKFA 2HA4A 4H7FA 2WHPA 1JU4A 2JF0A 1LPNA 5JZBA 1ORWA 2WJ6A 1R9MA 4MWTA 3GELA 5AM2A 4ITVA 4W1PA 1D07A 3JYHA 3C5WP 5ALGA 2WTMA 2G5PA 4H7DA 3RKSA 4QDTA 2QXTA 1CUSA 1EA5A 5AI0A 4UBMA 2ZSIA 4BB0A 4Y7DA 5HQ3A 4E11A 3ANSA 2GYUA 1GQRA 4ARBA 1U65A 3WKCA 1EB9A 1GQSA 3MUNA 5LIPA 4X91A 2BGRA 3HRHA 4W1RA 1QO9A 3GZJA 3KWFA 1ODTC 3I6ZA 4JYPA 1IUPA 1XKTA 1BEEA 1A8QA 2WHPB 1ZJ5A 2HDWA 4P08A 1DWOA 3QM1A 4ARAA 1F8UA 1NU8A 1CR6A 4OSEA 3UUEA 1VA4A 4RNCA 2PKYX 2ZJFA 2FJPA 5EHNA 5ALJA 3WIOA 4BBZA 4CI9A 2RHWA 3BIXA 4X7BA 2ZSHA 2WHRA 4U2DA 4UBKA 2OQIA 4PSUA 4FFWA 2UZ0A 4S0XA 5T4HA 1T4MA 1DQZA 4Z49A 4EY4A 1X2BA 4G8BA 2VQ6A 5D6OA 5AKZA 4KE7A 4Y2JA 5AKIA 1YA8A 2XT0A 1LGYA 4DGQA 1QIKA 2QRUA 4J03A 3WZLA 4G4GA 4GECA 2IITA 3WA7A 5DYWA 1XROA 1K8QA 3CCBA 2ROQA 3PI6A
chains in the Genus database with same CATH superfamily
1YR2A 4C29A 2WPNA 5I9BA 2JBHA 3IR6A 4OHYA 2GM9A 2AMYA 3GFBA 2QLFA 2J9YB 2PTHA 1OT5A 1XLWA 1XTPA 2UAGA 3ZY2A 3H75A 1DFGA 2ZANA 4YT2A 3PUYA 2IOQA 1XQVA 3RS4A 1HLDA 1CB0A 3IIJA 4RLSA 1JSXA 4RKRA 4C2TA 3O4IA 1ZGGA 2OGSA 1COZA 3PICA 1E0DA 3PXEA 1CZHA 5CYOA 3W6NA 4AUEA 4F21A 5JJBA 5LN1A 3CJRA 2H1VA 2OCIA 4GE3A 2Y1OA 2PL3A 3BMNB 4ESVA 4H0CA 1O9GA 3WYFA 5IM5A 4MVCA 3Q12A 4P84A 1KFJB 3D3QA 1COWA 2B1IA 3I6IA 4J3JA 3ZW8A 3RIMA 3LC0A 4EY8A 1EWQA 4AKIA 1QHEA 3GYGA 4CV2A 3M2PA 2AOTB 2PRJA 2WTBA 4YAOA 1P9OA 2ICAA 2P3OA 1N9ZA 1V5WA 3MBIA 2C2HA 3R0JA 4LHZA 1XTSA 4CL8A 4AQDA 5JS8A 3VZSA 4RLHA 3HVJA 5DDIP 3PHJA 1XMPA 1RRKA 4I50B 4BGUA 1ISSA 5B2FA 3SQXA 3B53X 1C29B 3CRQA 4OUDB 1WP4A 2WICA 3BMNA 1M8FA 1NP3A 2CDCA 2Y77A 3OICA 1R3DA 4YMUA 4G3XA 2CXRA 1TKCA 2A1TR 3UG6A 2YHUA 3H8WA 2IHUA 3ZJYA 4P4SA 1Z0ZA 1RHRA 3EH2A 4B3GA 3K2IA 4PINA 1U90A 3H8VA 4JXJA 1O4WA 2XKBA 5C8XA 1W36D 2YRWA 3BSFA 1N36B 2JJQA 3UAZA 5EI5A 4HQKA 1G19A 4RIGA 4CT5A 3WRXC 1G20A 4RMGA 3QPUA 4CV3A 5ER9A 1Q0ZA 3S8MA 1F1BA 1GVNB 4ZO7A 2R8ZA 5CLJA 1TTTA 1H66A 1P44A 4G5HA 2WC1A 4QULA 2FFQA 2HPHA 2POCA 3LECA 4E1VA 3VU1A 4EB0A 1SK9A 3K0FB 3P1JA 3VI4B 1WABA 5K0LA 3OJFA 3GLIA 2NT3A 2C9BA 4EDHA 1EINA 5A4KA 1JQBA 4CCYA 3JATB 3R3UA 3OT1A 3T0IA 4KFSA 3GFGA 3QEMB 2F9MA 4UAUA 1EE9A 1J8MF 1TPYA 1POWA 1MAWA 1NV9A 4NU5A 1TCBA 4QUGA 4CM3A 4XIYA 4B6OA 2GK4A 1G5QA 1VG9B 2KE5A 2P6UA 4K9DA 2QTBA 1EE2A 2XGGA 3IV6A 4PX2A 4YFVA 1OY1A 1AKQA 4FR5A 4Q21A 4CN9A 1YQUA 1QV7A 4NMLA 4OBXA 2Q9CA 3UNXA 4QUIA 5HE8A 3TQSA 4O4JF 1MR3F 4H17A 4ZQGA 2ZVDA 4I3GA 4TXHA 5EHQA 4I66A 2G8LA 3THWB 1T36B 1XZFA 2WNIA 2ZJ1A 4PGFA 2IU3A 2KX7A 2O7VA 1GN9A 4ETMA 1PHRA 2NU7A 2XAUA 1ENYA 3FB4A 1J9EA 3A1SA 2GN2A 3K15A 2D54A 3N2EA 3FJOA 1Y1RA 1QVAA 2YIDA 3C7KA 3COWA 3FJ1A 3ICOA 3PL5A 3EEOA 1R0KA 1Y3CE 2Y1XA 3FF4A 4INPA 4ZTBA 1Z7GA 4NQRA 4BX3A 4FJ0A 3SYTA 4MP6A 1NRXA 1BA2A 3DKPA 1QGZA 3LPDA 3TE7A 3H8JA 3ZY6A 5BSGA 1GPMA 3HRKA 4OJNA 4X85A 4B2LA 5IAAA 1G63A 2FPGB 3AI2A 3DKVA 3EXEB 4Y2QA 1GDTA 2HL6A 4G0MA 1U8ZA 4LSGA 1Z47A 1X92A 1N3IA 2FGJA 3KYJB 5JZ9A 3UV6A 4NJEB 3CR7A 3DBRB 5EN4A 1P0MA 3DEKA 2CXPA 3CCCA 3DZFA 1R5BA 2FYTA 2YOGA 1NQAO 5LNK6 1HNWB 3BREA 1USWA 2ID9A 2X4LA 4L9AA 3ZGVA 4JI0B 4MUEA 2HHLA 1CY6A 1YBAA 1GZ4A 4UHHA 1WM1A 1SU6A 1PV1A 2P6PA 3H2IA 4Q3NA 4Q7LA 4CU2A 4ESHA 4NENA 1J0BA 4ZO4A 2QL5A 5EMMA 1M1XB 1OBOA 2D1RA 2R6DA 3F2IA 3N3AC 2IV7A 4ZV4A 2DFPA 4EBBA 3ASYA 3JX9A 1KZ9A 5AVRA 5AUNB 5KI6A 4DABA 1IB6A 3QXGA 1M83A 5F3WB 2Q1TA 2A84A 3RJ9A 3T5CA 1W2HA 4M36A 3NNNA 4PG5A 3OM9A 5CEJA 2ZDHA 1LI5A 1R9GA 1R6BX 2JAHA 4IHQA 3KQLA 1J9ZA 4TWZA 4WEOA 1Z3CA 2HDNB 3OLVA 2WAYA 2D4AA 2E7ZA 5IPFA 1OCEA 1L4BA 1WVIA 1WDLA 2YN4A 1GT91 3PGLA 5T4BA 2Q9UA 3V00A 1P18A 2ZUCA 3FCOA 2WOJA 3A4IA 3MQFA 4Q9AA 1A9XA 1DPGA 2WJGA 3MWEB 2CJYA 2R0QC 2ZPTX 2WLTA 5KTOA 4J7CA 1Y5IA 4UM8B 3L1HA 1L8QA 2EL9A 2W0SA 1YB6A 3G6WA 4IH1A 5ABPA 1E2KA 2HXYA 3IIIA 3UHAA 3G8DA 3AF2A 1HZZA 3PC8A 2JZCA 4OH7A 3FSGD 4CTKA 5ADVA 4IZ6A 2NSYA 3B12A 4HLUC 2O8EB 1MUUA 5DGCA 4LYYA 5ADUS 2ZUTA 4JI4B 3T3PB 4G56A 3JASA 3NFRA 1U28C 4HG2A 4AJOA 1ZCBA 1AGYA 5BNTA 5I9NA 3LCVB 3G2MA 3HBLA 4BNTA 4P1ZA 3BQ9A 1NM5A 3RLFA 3GL9A 3UJAA 1THGA 3FMPB 3WKAA 2I91A 1CIJA 1HE1C 2CVHA 2FA9A 2O59A 4O2AA 3Q8WA 3SC6A 1SC3A 1UJNA 2WB4A 4LZNA 1BQ3A 4WK4B 5KX5B 1ZVKA 1ETHA 4XWYA 1E1YA 2R2AA 4RK0A 1NF9A 3SU8A 5A1JA 2DXIA 5CUQA 4PEVA 3ZDXB 3SHOA 1QSGA 1NXTA 1QNLA 3I45A 3AFGA 3RANA 4EVRA 4LJRA 1L4GA 1V11A 3L4BC 5FPPA 2XI4A 4LE0A 3WR5A 1OAOA 2FPMA 4B3MB 2B82A 3IUPA 5TB5A 2BEJA 3CO5A 3AVWA 3GFFA 1ZD5A 3KL2A 4DR6B 3RVNA 4TX1A 5F78A 3HB0A 5TGZA 3BHIA 1GKYA 3D3NA 4QHTA 4B4DA 1T1SA 1ZKMA 1ID1A 4E33A 1NFQA 1ACMA 5HP4A 1CYEA 1R0YA 4ZWNA 3PPXA 5LPNA 3HFJA 5L7WA 2CNDA 4PLFA 1Y5RA 1SXJC 1FTWA 1SC9A 5ALYA 3GGOA 3SEAA 3HWRA 5CA0F 3U0VA 4JDUA 4HN9A 3LCMA 1JHYA 2ZR7A 4ZQIA 5CB4F 4CMJA 2HO4A 4OQEA 1ZN2A 1FPMA 2O19A 4U3JB 2DU8A 4C6HA 5AKYA 1J8YF 3MERA 3A05A 4Q4AA 5SZKB 1AM4D 1X7GA 1C4XA 4TSFD 4LNAA 1N2JA 4DMFA 2Z09A 2V3VA 1IIBA 1R5NA 4YJGA 2CVPA 4TKLA 1UPXA 3U49A 5JNRA 3KSAC 1ECPA 1E2FA 1J49A 1SKBA 2Z56A 3CIOA 3SZUA 2ZQYA 1VHQA 2DKOA 2Q8QA 3IPLA 5FD8A 2W58A 2WYHA 4IMRA 1AQUA 1IHOA 1BCSB 1TVKA 4UFOA 3HDQA 3U4IA 3TEFA 4AJKA 3LC1O 4ZAXA 2XVXA 4YPOA 3MXOA 3OT4A 1P1FA 1P5FA 2OBYA 2OFPA 1NONA 1JKJA 3WMWA 4Z99A 1D6MA 4ZJYA 1HM5A 1RMTA 3JQ8A 2W2NA 2UVQA 4B6GA 2JGIA 3LJKA 5BVHA 1X13A 1DDGA 4W4TA 3OM0A 5HSGA 4JNKA 5CT8A 5IZCA 2DKFA 5I6DA 1TZCA 4NK5A 2FDRA 2Q1SA 4PBSA 1GAXA 3U31A 5TQ0A 1L5RA 2FMKA 4MJLA 3E22B 5C8YA 4MGKR 4OK3A 4BN0A 2AJTA 2VPQA 4DRXA 4C03A 1I3KA 4OQMA 3AF6A 2NP7A 4WKGA 3JU3A 4IZIA 5K6RA 5C1OA 4I1UA 5EMHA 1VYVA 4XUGB 1H2ZA 2NU8B 4QTXA 4HDOB 3ZIAD 5JYBA 3JWJA 1Y6FA 2GRJA 1Y4ZA 4OHFA 4BVJA 1Q11A 4HGRA 3UICA 1Y1KE 4C0WA 3VKGA 4RD1A 3OJWA 1KARA 2ZYIA 5KU1A 1DI0A 1NRWA 1ORRA 5DSXA 1PNQA 5F51A 1Y8QB 1U2DA 5B37A 1FSFA 1C1DA 1R4AA 4QQFA 5CAEB 2OXIA 4WH0A 2K4MA 3CF0A 4X8LA 1N2SA 5FLEX 4ER7A 4XUDA 3DULA 2GB4A 4YIKA 2FRXA 4YP5A 2CHEA 2AFVA 1W2WB 1Z4LA 3WMXA 3H1TA 2X22A 4M1OA 1P1RA 3PQ6A 5EG5A 3RSSA 3O21A 4C21A 4XJXA 5EQDA 1EEXB 2ZUEA 4TUYB 3TIGA 2Q3DA 2VHWA 3HFGA 4ZVLA 4EM6A 3O84A 2OC9A 3SQNA 3O94A 5DNEA 2B30A 4KO1S 4GDFA 2OO3A 4OPMA 1E3JA 4AJ2A 3OH8A 1MJFA 2GN9A 3V80A 4QVIA 3CNOA 1FFXA 1GUFA 3QTLA 2H16A 1HMPA 3CE6A 1JXAA 4KNVA 1Z2CA 1TECE 4J6EA 5D2CA 4Z0PA 5AW1A 1Q2XA 1XDBA 1YULA 4LF4B 2ZROA 1ZD8A 1JDNA 1M7GA 3TKAA 3EPRA 2X5OA 3W5AA 2R86A 4LXUA 1RFGE 3VAZA 3OG9A 4PZDA 1PU2A 3TBFA 1T9AA 3DBLA 2HNAA 3OEYA 2O2CA 3EPPA 3M0EA 4D3FA 1QRTA 2NU8A 4O2BA 1OWMA 4TSKA 1EH5A 1Z0AA 2YJTD 1Z26A 1CIVA 2JL1A 2IP4A 1A50B 1NVGA 2DC1A 4BX2A 1QGDA 2ZT5A 4OUKX 5AW0A 2ZU0C 4IOKA 1AGRA 4XGIA 4CIDA 4DRXB 5JTUA 1RTTA 5FLYA 1U7PA 1B6GA 3ETJA 5IUKC 3V4LA 3U3OA 1CFZA 4CPDA 4B7XA 2QUIA 2B4AA 2HY7A 3D6FA 5DRTA 4HMPA 1THTA 2I7TA 3BIOA 4KSYA 4Y2RA 3BH7A 3E3LA 5F1OA 1TA9A 3AJRA 4QXRA 4UZEA 4X1YB 5CTJA 4KOEC 3GXOA 3TTTA 2QYOA 3Q3VA 1DO2A 3A4YA 2MDTA 3QKSB 1K63A 3UG7A 4AZ0A 1A98A 1PNTA 4IDDA 4AZSA 3PKJA 5FTKA 2IEZA 2VPXA 3DQZA 1X9GA 5C7IO 5D86A 4CF4A 4CKEA 4QGFA 3U0BA 1EQAA 2FUNB 4GOKA 1BCSA 3IP9A 3BD6A 3ORRA 1I7PA 2RH8A 4K26A 4MUIA 4ZU1X 1NQXA 2G9VA 1HT2E 2C4TA 3AM4A 1YUBA 1CPYA 1RQGA 4TVKA 1ST2A 3D3KA 2B3DA 4UCWA 5DYGA 4ALLA 3U17A 1W5SA 2IVZA 4TROA 1AUOA 1F14A 5EP3A 4CT4B 1H4TA 5K0JA 2CUZA 1XMXA 1PO7A 1JEJA 3LL4A 1BMQA 4RFLA 2UYGA 1XWIA 3DKRA 3QEOA 3ABRB 2HOQA 3NTVA 4YGXB 5DHFA 3HCNA 2I99A 3PUJA 4MPDA 5TVGA 3ZQJA 2EHDA 2Z08A 4KU4A 4RCVA 4S1PA 3TRKA 1PJQA 1UQUA 3U48A 3EXFB 5CDTA 1D1QA 5CD1A 4JLAA 1QOZA 3CLTD 3GG2A 2V7EA 2QE7A 1HNXB 1FW8A 2IYAA 5A3SA 1A72A 1N1MA 3BQMB 4IQ0A 1N25A 4M9CA 2SKEA 3GMDA 3I61A 4MRNA 4UE3S 4EA7A 2RHTA 1HE2A 1I8TA 4JR0A 3ZIDA 4WCDA 5JXJA 3RYIB 4BNFA 1EVJA 1UT5A 2JJYA 1NE7A 4XGRA 3CURA 1NN5A 3MZ0A 5DP2A 2GBPA 4DDTA 5JQGB 2VRWA 1E58A 1LNQA 4FOLA 3TIIA 4D97A 1I2ZA 1EFHA 4H6XA 4BMVA 1E1RA 4ZI7F 2JCXA 4MYTA 4OO3A 3I9OA 1MVNA 1AN0A 3VR3A 2WT9A 3EHDA 4LGCA 5H3HA 4EG6A 3HE3A 3WP0A 2VSNA 2Z5LA 1E77A 3SBOA 3SJUA 1Q1QA 2YR0A 4H08A 4BCCA 1BE1A 4RLFA 3KJFA 5JROA 4CUJA 3PFHA 3C8MA 1VKHA 1PI3A 2XITA 2P9EA 2FP3A 3N76A 2VPPA 2WJJA 4OP3A 4UQOA 4EHAA 4EJSC 3L8HA 4ENSA 1GGKA 1K3FA 1EFPA 1LDBA 5AJXA 5LC1A 4YUXA 3DE3X 2IYUA 3O0DA 3WLMA 1JKMA 13PKA 3DTVD 1FW6A 2C29D 1K92A 4O3MA 5BWNA 2ZB7A 3OX3A 5HUHA 1NG9A 1BE8A 4BU0A 1EHIA 2C5HA 1TIBA 4XKJA 1VMEA 2NUAB 5L6MB 3FAZA 3OIWA 2GK3A 3ENWA 3Q3IA 4FVTA 4UOEA 4G85A 3QH4A 1U2RA 3UUFA 4F8EA 3CRZA 3P9PA 3JS5A 3GC6A 3HMKA 5AW6A 4PC1A 4A6PA 2OOKA 2KSQA 2O0MA 1BDIA 4TQAA 1R6DA 2R6CA 3FIJA 3SIPA 2ERXA 1TM3E 4GP6A 3GLFB 2YICA 3NHMA 1EG2A 2VTDA 4MQLA 1IAVA 3RG8A 5EIOA 4AF6A 2XQJA 1A69A 1UBOS 1IIRA 5TIIA 2WHQA 1VFNA 2RGWA 3AXTA 1QRSA 2ZREA 2UUPA 1L5GB 3V7WA 1B0UA 1D1SA 2QQGA 2ZUFA 1NN1A 2EYUA 3UEOA 4RA9A 1FZTA 1RP1A 1NJSA 2WIKA 2UZIR 2YQ5A 4NOKA 3VNBA 2AFHA 2QD1A 3A27A 5EIHA 4YUAA 2WJIA 3JQAA 1O6CA 3T0GA 5B1SA 1YU9A 5T3YA 1KA9H 3X1MA 2NU9A 1TUBA 3MT0A 4LHVA 4XJVA 4EB6B 4HYYA 1JP7A 1CE8A 3FF1A 2XHEA 1W581 1SCUB 2HUNA 2Q3EA 3HSSA 3KFXA 5G0SA 3HACA 3CFYA 4FHFA 1CZUA 1D6NA 3WY9A 5JNTA 3ZXUB 4BQPA 1UADA 1VRWA 3OE4A 2BFCA 1TZBA 1KQPA 1E2UA 4KE6A 5TEVA 4ASUA 5KMGA 5C8YF 2OE2A 3OQNA 2CFSA 3NWPA 5JSFA 4COOA 1ULTA 1H8EA 2R4TA 2VO1A 4PTLA 1QIGA 3LUJA 1JVBA 2EKZA 4LC0A 5EL0A 1E9FA 1TD9A 3OZWA 4ETIA 4F72A 5A5VA 3C98A 4DMRA 2ZYAA 3SGLA 1OAAA 2OO5A 3I2HA 1YUNA 1MAHA 1E9VA 1Y7LA 3GFOA 3FTEA 2WFMA 1PJ4A 2I4IA 3F8SA 3TLEA 2Q7OE 3THWA 1ISMA 4NYMR 3U3KA 3AI3A 1KPHA 3GUUA 1Z17A 4DWWA 4LHXA 5AI8A 5IVDA 1E9RA 1UFVA 1VMKA 3PNMA 4JYZA 4ND1A 3MVEA 4MR8A 3NP9A 1C0LA 2BHTA 2Q29A 1RKUA 4LOKA 5CLHA 3PNYA 1ZNXA 1HX7A 4FFLA 1Z0UA 1KC3A 3FYUC 3LZ6A 3P0RA 4RL4A 4TMTA 3VO8A 4BNWA 2X0FA 1L4EA 3W4KA 2FF7A 1R0WA 3JQAB 3TJMA 5J47A 3BRSA 2YNMA 5CXSA 3S2EA 3SQOA 4NSNA 1WY7A 4P3NA 1TQ2A 2JFVA 3T4UA 4CEJB 2EF0A 4IIJA 2Z9DA 1H1DA 1MC1A 2WKPA 3FCXA 4WZ6A 3L8GA 5BSHA 1L5WA 3LHSA 3OLZA 4Y0AA 1J24A 1EFKA 2B8TA 3AL2A 4LJ4A 4M76B 5E7JA 5KQRA 2P4EA 1QP8A 4QGSA 1R5OA 4MVXA 4RTQA 3P96A 5TNXA 3N8DA 2ZBPA 3WL5A 1JDUA 1H2EA 2WMNB 4B8WA 4BFWA 7GPBA 1YZHA 3ID6C 4N4AA 4YRJA 3KLPX 1W4AA 3HDTA 4FT2A 4Y2TA 2MMCA 4P34A 4KXQA 4IEFB 1DL5A 4BBPA 4GWKA 3R7WA 1R8YA 2QZJA 1Y9AA 2ZTVA 1K9VF 1AUXA 3PZBA 3HR7A 1Q3KA 1HEUA 1W0KA 3EXHA 3KSZO 4W9RA 4GPZA 5IAGA 1L7EA 2MSCB 3PXAA 2HXGA 3Q8XB 3AF4A 3IP1A 4L95C 1U31A 3OTWA 2OC4A 3L8CA 4POOA 1BYUA 4FCCA 4Q12A 3ZKWA 4LBWA 5BSTA 3ZGXA 4JQSA 2XA1A 3D9QX 2JK0A 4MLCA 2BFEA 4LI3X 3CVUA 5TQ2B 4Q0MA 2PZ8A 2XNKA 4CEHB 3PEUA 3LHKA 5E7QA 4OJKA 2XLBA 1QO7A 1YB4A 3WB1A 1PRYA 3M1IA 1HYEA 4RK1A 5J40A 1UFOA 1X8XA 2EP5A 5CX1B 2A30A 2XA9A 3GFRA 5FYQA 1O95D 3DAPA 1Z88A 1GD1O 5FI5A 4Z3DA 3VR2A 3ZHOA 3ER9A 1JNXX 1P81A 1TT5A 3OJLA 1MX3A 1P73A 3LKZA 5K3AA 1DC8A 4C7KA 5LZ2A 1I7NA 2DHEA 3C5CA 3OESA 4KBFA 4EO9A 4C9BA 1G5FA 1K0UA 2QM0A 2WFLA 4HLQB 2ZZKA 1KI7A 4IJUA 1JH9A 4HB2A 3IC5A 4BEBA 2BFNA 1ZRNA 2PZGA 2AH5A 1N3YA 4WNAB 2G80A 1TYBE 2QAJA 3GZTB 4N0PA 1MZPA 2IUTA 5AVSA 1P9LA 3GRCA 3ZCTA 4O4LB 4C6TB 2CJWB 3ZWWA 1QUFA 4AKSA 1WDWB 3TR5A 2NN3C 3KT6A 3P9SA 3RG2A 5K0BA 4LJKA 3ZGNA 2QP9X 4M0EA 4CLRA 1G0OA 2H59A 4LNUA 4QUEA 1UBRS 1UJ5A 2E2WA 3L01A 4F6LA 2LDXA 3ZWPA 4G24A 5DYNA 2Q3JA 2YJ4A 3EC7A 3R23A 1V7CA 5CB4B 4OQ4A 3VAAA 2N1BA 2WSSD 3BWEA 4JSYA 5DGHA 1WW3A 1NG1A 2FI1A 1E1QA 1CTQA 2VQFB 5FWXB 1YU6A 2EW8A 3OKFA 5CNMA 1L5LA 2RDMA 5JRJA 4KQMA 5KQSA 3C1AA 3E61A 2OM2A 2YQZA 1MVOA 2R8RA 4DNXA 1OX4A 3AHJA 4F5EA 3JZDA 2AG8A 2ZYSA 4E07A 2DBVO 3BXFA 4HD8A 3FSRA 4DM4A 1YBFA 2PD4A 5ARDA 2WDPA 2XUDA 5E3IA 3W6ZA 1UPBA 2HWKA 1SZDA 2P40A 4GLBA 1V9SA 2ANBA 5EKUA 4ARSA 2R1TA 3NONA 3EF1A 1K7SN 5K6TA 4HT3B 4KXWA 4ACBA 4M0DA 2AWOA 2RBEA 3M5DA 3TAXA 2VJOA 1H6DA 4CDNA 2V65A 1D03A 2GBIA 4RVDA 4I19A 1XDSA 4I6GA 1T4BA 3C8UA 4UEWA 5EJGA 4M9SA 5HDQA 1TCCA 3AY0A 1J2RA 1J5XA 2IZ1A 2NADA 3LC2O 4YAJA 4BVAA 3KZCA 1OC2A 3M6IA 2AHOA 3S2SA 3SF8B 1V1JA 4F84A 3FPSA 1P33A 3A9CA 4FKMA 4MR9A 4NOJA 5BQ3A 2ECOA 3QKWA 4PWYA 4JYAB 4KP7A 1KGSA 1L7BA 4EG7A 2M1ZA 3S29A 5H5JA 2WKWA 3CZRA 3W04A 4HZIA 2IQIA 3PUVA 5T7BA 1UFKA 3B3FA 1QO0A 1GA6A 4OBEA 1LSUA 2H6EA 3T4XA 2QL9A 4F4DA 5BN5A 1JG6A 3UOAB 2GJAA 3O9ZA 4R9UC 4E5MA 4P4GA 4Y3UA 2VWQA 3B89A 1ZUHA 3JQBA 2V59A 5TS3A 1CERA 1O6ZA 3C3WA 3RABA 3W7AA 3TR0A 4NCJA 1OLOA 4UPEA 3K0SA 4N3AA 3GEBA 1TQDA 4IEIA 1FS4A 3KP1A 1VKOA 4OSPA 1H22A 3I9V1 4HMQA 1QIHA 4LYEA 3ZV6A 1CFJA 1M54A 4ME6A 4KR0A 1FTNA 1GNPA 1P0FA 4OHVA 4Z0TA 4TWAA 2XGOA 3ROTA 2K87A 4G4SP 1E2HA 2OBNA 2H54A 3K09C 2DTDA 5L4SA 9LDBA 1R8JA 2HK9A 1TE2A 4KJXA 3Q7EA 3AM3A 4NZZA 3TNFA 5K8LA 4WZAA 2QI9C 4A26A 1AXRA 5IBQA 1TLTA 2Q62A 1ZO8A 4FFBB 1NZDA 1N7JA 5AJVB 3ZU6A 2ES4A 4LHYA 5KOYA 4QFCA 3TTSA 5DGDA 1YACA 2PX3A 4UEKA 2Y0EA 3RRBA 4PZEA 4D81A 4QVKA 2DKNA 1Q77A 4W9NC 2AN9A 3E15A 3EOAI 2E1RA 1L5YA 1RAAA 3ER6A 2F1IA 3HJNA 3FY4A 1WETA 2I8AA 1X0XA 4ZPXA 1DJPA 4FLFA 3BQNB 3RS8A 4ZT7A 4NS1A 5A02A 1O94D 1KWGA 4FSHA 4DN6A 5B58C 2GJKA 5IH7A 4OKNA 1IEQA 1XYVA 4DLKA 4CJXA 1T1RA 2QT9A 1NQTA 2AFIB 4BHTA 2WE8A 4TWRA 2CV0A 1LUAA 1QCZA 3X1YA 1BXZA 3L02A 2VAVA 4BWYA 2H08A 3KSRA 4BLQA 3AEXA 4Z9BA 4BVFA 4HMOA 4JHLA 3SR3A 5KX5A 5CM2Z 2IK8A 2QVXX 1XZBA 2OHXA 2QMYA 1DZ3A 3I05A 2PWYA 4TS3A 3ROEA 1L9XA 1U7DA 1U7UA 3LWZA 4GUDA 4P86A 1U2EA 5EE3A 3KE8A 3ED5A 4N5HX 3L6DA 4ARZB 5HKKA 3R24A 5KINB 5J4LA 1FNMA 3ADDA 4AFNA 3PA6A 5ALHA 4ERNA 5AQ1A 1ZMOA 1EVZA 1X1BA 2P2LA 1U3WA 4V0LA 4AMYA 4FKBA 2BONA 2O8EA 1PGOA 1HEYA 4D9CA 4HAOA 5B4VA 3KXDA 4K1XA 2V1UA 3F9RA 2PKXA 4JBNA 2ALJA 3CR8A 5DPMA 1LBQA 3LDGA 3RFXA 3G13A 3PF9A 1FRNA 1LK7A 1ONOA 3EZ6A 1C30A 1TMYA 1CY8A 4GF5A 1Q14A 2B34A 4QTTB 3DMFA 4NLLA 5JCJD 3EGVA 1ZH4A 3D7KA 4OMDA 1WHSB 1YD7A 3DOFA 3PX2A 3SLKA 4ZI3A 5CLFA 1FU7A 4AN1A 4PHHA 2C2ZA 2QP3A 4YXWA 2WNHA 3AOEC 4QE3A 1XX6A 5KQLA 2GPWA 2J67A 4MQMA 1DKNA 5ALFA 4BP9A 1QKKA 2ZWOA 3A6GA 2ZJYA 1U4NA 2P9QA 4QG7A 1D1PA 4RZHA 2H48A 4HI0E 4UUQA 4C0BA 4DR4B 4LQCA 1FXUA 2XNDD 1N34B 2RHRA 2ZRKA 4D6PA 5IDQA 3ZUGA 4WKPA 4I4TB 4B43A 3FCSB 1TVEA 4K8OA 5J5CA 3LUAA 2V6IA 3EVNA 3QEJA 4HRYA 2WAAA 1IJBA 2ZYVX 1CJTC 2OHHA 4RMJA 2C3MA 2HBRA 2MIIA 5ILOA 5E3JA 4LS3A 5AI9A 2B4KA 3PFFA 3TL2A 2XRFA 1WJGA 3FMIA 4FLEA 3IEXA 4R2LA 1MKYA 3VOTA 2I7XA 2P9BA 4B84A 4EF5A 5MGNA 3N07A 2R4QA 3LKVA 3P9XA 1MVLA 1FP1D 1GY8A 5EMNA 3R09A 1QC5A 3LGSA 4FD2A 4J2OA 3ZBUA 4HGOA 1KVQA 3I5AA 1KK2A 5JNSA 1RYNA 3UCFA 2X5NA 3I8SA 4YRPA 1J0EA 4LXHA 4PLYA 1GNLA 3EK2A 3LW7A 2A9FA 3ELUA 3RREA 3MS2A 1RBMA 3U7HB 4MUKA 4DFDA 1SEVA 4LJAA 5B7QA 3QELB 1ND6A 2APJA 4CMBA 3IUMA 3IQWA 1K27A 1B4DA 4KZKA 3MWEA 4CLDA 1RRPA 1UMBA 2WJAA 4CFSA 1P7ZA 3RK1A 1PV2A 3MGCA 1L5OA 1Y1LA 3QJGA 4IVNA 4Q9IA 3EC1A 5T6MA 4BJ6A 2QSJA 4KUEA 4HDCA 4QYSA 2R7NA 2Y93A 4TL6A 2O05A 1B26A 5IK2A 1DOAA 4LXIA 5JSUA 3PCTA 2ZI5A 3S2GA 1J0DA 1JKFA 3AWIA 4NI5A 4FDMA 4YJ3B 5EJAA 5B7NA 3ZD7A 4R40A 1JQ5A 1TF7A 3DW1X 4LAFA 3VYTB 4B48A 4C87A 1Z4PX 4OHCA 2C04A 5EA2A 4EA9A 1W5EA 4I4IA 4OX9B 5LM3A 5C0OE 3T7DA 7AT1A 1FC0A 5HNKA 1S9DA 1C3JA 1KJNA 2H2WA 4ER0A 1CD5A 3CN9A 1OZ0A 1YQDA 3M5WA 5BW8A 1QAMA 4I9UA 4NENB 2J5QA 4R8SA 1OIWA 4KPYA 3M1LA 1U2QA 3G1UA 4H7IA 3ZWKA 4X61A 3RRJA 3U7IA 1GGNA 2BFBA 1FX0A 2JGRA 2VJMB 2XGSA 5HF6A 4FYMA 3KHUA 2GCOB 3COZA 3VKWA 3VH3A 3VH1A 1PSZA 2A3NA 2RAUA 4R8VA 4UNIA 5C4GB 4EYEA 4PZ0A 1F2TB 1DVRA 4JYCA 4AKHA 2TYSB 1A5SB 3PCRB 3S1LA 1O8CA 5LKRA 1XPRA 2D5LA 4H7JA 3Q0TA 5JATA 5JXHA 4CMKA 1TU3A 1YL6A 1FIUA 4UREA 3LCUA 1L5SA 4XTRA 1OXBB 3R9KA 1EDZA 2QAGC 2XNJA 4NMMA 3JW8A 3P7MA 4PXYA 5JVDB 1YA4A 1YJ5A 3OZDA 4GOXA 1FQOA 3HCDA 2J5RA 4KIGA 4LZLA 3DMRA 1L5HA 4EP1A 2A33A 2IU6A 4QXMA 4MI6A 1CZOA 8ABPA 2X8LA 5H02A 4E21A 1XF9A 3HCOA 2O20A 2CBZA 4L5JA 2ODTX 4BGDA 1EDDA 3NRJA 4AZ3A 3UV7A 3T12A 4H3KB 3QLJA 1NF2A 5DNVA 3ZE9A 3T9DA 1AG9A 4TKZA 4RPCA 1N0IA 4RF5A 4B3RB 4BL5A 3LWDA 2Z6AA 5I9LA 2GVDC 4OB6A 1C9KA 3KZ1E 1BYIA 3F5FA 3UHFA 4GGMX 6PFKA 2CL7X 3KQUA 3DHNA 4YIHA 5M34A 2FFJA 3DZGA 1M8PA 3FKSD 3L0DA 2RH4A 4JB0A 4R7ZA 1XMQB 2PXXA 2NUBA 3Q9UA 2YZ2A 4JIGA 1Z68A 1TJ5A 2NVOA 2AOUA 1Y5LA 3A3NA 5KPJA 4HP8A 2QRMA 4MDYA 5B6JA 3QEMA 1OAOC 3C6KA 3DOUA 3NGXA 3T5DA 1U2ZA 2P0EA 1YRYE 2BI8A 4QYXA 3U7EB 1L3CA 2BVNA 4RJIA 1U0HC 2IOHA 3VO9A 2UZ1A 2LGJA 2ZAGA 3QKIA 3SFTA 3TMKA 1I32A 2H29A 5KOHA 2FQ1A 3HL4A 3C41J 4JMPA 1AOXA 2R85A 2CSXA 5BPFA 3RVOA 4PFJA 5FUQA 1L7VC 2ZWPA 1KE1A 1ZK1A 4YDQA 5JV5A 1EK5A 5IJAA 4MVYA 4ZC1A 1X14A 4MV1A 4CG2A 4QAJA 5B2ZA 1I24A 1SXJA 2D5BA 2XMDA 1R0BA 3HJRA 5C1BA 1VLJA 5DK6A 1NF8A 2KBFA 2HIAA 4J9VA 5HHTA 1V47A 4GT1A 4IIJB 1SVSA 3P8ZA 4FK8A 4DBLE 2A59A 5EIBD 1C8VB 3GHHA 2B1JA 2HW8A 3X0DA 5LOVA 4JLOA 4J6FA 2IEGA 3HVKA 4E51A 4RE5A 5CX1A 1RRCA 5JQWA 1DX6A 1WE2A 2Q6IA 3PCXA 4HVTA 3M4NA 4MI9A 3QW2A 4UVDA 2E3JA 3EQZA 3K32A 4DQKA 1VOTA 2QR3A 1IFXA 4B2YA 1UINA 3F49S 2BKXA 2PKEA 3KK0A 2SICE 5PNTA 3VU0A 4BO6A 5AVQA 1JQLB 1KAMA 2Z5GA 1FA9A 4H3VA 2PLNA 4N8SA 4FGUA 1JKXA 2J3LA 4MW4A 3K70D 3OLYA 3GW8A 3PXDA 1G1AA 3X44A 3GJ4A 2VAWA 4G37A 3P9RA 1YE3A 1SIWA 2JCSA 2C42A 1RYZA 4PLHA 3KHSA 4BB6A 2VTBA 4M88A 5JR3A 1UUFA 3GMTA 2OQRA 4U7FA 1MJ5A 3GV0A 1XEAA 2BV3A 4C4RA 2Y92A 2EBHX 4RXUA 1D8AA 3S28A 2ET6A 1NI3A 1L5VA 2FZCA 2ZT6A 4INAA 4L4ZA 4AO6A 5CNJA 5KMGB 3FBGA 5TXGA 1A2KC 1YQEA 3OQIA 2YN0A 1B1AA 5EERA 3FSGA 3U7JA 2E49A 4KQ2A 2R1VB 3KQTA 4JJFA 4KR2A 4OHPA 1RYEA 3W3AD 3AYZB 3CNEA 5BUSA 4ZYTA 3R7NA 3OQPA 1VJ1A 1FVXA 4D82A 5F2OA 4O2LA 2JA1A 3JV7A 1RZRA 4TYQA 2QTZA 3W77A 3CS3A 3ELDA 4Y67A 5EZQA 1UWCA 2MMGA 1VI6A 4M8SA 2VP6A 3L0CA 1IU9A 4M0MA 1QU2A 2BM8A 2V6BA 1ZMXA 3Q5EA 4EABA 3VJRA 2NGRA 4CV0A 1Q1BA 4WGGA 1TNDA 4YRZA 5J2UF 5FQOA 2X0DA 1YCGA 2Q5IA 4IDAA 2IX3A 3WKDA 2O8FA 1YJAA 5A7FA 5FFMA 3PHLA 4YRCA 4MEBA 2ASVA 4N8EA 3W6OA 3WNVA 4LVCA 3DWFA 1GR1A 2JARA 3G0DA 4R8MA 1FUEA 3EC2A 4J7UA 4OXYA 3QBEA 2X5KO 4EA6A 2D2VA 4TRJA 4O5OA 4C7OA 2OL4A 2C7BA 3PC7A 1SB9A 4LV6A 4HDQB 5AK4A 3BMQB 4MCHA 4MW1A 4RZIA 1M0TA 1RKBA 4KXLA 4NABA 4F3CA 3G2OA 3EXHC 3KG2A 3QUAA 1UJCA 4TLAA 5H81A 1DCTA 1WCIA 4HQLA 1R6VA 1F6WA 2VHYA 3WGMA 5A4AA 5A71A 1RPAA 2NUTA 4U0JA 1BN7A 4OH1A 5JLJA 2CHFA 2ZYDA 3DDOA 1CUBA 5JZOA 1D5CA 3FTCA 1K97A 1AKNA 4PHTA 4BJ1A 3IVMA 3DKIA 4GR5A 1SVKA 1V5GA 3UJ8A 1IWPB 1EP9A 1UOQA 4WXHA 2QRVB 4XFJA 1J5PA 2VJQA 3KUXA 2X0IA 1RE0A 2V74B 2I1LA 4ILEA 2HRCA 3HM9A 3WDKA 4IKOA 1YL5A 2NZVG 5L3QB 3ZE2B 2F3PA 1SH7A 5HFNA 2BDTA 2QG9A 3FYDA 3HQ4O 1BHSA 1KORA 2VYFA 3WYBA 1Q7TA 1U7HA 1J0CA 3LD9A 1RI1A 2B69A 2VNKA 3KAQA 2KB0A 5BWOA 2BCGY 4Q48A 5B55A 2H4YA 4LZPA 4RETA 3AVQA 1O96A 1R37A 2PYDA 4XGKA 1R0LA 4IFTA 4BRZA 3ETCA 4NULA 5MFZA 2FUKA 3OZUA 2AFIE 2UYQA 3QPBA 1C50A 1VE5A 3ZC3A 2TSYB 4L22A 1GGMA 5IXSA 2ZE6A 1NJ6A 4ZU3A 2PMKA 3F1LA 4HB0A 2VJAA 1H1TA 4LF7B 2H8KA 1S2NA 2MINB 4HJXA 5JAOA 3FFBA 1T5TA 4ZZIA 1S01A 4BB5A 1G8GA 2OVBA 2NU6B 4BNNA 3B3AA 3CSSA 4N6OA 1ZVQA 5G0VA 5BSVA 1AY0A 3IT3A 3VOBA 4B46A 1P31A 3LY8A 4BVGA 2OFFA 2AXEA 1DSSG 4QGAA 4HQOA 5AHOA 4EJ2A 1S4MA 1TUIA 3U80A 5LBUA 3HNRA 4FNOA 2NUTB 4P3KA 3RQIA 1HE3A 1X1RA 3TN7A 3UJ3X 2XB6A 2PFGA 1LQUA 3N0RA 3AVXA 1Y1PA 5C52B 1P6XA 1Y5NA 1W0JA 2ZJ5A 3B8HA 1QVRA 3MFQA 4FZRA 1SVNA 2LWIA 4TTIA 4JV5B 1SVMA 3LUPA 3CT4A 1YZFA 3CH6A 4MNTA 4Y0NA 1E3LA 4L51A 4EQ6A 2O5VA 2I6UA 3A04A 1PFUA 3H3FA 4HQFA 2CHUA 3GPCA 1JU9A 3VKHA 4O4IF 3DM9B 1T8WA 4X0EA 1JLLB 4DIEA 3S68A 1HTTA 1MLDA 1A8PA 1JAZA 4UM7A 1VB3A 2BGJA 1KOGA 1R4MB 1N2BA 2LDBA 4MQFB 5LYYA 4CQJA 5FWYA 2FJUA 1W5AA 3FRIA 4Z86A 1OBVA 4MGEA 3R77A 1U0FA 4FZ5A 5CK4A 2Q0HA 1SZCA 4LDJA 1NFRA 2ZUBA 3G0HA 2NV2B 5I45A 2R60A 1E0JA 2OSVA 3AB3A 2J32A 3P32A 5CHYA 2R6GA 3L06A 1D2MA 4GRIA 4BFCA 4J49A 1A7KA 3E23A 1M1NA 2HADA 3B9BA 1JHOA 2GK6A 2QNIA 1XZPA 2WD9A 1KY2A 5KWSA 1ZK2A 2HK6A 2JCBA 2DPLA 3G59A 2NVWA 5A06A 3RUDA 3MGGA 1MV5A 4HAVA 2RKOA 4I3FA 3EMKA 1L1QA 2JLVA 3D4NA 1NKTA 4OJTA 2GAAA 1GTG1 1VL0A 3I4LA 4QPNA 3UMCA 3ANLA 5C1IA 1TM2A 2PJZA 2ZRNA 1BRTA 2ZW9A 3EBOA 2QXYA 3M5CA 1JBKA 3N6XA 4MJ3A 4B17A 3DD1A 6ABPA 2PVPA 1ISPA 4RTOA 2JFPA 4G5GA 3EVCA 4G36A 3E03A 1DKRA 2IZOA 1QQ5A 4HAUA 3VHXB 5SY9A 2SKCA 4RDXA 5DHAA 4L2IA 4W8OA 4A0FA 1MJGM 3DYVA 9GPBA 1U1DA 3PUIA 5CW1A 4F4HA 2BZGA 4HH1A 4B83A 1C41A 2WI8A 2XQKA 1C14A 3QVVA 3RUEA 4PLCA 2GS9A 1M3SA 1E2MA 4FYVA 4MICA 5B4TA 1VSTA 2WFZA 4K9NA 3TLMA 1Z6QA 5B1IA 1QCCA 2G5GX 1EDBA 2G88A 3UUGA 1Y8QA 2QTWB 4F4FA 4J8PA 1N2CB 2JHPA 1ADGA 1G9XA 3OZFA 3ZWBA 1A9SA 4GP7A 3A14A 1JMKC 1C9NA 3U26A 3L0ZA 4KLCA 1KR5A 4ZVUA 1G5PA 2BMVA 2P27A 3PQ8A 4GKJB 1FFDA 3L6CA 2BEUA 1JG7A 1SMKA 3CLTC 1S7GA 1Z8DA 2AYXA 5DK4A 1PJAA 4Z9FA 5M29A 5BYBA 2QLBA 2X77A 2JIOA 4WSOA 5I7WA 1OH6A 1SC6A 2CLMB 4MKIA 4BO3A 5KVCA 1RI3A 3AQ4A 4R1OA 4GMKA 4DBVO 5E4TA 1ZVJA 3RVRA 3IOBA 4BQQA 3AV0B 3MAGA 1FX1A 2FW7A 3FSJX 3N53A 5BO5A 4C76A 4CTJA 1PDVA 4ZIRA 1AXEA 4FMBB 5CBPA 3HYNA 6AT1A 4WXYB 4AS3A 5JZMA 2W4MA 3QKRA 2GSDA 1UXGA 4DL9A 4H1VA 3M83A 2C4HA 1FTSA 5LA6A 4KN6A 4GVPA 4FEEA 3CZ5A 3L18A 5CA1F 4C0XA 4JSRA 1BKDR 3BL8A 2QLJA 4GI5A 1UC8A 3D0QA 1UKEA 4O33A 1ULSA 4YJ3A 4JWTA 5KNDH 3D4PA 1YJ8A 2G70A 5IWCA 1LDEA 1JR2A 1KKUA 2CXSA 5KWJA 1EUDA 1E7RA 3G6KA 4PRLA 5IXYA 1FLNA 2AE2A 2ZRMA 5DYIA 2B37A 2EBWA 4ZA2A 4B74A 3DNMA 3P5SA 3PPWA 1E9BA 2QRJA 1T5OA 3C4VA 2CNLA 3T15A 1CQWA 3AETA 4EH1A 4RY2A 3ZXSA 4AZWA 2WYWA 4TUYF 2EVWX 4KQ6A 5B1EA 3A4MA 4KIUA 4LFBB 3GLQA 1U6IA 3LCRA 3KX2A 2FZLA 3SSNA 3R6LA 4XQ0A 3BHMA 5IEBA 2WA1A 2C4UA 1OR8A 2HT1A 3F1KA 4L02A 1Q0HA 1TJ3A 3AH8A 4QDXA 5J1TB 4U7TB 4Q9HA 4WY8A 2AQ8A 1ZL2A 2F3TA 3HCRA 4EB8A 3ZHVA 4N7BA 3BWCA 4EY6A 5ED4A 1BHO1 2QKYA 1Q0SA 2F43B 2VTKA 1VE7A 2CZGA 3MJFA 4BLTA 4C4TA 5DBIA 3VVCA 2IVFA 5JWRA 4M53A 1C80A 2ZT8A 2N1MA 3S44A 4DMMA 2YV4A 3FVQA 4B0PA 4RKYA 5EY5B 2IEBA 4KAAA 2HLPA 4DMKA 2FX5A 2P30A 3GFTA 5KWEA 1IBKB 4M86A 5E2BA 2QN7A 3GUHA 1OJLA 1EI9A 4GI3A 1X7XB 1KKMA 5JAUA 1NLFA 3VTFA 1RNLA 1J8DA 1J4AA 5E0KB 3EFEA 1MO2A 3IEUA 2E6KA 2GCOA 4EMSA 2GKGA 4P31A 3UK1A 4KNYA 3VISA 5ENZA 3P94A 4Q4JB 5JFTA 2CMDA 5EJ2A 3QY9A 1OPXA 3HGMA 1KFCB 4AP6A 4NFLA 2C9OA 4K6CA 5ICMA 3PTAA 1KSFX 1NW4A 1G7TA 4NXNB 3ST7A 1J2EA 1J07A 2ADOA 3N8GA 3U39A 2HBQA 1HOTA 2O52A 4CW7A 1CUGA 1BD4A 1HOXA 1ECFA 1FPQA 2AR9A 2VUSA 4CQMD 2V9CA 3HBAA 5JS6A 3ZBQA 1RRGA 4NOMA 3I53A 3PDIA 4ASUD 1U3FA 2PWBA 3MT9A 4B9AA 1UBJS 2D06A 1BX3A 1FYVA 1POXA 1QQ6A 2XF2A 1E69A 1GN8A 2HC9A 4JUCA 4KGVA 4XIGS 3TGWA 3HZOA 2CLKB 3VO1A 1KDTA 3DZ8A 1QH9A 2YHIB 5I8ZA 4P0TA 4B3TB 3HTXA 2H1WA 1GU1A 4TZ6A 2ILTA 1U9IC 3KSMA 3N7AA 2JFBA 1DAHA 2W71A 3H2BA 1QRAA 4PSAA 3VDRA 1KQGA 3DR3A 3QELA 4YRIA 1ZOOA 3WK4A 4DLAA 5ELXA 1M1UA 1KQNA 2O3QA 5FNVF 5HK8A 2G1PA 5CA0B 3WDMA 2HDHA 1XFAA 2D74A 1BG6A 2H9AA 3H2JA 4JL8A 4DLXA 1A7UA 4JLWA 4RMHA 1XT6A 3HKEA 3OKCA 4K3UA 4UNPA 1J1ZA 4EHKA 1NWHA 3Q7IA 3VR5D 3R6DA 1K68A 4HEQA 4JI3B 2PV7A 4LMAA 3IQHX 5TSDA 4ZI7A 2N42A 3B5JA 4MVJD 1C2TA 1QZXA 4FHGA 3X3HA 1YNSA 5E9QA 5BXYA 6ADHA 1EFRD 2BFFA 1F8GA 3EDOA 5AWFC 3OZAA 3HXPA 3EQ6A 4DNFA 4JELA 5ALNA 4INJA 3IR5A 2HSEA 1LPMA 4JJIA 3CEHA 4WAUA 5JG7A 4RAOA 3UMMA 2PS1A 1KTVA 3DBRA 3PQEA 3OPYB 4JJ7A 4K86A 1K5HA 5JJ5A 2AMVA 4N03A 5ESRA 5FPSA 1GSHA 2W4QA 2AEMA 3WFZA 3OMXA 1DC5A 4CM5A 1B23P 2VBGA 3FCCA 2Z8YM 1WLSA 2F7SA 3I4CA 1NOJA 3MCZA 3ITNA 3U3ZA 4KV7A 3EJ6A 4II3A 2GFQA 3G0IA 3R7FA 5KQMA 4ID3A 3VKUA 3OUZA 3TG2A 1ESZA 1V6AA 8MHTA 1NYTA 2D1QA 1DAIA 2K2QB 3FIUA 5FBQB 4PIVA 3COYA 1JT2A 3EA5A 1TT7A 3MOSA 1K06A 3K1JA 2I8CA 3N0VA 3D4LA 1PL8A 4OHRA 4NTZA 5WRFA 4DB4A 1UM8A 3ZVKA 4L0MA 3GEGA 1GAEO 5ILQA 5A4JA 1PTKA 4PANA 4WI1A 3NWEA 4B8ZA 1AMNA 4O2RA 1E2DA 2ZSBA 2JLCA 3MBKA 4GZ6A 2WF6A 2YZ7A 3BF8A 3REQA 1YZUA 1ZUIA 2ID8A 3A2MA 3STTA 1NT2A 2H8GA 2EFHB 4BLRA 4KI0A 4PZCA 2D5IA 1R12A 2R62A 4G23A 1UXKA 1Y1SA 3T95A 1UPTA 3QU9A 1KC1A 1USGA 4YJ3F 1HBJA 5IKXA 3AB7A 2IEDA 2O5RA 1SJ9A 4HQ6A 3UA4A 1BAPA 3IP8A 3FWYA 5JWOA 1Y4DE 4RS4A 1CC1S 1OE0A 2M9MA 3K7EA 1W87A 3C85A 3MJEA 3Q6MA 1EYZA 2AMFA 4A2QA 3GJ6A 4DHWA 2CMHA 3D2LA 3DEIA 4TQUS 3H7AA 3TJZA 4G25A 4H0NA 3PGXA 3D81A 4WZBB 4B45A 2MJLA 3DVQX 4JLPA 1ZD1A 5H83A 1ZJJA 4ZOLA 4JP5A 2YIMA 4LFCB 2VUTA 2NYVA 4FJ1A 4QUBA 1AS3A 2PMEA 3WLQA 5BUQA 5LU8A 5FUBA 3HA3A 2H07A 1JDJA 1P3JA 4Q24A 1M2EA 2O2GA 5CXQA 3D8BA 3MINA 4M46A 4PFKA 3NUGA 2KI5A 4XJTA 1Y1QA 4JX9A 2OBLA 4TYPA 5IABA 2BFOA 3RS0A 2W48A 4Z6KA 2NO0A 3ND5A 2ZAOA 1VXRA 3DQPA 1AZTA 1PQUA 1OIXA 4FMCF 4UARA 4JXXA 2AE1A 3FTPA 4ZALA 5ALIA 4AYWA 1ZR2A 6Q21A 3CZCA 5J4VA 4GC9A 1JWBB 1NPDA 3FGPA 1KAGA 3Q3EA 1XCGB 2FW0A 3WMRA 3CX6A 3ZXXA 2VHZA 2ZYGA 2AR7A 3PA8A 2B98A 2Z9CA 4RVCA 3TPFA 5L4NA 3TAUA 2D0OB 1X77A 1E5VA 4GR9A 1NDQA 3K9HA 3KUKA 5FH9A 2A5GA 2XV1A 4I9GA 4I4TF 1EZ1A 1HGXA 2AKAB 1GZ5A 2WM8A 4N0DA 4DPLA 3DT8A 4OI4A 2MYUA 3IBFA 3OQ6A 4WBNB 2C84A 1P1JA 2DMRA 1A4RA 1LPSA 3LFUA 3NTLA 3RV4A 5AVOA 2PUTA 1E8NA 3D5TA 4E09A 1JQJC 2C58A 3UWOA 1VPWA 4K0KB 5F2EA 3S40A 1KI3A 1A96A 2VH2A 3OWXA 1ISFA 1TYZA 3K0FA 1Z18A 2WKSA 5EE0A 3UW1A 4AM8A 2CFTA 1SBZA 1GA4A 5KJ1A 1E63A 5FPHA 3LIPA 1GAQA 4ZEOA 1IWOA 4ZIRB 2WF9A 3TRIA 3KL4A 2HSGA 3WGTA 3S6JA 1XTTA 4RVOA 4K88A 5JSKA 2I03A 3RT9A 3C2QA 4NICA 5THXA 2DX7A 1QDEA 2CCKA 2ANCA 1YVDA 2GA9A 3MGBA 5DJ5A 4CIYA 4Q4LA 5JZVA 1WZCA 1Z13A 4E70A 1JIKA 3A1CA 4DR2B 1PVDA 2FKNA 3N2GA 4Q16A 3R9WA 2X2PA 5IS2A 4DKJA 4TV9B 1Y4AE 5BP7A 3GFQA 2P7HA 4KGZA 1XTZA 4MI1A 2WM2A 3JAKA 3MPUA 4HYEA 3TW0A 1T15A 1X1TA 2D8MA 2H0AA 2XQGA 3BE5A 4KIFA 4NIMA 5AO9A 4IR7A 3TQCA 2FQWA 3G2HA 4WA7A 4MS4B 1W4RA 4DIOA 5IMSA 4F9FA 5EGSA 3L4EA 2Q45A 3ODPA 1S6YA 1QE5A 3D6NB 3B7PA 4KWIA 5EIWA 3W2FA 4KBGA 1P74A 3KEGA 2A94A 4DGSA 5GJBA 3RIHA 4XLLA 2P9HA 4NBKA 2ZR0A 2BFEB 4OP1A 4WXPA 3ZEIA 4CIAA 3VBCA 3D4OA 3V4VB 4K9SA 1QS0B 2WKQA 4M3NA 3LOQA 3ZZTA 4HGZA 2OAEA 2FQXA 4TGLA 3OOSA 4R84A 5ALPA 3QU7A 4I5DA 2YWEA 2LR0A 3V2IA 5JADA 4JI5B 2MU1A 2ZI6A 3QTTA 4HNAB 1IOLA 3QXJA 4IOJA 3BXXA 1YZTA 4JL6A 5K20A 2WYVA 5CEFA 3UPTA 1DFIA 4WVFA 4EGFA 3GFVA 2RKWA 1QF7A 1LDNA 4DV1B 2J9ZB 1SVUA 3LA8A 2YYZA 4DWVA 2WU1A 4EKEA 4PAQA 2BGTA 2BRUC 3DEHA 3P2OA 4V1CB 2DT5A 5EJEA 1A95A 3NU1A 3ZV4A 5B12A 5TMPA 5COQA 4HFRA 3NKFA 2O8BB 2X58A 3IKVA 2DGDA 4YAEA 2PUWA 2ZRCA 4WEQA 4NV3A 3UTCA 5LZ7A 3JZAA 3C3JA 3RVDA 3B38A 2BSAA 2P6RA 1R5JA 3BZWA 4RBNA 2PT6A 4B32A 1CUWA 4XARA 4CT0A 4YLYA 2VDLB 1WCYA 4UVIA 1VBNA 2CJWA 2ZBUA 4O4LA 5D1HA 1M1YE 4UHJA 3RRZA 4NU6A 4BGEA 4DIDA 4BWVA 1KMNA 1QPGA 5K0TA 4XPIB 4HBGA 3W1EA 2AC2A 4KKVA 3OEHA 1D4AA 2CK3A 4YT5A 2NP6A 2FETA 3MFYA 1T26A 4J1SA 4LHEA 1R50A 4X84A 4HQ0A 4Y30A 4P7GA 3U4MA 1ZN8A 2ZVPX 2P90A 1RMYA 3A4LA 3D8UA 1IXYA 5BYAA 1T5DX 2CDBA 2WFAA 4K05A 4YY3B 2XE6A 2P3LA 1YOVB 4YYEA 2FX2A 4UDOA 2R8EA 3IQGX 1X1EA 4PZPA 2G17A 1TB4A 4P81A 5LQJA 2V7QD 4N7RA 5CJPA 3H9JA 4KACA 2DYKA 4WCVA 3DW3X 5GINE 4GXTA 3FOEC 1FYXA 2HZBA 2Y8EA 3ESCA 2XWQA 1FFYA 1DTWA 4MH0R 4C4ZA 3FUUA 1B93A 4GNRA 4O8ZA 4FB4A 3LTNC 2OVFA 2XXAA 1JDBC 2G67A 3SK0A 2PSHA 5H9WA 4D96A 1KR2A 2JLSA 1RPTA 5JCJA 4EJMA 1PYGA 4OHZA 4B3BA 4XSHA 4XDHA 3OTHA 3DXZA 3PJRA 2YWBA 3DDCA 4GR4A 4L0DA 3FVVA 3LKBA 3MMZA 1ZLYA 2C07A 2MSWA 4R05A 3V1KA 4EGCB 4NKRA 1R2QA 3AR3A 4EY7A 3ABQB 1L5FA 1MAVA 3QU5A 1CUDA 3R1IA 3AVUA 3HY6A 4LYGA 1I6LA 5CU7A 3ZCRA 3DTYA 2X0NA 4RE6A 5K2OA 2HIMA 2POQX 1SU7A 4E4YA 1VE6A 4PBRA 5HZGA 1XZLA 1GGVA 1J20A 1SBIA 2O3TA 1FQKA 1NJFA 3OJ0A 4L8VA 2OP1A 1VL2A 5AOBA 4F92B 3RTBA 3GP8A 1LD3A 4NZPA 2IPNA 3EEBA 2VRNA 4LWPA 4M8KA 1J2TA 3VNSA 1ZIDA 1GNQA 1XHFA 2FLWA 1NZJA 2ZTUA 1NNLA 1XRPA 4OGKA 1WV0A 1IZYA 4QDJA 1P3DA 4X6LA 3ZU2A 5BWMA 1FFCA 4G63A 2XDQB 4F46A 5BUZA 2ZWVA 4QXOA 3BTVA 1P62B 4XX0A 5B2EA 1HMYA 1S9HA 4NYMQ 3RSQA 4F8YA 1MJHA 2WTEA 5DHQA 2IOYA 3KOWA 2FPRA 3THSA 2PZBA 1PR1A 4E6EA 4HVAA 2H1LA 2RCNA 3DMDA 4PYJA 2AYZA 3CH5A 4J7XA 4YFYA 1K8YB 5KJEA 3DLIA 5H59A 5C5CA 1ZSVA 2BEVA 3QNUA 4ZT2A 2JIZA 5HJ5A 3OTOB 4KPUA 3RSZA 4EUKA 2QNRA 4O1IA 4R51A 4TTRA 1AJEA 5I7RA 2HMUA 3D3WA 2Y1WA 5HA5A 4YRBA 5DBFA 3MC1A 5ESDA 3V8PA 3ELYA 1I3OA 3EHEA 1DUVG 4DTIA 4QLBA 4M22A 1YF3A 1M2FA 2AN5A 1SEPA 1XNJA 2QN8A 2QQ5A 2DY1A 3EBPA 2PAFA 3B85A 3K9QO 3F5SA 4DJ5X 4JJKA 1K8XB 2NV0A 3CT6A 2G82A 1G59A 3HYSA 5H3CA 1CRZA 3HLTA 4OQNA 1NX9A 3SYMA 1CZKA 3D59A 4GPIB 1G2PA 3M7IA 1XCJA 4XYGA 3JPWA 1GGFA 4OB7A 4B6QA 1DE0A 2QU8A 4RY0A 3F90A 2AVNA 2P3SA 3ISVA 1NA5A 3CF6R 5F4BA 1USVA 4BCBA 4P2BA 3Q11A 3NALA 4WKOA 1W0CA 5T8KA 3T54A 5KNBD 4NARA 1OH7A 5A4IS 1WMSA 1ZKDA 2XT9A 3RRNA 3A2LA 4RANA 1KI6B 4JOCA 4KQ1A 2XCIA 3CUSA 2CC2A 4LZAA 2H1FA 2H63A 5F9HA 5LQAA 2AJCA 1YVRA 1RKQA 4X95A 3WBJA 1TYDE 3QF4A 1NKVA 2JIBA 1CUVA 2E5WA 3QVTA 3SSOA 4F7WA 5KHLB 3NBXX 2XE4A 4PG6A 3C3CA 4F12A 4Q82A 4QDZA 1IBRA 3DB1A 4PBTA 3U7GA 3Q72A 5DTQA 3HCWA 621PA 2CV1A 1MB2A 2WD7A 3NNSA 2AC7A 4Y1EA 2G9QA 4Y6RA 5K3EA 1SUWA 4KO3S 4MJ7A 1U5BA 4AW9A 5CB6A 4O2BF 3JWHA 1FTYA 1AKUA 3CW9A 4KR6A 2JHAA 4K9QA 5LUBA 1YKSA 2IYYA 2IYQA 1KL7A 4HYTA 3BE4A 2C5EA 4PNEA 1KIMA 2YJZA 3OSZA 2PD6A 3CKYA 3M9XA 2FWIA 4X71A 5CW2A 5A4MS 1Z3IX 5CPBA 5D3MA 3ROFA 6LDHA 1Y6GA 2GA8A 1FMTA 1YSCA 2G6TA 4JY7A 3L43A 2WAOA 4MDEA 1GJRA 4F06A 1CW2B 4PIPA 4C2AA 5DN9A 1F0NA 1ZOPA 1C9YA 1YS6A 2ZVQX 3OQBA 1D2GA 3AQIA 2Q28A 3GCDA 3N6VA 4JBHA 1EXWA 3P2KA 3WYDA 1AGNA 3T06B 4NU0A 4LNHA 3IBTA 2JGKA 4AJIA 1GG2A 1JSZA 1NATA 3B6KA 3DTVA 3K6KA 2HCRA 3PFBA 1BXRB 4HJRA 5CNIA 4OQQA 1ZM2A 1U8YA 2VSQA 3H42B 1SKYE 1OLUA 1C0KA 4XM1A 3KBBA 3WADA 1TC1A 1HQKA 2GESA 2XMPA 2J4DA 2XNHA 2Z2IA 2ZAMA 5E6UA 3LIIA 4D99A 1DAFA 4OLAA 3IQIX 1ZWLA 3AR2A 1AF7A 4H7FA 4NCHA 2JG3A 1TEZA 4W7IA 4G1CA 1LPNA 3D8SA 4TMXA 4AKGA 3BMCB 4X3OA 2EJWA 2FZGA 2JCVA 3AVVA 3LGAA 3HDYA 3KXIA 5LMUB 1B8PA 2VWGA 1GNSA 1YC5A 2ID7A 3DZHA 3GBVA 3M5PA 3HJCA 3TCNA 2ZZMA 3L07A 3GAZA 3HB1A 3CUVA 3KJZA 3I1JA 5ECGC 4H7DA 1IHUA 2ZFUA 5FULA 3KPWA 2QTVA 3T3HA 2QXTA 3K1AA 1EA5A 4NAHA 1F48A 4UBMA 1S2OA 3O74A 2RGNC 4BB0A 4Y7DA 4IX1A 1RYFA 4HAZA 1SVOA 3ANSA 4LBYA 5TQVA 2HDOA 4G86A 2VSFA 1QF9A 5CIWA 4YC7A 1PZHA 1V1RB 1YRQA 2IY7A 3ABOB 3TQRA 5BMVB 1T2VA 2YW2A 2SCUB 1E3IA 4J0EA 4KIJA 2H5IA 4ZZ2A 2EAUA 1KJQA 3NJ8A 1EB9A 3T3NA 3MUNA 3MTAA 5KCMA 2B9EA 3TE6A 5DSZA 4EWLA 4M7WA 1LB1B 2O3JA 3KJQA 3KV3O 3RFTA 1N4DA 3GGDA 2WJHA 5BYKA 1D04A 1J6UA 1ODTC 2J0SA 2O14A 2AEEA 1WMAA 2I3GA 2ZRAA 4JYPA 1IUPA 1E7MA 4C3VA 4HX2A 1PFVA 3E05A 2ZIXB 2CVZA 2IPLA 2EFYA 2VDVE 1Z74A 3KYCB 4RWEA 2UYOA 4FMCB 5EJIA 2BN4A 5C8YB 1O9HA 1FP7A 1L3IA 1WDMA 3U81A 1G38A 1KPIA 1XG5A 2IIPA 4LYHA 3VPAA 2A8YA 3IALA 4WBSA 3CF4G 4OSEA 3B6JA 5EE9A 4X7MA 5JSQA 2PUCA 1G7RA 2BEUB 2VP4A 2IXTA 1KJIA 2M6SA 2NACA 2QPAA 5HUJA 1NUPA 5FAKA 5AUQA 2W0MA 1DIOB 3EUFA 5EKDA 3P0JA 2FJPA 3QUBA 3A26A 1JKJB 1U3GA 1U8FO 1GQ2A 2GDJA 2ZS8A 1FX0B 2PX2A 4XIJA 1BH6A 5ALJA 3V97A 4CI9A 2IS2A 1ZU5A 3KWLA 1XJWA 4QG3A 2ZXEA 3WLNA 1V16B 2ILVA 1J2UA 1ML4A 2C3YA 3H5TA 4BEJA 5KYKA 2NNLD 3LU1A 3MF4A 3ZDRA 1HYQA 1ZXXA 3Q7SA 2IZ6A 5A5FA 1FBTA 4U5XA 3H87A 1T6ZA 4R7GA 4Z49A 2BFDA 4EY4A 4Z54A 4QIHA 1IN4A 1EBFA 1T4GA 2G1JA 3WLTA 3ZV5A 1NW6A 4OLBA 4XWOA 3KPJA 3NDRA 1PLJA 1X2BA 1CR2A 1Q19A 4DVGA 2ID4A 1G21B 1PZEA 3GB9A 2OYSA 1H2HA 2MR6A 3ZHBA 4IMIB