1SCKA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetone
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 99
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sckA00
2OAGA 3BIWA 2GBGA 3TEJA 4RE6A 5JALA 4C01A 4UHBA 3OTQA 1VLQA 2OAEA 1BE0A 1E8DA 1XZEA 1L7RA 2V97A 3HYSA 1HBJA 5LKRA 5ALTA 1VXRA 4U2CA 4D9JA 2BUAA 1H2WA 4WDQA 1R50A 1XQXA 4IH9A 2ONCA 2WQZA 2HA6A 3IUQA 3P2MA 5E4JA 2JF0A 4AN1A 5ALNA 2OG1A 4BBZA 1CUDA 5FRDA 3WLAA 4KE6A 3O4JA 5DLPA 4CCWA 4Y2YA 1DT5A 3HACA 4UFOA 5EI5A 1RWQA 1UK8A 5AOCA 1XZLA 5AKXA 1CUAA 1EDBA 3O9VA 2ECFA 3I1YA 1VE6A 2QXUA 4ZGBA 5EHZA 5HKAA 3Q8WA 4RPCA 5AOAA 4WY8A 3L1JA 1XKLA 1UKAA 4CFSA 5ALFA 2C5FA 5A7HA 2HU8A 3ED1A 3V48A 1J1IA 4K2AA 5HQ3A 4G8BA 2Y6UA 3R3VA 3G9TA 1JJBA 4X6YA 2VSQA 3ANSA 4G5XA 4C89A 4E14A 1ZD2P 2BAGA 1QFSA 2Z3ZA 1Q83A 4UUQA 1CUSA 5T4HA 4QDXA 2PKYX 2XUQA 4JYMA 1AZWA 5ALYA 4WCVA 2V98A 1O6GA 4DMFA 1GT6A 1VZ3A 1H22A 1P0QA 3HSSA 3UMJA 4M0FA 4BZZA 1XZFA 4AMZA 2HM7A 3WK7A 1UWCA 1D07A 4DGQA 2C0QA 2XUJA 1LGYA 3D5EA 3KDAA 1HLGA 1L7QA 4PW0A 1GQRA 3FNBA 2PSFA 4EUSA 3LIPA 5LZ7A 3A2LA 4UBJA 3H1AA 2QJWA 4KRXA 3R3WA 5AKGA 5A62A 1UK6A 4ZXFA 3T4UA 2WJ6A 1LBSA 3R40A 1B6GA 1EDEA 3ESCA 2ROQA 2W22A 3WIBA 3F98A 2WHQA 2RI6A 3G7NA 5HQ3B 3AINA 5ALGA 2HIHA 3BIXA 4S0XA 1NX9A 3O95A 4H7DA 3FSGA 4OB8A 3MGAA 5A7GA 1IZ7A 1XLUA 4H18A 3CCBA 4IHAA 4UFPA 4DSAA 2I3ZA 5H3HA 1FFEA 1BS9A 1CUHA 4C4ZA 3C70A 2C4HA 3QITA 4U2GA 2CMFA 4ARBA 1ZOIA 2WLSA 2Q0XA 2O2GA 5BV7A 5F4ZA 3IURA 2CUTA 4WY5A 3DL7A 2JGKA 1TRHA 1QO7A 1G4HA 3ESDA 4B0OA 4X3CA 4A16A 3WL7A 4F0JA 1I6WA 2OGZA 3LCRA 1ZD3A 1CPYA 4G9GA 5LIPA 4MQMA 1W76A 4P08A 1TCAA 1TQHA 1LLFA 1MN6A 4FDMA 3M82A 3HLKA 3N2ZB 5EFZA 1N8SA 3AUKA 2XUKA 5ALJA 4KE8A 5DWDA 3C8HA 3D2CA 4H7IA 4AZ0A 1ODCA 4XJVA 1YS2X 3IULA 1YASA 1F8UA 4M0EA 4B83A 1ISPA 5HFNA 3ESBA 4QZVA 1FFAA 4EZIA 3DCNA 3AFIA 1AGYA 1X2EA 4EA6A 5CH5A 1K63A 5AICA 1UOQA 4BRSA 2HA0A 4RE5A 4HXEB 1WHSA 2OPHA 3WKEA 4DNPA 3AIMA 4FLMA 5BWBA 4PNZA 2O7VA 4HVTA 4JNCA 3I1IA 4GW3A 4CG1A 1PJAA 2HRQA 3MUNA 1CUZA 2ZSIA 5ESRA 4HRYA 1Y7IA 2HL6A 4CCYB 5JASA 5DNWA 3ICVA 1P0IA 4H35A 4AB1A 3G0BA 2OGTA 3OC0A 3KOOA 3I2JA 1P0MA 4B85A 3ICWA 2V96A 3WJ2A 3MUOA 4WJLA 4CIAA 5JATA 4NS4A 4OB6A 4DSZA 5FPQA 2XUIA 3V1LA 1A8QA 5AKYA 4BDTA 2Z3WA 2VAXA 3U1TA 4EY8A 1QIEA 3C6YA 2XE4A 4Q82A 4DMHA 1E3QA 4ZREA 3QPCA 5AI9A 3CN7A 1ZJ4A 1E89A 1MJ5A 3ZLTA 3I2IA 3BJMA 3RARA 1QTIA 2PM8A 3H2IA 1R3DA 2G4LA 1YS1X 4ZI5A 4W9RA 1EB8A 4LYDA 1MPXA 4BCCA 5HF6A 2DHDA 4G4IA 5AI4A 3VXKA 5IKXA 4KYVA 2XUGA 4L9AA 1UKCA 1AURA 4FMPA 5CH3A 2XQGA 1FFCA 3K9BA 3FYUA 4NMWA 4QDUA 3WK9A 1RYYA 2VJCA 5FP0A 3L1HA 2QVBA 3FWHA 2ZYHA 1CLEA 3D3NA 4UBMA 4OYLA 5T4EA 5LLSA 3ESAA 3DYVA 3IA2A 2PPLA 3DD5A 2GZSA 2VA9A 3FOBA 4QDOA 5JD5A 2JGFA 2WIJA 1XQYA 2BJHA 1VZ2A 1ZD4A 5CXXA 4KAAA 3HXKA 2R11A 4X6XA 4EY4A 3WIOA 4C4YA 2RHWA 4HAIA 2YASA 4P92A 1LZLA 4ROTA 2K2QB 5D6OA 4EY5A 5AP9A 3WYNA 2H7XA 5EGNA 3AIKA 3SX4A 2IX9A 2WHPB 3VDXA 1W75A 1EA5A 1C4XA 1E66A 3RLIA 5KWIA 2BKLA 4J0IA 4W1SA 2H1IA 2PVSA 5E4YA 5DYYA 1SCQA 3DNMA 3FVRA 1OXMA 4DM7A 4X93A 3AJAA 3PI6A 3I2HA 3F97A 3G0IA 5K3AA 3DKRA 3I2KA 4OU4A 1WB5A 1T4MA 1FSSA 4RGYA 3F9CA 3KXPA 4B84A 5AH0A 1JMYA 1C7IA 4QLAA 1EX9A 5AK5A 2QUAA 2CBGA 2H7YA 3QPDA 3WL6A 2I03A 2AJ8A 2QJRA 3WL5A 4BTLA 1ORVA 1AX9A 4N5IX 4CG3A 4LYEA 5LKAA 2YYSA 1WB6A 3EQ7A 1BCSA 2HU7A 1H2ZA 2OCLA 4FHZA 5JD4A 2J4FA 1SC9A 4DIUA 4HS9A 3H17A 1S8OA 1TK3A 4KAJA 1LPAB 4AMYA 4W63A 2DHEA 3LIIA 4DMKA 1UOPA 2XUAA 5SYNA 3QH4A 2J3DA 3ZLUA 1FFDA 3O4HA 2C58A 4BB0A 1CUCA 5J3JA 4G8CA 3EF3A 3STTA 4KR0A 4BAGA 5KREA 1JJFA 2HA4A 4X91A 5E4TA 5ALPA 3CCCA 3S2ZA 5JAOA 3WWDA 4X6UA 2PU5A 3BE8A 2HFKA 1BRTA 1QIIA 5LZ8A 2WG0A 4B80A 2XMGA 3Q0TA 2AJCA 5AM1A 3ILSA 3R0VA 5FPPA 4UPDA 4Q3KA 2J4CA 3STUA 3HC7A 1K6EA 4I3FA 4L72A 2XQIA 3KWFA 2ACKA 1GZ7A 5AK4A 3WKCA 3VVLA 5AKZA 2XQJA 4E11A 2WTMA 4A5SA 2X5XA 1BU8A 2HU5A 2HRRA 4PV7A 5ALHA 2G5TA 5AKKA 3UUFA 5BWCA 4MYSA 3T52A 4DNQA 2HHAA 5CTAA 2PL5A 3FCXA 2Z8ZA 5I7UA 3LS2A 3OPMA 4Z49A 3ZWQA 3H04A 4Y2TA 2JGEA 1QIGA 4MYDA 1VA5A 1KU6A 2QOEA 4BVJA 3FYUC 2XMDA 4PSCA 5C7YA 1CUUA 2HA5A 3STWA 1J2EA 3WWCA 1R4ZA 1R1DA 4TGLA 1XQVA 5LP1A 3STXA 1CUXA 3D7RA 5EHNA 4X85A 5AM4A 5CT6A 5AI6A 2WJ4A 2GYVA 2CB9A 4EY6A 1UK7A 5JAUA 3RK4A 5IVKA 4EY7A 4Y2PA 4BTVA 1YAJA 5FUMA 1UXOA 1CFJA 1NU6A 1A8SA 3K2IA 5LYYA 2ZJ6A 1J06A 1YSCA 3K6KA 3W2TA 4GLBA 4HXGA 1ZICA 4PSDA 1FJ2A 1U8EA 1QONA 2JBWA 1VKHA 4FKBA 5AM0A 1MX1A 1F0PA 3L1IA 3WJ1A 4G9EA 1XZDA 3NWOA 4FFWA 4UHFA 1ZI8A 4UBLA 4KRYA 4OUKX 1T2NA 4FTWA 2ES4A 1VE7A 5T4FA 4LXIA 3W04A 3ZI7A 4JH0A 1A8UA 5ALUA 1XZCA 3GUUA 4Y2SA 5AK6A 3G9ZA 3FVTA 1WPXA 1GPNA 4WFIA 3M81A 3C6XA 1A88A 1MAAA 1LPPA 4FFVA 4HTAA 2UZ0A 3KD2A 4BVLA 3STYA 3BDVA 4X00A 3WK4A 3H2KA 4Q34A 5ALKA 4ZRDA 2Z5GA 1R88A 1CVLA 3JW8A 4MJ3A 1UKBA 1VOTA 2VF2A 4QLOA 5D3KA 4J0HA 5ALOA 5AK3A 5CRIA 4KACA 3QZUA 3BL8A 1VA4A 1Z68A 2EEPA 2ORYA 3H2HA 4PSUA 5CT5A 3BWXA 3DOIA 2WIDA 4BYMA 1WOMA 3QM1A 5I9IA 3VJKA 4AX4A 3DS8A 2XMZA 5ALWA 1DWQA 1G5FA 3G0CA 3BJRA 5AKHA 1XRQA 5AI5A 4C6HA 3JYHA 4BVKA 2ACEA 2D5LA 4FLFA 1K5PA 3WWEA 3HRHA 3GZJA 1XQWA 1CUFA 2C0PA 3GBSA 1ZIXA 4ETWA 5HF9A 5AKLA 4BE9A 2O7RA 3I2FA 4K5QA 5AM2A 1XRRA 3FSGD 1QIFA 2BCEA 3QMVA 3W06A 3V1NA 4N8DA 1HPLA 4Y2VA 2EDAA 1QIHA 1EI9A 5DTJA 1CQZA 1EB9A 2VJDA 1H2XA 2X8BA 2WM2A 5T4BA 1YCDA 4GI1A 3WYDA 1PV1A 1CUGA 3AZOA 1QE3A 4CIBA 5K3FA 1MO2A 2O2IA 2HADA 4OYYA 3I6ZA 2WIGA 3U0VA 2PUJA 1MNAA 4Y2RA 2B4KA 2DQZA 4PO3X 2PBLA 2QR5A 1MU0A 1QIDA 2CEKA 2XT0A 3S8YA 4GHWA 1CIJA 4F60A 2FJPA 4KE9A 3W05A 2AJDA 5A2GA 3STVA 2VEOA 5DNVA 5EIAA 5EHXA 4X92A 3H0CA 1GPKA 1R9MA 1R9NA 1IUOA 2QS9A 4CI9A 2XMCA 3G9XA 3BF8A 2ZYRA 1XRPA 4EBBA 5CMLA 4EHBA 2BFNA 4FWBA 3WQHA 4W1QA 3V9AA 3QYJA 4MQLA 5K5EA 1XRMA 3V1KA 3HZOA 1SOMA 1USWA 2HA7A 2OGSA 3I28A 1ETHA 2VT6A 3A6ZA 5LZ9A 5HCUA 5ALZA 2WHRA 5EHQA 2QXTA 3IBTA 3O0DA 2QT9A 4INZA 2OLEA 4DMCA 5CT9A 3OURA 2QM0A 3WA7A 1N5RA 3R3ZA 2PU7A 2DHCA 5AO9A 1PFQA 4K6HA 3H2JA 4YASA 2EDCA 5ALIA 1JU3A 3F67A 3QBJA 3WI7A 2G63A 2AXEA 2WTNA 1CUJA 2O2HA 5JD6A 2JEYA 3NOXA 4BZWA 2ZJFA 3R41A 1XKTA 4P93A 5IVHA 4GDMA 1KEZA 5ALVA 3TJMA 3IUNA 5K3FB 1Q0ZA 4ZWNA 1CQWA 2QUBA 4W1PA 5CXUA 3GELA 1WCYA 1GGVA 1XZMA 4AO6A 4QNNA 3DDUA 3HJUA 2RIPA 4AO8A 5E2IA 4G4GA 1XZAA 3HEAA 5C8ZA 5KWJA 3H18A 4B9EA 2RONA 1BCRA 3JWEA 4XIIA 4BP9A 5ALEA 2XMRA 4JUIA 3HI4A 2WFMA 1CUBA 1UFOA 5CW2A 2JGJA 1QIKA 5C8XA 4X7BA 3A2MA 4QDZA 3R3UA 1E8MA 1BROA 3KWJA 1XZKA 2XDWA 3W9UA 5IVIA 3EQ9A 3C6BA 3QVMA 5JZ9A 1MX5A 1LPBB 1E5TA 3DLTA 1THGA 6YASA 4UBOA 3TGLA 5AKIA 1G66A 2XUHA 2PSJA 2H9YA 4BRZA 1OILA 2IIVA 2B61A 3FBWA 4AZ3A 3ZV7A 1MAHA 4DTCA 1QJ4A 4UBNA 1EXWA 3FLAA 5CH8A 4W1RA 1ZGBA 4Q1VA 1O6FA 1JI3A 1EH5A 1ZI6A 1XLWA 3QMMA 1ZIYA 1ZD5A 4XX1A 4B6GA 2OCGA 4N5HX 4NVRA 5ALRA 2QTBA 2Z8XA 3PUIA 4OB7A 5K3DA 4UHDA 2YH2A 1IZ8A 4BAUA 1W6RA 3MVEA 4QDTA 1ACLA 5ALXA 4ZV7A 1GKKA 4I4CA 5JZBA 4X95A 3M3DA 4Q05A 4LXGA 4N8SA 1U2EA 4JEIA 2WU3A 3IDAA 3WWPA 4I19A 5CURA 4CCYA 2PSEA 1A7UA 1EK1A 5D7BA 1BN6A 5DYWA 1U4NA 4U2FA 1ODSA 2OCKA 4FNMA 1NU8A 5FOQA 1AKNA 1JFRA 4QEKA 2WIKA 5FLKA 3AZQA 2WUGA 3B3QA 4Y2XA 3I6MA 3RM3A 2WUDA 4AXBA 3GFFA 4KJXA 1B41A 4Y2JA 5EIHA 1EDDA 4QWMA 1EK2A 2H7CA 1MX9A 1SCKA 4J7AA 5HF8A 3E0XA 4C88A 5K3BA 4OSEA 1QGED 5AHXA 2B20A 3FLBA 3VKFA 4RNCA 5DNUA 1UK9A 3FYUB 4X97A 1YB6A 1CUIA 2Y2VA 1RP1A 2OXEA 5JIBA 2WKWA 4H7HA 1IVYA 1Y37A 5AKJA 3R3XA 2WHPA 3EBLA 2X76A 2JIDA 1U65A 2FJ0A 5DYTA 2D0DA 1F0NA 1YA8A 2JEZA 4UBIA 4PF1A 1XZJA 1N1MA 3D2AA 2XQKA 4OPMA 4E15A 1HKHA 3IUJA 1Q0RA 2ZYIA 4AO7A 4P9NA 4L3WA 4Y2QA 4M0MA 4X90A 2HDWA 4B7ZA 1THTA 2WFLB 1E8NA 3WKDA 3NUZA 4Y7DA 5HK8A 3WL8A 3W9BA 2XMQA 2AJBA 3WA6A 4CG2A 4L0CA 3EIOA 3DEAA 3SC2A 5HFAA 4JYPA 1DX6A 3C5VA 3D0KA 1IUNA 1DINA 4BCDA 5A71A 1C7JA 1L7AA 5AI0A 2P8SA 1LBTA 3M83A 5LZ4A 4WDRA 1XZHA 1DWPA 2GZRA 5LZ5A 3LP5A 2PUHA 1IMJA 1M33A 1VJ5A 1GXSA 2VAVA 1HDEA 1P0PA 4BC1A 4OD0A 2JGIA 4X71A 2RGUA 1JMKC 4QE3A 3DKKA 2WG2A 3X3HA 4H7EA 2WSLA 2CKMA 3VISA 3IIIA 4QA9A 1LPNA 2WUFA 1CR6A 4FBLA 3OM8A 2CJPA 4A23A 1GKLA 3C87A 1UZAA 1AUOA 2ZYSA 5C81A 1WPRA 3H2GA 4UFNA 2VQ6A 5DJ5A 2WILA 1LPSA 2DFPA 4DNFA 4U2EA 2HA3A 2XLBA 1XRNA 1Q84A 3IVMA 3RKSA 4FOLA 1HQDA 4IH4A 1JJIA 3PFBA 1MNQA 2HFJA 2XMSA 4AN0A 2GBFA 4BC0A 1BEZA 3WK8A 5SYMA 1FFBA 1LPOA 2LIPA 2OQIA 4Q3OA 2XUPA 3VJMA 1JT2A 2WG1A 2DCMA 5BOVA 1QIJA 3G9UA 3FYTA 4H77A 3WKAA 5CBKA 3ZLVA 3FCYA 2C7BA 3PICA 5ALLA 4BE4A 2DQYA 1YAHA 1TIBA 4MWTA 3PFCA 3KSRA 1ZGCA 1W4LA 4X94A 3V1MA 4KAFA 2BGRA 2PSDA 5IH7A 4FBMA 5HK9A 4B81A 4J0CA 1SCIA 2AJLI 5FV4A 2HA2A 4LIPD 2QKYA 5AKEA 3F96A 2VJBA 3D59A 3IUMA 4J0KA 3YASA 4UBKA 1CUYA 1QLWA 1XRLA 2Y1KA 4J0DA 5AJHA 5AI8A 5JARA 4H7KA 1TAHA 2W6CX 4NZZA 4QWWA 1MT3A 4FNGA 1F6WA 3DQZA 3O9MA 2JGLA 2BUCA 1X70A 1CUWA 3QPAA 2XMBA 5AM3A 4J0GA 1LZKA 1YR2A 2XQFA 4EB0A 3G8YA 5AIBA 2R8BA 4HRXA 2WUEA 1WHTA 2XUFA 3QMWA 5AIAA 3PF8A 2ZJ7A 5JANA 3VJLA 3VVMA 2FX5A 3I6YA 3B12A 3CXUA 5JAPA 1EVQA 1AQLA 5AOBA 4Y9SA 1XZGA 3OOSA 1TKRA 3DJYA 3LLCA 4J3JA 2QZPA 2VJAA 4B82A 4WFKA 1Y7HA 5HF5A 1KU0A 1N5MA 5ALDA 1UOOA 5JZSA 2YXPX 3ZPXA 4N8EA 1XLVA 4MWSA 4GBGA 3BDIA 3WK6A 1QOZA 1CV2A 4UHCA 1K4YA 1GPLA 1W1IA 1EVEA 4HZGA 5JAHA 1XZIA 4J03A 2RAUA 3E4DA 3H1BA 3AILA 1WM1A 1UT6A 4PQEA 2QRUA 4IQ4A 2DR0A 2WIFA 3A70A 4LKOA 2WJ3A 4MEBA 2I78A 1ACJA 2NW6A 2RHTA 1BN7A 4GXNA 4TVKA 3N0TA 5JYCA 2I3DA 3D2BA 3DYIA 1DTEA 1EHYA 4IO0A 3HABA 3OG9A 4YK7A 4KE7A 2PSHA 4ITVA 5ALMA 4K6GA 3E1GA 4V2IA 2GYUA 3ANTA 3WK5A 4G1FA 1QO9A 1QTRA 5CT4A 4C87A 3C8DA 4F5ZA 5HKBA 1AMNA 2B9VA 3EQ8A 2OQVA 4UHHA 2GYWA 1CEXA 3G0DA 1CUVA 5LZ2A 3C6ZA 5A7FA 3F8SA 2XUOA 2XUDA 3NGMA 4H7FA 4YPVA 2XB6A 4Q3LA 2GBIA 4Y2UA 3WZMA 3PF9A 4LXHA 3C43A 3BXPA 5JADA 1W52X 4H0CA 4MXDA 1DWOA 3FAKA 1EINA 1YB7A 1VXOA 3WMRA 5FXMA 1DQZA 1SFRA 2E3JA 2XI4A 3WKBA 1XFDA 2Y6VA 4IH1A 3DOHA 3D4LA 4BCBA 3DL4A 3C5WP 2VATA 5K3CA 4OCZA 4BDSA 2JGMA 4MEAA 2WFLA 1JKMA 2WU4A 4FLEA 1MTZA 2GBCA 4XWGA 1CUEA 5KBYA 3IB3A 1ZJ5A 5ALSA 3O4GA 1DQYA 2VT7A 2QMQA 2IITA 4U2DA 2C5GA 1DT3A 1K8QA 5EIEA 1ZI9A 1HL7A 1YA4A 2ZSHA 4E46A 2VTVA 4DLNA 1CRLA 2BGNA 3H19A 1J07A 3C45A 2CZQA 2J3QA 5HZGA 1BEEA 5K3EA 1TCCA 5FKJA 4B0PA 5YASA 2V9ZA 1AC5A 3I2GA 3B5EA 4B9AA 3PUHA 1TCBA 4TPKA 4KEAA 5C8VA 4U2BA 4GWLA 1IUPA 1LNSA 3BF7A 5A6VA 4O08A 3PDCA 3AIOA 2DSNA 4GEGA 3FLEA 2OCIA 4UHEA 5CT8A 3R3YA 1OCEA 2WFZA 1XROA 3SK0A 3A2NA 2Y2UA 1H2YA 1WB4A 1LPMA 4GECA 4K6KA 5I8PA 1DU4A 4G8DA 4DYHA 4BAZA 4HXFB 2XLCA 4F21A 1JU4A 3E3AA 3PE6A 1G42A 4G4JA 4WFJA 5DTIA 1GQSA 1QIMA 3O4IA 2FUKA 3WWOA 5IVDA 4OU5A 1DX4A 3WZLA 1X2BA 2ZVDA 4DNOA 3G02A 3GROA 1QZ3A 3GA7A 1QFMA 5AM5A 5ISMA 3CN9A 3UUEA 7YASA 4LHEA 3TRDA 2G5PA 4J0JA 4ZV9A 4ARAA 2PX6A 5ALQA 1XZBA 4AQDA 5FDFA 4C4XA 4H7JA 3G0GA 1ORWA 3AZPA 1ODTC 5D3ZA 2BUBA 4YX9A 4XVCA 3SWWA 1H23A 4BP8A 4BATA
chains in the Genus database with same CATH superfamily
2Q3CA 3F9RA 1NVDA 1QG2A 1FJGB 4RVFA 2FSHA 4HHEA 4PPFA 2G17A 4MO2A 1DEOA 1PLJA 2J0UB 3RIXA 1DBRA 3GGJA 4LXUA 3SYLA 3JWJA 2G7ZA 4HLQB 4EKNB 5JALA 4LVNA 4UHBA 2G67A 2RGNC 1II9A 4D4GA 1WCIB 1IXSB 4FXPA 3UW3A 1T29A 1H93A 4ACBA 1XA0A 1H0SA 5A4FS 1M3SA 1A69A 1GR0A 2PUWA 3IJPA 5EINA 5L7TA 3AUTA 2RH9B 1DOHA 3OIWA 2ZRKA 1HNWB 4E5YA 3HVJA 1ULHA 3B8HA 2VH2A 4ZOLB 4D9JA 3GLFE 3A11A 3PPIA 5F3RA 4ZYLA 1RWBA 4HB3A 4X20B 3NHYA 2GF0A 3T54A 5C8DA 1XIVA 3AR8A 3JSAA 4NBWA 2GHQA 3MLEA 3UA3A 2C7OA 2WQZA 2Z2IA 2FUEA 3QFSA 2ID7A 1KPGA 2QY9A 1W29A 2ZYWX 3I4LA 1YC5A 2AOTB 3LOUA 3J7TA 2FMTA 2HCRA 4DDTA 2NTJA 4MUYA 1M6WA 3P2MA 4IF6A 4YH1A 5IKMA 5I3ZA 4AN1A 2AH5A 1QRRA 1PT5A 1I32A 4RHUA 4BO6A 4P31A 1JKXA 1SBIA 1YE8A 4BBZA 2W48A 3DLCA 1YZVA 1MOQA 3CPEA 4QBTA 1CUDA 3AW8A 4K1LA 4KQFA 2GPSA 4Q9HA 1KR2A 3SGLA 1N9ZA 3VDRA 2CDAA 2VUHB 4YJDA 5LUBA 4BGEA 1OFTA 3GHHA 2OZPA 4MUXA 1XCPA 2FPKA 4HUQB 1YRLA 4JYAB 1SAYA 1A9QA 2XB8A 4MKRA 2A57A 3FI0A 4HB0A 1MXHA 1B6SA 4NJEA 3RKRA 3PUKA 1EYZA 3KQQA 4CCWA 1W0KD 1XEWY 2QM7A 3EC7A 3HACA 2J9XB 4EAAA 1I2CA 3GUYA 2DFNA 4OHMA 1D2MA 1G4AE 2BFDA 3QFCA 1H6CA 1XX6A 2UDPA 3HHPA 4TWJA 1HYEA 2AHOA 2GCIA 5TX7A 5EI5A 1WDWB 4BEJA 5ELXA 4DR3B 2Z2XA 4UOZA 4ZCMA 3VZCA 1XZLA 4AMBA 1N7IA 1CUAA 4NMHA 4PNEA 3O9VA 1WTAA 1GL9B 1LH0A 4O5AA 3VC2A 2ECFA 4YRGA 1WETA 5HS4A 5IDQA 1AKQA 2WPDD 3A1EA 1Q1BA 4LKRA 3TNYA 3S8EA 1P17A 3GGCA 1N2JA 2Y1XA 5TARA 2CD9A 1DC3A 3ORQA 1SCDA 2V7TA 3E22B 4KL8S 1T6XA 4MYTA 4WY8A 3L1JA 3TZBA 2O1XA 4TLDA 3T5BA 2RJ3A 3WVNA 1DOAA 1ZUHA 3MA0A 3BRWA 3ZCVA 1DAGA 4YMGA 3G2MA 1T2VA 3OKCA 5ALFA 2IV3A 4IIFA 4EGJA 4LDRA 1G20A 5A7HA 2HU8A 2O14A 3I9V6 1FDTA 4K9LA 4M0UA 4GOMD 3T1OA 1Z4OA 4RVHA 2BI4A 5EE9A 1J1IA 2HLNA 3A6FA 4NHEA 3A7EA 4G8BA 4WLVA 4MB6A 1U3TA 1Z5VA 2CNOA 2HGSA 2XAAA 3KEGA 5I7FA 4HATA 3W6PA 2HSZA 5EJ7A 4DQVA 3RRYA 2A88A 1T5TA 4X6YA 1CQXA 2P5UA 1P18A 3OD5A 4LHXA 1XPRA 3ENNA 3UFXA 3SBEA 1K27A 3B6MA 4XOUA 1BXGB 3NU1A 5HCNA 4G5XA 1CS4C 4NEHB 2SKEA 1T8YA 4Y6GB 3RS4A 4C89A 4E14A 1QFSA 2Z3ZA 1JN0A 4C3UA 1RHRA 2DBQA 4GZ5A 5AXBA 3C24A 3W2EA 1L5YA 3D81A 1TF2A 4WXHA 4MHOA 2BEJA 2QT1A 3R8XA 2VTBB 1WD5A 2Q6TA 3FCSB 2C88A 4HSGA 3O94A 4W8GA 5ALYA 1DEKA 4J2HA 4RHXA 4BP3A 3HZHA 2MYUA 2GF9A 2FFJA 4CUKA 5C3MA 4BMYA 3V97A 4R2MA 3C74A 4N3CA 3ICCA 5EJFA 5E7MA 3EX7C 1GT6A 4PCUA 1ICEA 3JD0A 5BQ5A 1MQAA 4M0FA 4AP5A 1S8AA 3GNSA 4XUDA 1WB9A 4RKEA 1D07A 1WSBA 1G9XA 1VPEA 2V3WA 3SEZA 3LNTA 2DG2A 1QCYA 1E1DA 1L8XA 3K0CA 3K9QO 3OTHA 4HI0E 4WK0B 5EXDA 1DP4A 1SBCA 4WZ6A 1H2EA 4B3CA 1QQTA 3TAXA 1EXMA 1T0UA 5EQJB 2PSFA 4MQEB 4S1VA 4B6FA 3NASA 4PQGA 4Z3DA 7ABPA 4DLVA 1SCUA 1JR3E 2JK1A 3R3WA 4CL0A 3C5CA 5A62A 1EFDN 4NE2A 3D4NA 5HPYB 5D6NA 3T4UA 5CB6A 3BTUA 4F1KA 3I04A 4M9SA 1E2QA 4IDDA 2CXPA 1B6GA 4RHCA 3ESCA 4TYQA 2V1XA 2ZYGA 3HN7A 1TO6A 1G1AA 1CFZA 2LV8A 2ROQA 4Z9AA 3GX1A 4QOFA 3T0IA 5JXJA 5TC4A 4PO1A 2R87A 3U56A 2EERA 3AF0A 3WYEA 1E79D 4LJ9A 3OTWA 4U2KA 4HQNA 5LMZA 4HB4A 1HMPA 1PSDA 3GH3A 2GJKA 3LUKA 3HUDA 3MD0A 3Q4GA 4I2VA 1CE8B 3OQVA 1SRQA 4PYRA 1KWGA 2GUWA 4RTOA 2Q3FA 3G7NA 1UPFA 3CG4A 4KLNA 2IYFA 2ST1A 5BORA 3PXUA 3CZ9A 3CZRA 1I9CA 3PHHA 4MYRA 3I5YA 2IFTA 3F7NA 1N0HA 3BWVA 4S0XA 2K7FA 2OZLB 3AETA 3E9YA 3QLEA 3IBCA 4EGFA 3FSGA 4PCLA 3FZGA 4M6WB 3K0HA 7REQB 2EX0A 4OB8A 1NJ5A 4ZTBA 2UV8A 4BEVA 1DGQA 5EMLA 3RF7A 3L1KA 3GK3A 1T0BA 1Q7RA 3IHWA 3QWAA 2YY7A 3ZWAA 2B1GA 4KKVA 5KHAA 1L7PA 1WXFA 3WLIA 1KI9A 3RVQA 2VPWA 1U0NA 4H18A 4IHAA 2BZSA 1THMA 3IQDB 1IHXA 4WOJA 5ES4B 3CO0S 4XZ3A 4DSAA 2I3ZA 2ZYDA 2V0CA 3KXDA 3VI4B 2C2BA 4LXXA 4QDJA 3F4KA 4DQLA 2ORIA 2WU0A 3HV2A 3LLMA 3HPRA 4O02B 4WNIA 1QG0A 3C3WA 4RFSB 4S1NA 1W25A 5A04A 2P41A 3B6KA 1K3TA 4KXFB 4RIHA 1OZ0A 2FZEA 4URWR 3U1BA 2V7QA 1K88A 2W9XA 1CUHA 4B43A 3T34A 5L51A 1RM4A 3DJFA 3QOYA 1X7ZB 4ES6A 2WVJA 2XWBF 2ZT6A 5ULLA 4E12A 3EF1A 3ITEA 5BV7A 4IIXA 3IURA 3DPUA 2Q41A 2YR0A 4JDPA 2H1LA 4HVCA 5DHRA 1JFTA 1RW4A 3GRYA 3JASA 4BUZA 4FWIB 2WAAA 2DEUA 4PX9A 5A03A 4X7PA 1M5RA 3HN6A 1T5IA 2SECE 3I01M 3PS9A 1KYVA 1QO7A 1JPUA 1ZK3A 2AV6A 2IDJA 4KN5A 4PE5B 4PZPA 3PT5A 2JFYA 4PTYA 4A16A 3WL7A 3WP0A 2AOTA 4R3WA 1EFLA 5DI3A 2YV1A 2WU1A 3BMXA 1Q7GA 1VLVA 4IQ8A 1NC3A 2GTHA 3DTVB 4TV8B 4IUBS 4A73A 4POOA 5I47A 1FSPA 2A0KA 4W9NA 2Q5LA 4MQMA 4TWIA 4HJRA 2CXOA 3LT4A 3AUUA 1GTSA 3FPKA 1Q91A 1Z4KA 2JLQA 5TQ2B 4IGIA 2B1RA 3PFIA 5B3JC 1LC3A 1A04A 3AC0A 3QVOA 3SPXA 5H4GA 5E9QA 4AKSA 2OO3A 2QM3A 3B6IA 4UULA 2C96A 4XUEA 4YQEA 4CKEB 2FZCA 3EOZA 2ZTMA 4U02A 3U3KA 2GX6A 3QKRA 4TTAA 1JA0A 4MLCA 4B46A 3QPVA 1RYZA 3H2SA 5JDIC 4M0CA 3CVOA 1E2IA 1X86B 2NTYC 2VYVA 3NRBA 3D7SA 1SCBA 3UHJA 4O4LF 2MU1A 4N82A 3I9LA 8ATCA 2OG2A 1AVTA 2QE7D 3AGQA 3DDZX 3D2CA 1XQ6A 4HWGA 3S1AA 4CVNA 4YYZA 4AZ0A 4EVQA 3IIEA 1UMBB 4M0LA 2HYIC 4QVGA 1OX5A 2ZB2A 1FBTA 1OHHD 2WW8A 3F46A 4XM0A 2EJUA 3F5FA 4B40A 1Y1SA 4F86A 2FX2A 1KYYA 2R44A 3MTGA 5G0UA 4Y1GA 1OV4A 4G26A 3QF4A 4JFRA 1XCBA 4M0EA 5DBEX 3C1TA 4UTNA 5TEWA 1ISPA 2B7BA 5BNFA 2MR6A 2P11A 3DFKA 1DO8A 3D4IA 3ESBA 2RAVA 5HFNA 3UV7A 4C0QC 3TD6A 2C97A 1OBVA 3IIKA 1O1YA 1QGUA 4OH1A 5F7JA 3WLNA 1C1XB 1KK0A 4A0HA 1NBHA 4G24A 2VNKA 1OROA 5E6SA 3PCXA 4ONEA 5DX0A 1X2EA 5LJLA 4BJ3A 1ZSVA 3BT7A 1YL6A 2ZYUX 3MWKA 1S4MA 3OFJA 5JW6A 2QLMA 2X9VA 3ADKA 1X0VA 4M9CA 4RLFA 4RVSA 3PLAE 3TLZA 4EYSA 3DT9A 1C5KA 1Y9JA 4Y2GA 3WKEA 4B73A 4NF2A 1LJUA 1UBKS 2QZ4A 1BMDA 3H16A 1H4TA 2Y9PB 4BB6A 5BXQC 2X40A 2XBMA 2EGHA 1J9ZA 1F5SA 1NV8A 3JTEA 4OHWA 3O3CA 4JJ6A 1GAXA 5GIOE 3I1IA 4KPFC 2OZLA 3AETB 1OXTA 2ONKA 4GM1A 3T9AA 1XEXB 1VCIA 4Z51A 2WY2D 3WV4A 2EFEB 4JJ7A 1ND6A 1OYVA 4K9RA 3QVGB 2AG8A 4OKNA 5DNWA 5E9WA 4IXDA 1JTEA 5E6RA 4MUEA 3E81A 4RW0A 1YS7A 4CKZA 2O07A 1J9GA 1W1WA 3Q85A 1V47A 1P0MA 4CMGA 1SUDA 5KOHB 5DVZA 3B1JA 1G3IA 4PANA 3LD9A 1AKEA 3TLKA 4WJLA 3ZD7A 1U8FO 4AIRA 1EWQA 1NI5A 4EDHA 1XMPA 1GQYA 1NVBA 4JYBA 4LWQA 2WYWA 1HOXA 3NHBA 3DTVD 4LDQA 1XTRA 1M9NA 5DBOA 1SGWA 4REQB 5K6RA 2JZNA 1HFJA 3RT7A 3V1LA 1J90A 1DJQA 2PX2A 3K92A 5CVVA 1VJDA 4BJ1A 2BCGY 1A8QA 3HR7A 4FILA 4FEAA 1KAQA 2Z3WA 4K9MA 4BDTA 4O8CA 1HRKA 2E4YA 1OBOA 1QIEA 3C6YA 3ZCSA 3PQ5A 3ROZA 1E7WA 2IJGX 2R7KA 3Q87B 3L77A 1JXOA 4OQFA 2FLKA 4BV3A 3O8OB 2ILTA 2Q4OA 3HL0A 3NRJA 4BO3A 4DLLA 2C9OA 5AW8A 1LQ2A 2EOAA 2NU7B 4QC2A 4O63O 3ER8A 1RHQA 2ZAYA 4TV9B 1XJWA 4BNIA 1N1DA 3LI2A 2F48A 1MJ5A 4F6RB 5C51B 1NMQA 4ZVQA 1P29A 2D5AA 3L79A 4FE4A 2DR3A 2D00A 3JAWB 3O91A 2X0DA 4DV3B 1X7HA 2AD5A 2L82A 3CLTD 3L4BA 3SXPA 3KHKA 2J9FB 3F5SA 1FX0A 1FFHA 4L6IA 4PC3A 3SF8B 2XGGA 1YS1X 4PY2A 4AUMA 4BU1A 5IN5A 3QWBA 4LYDA 1U8ZA 5FBLB 1RLJA 2W2OA 1P75A 1Z0JA 3FXAA 5KDDA 1EFHA 1PD0A 1J0DA 2DHDA 2BFWA 1MA0A 1ZBDA 2O8CA 4PC6A 3JQGA 2VAWA 4JIGA 2BSAA 4MMYB 1NJ2A 3VXKA 4MW4A 3SZGA 1R0WA 4LC1A 4MLPA 2Z4TA 3WLSA 1Z0AA 2GZ1A 1YU6A 2XUGA 2E0IA 1KF0A 4FHGA 4Q7EA 5EKDA 2XF8A 1UKCA 4R5MA 3WLHA 2QYTA 4DMMA 5J4LA 2XQGA 5KTRA 4F38A 3CPJB 2QI9F 5KJCA 4TTIA 4AX8A 3GJTA 1HURA 3FYUA 2IVFA 4H7PA 4IDOA 4QDUA 1MHTA 4QM7A 1RYYA 3QSGA 5FCDA 3SZOA 1XU9A 2WIAA 5DZSA 5L3SA 2ZRNA 2NZ2A 3AXSA 2A1IA 1C41A 3D3NA 4L8WB 4X0EA 2B7CA 4OYLA 4QUJA 5T4EA 5JU6A 5LLSA 4KSBA 2BDEA 1NTRA 4M7WA 4BKPA 4EEKA 3TLYA 1JQJC 1TDJA 3Q3HA 4QPNA 4C3VA 2E18A 1NR1A 4RQUA 1V95A 1KO8A 3AJ9A 2A6PA 1M7GA 2FSVC 3QBVA 4AJ9A 3JZMA 4Z4HA 5HX7A 3EULA 1G3QA 3D1LA 1ZUWA 4EB6B 1ZUNB 4CL3A 4EL0A 3H99A 4QDOA 1CR0A 4ZTUB 3WBJA 4RLSA 2OA0A 4O4HF 3ZD9A 2X4GA 1TTHA 4FDVA 4C07A 1HQKA 1UP7A 2J3HA 3NHKA 2ZSEA 3PRHA 3H9EO 1ZD4A 4PPYA 2ONJA 2DHQA 3O73A 3NHZA 3VR6D 4E5UA 1RQNA 5JLJA 1NYTA 4AWAA 1OVMA 1RYMA 3BGSA 4C4YA 4EIWA 2RHWA 1NXXA 3P4UA 4OM7A 1Z4MA 2QW8A 1KYTA 1XMIA 4LZWA 3AF1A 1VKOA 4RL6A 1E2KA 3D8SA 3EXAA 3FMIA 4HC4A 2B69A 1JVNA 1XK6A 4GP6A 4ZAXA 1E58A 1ZSNA 5AP9A 2IZ7A 3P94A 1O9BA 4HYQA 5FPTA 3W6ZA 5JCXA 3I23A 3AIKA 4AQ7A 4DR6B 2GPAA 2JRLA 2WZDA 1SUWA 2VJOA 5HMMA 5B4VA 2Q49A 1FJHA 4YEDA 5DTRA 1VHDA 2DBZA 2O2XA 1C7ZA 1EA5A 3T7JA 4EGAA 1AZLA 1VE3A 1FRFS 3UJ6A 2B82A 5FORA 4GR5A 4P32A 2QD1A 1KAMA 1BHQ1 1UDCA 1RJ9A 4LK3A 4W1SA 3EWSA 1U31A 2ZRFA 2G71A 1TQ6A 2XKJE 3PUVA 4MLDA 3H9UA 3S2FA 4YRDA 5HDBB 1VPTA 4MI3A 3UHFA 3W90A 3DT8A 4IWXA 3DNMA 2RJNA 1OXMA 1O6CA 3CZ5A 5F73A 4O33A 2R6FA 3PI6A 3TLBA 2QIOA 3VR4A 2ZR0A 2GO7A 4CT5A 4DUGD 4JL8A 3F7OA 3HY4A 3NT5A 4MZDA 2JAUA 3WG9A 1APBA 2I2AA 1U7DA 2Z57A 3PQ2A 4KBYA 4LYYA 4CLDA 2PMCA 1GY8A 4NU0A 2QMYA 4LYGA 3RAEC 3GFVA 3IDSA 3BKWA 4MRNA 3X2FA 1ZRNA 4OU4A 3AHJA 1PQUA 3IUPA 1T4MA 1MW8X 3U2QA 2CLSA 3P9YA 1CIPA 1FSSA 2RGBA 5CLIA 3F9CA 2M2IA 1J22A 3RJZA 2O8VA 2X86A 4ER7A 2HMSA 2VHZA 3SQMA 1BMFD 1JQEA 2Y4NA 4D6XA 4QLAA 1FU7A 2CFTA 1Q3KA 1PE0A 1JNYA 6GPBA 5K8UA 4MVJI 3U44B 3QYFA 4F1WA 3TINA 1N2CA 2ON6A 2CBGA 2H7YA 1SC4A 1M8PA 3BHIA 2ZVPX 4YRKA 2QL9A 5IC4A 3MRVA 2AJ8A 1C0PA 4KK4A 2Y68A 2QJRA 3WL5A 3TX6A 1RBQA 2GARA 4BTLA 3OESA 1EK5A 3L7DA 3D9QX 1JKFA 5H80A 2EKQA 1AX9A 3LXRA 4N5IX 4R68A 4X1OA 4DYDA 1NSTA 4IXWA 2G6BA 2HKIA 3EJWA 4MWZA 3CM0A 3WHIA 1EFCA 1UXJA 1NW9B 4HL6A 4QUDA 2XH8A 1MB3A 1J23A 3HBJA 4TYPA 3HVKA 3SE7A 4D4MA 1MR3F 1E3EA 3W8DA 1WB6A 3AI3A 4ZJPA 3ZWWA 2PHZA 1H2ZA 2OCLA 1H3FA 4LC9A 4NPCA 4DG8A 5IDVA 4LC0A 4P5DA 4ESEA 5A1TA 5C35A 1P1CA 1ZESA 1SC9A 2AN3A 2J4FA 5JD4A 3H17A 1TK3A 2QTVB 4HN4B 3Q7SA 1FSZA 3TNLA 4ATNA 4C0JA 1N5IA 5IKPA 2AFIE 2MYPA 3V2IA 1Q77A 4NOLA 4W63A 5DX1A 1G6Q1 3P71T 2G88A 3LIIA 1V2GA 3O6VA 2ZSBA 3GDWA 1FTQA 2VHTA 4JR1A 2ZB3A 3AEQB 4DMKA 3RHTA 4M22A 1FP4A 4V0ME 5GZ6A 4AMVA 1VIMA 1TQ2A 3KKOA 1F8XA 1HL3A 5CDFE 3UQZA 5CHYA 3NM6B 5AESA 1NRXA 1JLMA 3JSXA 1F2TB 2YCLA 3O4HA 2VQFB 4IVNA 1DIHA 3HNPA 3L92A 1AUPA 3HFSA 4FX5A 4ERXA 1PZXA 5BN4B 3KOZA 4K40A 4DIFA 3JYLA 3STTA 1M66A 2VPYA 3P1JA 2IIBA 1SKYE 4DIOA 2AC2A 4BPRA 3OKAA 1E61A 3ROPA 3PC7A 1W73A 2I4NA 3M1AA 5JAZA 5AVKA 4DTIA 5MN4A 3KSUA 4WE3A 4TXLA 2GZDA 1Z2NX 3UBTA 4COKA 2PU5A 4XVHA 5BMVB 2DKOA 3SFTA 5JSHA 5KYGA 3RVJA 3FFBA 1Z39A 2WG0A 5EE5B 1U3GA 1FDUA 5PNTA 4UU8A 1JECA 3IQIX 4KMRA 2AJCA 4LJ6A 4QICA 2PWAA 1LBIA 3BRCA 3FCUB 4H9GA 4PGAA 2DWUA 1SVIA 1HDYA 3LT0A 4WT7A 2C84A 3HCBA 4Q3KA 4XIFA 2OXFA 1U7WA 3WTBA 4HNRA 4EI2A 1K8ZB 2P2DA 2VYQA 1PQ4A 1EP1B 4IO1A 4NYIR 2PWPA 5M34A 1YS9A 4BWYA 3AVOA 1W4ZA 3I39X 3SJUA 4N1AA 2VVTA 3DEHA 3IMFA 4C43A 2PKQP 4DCPA 5IT4A 2J85A 4YJGA 2L18A 2I2XB 4YVFA 3G49A 3KWFA 3PCRB 4QOGA 1PL8A 4DDUA 4YRAA 3RSCA 2QBYB 3THRA 5G4KA 4EJSA 1RWNA 2GHRA 3F1LA 3O3OB 4BQIA 1NBEA 3SY8A 3DO8A 5A5GA 2E5FA 3MLAA 3EAQA 4E11A 1J1UA 5F76A 2QDKA 5MN5A 4WOBA 5GONB 5F9MA 1N7HA 5SY4A 3SYTA 4RMGA 4RQTA 3T7AA 3U26A 2C8VA 3C6QA 4FGJA 2G76A 1Q1GA 4IHJA 3EZFA 3BCUA 1HMYA 1RFGE 3CIFA 1ZUNA 3S5JA 3KU4A 4DREA 2EW8A 1Y4AE 3T4XA 5AKKA 3UUFA 1S3GA 4LG1A 3FPBA 3UYLA 4MYSA 1B26A 1MRZA 1KIFA 1G2IA 3EF0A 2ZE5A 4G0QA 1WUJS 4DBLE 1AJEA 2EP8A 5EC8A 1K8XB 2QJTA 4FZVA 4K7JA 5CTAA 1ODKA 4YAKA 1I0IA 2VI5A 3FUUA 5M3BA 5AHOA 1TYAE 3DNFA 4F6CA 3D1JA 3U3OA 5I7UA 4RTQA 2LCIA 1J24A 3OPMA 3ETCA 3CURA 1GPJA 2WV9A 3P52A 3A1NA 5KTNA 5FPSA 1HXHA 2AW3A 1FNMA 4TVBA 1U3UA 4W8HA 1B6RA 5EAIA 2VC2B 2HF8A 3DTYA 2IU3A 3Q0IA 3UMBA 2VUUA 1XE3A 3TOXA 4BVJA 3EUEA 1OFVA 4UMDA 3DVRX 4DJAA 2XMDA 1N6IA 2A84A 2D0OB 2NQTA 2IUUA 3Q0EA 4YI5A 4ZT2A 3C2QA 1KY4A 4ENQA 2VA8A 3PSAA 1HG0A 4FN4A 3DAYA 3DZCA 4A0FA 3NWPA 1VJRA 4FFBB 3ZS8A 1MV8A 2R4UA 1R4ZA 3ESXA 3E2IA 3NHUA 4X45A 1K06A 4RIGA 5FNVA 3WY9A 5KNBD 4FHEA 5ARCA 3A05A 1M2KA 1WDKA 2O23A 4AI6A 5DSXA 1EQUA 1XQVA 4ZEXA 3TOVA 5LP1A 1SURA 3DG9A 1ZY2A 1CR1A 2NVBA 1B2LA 3DWIA 3H5AA 4D8VA 2CXTA 1D4ZA 2BJWA 1AGPA 4P82A 4RPJA 5EHNA 3N3BC 4UOEA 2XODA 5K8VA 3FHTA 2MSNA 3C3KA 3TH5A 4C08A 4LGYA 3ZXXA 3QFFA 4TV9A 1HDXA 3QHAA 3IKVA 2OB1A 3DO6A 4UTRA 5CT6A 2A0UA 1Y9AA 4ZXPA 2R1ZA 2J4DA 1VPDA 2QQEA 3LT5A 4WWHA 3IBFA 4DV6B 2PH7A 2XADA 1YQUA 3UEOA 4FWTA 1NW7A 2WNSA 1UDXA 5JYDA 4CL2A 3HA5A 1T10A 3NMUF 4HAVA 4C9BA 1LRJA 2JI9A 4AKEA 3UZUA 3K5WA 2DAPA 2HEGA 3BRWD 3ZIDA 5FWXB 3GVIA 4QQFA 4Q1DA 4Y2PA 5H1YA 3R0IA 4XRRA 4BMVA 3RHFA 3JU3A 4EY7A 3Q15C 1ENPA 1FYXA 2GEVA 3HA2A 3CEMA 4P5EA 4D82A 2D3WA 2C7RA 2IOYA 2QVGA 1QUFA 3DZBA 3PWKA 4YREA 5LMCA 1KXJA 1XN1A 4KV9A 5DBFA 5HBGA 5IKOA 1C4WA 4UU7A 1NDHA 1XRSB 4EGCB 3UUGA 1R8YA 4BLUA 1YSCA 3TQSA 3GZ4A 1N34B 2X7XA 3O84A 3OEYA 4MUFA 4RM2A 2AN4A 3FLMA 4CQMB 5AUPB 3RYIA 1QCZA 4PSDA 5DMHA 1WY5A 4OBWA 4QFBA 4OOEA 2OHFA 4DJ5X 2J9GA 2XYGA 1QONA 3D7LA 5JEDA 2QTWB 4L4SA 3L02A 1QHHA 4FKBA 1AKWA 1Z4PX 3HA7A 4PQFA 1LS1A 1J2RA 1L9XA 5AM0A 1MX1A 4E70A 5M5BA 5J40A 1Z4IA 2GH1A 3BIFA 4ZT3A 1F0PA 2QMEA 1NWCA 4G0VA 2XECA 2VXOA 3WWZA 3L1IA 1DO0A 3C1OA 5HM8A 1XG5A 3OLXA 3PFKA 3U6BA 1V6SA 1YDMA 3QE2A 2EC5A 2BSQA 1E64A 1NXPA 2HJSA 3WJ1A 4EMSA 3AJ8A 2P9FA 4DLTA 3BD9A 2YFKA 1XKXA 4CEHA 4L16A 3EFOB 1ZI8A 1KFEB 2TECE 4UBLA 3OLCX 1QWSA 3T95A 5JH7F 2NM0A 2P27A 4OUKX 2GHTA 3UXYA 4IOMA 3DEZA 4LZNA 1VE7A 2G9VA 2HSWA 3CFYA 1X15A 4JJ4A 1DJOA 1TC2A 4L57A 1JTFA 1P1JA 1RP7A 2C2GA 3R0ZA 4Q4AB 3GLHE 4DV2B 4JH0A 4ANFA 2QPLA 3N1UA 2IUEA 1DEAA 2Z0MA 2QP9X 4Q3NA 2XRZA 2XNDA 3GUUA 3K70B 2CHFA 1V6AA 5AK6A 3ZU2A 4S24A 5CCXA 3FVTA 4MV7A 4ARSA 1WPXA 1NUTA 1IZ9A 1GR1A 1GPNA 1DAMA 2C8KA 2DFDA 3ZY5A 1SHTX 3L0SA 2ASEA 1Z34A 2HXSA 2NVWA 2V6MA 3GJXC 4KPYA 2NUAA 4R9UC 4EO4A 4BO7A 2WQ7A 5DX8A 1SQGA 1X1EA 2OGWA 4PN7A 3PQFA 3JZDA 1U8AA 1FRQA 2I3BA 1DPGA 3NKVA 1DRJA 2O48X 4JLVA 4AS2A 4CF7A 4CM8B 4X1YB 3DHVA 3QE3A 2YZ2A 2IPOA 4QRHA 4A5OA 4EAQA 1RKUA 4HQ0A 1IVNA 2VOJA 2X9QA 4IGFA 5BV2P 2O8FA 4FFVA 4RSGA 5J2TF 3V3KA 3FF4A 5FTLA 1A71A 2BJVA 4NBNA 4Z1OA 8MHTA 2J46A 1DAPA 3STYA 2YOFA 1DBPA 1F2VA 1G21A 1XGKA 1O4WA 4X00A 1XPJA 4FOTA 4I55F 2VQEB 1B0ZA 1RWKA 3LW8A 1DUIA 3FKSA 1MDFA 3AR7A 4A3SA 2HCTA 3ZV3A 3UWDA 1VJ0A 4L0QA 4N5LA 2IUYA 1LVHA 2L69A 5DHPA 4DIKA 1F06A 1J2UA 2ZWMA 1DAHA 3PFNA 1CRZA 1R0KA 1W4BA 1UKBA 4QHYA 1EIWA 1JR6A 5DXFA 2KS6A 1W4AA 5D3KA 1JFFB 3E1SA 4BLVA 4HWOA 2VPTA 1OH7A 4UZEA 4A1FA 1KO5A 5AK3A 1RRCA 1E6LA 1K1EA 1JAZA 1C9NA 1FRZA 1K8RA 1VA4A 2EF1A 5E6SB 3M4YA 1U4OA 1U2QA 4D8YA 1QOQB 5L9AA 1YC2A 4M1TA 2OD2A 1A7AA 3T7DA 4H6WA 2C95A 3UICA 4HX2A 3ZE6A 4PLTA 4UNSA 1KP2A 3D8BA 3G2OA 3HZRA 1ZGHA 2DHRA 1W85B 3HVIA 1FY2A 1FU4A 1W96A 1TU3A 3TN7A 1UT8A 2YWJA 3AVPA 2FXVA 3E9QA 4PRYA 2JIZD 3II6X 2J3EA 4PSUA 1Z2AA 3GV0A 1E2NA 3NAGA 2B1IA 2B8TA 5CEFA 3N0WA 3I45A 1ZX1A 1FTSA 1W4CA 5DO9A 3TK1A 1IH8A 1JE1A 1ACMA 5FO0A 1N2HA 2A67A 1TJ4A 1WOMA 1XXLA 1E9FA 4RYLA 1BS1A 3T15A 5I9IA 4EHLA 3FTDA 2GTPA 4AX4A 3VSCA 1HT2E 1I4LD 1QUEA 4HGZA 4J0EA 3NC4A 1O57A 2I3GA 3CUYA 4H3KB 1CX9B 1MIOB 2Q3DA 2NQ8A 3I37X 3O03A 2AG1A 3PUXA 4IINA 3CBQA 3DVQX 3W3ZB 4DUPA 1J8MF 4Z4QA 3R8FA 1MORA 1KK3A 2ZZKA 3HYRA 3QF7A 1KJYA 2R1TB 3GARA 4G01B 5AI5A 3G8AA 4CN8A 3JYHA 4A7PA 1Y3CE 5B3KA 2IYUA 2HJGA 2B8JA 2AA3A 2GDJA 3RNLA 3TW8A 3KOMA 1C8LA 1ZP6A 4BVKA 2ETXA 1TW3A 4O2AA 1TAGA 3B6EA 4IUDS 4PNPA 4PYLA 4MUMA 4EW2A 9MHTA 4JVSB 2OVBA 3EK2A 2V6JA 4MS1B 4AP6A 3WC4A 1QAQA 1M73E 1NVEA 2G8LA 3IERA 3P5SA 4FSXA 2PMEA 1VYUA 4GZ6A 1PJLA 3HRHA 4XDZA 3EGOA 3MOIA 3H1FA 3H65A 3GUHA 5F78A 3KZOA 4N47A 3EXFA 5BSKA 5C1IA 3CLHA 1F6DA 1KETA 1VC2A 3LQ1A 3QRWA 4P4SA 3ZN2A 5AFSA 1AF7A 1LDBA 1W581 2ZVQX 4FU0A 2IEAA 1ZIXA 3OF5A 1QQBA 1SIUA 3AR5A 4CWAA 5AKLA 1ZLYA 3N6VA 2B7LA 3AJDA 4JK3A 4UW9A 3EWAA 4K5QA 3TIIA 1NE7A 5L4LA 1XK7A 2QEQA 1QIFA 2IT1A 4R8MA 2BCEA 4M7PA 4N01A 3QMVA 3C8ZA 4CNQA 1O87A 5HM6A 3VR6H 5NULA 3I3OA 4Q00A 2CMGA 5AVZA 2H11A 3U7RA 2ZIZA 3VR6A 4RTLA 4BVGA 5JSUA 4LX8A 2V55B 2OESA 2W6JA 1GTVA 1HPLA 1P1IA 2F59A 1K97A 2G0TA 4U9UA 1M6NA 1LTHR 3VR2D 1V4BA 5C4IA 2YFHA 4QJ5A 1SBZA 2A59A 1G3MA 1OXBB 2QN2A 1R5OA 1Z0DA 2WR8A 5DF1A 5K4AA 2IPMA 1LLUA 4TT3D 1U1EA 3LKDA 5DTJA 3DAFA 3SDSA 2H9IA 4M76B 1AS2A 1VLHA 1EB9A 3DW3X 2Q2NA 2QX4A 4F84A 1SWWA 3L01A 1TLTA 1IQUA 2X8BA 1GCOA 2JKVA 3RC2A 5T4BA 3R44A 4JC4A 2HPZA 3I0ZA 3OX2A 4HPJB 3WYDA 2F43B 5I9NA 3EASA 3L4KA 2QTMA 1ECCA 1KHTA 3AZOA 4GE3A 1XTUA 1CKEA 5CVDA 7AT1A 3HKEA 1CERA 1FDRA 2HRDA 4LE1A 4CIBA 4Q7KA 1KZ4A 1QHHB 1KKMA 2OAP1 5G1PA 5H59A 3NTXA 5EUQB 4UUAA 3A6PC 5L7YA 4D56A 3U0VA 4G0WA 1L5MA 1K08A 2DFVA 1ZVQA 2PUJA 5K8LA 3RV4A 2E55A 4Y2RA 3VR5H 3W6OA 3BWEA 3EH1A 1EJ2A 1Y5RA 2HMYB 1LC0A 4YRCA 3X1XA 4Z4GA 1NYQA 1POXA 2HNKA 3PWZA 2C3YA 1BDMA 1TRKA 1RWMA 2DUMA 4IIBA 3E8SA 5BRNA 1MU0A 2BGJA 3TAHA 1CQIB 1QH1B 1QIDA 4L4XA 4HGYA 2W2VA 4TWBA 4UMVA 3F49S 5HIJA 1SUEA 2DX7A 4LOHA 1FFGA 5K4HA 4PHTA 1CIJA 1E18A 1Z75A 3O8OA 3RQSA 3VR5D 4TKLA 1KZ1A 1BNCA 3OIVA 3UW1A 1YZKA 3W05A 2FEMA 4F6LA 3CR8A 2HQOA 2Q3HA 1GTG1 4DLZA 4CDMA 3FPEA 5BNTA 2ZJBA 2KE5A 1EMDA 3V2GA 1XCJA 2PJDA 4IJKA 4KREA 4QQKA 2FG6C 1A8PA 1T3TA 2E89A 4LWZA 4MQEA 4F9GA 3VUEA 2B9EA 4X92A 4LRUA 2IXTA 2QMUA 4RAOA 1SB8A 5KYYA 2RBKA 2P6OA 1GOTA 4NYMR 3GPBA 4ND8A 4AROA 4C0AC 1PFUA 2HDNB 3TRKA 1PFYA 4B7XA 4C0BA 3LTEA 3VH3A 4EY3A 5GWXA 2B5VA 2GN0A 2VK4A 4XCVA 3E48A 2IS2A 3ON5A 5CMLA 5FF9A 4TSFA 2AXPA 2IHYA 4TXHA 3FM9A 2FQXA 1HE1C 5J2TA 1XTQA 1XJ5A 2PT5A 3EAGA 3OZEA 3TUZC 2OCBA 3V34A 2BSXA 4AURA 4P84A 4B3FX 1XLTC 3OJEA 3UCFA 3V9AA 2XKBA 4OFWA 2H16A 2HBRA 2WE7A 3QYJA 4LV6A 1N2BA 2POCA 3NYQA 1VI5A 3IC5A 3NZEA 3V8RA 2CE2X 3K5PA 1XRMA 4MMZB 2EQAA 4N0DA 3CEPB 3HO1A 3HBMA 3KQTA 1J2JA 1CB7A 3TCKA 3WSTA 1SOMA 3WRXC 1JIUA 2HWUA 3I28A 1AY0A 2J1LA 2CXUA 1ETHA 1WHSB 1XI2A 4F4FA 4OFBA 3K31A 1QAOA 3CKLA 1N92A 3KL2A 4RDCA 1R10A 3A36A 1P6XA 2P8JA 3EYAA 5L95A 2AQ8A 1QK4A 3PVCA 4Q18A 4QGGA 5MDHA 3I0NA 1K6IA 4GR9A 4IWNA 3EC1A 4WASA 3MWEB 5EHQA 5KVVA 2YJ4A 4NHOA 1FTNA 3AW9A 3NT4A 4PZYA 1YMUA 2RHHA 3ZNOA 1KMIY 4ZYVA 2WQ6A 2OLEA 2PX8A 3FKSD 1VYTA 5P8WA 1DQPA 3TLGA 1AQUA 2CFSA 3OURA 2GNAA 2QM0A 1R6UA 1W85A 2QMZA 2QN6A 3O8BA 2W2KB 3TEFA 1H6BA 2PMDA 3CH5A 5CIQA 3NQ41 2G04A 3CBGA 5ICCA 1WR8A 1HE8B 2P6MA 2C99A 5D84A 4ZKDA 1Z38A 4G0MA 2ADFA 2NO6A 4K6HA 3AVTA 3KB8A 4AMUA 4OJKA 1PW7A 4NU5A 4KODA 4UE2A 4DJFC 1LNQA 1P1KA 4FZ5A 1D8AA 1Z18A 2PMFA 4J16C 2AW5A 1D4OA 4MWDA 2O5VA 5KI6A 2XYHA 4E5NA 3ACDA 2R3SA 1TT5B 2EBUA 1JWAB 3WICA 3RPEA 1Z0UA 4P3OA 3DDWA 4S1WA 3EE6A 1LX7A 1UJMA 1XDDA 2AXEA 3EXHA 2P7HA 4IIVA 4K28A 1E3IA 1X8KA 1U0TA 2IU6A 2JEYA 1PP4A 1ZN9A 4O2AB 5CLJA 1T5HX 2D8MA 3EVFA 4R7GA 3QXJA 2FZLA 4XKJA 4ZQFA 1PJ8A 5HHTA 5DLYA 3E61A 4FE3A 5T67A 5IVHA 1D09A 1KEZA 5CB4B 1U0LA 3TJMA 1SBHA 4ZVNA 2WK1A 5L3RA 3Q6MA 4ZWNA 1SZPA 4Z9FA 2QUBA 4RL4A 1PG0A 4OKSA 4WLEA 2VYCA 5JXHA 3PJDA 3DL0A 3PQ8A 1V5IA 2JIPA 2PKEA 5A3QA 2HBYA 1D6SA 2AQHA 3EXIB 1GGVA 2FLWA 1I7QB 5C1PA 3I09A 2L2QA 2RHBA 2PAAA 1SXJC 1UFRA 3KQVA 3P9QA 1Z35A 1ZC3A 3QQPA 1YVEI 3AV3A 3DDUA 3FDFA 1W2HA 2XB9A 2IYNA 3IAUA 1YR9A 4Q16A 5E2IA 2NUAB 1LA2A 3K0CC 4I0WB 2ZBDA 3ZXIA 5IZCA 3Q9NA 3Q3GE 4BLSA 1NKVA 3MWLA 3QPWA 1V6CA 1QYVA 1Q7BA 1WSDA 3VU0A 1Y7TA 1U2SA 6NULA 3D7KA 3H9JA 3AVYA 1V43A 1JPJA 1ECPA 2KQUA 2ODBA 2YV4A 3D6FA 1YHYA 2E49A 3H2BA 5CNMA 3NT2A 2IDZA 3L8EA 5ALEA 1M2GA 1I80A 1CUBA 4HGRA 5H82A 1KEUA 2Q45A 1CLUA 3HO8A 4JEHA 1OUMA 1WU8A 2NGRA 5DCLA 4W6ZA 3UJ7A 3FWNA 3EIFA 3R3UA 2DLNA 4MWCA 3TPCA 3KT6A 3ADPA 4D4JA 2VS1A 3BXZA 4UM9B 1NGSA 1RKXA 5DBGA 2PZFA 2Q6VA 4UNRA 2JLSA 3KWJA 3L7NA 3W9UA 5KTSA 1U3VA 2ET6A 1WU7A 1J8VA 2O0JA 3KVYA 4LQCA 3L46A 2JDID 3GZNB 3QVMA 3DBVO 1MX5A 5CFPA 2XWQA 2IHTA 1ZNWA 1LPBB 4QFMA 3WGKA 2E87A 3DLTA 3DV0A 3LUCA 1THGA 6YASA 4JAVC 4UBOA 4Z0TA 4B79A 3H2ZA 1U1DA 4ERNA 2FEWB 5AKIA 1G66A 2X2FA 2H9YA 1IWOA 4RK7A 5CYOA 4H16A 3S99A 1JPVA 3DMPA 4TXMA 3VYUB 1OHHA 1H65A 1TJYA 3IPAA 4DRXA 5CB4A 5JJLA 1XD2A 1SVLA 2NZUG 4MRPA 5J9FA 4A8HA 3NG1A 2H0QA 4IV0A 5EYPB 2IBTA 2UXDB 1H9CA 2EP5A 1DXHA 1ZNQO 4DTCA 2YZNA 1OKKA 5LMNB 1ICIA 1Z17A 2H65A 1WAMA 1T5DX 2VNIA 2W8BA 2BFPA 4OO3A 2FWJA 5E9AA 4EFDA 5ITZA 3ADCA 4B4UA 4W1RA 1CY1A 5CH8A 5K0GA 1Z6ZA 3RTCA 3PLRA 1A95A 1TEXA 3ASZA 3HG7A 3F5QA 2P5TB 3G7SA 4PG4A 4QO7A 1ZIYA 4R83A 1MQSA 1I30A 1T1JA 3RVDA 3TNDA 4D0SA 2OCGA 3NWEA 4NE9A 4E88A 4A36A 5ALRA 1CNFA 2E6KA 2FP4A 2UVPA 2GAFA 2YHSA 1NVKA 1EFKA 3L6RA 2Z8XA 4FP9A 4JYCA 4OB7A 4RLQA 4PG6A 3FVQA 5K3DA 4G1BA 4RA6A 2AVNA 3FDZA 2Q5EA 3ZGVA 3AERA 1XPUA 3CA8A 5EE1A 1DIRA 1E0SA 3W8RA 1KO7A 1TM4E 4KDFA 1M8KA 4ZV7A 3UWMA 3QU4A 5JHHB 4LZJA 2A30A 2I4OA 4X95A 2EVWX 2Z5FA 1QHEA 1EFTA 3PHBE 2NLOA 1IHDA 3QLUA 4LXGA 3T38A 4JP5A 4QBKA 1IHYA 1KI4A 2GPJA 2I99A 1UODA 2BEVA 2J41A 1XDSA 5WRFA 3TLAA 3V9PA 1HNXB 2MMCA 4BN0A 1EUDB 1U2EA 3N7AA 4ZARA 3IDAA 3TECE 4K9KA 1R0ZA 2GK7A 2C4MA 5J4HA 5KQMA 2EV9A 2PSEA 1A7UA 1IZ0A 1HH4A 4JOCA 1JDZA 4IX1A 2OCAA 1PX0A 3IE0A 4ZU6X 4A26A 4QJIA 1U4NA 1AG9A 1ODSA 4DXAA 3WSWA 4EITA 5A9SB 4UOQA 4W5WA 4L8VA 3B1XA 4DC1A 2WB4A 3RJTA 3N2NA 1QQ5A 3EGXA 2ZSFA 3LG2A 5F2EA 3GLQA 3FUTA 3EB9A 3L06A 2WNHA 4GXRA 4J76A 5DW0A 5CFNA 1T36A 5FOQA 5C4MA 4QGFA 3VO8A 2P6RA 1Q0QA 1JFRA 5FLKA 1R6XA 3AZQA 1WF3A 1YK1A 3ONEA 5KZMB 3B3QA 4Z4EA 2OO7A 2FLVA 1O0BA 1M0EA 4J9VA 4MZXA 4QOSA 3MZ0A 3VA7A 4UTXA 1A4IA 1TX4B 3RM3A 1WXWA 3CUSA 3QENA 2Q6IA 4L5CA 1UBUS 3T3HA 3UG7A 4MV8A 1FB5A 2BMWA 2QZSA 5IWAB 2YY5A 4KJXA 2WWVD 4ZC8A 1A82A 1EDDA 1FQOA 3FKJA 2X8AA 1E3WB 3O75A 8ABPA 1W88A 4L51A 4QWMA 3TE7A 2BTOA 1WG8A 4JHXA 3OJWA 1U7OA 4H59A 2XOEA 1SCKA 4AG5A 1Y4UA 5BSHA 1T4BA 2FP4B 1JALA 1PR6A 2CBXA 2XMPA 4E6EA 1T3SA 4R9RA 1TVMA 4P0QB 1L7NA 2A3RA 3DM9B 3LV8A 3PHCA 1JA9A 4BNUA 1QFJA 3BWMA 3TFOA 1WNTA 1V25A 4OSEA 2IPAB 3JR7A 5EEGA 5H83A 4II7A 1TO1E 3N2EA 5AHXA 3W8NA 4EB3A 1BXZA 1GO2A 5J2UB 1GCIA 1H8ED 1N9KA 1XT6A 2QX6A 3PTLA 2E4WA 4RNCA 4D4LA 4EELA 4MSUA 2I9KA 2OC4A 2QP4A 4RY0A 2Q5FA 1YZLA 2B5WA 4YO7A 5DNUA 2R5WA 4AKGA 1NFQA 2R00C 1LK5A 4N0PA 4KVZA 4NOMA 5ARDA 3MJRA 5KJ1A 4DB4A 2FMXA 3B78A 2E5LB 3ITNA 1Z06A 1ILEA 4RWEA 2XVZA 1T2CA 2Y2VA 4Y1FA 4D45A 1RP1A 5DGTA 3JQEA 4CKBA 5BSFA 3B9BA 4RHEA 3U19A 3TOZA 4IRMA 3NHRA 1Y1KE 3I9NA 4JJIA 2DLCX 1ZJZA 3HB9A 5EHIA 1HSOA 2A0XA 2H52A 2W8ZA 3ONNA 2FFBA 2I80A 2Q5IA 4LAFA 1Y37A 4OHRA 4QSHA 5MF6A 2FEOA 2OENG 3D8RA 3HCOA 4YGYA 4G1EB 5IULC 1WQ4A 4ESVA 3BIJA 4MWOA 2X76A 3H1EA 4CT0A 1U65A 4DSUA 5BSVA 1PEDA 3OMLA 2X1HA 2XNKA 5DYTA 5JQWA 2LBPA 2WZCA 4JJZA 5HS6A 3PEEA 3ZCTA 1YZYA 2JEZA 3LFHA 1SULA 1PTKA 4DJJA 1O95A 3E5MA 2JFOA 4XM1A 1NUUA 1ZNXA 2Z9BA 2R47A 4DG9A 3FPLA 2H5IA 1V0JA 1VJTA 2XQKA 4OPMA 4TZKA 4W5NA 1B16A 4CFZA 2ECOA 2W6NA 1DSSG 1GRVA 4JLUA 1X8LA 1ZXLA 1WD7A 4PRZA 4R1PA 5EJ5A 5KTKA 3IUJA 2PY6A 2R6R1 2YZMA 5F4BA 5C0OE 5JCOC 4K6MA 2JH3A 4DMRA 4LOIA 1G8JA 1NE2A 2WPDA 4GZMA 1ID1A 3QEJA 3T7TA 4L3WA 1F2TA 3IPXA 3JQ9C 3E7PA 1FQJA 3CUTA 4M0MA 3QOXA 4OI4A 4KQWA 5FULA 5ERXA 3H11A 2QL7A 3NHPA 3S2IA 3UCXA 4B7ZA 4DC9A 1QOPB 4JHLA 5IYZA 2GXQA 5BMVF 3JQ6A 4HY3A 1W34A 3JRNA 3M5DA 1WSWA 1UM9A 1D2RA 1XU7A 1ZC4A 3A37A 4IOKA 4KX3A 3F3KA 3OUUA 2EX4A 2RSLA 5EWJB 2FSVA 2XZDA 3W5AA 1I2BA 4Q7LA 4D79A 3PG5A 4L0CA 2HXGA 1Y7PA 3CE9A 3F47A 4I4TF 3WBKA 4MYHA 4EG3A 4ZJZA 3SC2A 2F4NA 2R7AA 4JYPA 4IDBA 1DX6A 3D0KA 5EWLA 4MA4A 5ICSA 1TPZA 4CGZA 4BCDA 5JO9A 2V7VA 3A58B 1P7VA 3ADOA 1L7AA 2UUPA 2WF5A 3HWSA 4D9HA 2XW6A 4EMTA 1DBSA 1JILA 3RROA 3V5NA 3M83A 1FYFA 5DHSA 3RTAA 4COOA 2XUZA 2RARA 2V4UA 3QX3A 1U8XX 1XCMA 4MJXA 1UH5A 1T9GS 1DPFA 4IOLA 5SZIA 1TYCA 1KP9A 4MS1A 1U8TA 4N0EA 3ST7A 4BFSA 2NN3C 5A9RA 4YCDA 4BO0A 2X6QA 4CLXA 4XB6B 2J0EA 5CP8A 4ZQEA 1KORA 1A4XA 2ZITA 2C78A 2O0MA 3OMWA 3J81A 1IMJA 5EIWA 5JG7A 4TTQA 3QIVA 3RLFA 3GJ3A 5IXYA 4HSEA 1XEWX 1A9PA 3F73A 2NO5A 4NNPA 1HDEA 1Y1PA 5ILGA 4OD0A 3HSYA 1KO4A 1MT0A 2BM0A 2D5BA 2QL5A 1LV7A 2JGIA 5K6AA 2FW7A 5IBPA 4X71A 3WZ2A 3BXHA 1FVXA 4MKXA 4M86A 1H4QA 1GPBA 2C8JA 4ZQBA 2VR1A 4C05A 4FDTA 3DKKA 3IVXA 4ED9A 4MVJP 1IAQA 1ZU4A 5ADHA 1NXWA 2CK3D 1Q2XA 2BISA 4DDHA 3VU9B 3T41A 5LQUA 4Q4DA 3VISA 4ZV4A 2WUFA 5B12A 1MBZA 2YW9A 1FUEA 2CV2A 1I1OA 3V4ZA 1M67A 1G291 3JVUA 1KL7A 2BMVA 2LVBA 1AUOA 1HETA 2ZYSA 1WPRA 3ENZA 3DLAA 4I50A 4ND7A 4URUR 2Z08A 3VKUA 3JD3A 5ECWA 3AUXA 4HEHA 5BR4A 3I62A 3C6KA 1HDZA 3PC3A 4GOLD 1O94A 2D5CA 3TCXB 1UXHA 4LJSA 1F51E 1I4TD 4D42A 4DCSA 2AYYA 5DV9A 1I2MA 5CR9A 4U7DA 4MEJA 4J1QA 4B8ZA 2R25B 3KUCA 1SCAA 1Q0SA 3NHJA 2ZRIA 1XNHA 1T1SA 2C61A 4OFZA 5IH3A 1YFLA 3IMGA 2K4MA 5LB2A 4BO1A 4EPWA 5KTTA 3JD4A 2PH1A 1JJIA 4BVHA 3AEKB 2C2XA 3LF1A 3FTQA 3WAGA 3B20A 2VTKA 4E5KA 4YXWD 1BEZA 3L82B 5LYJA 1BSVA 1Z4QA 2VDJA 1NPYA 1WTCA 4FHFA 1VHLA 2QQ0A 4CKCA 1U1CA 1PL0A 2GCEA 2OQIA 1QLJA 2FVYA 4KSCA 2XUPA 5IX8A 1E20A 4M7OA 1QH0A 1E7RA 3TEMA 1B2RA 3VO9A 1FVOA 4BO8A 1JT2A 2WG1A 1S1MA 1TIPA 1RLMA 4HXYA 3BEDA 2X0FA 1QH8A 3G9UA 4GKKB 5JNRA 4ML3A 3KWMA 3NM4A 2IW1A 3PFHA 3MWDA 4KXWA 5CBKA 1UADA 5G40A 4EGSA 3W7AA 1GNVA 1OX4B 1YNOA 4NI5A 4I55A 2BBOA 5ALLA 5HWSA 1DMSA 3F74A 5CNJA 3AP2A 4YBZA 5C1DA 2BE9A 5AVSA 2X5JO 1ULUA 1V39A 1STOA 4ZANA 4EBBA 4MQ6A 3MLBA 1NVWQ 4RSHA 5NLLA 3KSRA 5HW0A 1ZGCA 1G17A 1VE5A 2CJXA 1M2VA 5DNDA 3SKXA 4ZI7B 4RMIA 4MVJG 2W2QA 4B81A 4K9PA 1QDEA 3EBPA 2AJLI 1AKRA 1TO2E 3WAJA 5AVXA 1OFUX 5K51A 5A5VA 3WYCA 3DLBA 5AKEA 2D1RA 1RYDA 3VSBA 4J0KA 5I7VA 4N7MA 2H2DA 3GGGA 5JBQA 1YFZA 2Z1NA 2JAPA 3A2KA 2J6HA 3FTFA 1XRLA 5KQLA 1VIAA 2FHPA 3KJHA 4ZU3A 4QUGA 3VUFA 2DTEA 4NZZA 4AULA 2DQSA 1DVRA 1ONOA 1B00A 2YV5A 3A1DA 2F1JA 3HJNA 4XW2A 1F6WA 5FTMA 3DXXA 4P83A 1TVCA 2EWVA 4GLOA 4WZAB 2A1UB 3AESA 2HW8A 4Q03A 3P0FA 2NZXA 2H1HA 3SIRA 4R1MA 4TLAA 2RC6A 4JC0A 1VHWA 4ZMSA 5JCZA 2OBBA 4MTCA 3GYBA 4P3YA 4KN6A 1HDIA 4ON9A 5FUWA 1Q0TA 3QPAA 1RR6A 3EEIA 4BNKA 2Y92A 3ZHUA 4QXRA 3JD1A 1X8JA 1EVKA 3FNHA 4WNCA 3TCNA 4J0GA 4QASA 5KCZA 1T8TA 4MIKA 5DM4A 4YDSA 4YT8A 1RHJA 2HCFA 3UFXB 5FT9A 1CE8A 1P2DA 2QTTA 4NZMA 4TWAA 3V7FA 1J7JA 4RD1A 2IL1A 2WUEA 1EGVB 2FRDA 4DV7B 4BEBA 1HQCA 3TLEA 5KEIA 2VIIA 1IY1A 3GAMA 2F3TA 1RIIA 3EG9B 3GRCA 4N3NA 5I7EA 1E0AA 3VJLA 2CJWA 3RGGA 3V4RA 3B12A 2EL7A 5EZYF 5FNVF 2IF0A 3HB1A 3MAGA 1SG9A 4X3OA 4RVOA 3A1SA 4QPDA 3TLMA 1AQLA 3GN2A 3ZYCA 2H3EA 5AOBA 4Y9SA 3EOBI 1DAEA 1CB0A 1XZGA 2C4WA 3OOSA 1TKRA 1GDDA 3ENVA 3FROA 2DBRA 1HNZB 3DCYA 3LLCA 5DB4A 2EKPA 3MF4A 1T15A 1W47A 3OZDA 1M2VB 2FN4A 4DFDA 3SYNA 2DFKB 1F8YA 4PLPA 4B82A 4YO8A 5REQA 1DELA 3A4MA 3UENA 4DA9A 4ND3A 1Y7HA 1XAJA 3WLKX 1J97A 3Q5DA 3NGLA 3TTWA 5FWYB 3OJ0A 4F46A 5AR1A 3DDHA 1N5MA 5ALDA 5HBRA 5KOJA 4QLBA 4LOJA 3U80A 4BQOA 1XA4A 4M37A 3ZPXA 3R6LA 5DGXA 1DC6A 1PDWA 4TMWA 4WGFA 4BWVA 2WUVA 4OAPA 1F14A 2F6RA 2JZCA 4FSHA 3SYMA 3ZDAA 4PLCA 1N2OA 3BDIA 5ELMA 2QF7A 5EGSA 3VU1A 5FB3A 4H4EA 4PHCA 2IP1A 1SZCA 3IVRA 1D2HA 2BRUC 1NQTA 1GPLA 5C7LO 1GV1A 1W1IA 1YFKA 5DBIA 3HU1A 3RTBA 5SZKB 4HZGA 4PLFA 3ORRA 1N25A 3F9IA 3OMXA 3S81A 2O3SA 1SY7A 4FI3F 1XZIA 3AM1A 4UUMA 4CMAA 1BWQA 1ORHA 3AF3A 3E4DA 3K9GA 2J9YB 1OF1A 1EGMB 2QSJA 3C48A 3DMTC 1IK6A 5DH9A 5DM1A 1RXEA 4ODIA 2QRUA 1TZCA 2PJUA 1ESNA 3B1ZA 3TMKA 3A70A 3IP8A 4J7CA 1ZJYA 4UXJA 1TCUA 1V9CA 3RVLA 3KB1A 1OLXA 5CDFA 1U28A 5DYNA 4MQBA 2HAEA 2D1YA 2NW6A 2RHTA 2VKTA 5GGYA 2FG5A 1IN1A 3OA2A 4JENA 3IP9A 1RPZA 1XEFA 3LOQA 2KHZA 4W9MC 4TKVB 3AUJB 5FPHA 1C9MA 3N0TA 2Q4RA 3QWIA 5D3QA 3WDSA 2YQ4A 1QG6A 2GUGA 4LQDA 5IJZA 1P73A 3OY2A 3THWB 3E22A 3SQDA 1J56A 1PF7E 1QKIA 4Y67A 5MN6A 3ICPA 4P4UA 4X1IA 3T06B 1W0JA 2G1PA 1OFGA 1TADA 1JLRA 1J8QA 3M4ZA 4LNHA 1B6TA 1G8KA 2O05A 2A4KA 3LWNA 5TVKA 2EW2A 4KE7A 2PSHA 5BN4A 3W2GA 3WIUA 2JW5A 2MSWA 3RD5A 1SR8A 1NSFA 1FA9A 3RG8A 5ALMA 2OBFA 1N3IA 4B17A 4BLTA 4HYEA 3OT1B 4YC7A 2JAOA 1JXMA 2QE7A 2V4MA 3E1GA 2GYUA 3TTTA 4C2TA 3RUIA 1YB5A 2EJWA 2UYHA 2QAGA 1XHFA 3FZQA 3DMRA 3MIZA 1W9HA 4NU6A 4OL0A 1E4OA 3AY7A 4YRJA 3ZIUA 2EKZA 3RUPA 2QUIA 4CQLB 4F5ZA 3C8DA 5HKBA 5LD2B 4PYQA 2AB0A 2QUHA 3C3AA 4RA9A 5KDOA 1UBLS 1S2DA 2DY0A 4M1YA 3AEXA 4ZYXA 1HYGA 3HVHA 5HVNA 5BP7A 3PZRA 1HDCA 5ITSA 1EP3B 3G0DA 4R0NA 1JZTA 4OATA 4RK6A 1GU0A 2W6JD 4LJ5A 2KLHA 4TS4A 5FD8A 1YKGA 4AVYA 5FYDA 3PX2A 4XOIA 5DN6A 3CU5A 1CY8A 3HXMA 2XUDA 4H7FA 4QPCA 3TQQA 4YPVA 4B5LA 3E9MA 3C3MA 4Q3LA 2FPIB 4I8XA 2OM2A 2GK6A 4B3XA 1PV4A 2IYWA 3W1WA 2FR8A 4IIJF 3WLFA 3V7NA 4JJEA 3WZMA 1WRBA 2JI7A 1AH2A 4JLJA 1DQSA 4HRVA 3QLJA 2G8NA 5JADA 4OMFG 1FVFA 3K6SA 5HQ3A 5EWJA 4ZZ0A 1EINA 2V03A 4M4SA 4TSRA 3QX7A 3WMRA 3ODGA 1K2WA 4JLOA 3FZYA 5HUHA 4C4RA 2ZUVA 5A2QA 3ETDA 2FN8A 5HTOA 1FUUA 1SFRA 2H4HA 2E3JA 1ATZA 1OY1A 2JGRA 2XI4A 3N0RA 4HNQA 1YDEA 1TGVA 4N6OA 4NZNA 4OYRA 4RDIA 1E3LA 3B53X 4CMHA 1M1XB 3WKBA 3SF0A 1XFDA 1PFGA 2FWNA 3AMVA 3TW0A 4IMJB 2YJNA 2X1MA 2FNAA 2OCXA 1DBQA 2H2AA 3IQXA 4TZ0A 5IT9A 1UC5B 4D3ZA 1OJLA 2QRVB 2OD9A 3FRHA 3KZ1E 4KCGA 4QELA 5F1YA 5TPWA 3SICE 4TYWA 1ZK4A 1NXQA 2Q5OA 4NJMA 4KITB 3ISTA 3LE8A 1JQLB 3W5IA 4AYWA 3Q41A 5GVSA 3IE1A 3RWOA 5IM4F 2ZB8A 3NETA 4FT4A 2C5EA 4C06A 4ENTA 2H4YA 3IT0A 1E2JA 2FRDC 2ZPUA 4MGZR 3NHMA 4IVRA 5GJWC 1UL1X 3RYHA 2OM6A 1IQPA 5K6TA 4RQAA 3ECAA 1N32B 3C0KA 1UWLA 3SX2A 3K6SB 2O3TA 2AZTA 1FZTA 2W0MA 1NOIA 1KFKB 1WXIA 2LW7A 1VJ1A 3CLVA 3FYCA 3IOEA 3W5HA 3GIWA 4FLEA 5IC6A 3TAUA 1VPVA 5KBYA 2FPGA 1CUEA 5JYEA 1ZJ5A 1USIA 4MW6A 3G5MA 1R4NA 5JVDA 2MYNA 5DHTA 1QGOA 1DQYA 3ZXUB 2YZGA 1L8AA 3U4CA 4GPTA 3NH6A 4QFDA 3TNJA 3CWZA 4H1HA 5CW1A 3CZAA 4MDEA 3L4EA 3IEIA 5GIPE 2C5GA 2OXTA 1LLQA 3BWCA 5JR3A 4QQNA 1HL7A 1LSOA 3OT5A 4DG5A 1CR2A 4E46A 4PQYA 4EF6A 5K0EA 1N5LA 3KXKA 4GF5A 3JASB 5EXTA 4IV5A 3H19A 3GFGA 3PEVA 4RTMA 3UMFA 4JZKA 2YOHA 2GN4A 3H86A 4PICA 4X7RA 3UH1A 1O54A 2J3QA 4PO9A 5H0IA 4ARZA 2O1WA 2I8AA 1D8TA 2QL6A 4C7MA 4D3XA 1JVSA 4IS2A 1PJ2A 1Z56C 4JLKA 1AC5A 1S3IA 1YT5A 2MMGA 3RSGA 1RJGA 2HNAA 1JB9A 1TCBA 3E23A 1KYZA 5J2UF 2PH5A 3FUVA 2ZJYA 4KEAA 4FYJA 4NONA 5A5FA 1JR4A 9ABPA 1LNSA 3BGVA 4U1RA 4NABA 3SS9X 3IBYA 3IUBA 3BSSA 4JELA 1SHKA 1Q17A 4MW7A 3H7AA 2ZS9A 2MIIA 1N36B 1DTSA 1L7VC 2DC1A 1C0IA 4FEGA 3S2SA 4M1KA 4ECAA 2JLYA 1XROA 3FUCA 2PS0A 3VH1A 5IW8A 4TN5A 1B74A 1LPMA 4U7TB 4DABA 1X92A 3U4DA 1ND5A 2DUWA 3L41A 1JDBB 4G8DA 4DV5B 4ISBA 2IV2X 5BWNA 1ZGAA 4HXFB 421PA 4ZI3A 2VYNA 4OIMA 1JU4A 2A14A 4YHBA 5E1MA 3WRYA 4DPMA 2YCBA 2FEKA 4F1JA 2HMTA 2YHAA 5CDYA 4G4JA 1FDWA 3BXFA 4EWLA 3EXG2 3FYDA 4L9WA 3O4IA 2QHXA 3KPVA 4FFRA 2G09A 2D2XA 1QPBA 3GO4A 1NXOA 5E7QA 5AUNB 1GSHA 3DEJA 4DA0A 3KSMA 1X2BA 4X5OA 5T8KC 2OGUA 2VJYA 3G02A 4UVEA 1WBBA 4X44A 4Y18A 2FSFA 3K0AB 3WLLA 3T8YA 1QRSA 1BW9A 5A3JA 1KZ6A 4LNUA 2ECKA 2VWQA 2XYRA 1E77A 5AM5A