1SCKA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetone
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
256
structure length
256
Chain Sequence
b'AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-acetone-cyanohydrin lyase
molecule tags Lyase
source organism Hevea brasiliensis
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
total genus 99
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sckA00
2WTNA 4ZV9A 5HK8A 3G0IA 1THGA 3PUHA 2VJCA 5FPQA 3BF8A 1DQZA 5T4FA 4ZRDA 1Y37A 4Y9SA 1TAHA 3I6ZA 1QONA 4AN1A 4E11A 2QS9A 5JASA 5LZ5A 4L72A 1WB4A 3BXPA 5ALSA 5HKAA 1EH5A 3WIOA 4X92A 1E8MA 4Y2VA 4UBMA 3MUOA 5C8ZA 4JH0A 2C5GA 3ICVA 1QIIA 3GFFA 5ALVA 4OYLA 5IVIA 4DMHA 2H1IA 2O2HA 2QUAA 4F21A 5LKAA 5IVHA 1SFRA 1E8DA 1CUVA 2ES4A 4KAJA 3HYSA 3WYNA 1IZ7A 1H2XA 2X5XA 3H18A 4LXIA 1CQWA 2WU3A 3N0TA 2JGJA 4G9EA 3AUKA 3G9TA 1CV2A 2DSNA 1Z68A 4UBJA 3QZUA 2RI6A 4HRXA 2HA3A 4P93A 1ZOIA 2BGRA 5K3FB 4BTVA 1W75A 3BIWA 2RONA 4E15A 2WFLA 1ZJ5A 1GPLA 3H2KA 3SK0A 6YASA 4K2AA 3R3YA 5ALRA 2ROQA 1ZD2P 3EQ7A 3C8DA 1NU6A 4AO7A 1DT3A 3C45A 3GA7A 5CMLA 3HEAA 1LGYA 2I3ZA 3PUIA 5JALA 2AXEA 2WG0A 4AQDA 5ALWA 3WYDA 1QIHA 5DJ5A 3B5EA 4JYPA 5AOBA 1J06A 2AJCA 3OM8A 4EB0A 2H9YA 4KE6A 4Y2TA 3O4GA 1AX9A 1XQWA 2HDWA 5JANA 4BTLA 1JMYA 1A7UA 2QT9A 2VTVA 2GZSA 1U8EA 4I3FA 3ZLUA 1BN6A 3X3HA 2G5PA 4UHEA 1GT6A 7YASA 3D7RA 3P2MA 5A6VA 4UBLA 4DNPA 2HRRA 4WDQA 1EB8A 2W6CX 4XWGA 3I1IA 4G4GA 1EDEA 2BJHA 1TCBA 4C4XA 1C7JA 1O6FA 3O95A 5AKLA 5C8VA 1LPPA 1RP1A 1ZIYA 5LZ4A 5DTJA 1CRLA 1X70A 4OPMA 5EIEA 5FRDA 1R9MA 4HAIA 2Z5GA 3M83A 3IIIA 2I78A 5C81A 4DSAA 5FUMA 1UK8A 3VDXA 3IUQA 2X76A 4PV7A 4DLNA 1IUNA 1NU8A 5LZ7A 4OU5A 2QXTA 3I2IA 1Y7IA 4BCBA 4D9JA 1S8OA 1HKHA 1MO2A 3QVMA 3JW8A 2WSLA 4Q3KA 2OCIA 3C43A 3HLKA 4CI9A 2WQZA 4UBOA 1R3DA 3PF8A 5AM4A 3BJRA 4H0CA 5D3KA 4O08A 4LKOA 2QTBA 3D5EA 2J4CA 4Q34A 3A2LA 3G7NA 2EDCA 5I7UA 1JJIA 5JAPA 1HPLA 1UKAA 2Z3WA 3FVTA 1KEZA 1XZJA 2WUFA 4WFIA 3R3UA 4KAFA 1E89A 5A7GA 2WIGA 3B3QA 4S0XA 3IUNA 2ORYA 4B0PA 3IDAA 1U2EA 3O4HA 2AJLI 4LXHA 2JEYA 5FDFA 4X3CA 3LIPA 1IVYA 4EY7A 3DYVA 5AIBA 4H7JA 2G63A 1L7RA 2PX6A 4N8EA 1JKMA 1N1MA 3WK7A 2ACKA 2XMSA 4MYDA 2VEOA 4E14A 2VJAA 2DR0A 1QFSA 1XZEA 2O7VA 4GHWA 2VJBA 4J0JA 2VT7A 3PDCA 2AJ8A 3R3ZA 2QUBA 3ESDA 1CUAA 5HK9A 4BYMA 4KACA 4RGYA 3V9AA 1H23A 3D2AA 3EBLA 4FMPA 2XI4A 3WWDA 3E0XA 3O0DA 4HXEB 2XQKA 3IA2A 1EB9A 3WZLA 4J0GA 2ZYHA 2Y2VA 5AM3A 4AO6A 1W4LA 1ZI6A 4AN0A 1IUOA 1QIGA 4WCVA 1OILA 3H2JA 1B6GA 1LPBB 1ZICA 4H77A 1ACLA 4CIBA 3G0CA 2IIVA 4Y2RA 1SOMA 3WK6A 1XZAA 5FV4A 1VOTA 5AI8A 4UBNA 1MX5A 1HBJA 4GBGA 4ARBA 4ZGBA 1DWQA 2OAGA 5DNUA 2ZJFA 3BF7A 4EZIA 1TCAA 1XZMA 1QTRA 4DIUA 5HFAA 1XZKA 4BE4A 2B61A 4F60A 3EQ9A 3NUZA 3I28A 5CH5A 3WIBA 2WIDA 5CW2A 5DYTA 2XMGA 1YB7A 3D3NA 4KEAA 1UK6A 4EY8A 2XMBA 4J0HA 2XMDA 4FBMA 4MWSA 3ZLTA 2YXPX 3DOHA 1D07A 2ZJ6A 1THTA 1WHTA 5ALQA 4P08A 4BE9A 4UHDA 1XLWA 1IUPA 2XUQA 4B9EA 1L7QA 1J07A 2PUHA 3DQZA 1EK2A 2WU4A 4IHAA 2R11A 1UKBA 1USWA 1F8UA 2V9ZA 4L0CA 4ZWNA 4W1SA 3I6YA 2Y6VA 3D2BA 3WL8A 1Q84A 2XMQA 4P92A 2C0QA 3HSSA 4J7AA 4WJLA 4PQEA 3FBWA 1EDDA 3H19A 1MPXA 5A7FA 1OCEA 1YA4A 4H35A 4EA6A 5ALHA 2BGNA 4H7HA 1JJBA 1PV1A 4DMCA 3D2CA 4FBLA 4BZZA 5CXXA 3AILA 1E66A 5K3AA 2RHTA 4QDZA 1DQYA 2HU5A 1CUHA 3BL8A 4WFKA 3FCXA 5CH8A 3W9UA 1A8QA 4U2FA 1WB5A 4B6GA 1EDBA 4WY8A 4CFSA 4UHHA 4X90A 4H7EA 3F98A 2NW6A 3C6BA 3LS2A 3E3AA 3IURA 2FJPA 3SX4A 4BDSA 4C88A 3A2NA 3STYA 1GKLA 4MYSA 4J0KA 4HVTA 1XZGA 2D5LA 2C5FA 3E4DA 1VZ2A 2PVSA 5ALUA 5AK5A 3I2FA 1DU4A 3UUEA 5LKRA 3M82A 3C6XA 3Q8WA 3TEJA 3QM1A 5AIAA 3WI7A 5CBKA 2HA2A 5LLSA 1MX9A 3OC0A 4V2IA 5CT8A 3H0CA 3HZOA 3DLTA 1GXSA 3EF3A 1Q0RA 1VE7A 1CUEA 2OAEA 4PW0A 4UUQA 1ZI9A 3F9CA 3LLCA 2I3DA 1VZ3A 3IBTA 5FPPA 3M3DA 4FWBA 3FYUA 4LIPD 3V1LA 4QE3A 2HFKA 2BFNA 1EK1A 2CJPA 1GPKA 1BE0A 4TPKA 4X85A 2DHCA 3WA6A 1QOZA 4X71A 1QIEA 4A16A 4BBZA 2XDWA 3C87A 2FJ0A 4HTAA 5HF8A 4KE7A 4UFNA 1BROA 1J1IA 4BVJA 1AUOA 2DQZA 3FCYA 5I8PA 1CUFA 3G0BA 4G9GA 4AMZA 4ZREA 5IH7A 1ODCA 3KXPA 5KREA 5FXMA 3WMRA 4QLAA 1CUIA 4IH1A 5T4HA 2JGEA 1CLEA 3WK4A 5ALNA 4UFOA 3NOXA 1GQSA 3DL7A 4BAUA 4J0CA 1G66A 1BEZA 2ZYIA 5AKIA 4NMWA 1WPXA 4KJXA 2XLBA 3L1IA 3G9XA 5ALFA 1WOMA 3WLAA 4FTWA 5FOQA 3LP5A 4U2GA 3KWJA 2XUPA 2PL5A 3T4UA 1TK3A 5EFZA 5T4EA 1LZKA 1VXRA 3NGMA 4W63A 4N8SA 5HFNA 4YX9A 4CIAA 2G4LA 4JEIA 2IITA 3IB3A 2V98A 4U2DA 5C7YA 2GYVA 4XVCA 3IUJA 2XUDA 1JU3A 2FUKA 2R8BA 5CT6A 1EX9A 4DNOA 3U1TA 4BCDA 2Q0XA 2XMRA 4EY6A 3VVLA 1CUCA 2OCGA 5K3EA 2OLEA 4BDTA 5ALIA 1LPNA 1LPSA 5DNWA 3CN7A 2FX5A 2CBGA 2WILA 4M0MA 4DYHA 3VJKA 2OQVA 1DX4A 3I2KA 1MU0A 1UOOA 5K3CA 1H22A 2PU7A 1GQRA 1P0PA 5HF6A 2H7YA 5ALYA 3RARA 2QRUA 2DQYA 4PSDA 3LCRA 4GW3A 3B12A 4NVRA 2WJ4A 5HZGA 2XUGA 4ZI5A 4G8CA 5ALOA 4UHCA 3WKBA 3ZPXA 4G8BA 2PM8A 4LHEA 1XZCA 1A88A 1XQYA 2ONCA 2XMCA 3VVMA 1G5FA 4GXNA 4CCWA 4J0DA 3C5VA 3STWA 3AZOA 2HIHA 1CQZA 3JWEA 3IUMA 4H7DA 4LXGA 3VKFA 4B83A 4G5XA 1CR6A 1XRLA 2VQ6A 3BE8A 1HQDA 4Y2XA 3DDUA 4G4IA 5AICA 2OGZA 3ZI7A 5JARA 4PNZA 2W22A 3FLBA 4PSCA 2BCEA 3R40A 4B80A 4QLOA 4DM7A 4PO3X 3KD2A 2P8SA 1W6RA 2XMZA 3H04A 5EHZA 1C4XA 2ZSIA 3FSGA 2QXUA 2HU7A 2XQFA 3STVA 3KDAA 4FKBA 3TJMA 4DGQA 3QPAA 1QIMA 5AKEA 1JI3A 5JIBA 5AM0A 3H2IA 4EHBA 1R88A 5AKZA 1XLUA 3FLEA 5ALXA 5H3HA 1ZD5A 2CEKA 5I9IA 4UBKA 1CIJA 1ETHA 5ALEA 2GBFA 5BV7A 4A23A 2QR5A 2XB6A 4M0FA 1QO7A 2OG1A 5HF9A 3SWWA 4QDXA 5A71A 1JMKC 2BKLA 5E4YA 5BWBA 5EIHA 4JNCA 3IULA 2DCMA 2B4KA 4LYDA 5KWJA 3STTA 4Y7DA 1XKTA 1X2BA 5ALPA 3CCCA 3FVRA 3KWFA 3F96A 2C7BA 5SYMA 2QZPA 4X6YA 1LPAB 5JZBA 1EHYA 4C01A 1ZGBA 3RK4A 4TGLA 1JT2A 2C58A 1CUBA 3V1MA 4BRSA 4ZV7A 1YB6A 4XIIA 4K6HA 3G9UA 2OGSA 1MJ5A 5AJHA 1ZJ4A 1O6GA 1UZAA 1EA5A 3NWOA 3OOSA 4MXDA 3HRHA 1ORVA 4N8DA 1QJ4A 2OQIA 3AFIA 5E4TA 2GBIA 1M33A 4G4JA 3VJLA 1AKNA 3HABA 2RGUA 2WG2A 5E4JA 2JGMA 4X95A 1MAHA 4GEGA 2Y1KA 3Q0TA 3ANSA 3FSGD 3KOOA 4KE8A 3OG9A 3FNBA 4KR0A 4Z49A 3PF9A 3TRDA 3PI6A 4FOLA 3WWCA 4OSEA 4X97A 2WFMA 4FLFA 4QNNA 3H17A 3V1KA 3W06A 2HA4A 2PSHA 4ITVA 1WPRA 1XROA 3AIMA 1UXOA 4BP8A 1UOQA 4CCYB 2JBWA 2WUGA 3O4JA 5DWDA 1MX1A 1Q0ZA 1SC9A 2WM2A 1C7IA 4G8DA 1AURA 4G1FA 2HA0A 2VT6A 3I6MA 1G4HA 5JATA 3MGAA 2QM0A 3D4LA 1E8NA 3STXA 4RE6A 3GUUA 2Y2UA 1HLGA 3YASA 3D0KA 2WKWA 2X8BA 3F97A 2WJ6A 2HL6A 2HFJA 3W2TA 5DYYA 3DL4A 1TRHA 1T4MA 5DYWA 1I6WA 3S2ZA 3C5WP 2WHRA 3ESBA 1XRRA 3FLAA 1ODSA 2PPLA 5FKJA 1AC5A 4AO8A 4C6HA 3WL7A 1H2WA 5ALMA 3H2GA 1KU6A 1BU8A 1TKRA 5LZ9A 4Q3LA 1CUZA 3HI4A 3A6ZA 5CRIA 1LBSA 2JGIA 2J3QA 1R9NA 4HRYA 3O9MA 4FFVA 2WIKA 1MNAA 4H7IA 4AB1A 1DT5A 2WJ3A 4I4CA 4X6UA 1BCRA 5A62A 4BC1A 2BUCA 5IVKA 4WY5A 5T4BA 5JD6A 4MEAA 3AIKA 2CUTA 4MQMA 5D6OA 1F6WA 5JAOA 3BWXA 2CKMA 5E2IA 4EBBA 5AK4A 3WKDA 3N2ZB 2ZSHA 5FLKA 1BCSA 4UFPA 5K3FA 5AKKA 5AM1A 2HA6A 3S8YA 3QYJA 5KWIA 1GKKA 2YH2A 1BEEA 2VAXA 4FNMA 4DNQA 4MEBA 5JAUA 1YA8A 2VJDA 3QPCA 2XQGA 4C89A 4HS9A 4N5IX 3U0VA 3K6KA 4FNGA 1OXMA 4AMYA 2HM7A 4RPCA 3ZLVA 2OGTA 3PFCA 1UK9A 1G42A 2PSFA 2B20A 3WK8A 1YR2A 4J0IA 4Y2QA 1CVLA 2H7XA 2XUJA 3RLIA 5CXUA 5K3BA 1N5RA 1WHSA 4K6GA 5ISMA 4RNCA 3WL6A 1P0IA 1BN7A 2XUOA 3AINA 1P0QA 3H1BA 4BAZA 1LLFA 4YK7A 4Q05A 1JFRA 3W04A 4Y2PA 1HDEA 1CUYA 1YAHA 4QA9A 4K5QA 3WK9A 2VA9A 3H2HA 1UWCA 4X00A 2XQIA 4QEKA 1XKLA 4ZXFA 1EXWA 2VF2A 3F67A 1SCKA 1QIFA 3AJAA 3ESCA 5F4ZA 1GZ7A 2XE4A 3CN9A 5ESRA 4DTCA 3QMWA 1VA4A 2PUJA 1H2YA 4MWTA 3DKKA 4C4YA 3EIOA 1XZBA 2WIJA 1P0MA 2H7CA 3T52A 3PE6A 1QGED 4C87A 4XX1A 5SYNA 3DD5A 5AH0A 3L1JA 4C4ZA 2O7RA 1T2NA 4ETWA 2QJWA 2ZYSA 4EY4A 1DX6A 4GLBA 1XRPA 3WJ1A 5JD4A 1F0NA 1MT3A 1XRQA 2J4FA 3KSRA 3FYUC 1LPOA 1IZ8A 3G0DA 2B9VA 3C6ZA 2I03A 3ESAA 4KE9A 5EHXA 5HF5A 1LZLA 2WG1A 2JGFA 4Y2SA 3I2HA 1VKHA 3C6YA 4GWLA 2QKYA 1EVQA 1RWQA 2LIPA 4U2CA 3HACA 1AQLA 3BDIA 1CUWA 2HA5A 3I2JA 1QE3A 5AO9A 3ZV7A 5CT5A 3FAKA 5ALKA 2VATA 1WB6A 4IO0A 4F5ZA 4KAAA 4B0OA 3G02A 4AZ0A 1MTZA 4YASA 5ALLA 3UUFA 4U2EA 5K5EA 4CG2A 4BB0A 4IQ4A 4CG3A 2PSJA 3G8YA 1YCDA 3A70A 3WKCA 5BWCA 1ZD4A 4L3WA 1H2ZA 1PFQA 3L1HA 1UT6A 2CZQA 1B41A 1VLQA 5JZ9A 3H1AA 4H7KA 4MQLA 1CUJA 1YS1X 4QZVA 3STUA 1CPYA 1UOPA 4Y2JA 1AZWA 5HQ3B 5AKXA 4Q3OA 4PSUA 4OB6A 3HXKA 4FHZA 4BVLA 2J3DA 5AHXA 2WUEA 2JIDA 3TGLA 2JF0A 5A7HA 3PFBA 1E5TA 4OB7A 1TIBA 3W05A 2ZJ7A 5CTAA 1U4NA 4LYEA 2WHPB 1XRMA 4KYVA 1ZIXA 1LNSA 4FDMA 1DTEA 3G9ZA 1FSSA 5D3ZA 4AX4A 1K4YA 3HJUA 2JGKA 3GZJA 1E3QA 2G5TA 4WFJA 2V96A 4RE5A 2XUFA 4QDTA 3DJYA 3WWOA 3FYUB 1A8UA 3R3XA 3WWPA 5AI5A 5J3JA 2OPHA 3GROA 1ODTC 1XZLA 1EINA 2PKYX 4F0JA 1IMJA 1EVEA 1FFBA 3V1NA 2QOEA 1ZD3A 4OU4A 4Q1VA 3A2MA 1RYYA 2RAUA 4X7BA 4FFWA 4EY5A 1N5MA 3BIXA 2VAVA 2C4HA 4AXBA 3QITA 4UHFA 4HXGA 2XT0A 1VE6A 3WK5A 2WLSA 3M81A 2QMQA 4OD0A 4BZWA 2DFPA 5AI9A 5AKYA 3HC7A 4NZZA 5HQ3A 5LZ8A 5DLPA 5AOAA 3CCBA 1YAJA 4H18A 2XUAA 3QPDA 2EEPA 1CEXA 1SCIA 1XZHA 3CXUA 4PF1A 4OCZA 1LPMA 2RHWA 3DYIA 4HZGA 1QIKA 1TQHA 4QWWA 2Z3ZA 4GI1A 4CG1A 1Y7HA 2OCKA 5CH3A 5AI0A 3WL5A 4B81A 1DINA 4X91A 4E46A 3BDVA 4NS4A 1CUXA 3K9BA 1AMNA 3WKAA 2GYWA 1VJ5A 1FJ2A 2QVBA 1UKCA 4TVKA 5AKHA 3R3WA 2VSQA 1R1DA 1X2EA 5EI5A 1A8SA 2HA7A 1FFDA 2GZRA 4EUSA 2K2QB 4QDUA 3DEAA 4BAGA 1QO9A 5LP1A 5C8XA 4JYMA 4QDOA 4GDMA 2EDAA 3O4IA 4OUKX 2GBGA 1R4ZA 1ACJA 5LZ2A 4HXFB 5ALTA 3FYTA 2DHEA 3LIIA 4M0EA 1N8SA 4W1RA 2ZVDA 1DWOA 3MUNA 1J2EA 2Z8XA 1FFCA 2GYUA 3F8SA 1XZFA 5HKBA 4B85A 4ROTA 1YSCA 3O9VA 2WHPA 2DHDA 4AZ3A 2WUDA 5AI4A 1QLWA 4J3JA 1XZIA 1MNQA 4I19A 3BJMA 3GBSA 1FFAA 1UFOA 3DKRA 5AK6A 2BAGA 3K2IA 1W1IA 4ARAA 5DNVA 1BRTA 2RIPA 3QBJA 1XFDA 1KU0A 4JUIA 3WQHA 5JD5A 1WM1A 5JAHA 3DNMA 1WCYA 1CUUA 2WHQA 3C70A 3C8HA 1YS2X 1ORWA 1MAAA 1XZDA 4X93A 1R50A 3WZMA 1GGVA 2AJBA 2AJDA 5AKGA 5EIAA 2JGLA 3OTQA 4Y2UA 3V48A 4BRZA 5JZSA 2WTMA 3ICWA 5AOCA 3R0VA 3GELA 1Q83A 4W1PA 5HCUA 4QWMA 4UPDA 5A2GA 2V97A 2WFLB 2YASA 5BOVA 4YPVA 3MVEA 1AGYA 1QFMA 2O2IA 5D7BA 5ALGA 1VA5A 3G0GA 3I1YA 5AKJA 4KRXA 2C0PA 5ALDA 3I2GA 4GECA 2HU8A 1JJFA 2D0DA 3QMVA 4B82A 1UK7A 2OCLA 1EI9A 2Z8ZA 2QJRA 4A5SA 4XJVA 3VJMA 4X6XA 1QIJA 5EHNA 4Y2YA 2BUAA 4DMFA 2ECFA 1LBTA 1W52X 2PSDA 3WA7A 2WFZA 2UZ0A 3AZQA 5LYYA 3ILSA 1HL7A 5ALZA 4BCCA 4X94A 3WJ2A 1K6EA 2CB9A 2OXEA 3AZPA 2HRQA 4BP9A 1TCCA 5CT9A 3PICA 4B84A 5IVDA 4H7FA 1CUGA 4MJ3A 1ZGCA 4UHBA 4DSZA 4UBIA 1K8QA 5EGNA 4BC0A 1SCQA 4KRYA 2HADA 2PSEA 2PBLA 5IKXA 2O2GA 5AP9A 2ACEA 1CUDA 1CFJA 4L9AA 4FLMA 3E1GA 3IVMA 1W76A 1XRNA 3ANTA 4CCYA 3VXKA 4IH4A 4FLEA 4BVKA 4INZA 5ALJA 2HHAA 1DWPA 4U2BA 5JADA 1FFEA 5EHQA 1CUSA 1QTIA 5LIPA 2Y6UA 4J03A 3OURA 1NX9A 5FP0A 3WWEA 2IX9A 1QIDA 1GPNA 2GBCA 5AK3A 4IH9A 2E3JA 2PU5A 2JEZA 2WIFA 4DNFA 3FWHA 3UMJA 3R3VA 1F0PA 1K5PA 2ZYRA 1U65A 4N5HX 3AIOA 2YYSA 4K6KA 1YASA 3VISA 2XQJA 5DTIA 5JYCA 5YASA 3EQ8A 1XQVA 4BATA 2XUIA 5AM2A 3QH4A 3DS8A 3WKEA 1XLVA 4WDRA 1XQXA 3RM3A 3FOBA 1MN6A 4W1QA 2CMFA 4W9RA 4B9AA 5K3DA 3JYHA 1JU4A 1QZ3A 1ZI8A 1BS9A 1L7AA 3ED1A 5KBYA 5CT4A 4OYYA 2XUKA 3DCNA 3ZWQA 5CURA 3DOIA 5AM5A 3QMMA 1K63A 4Q82A 1PJAA 3D59A 2XUHA 2BUBA 3RKSA 2XLCA 3SC2A 3R41A 4B7ZA 4OB8A 3W9BA 1VXOA 5AI6A 4DMKA 3OPMA 4P9NA 1ISPA
chains in the Genus database with same CATH superfamily
1A1SA 1RJEA 2XOKD 4IUCS 2RDMA 4Y6LA 1W34A 5JCZA 4C1BA 3NKVA 1JDBC 4CTJA 4F9GA 2BEWB 2KM1A 4PWYA 1E69A 3WVNA 5AFSA 1NOKA 2QX7A 5FPQA 2OKGA 3VTFA 1DQZA 2Q2QA 4ZQCB 2Y66A 1G1AA 1RI2A 2AT1A 4UUOA 3LXRA 5ESWA 5T4FA 1T8WA 1E2QA 2WSBA 2XKAA 4NDZA 4JBWA 1H5QA 3TNJA 1IBLB 2F90A 1TAHA 2W6OA 4CLRB 1XRSB 3PX2A 5KYTA 1XTJA 2M98A 1J49A 1LQUA 4NYMR 3AVPA 4QPDA 1Q20A 5DHSA 3I6ZA 4I5EA 2A30A 3RC9A 4LI3X 1SHLA 4IOMA 2IK8A 3HL0A 2J07A 5AW5A 1L5KA 2QVZX 3O1LA 1CD5A 1LDNA 3OP4A 4A0GA 2YQ5A 5FUQA 3S81A 4E4TA 4E1VA 4HZUA 2IOYA 1HZZA 2JLRA 4FDUA 4RPJA 2PZEA 4F92B 2FP3A 4JLUA 3WFIA 4EWLA 1NQUA 1E58A 1EAYA 5ALSA 3WG9A 4Q3AA 3B1YA 3U7FB 1NFRA 3ENWA 4MR7A 3GT3A 1RHMA 1ZJZA 3B20A 4ZQIA 5JO0A 1WB9A 2QAGC 2F1KA 3O03A 3PHGA 3M1AA 3PUYA 4UBMA 4IXDA 1E7YA 2WK1A 4UQOA 5E6SB 1ZKDA 5HP4A 1LCIA 1O96A 3GGJA 5BYJA 3SKVA 1COZA 2UUAB 1RHQA 1QIIA 4WA8A 3RUIA 1M1ZA 5IVIA 4Y3UA 1G0OA 1QDEA 3A1UA 2GCEA 2ZSEA 3GBPA 2H1IA 4WWHA 5LKAA 3S8MA 1VECA 4EGQA 3SQDA 2LBPA 2AVNA 1DPGA 5H9VA 2R0QC 4AI6A 3BBPA 2CMHA 5P21A 3V2HA 3WYNA 1C50A 2AG8A 2X0IA 2FPXA 2OK7A 5FUYA 1KL7A 1NLFA 2HH9A 2X5XA 3Q3HA 1PDVA 1IY1A 3QU4A 4DCNA 2H07A 2YOHA 1CV2A 1CG6A 1D09A 3FDZA 4FS3A 1YJAA 2RI6A 2F62A 3COJA 3PNMA 1ZOIA 1ZMTA 4M0UA 4EI2A 1GSIA 2Q2WA 5DHFA 3MEQA 4Z0NA 3RB8A 2AD1A 4XOIA 4YMUA 1ZR4A 4O5OA 2Z5LA 4LF4B 3BK7A 1NBEA 1KI3A 4RK4A 3HKDB 3LUBA 3D0QA 2GK4A 4Y6QA 2RGCA 2BIFA 4V03A 3FWPA 1R0ZA 5EHIA 2PBZA 3TTSA 4D4LA 1P2FA 1NYQA 3OQNA 2QGFA 2RONA 2VQ3A 4E15A 4XVHA 1WKBA 1QG2A 1XHEA 1ZJ5A 1PF7E 2ZUBA 3OOHA 1I9CA 4FGSA 2ZAIA 4R2WA 4LTMA 1Q15A 1OT5A 3QY9A 2GESA 2PUWA 2PKCA 2QN9A 2GCOB 4M9QA 4O4LF 1VGRA 3EQ7A 5IUJC 4QNRA 1KZ4A 4FCVA 5GIPE 5LQDA 1NATA 2IQIA 1H0HA 1ZH0A 2FE1A 4YWHA 4AECA 3RNLA 5KKAA 5B55A 4LVCA 1EVIA 4HXYA 3SYRA 3ZQ6A 2NGRA 2CNOA 1Z13A 1A7AA 1PT7A 4PGAA 4FWIB 5DYNA 2AXEA 3DNPA 3A2KA 5G0WA 4RUKA 4AN4A 1IL0A 3KLPX 1BYIA 2WG0A 1O95A 4AQDA 4IBOA 2R4UA 1QIHA 2NV0A 1AKMA 2ID4A 3L6EA 2RHDA 3H75A 4JYPA 3FGNA 1VPLA 1GCAA 2AJCA 3H9JA 1I5EA 3CPJB 4EGFA 4Q9DA 1G7TA 3RASA 3RHSA 3O4GA 3P0IA 4NIMA 1NYRA 1T5IA 1U9YA 2D5AA 2QORA 4N0PA 3SBXA 4IDDA 3R8CA 2FY8A 5K0GA 1CFZA 3LFTA 3IPRA 1QP4A 3QVTA 1Y9ZA 1H6CA 3THSA 3A1FA 1JMYA 1DMRA 2AFIA 4FZRA 4M7PA 1XZ8A 3EDCA 3BXFA 3FAZA 4FFPA 4W5JA 2HLPA 3EISA 4ENRA 3G2IA 4RTKA 5G02A 4IDGA 4XWOA 2OV1A 4TV8F 4YUVA 1JG7A 4LJ9A 1ODFA 4RTNA 1RVDA 1Z4LA 2A0FA 3TPCA 4TVBA 3WO0A 2MSWA 3TLJA 2C1ZA 1PJCA 4XQCA 3MBOA 3JQ7B 2V58A 3GDOA 4U6NA 4NFSA 2W43A 1DEAA 2M9MA 4UMFA 1BA3A 1ESNA 1JZQA 3SSOA 1SUFA 3H1PA 4J7UA 5BWOA 2BMEA 3I1IA 3EA4A 4JZYA 1EDEA 2BJHA 4M0DA 5E7IA 2XVMA 2JKYA 3ZTTA 2QJOA 3NCHA 4CF5A 3FNEA 4NTZA 3O95A 5E8JA 1C3VA 4DABA 1LPPA 1Z36A 5FO1A 4MP8A 1EP1B 5I4IA 1FS6A 3N59A 2O8CB 1NN1A 4JI8B 3OOWA 2V4ZA 3IT0A 1X70A 3H5WA 4NJEA 3LL7A 5EIEA 3EULA 4LF6B 1U90A 3A25A 1V8BA 2I4LA 1LWOA 3LLUA 4XAQA 1M75A 4EG3A 3QW4B 2HX1A 1MH1A 4L1KA 1L5WA 1FYXA 2BISA 3IIIA 5EJIA 4JB2A 1Z33A 5DYGA 1GU7A 2PVPA 4BKUA 2FVYA 2NXEA 4DMRA 2KPOA 2X22A 3C0KA 2A3RA 2ATIA 3OZIA 2X76A 3ISJA 1A9ZA 2FHPA 2Z98A 3AR5A 1U5BA 4RTMA 4Q19A 3M5PA 3TD2A 1JR4A 1R8JA 4KXUA 4H1WA 3KV3O 3ORYA 5JFTA 4AG5A 1OU0A 3MWDB 1TUIA 2GZMA 2I34A 3N2GB 4G8JA 4QBIA 5LZ7A 4L27A 4NAUA 3J7TA 5D5PA 4E22A 3I2IA 4U3JA 4NABA 4ZHQF 3BXZA 3VOTA 4J3NA 3QVMA 5F52A 1E9BA 1S1MA 3OIFA 4A82A 2ST1A 1KO7A 1R4NA 1VBMA 2RG1A 3HMKA 2WSLA 3N3AC 2ISCA 2KB0A 3P32A 3PEUA 1XWWA 3PQ6A 4D99A 1EXVA 2OCIA 4CI9A 1SXJC 4WNIA 3CVWA 1R3DA 2ZQYA 4ZDJA 3O3MB 1F9AA 1Z9BA 2XNDD 1TJNA 3PF8A 5GJVC 4B3FX 1XV5A 3ZDAA 3F6BX 4O1MA 1FU7A 1BQEA 4H3VA 1YB4A 4Q3NA 4K3VA 3C97A 5KYUA 4E5UA 3X1JA 1P6XA 2YJNA 3VUEA 2BKXA 2IUUA 3RFCA 4ABTA 1YQEA 3QOWA 2NAFA 1RZRA 3JR7A 2JJ1D 2NU7A 3AWIA 3D5EA 4XPIB 1H9AA 4Q34A 4NZNA 2EYUA 3A2LA 1AKYA 4S1PA 3DE3X 4D4JA 3B6MA 5DN6D 1M2EA 2Q4RA 3WAKA 3H4VA 3BGWA 3UYKA 4NZMA 1KE2A 1WUHS 1T9GR 2Q07A 5H1YA 4B45A 2GCPA 4KN6A 4RSHA 4W9MC 1NUQA 2WMOB 1NRXA 1IQ0A 3AR8A 3LD9A 4D9JA 2WUFA 2C2ZA 2C5AA 2GILA 2H1RA 3I6BA 2GEKA 4OH7A 4WFIA 4ZPJA 2HDOA 3MTDA 5BQ3A 4CTNA 3TR0A 4BNXA 2M6RA 1WLSA 4RY8A 1UIRA 1XP8A 4EI8A 1XUOA 3VAYA 2XCIA 4F8JA 2C2YA 2LE0A 3REOA 3E5MA 5T3UA 4MKHA 1AXGA 5GJCA 1N34B 1SM4A 3CINA 1GCOA 4WKOA 3LDAA 2JC3A 3UJCA 1HR0B 2O8NA 2UVDA 5FBVB 3B8EA 3GLIA 3F8TA 2AJLI 5I7EA 1JEYA 4WCDA 1ARZA 2A1IA 2IEAA 3JYPA 3ICOA 3RBXA 1WU7A 1WXHA 1XMXA 2FN3A 4X3CA 5T8KC 1IVYA 5FL3A 4AJ4A 4B5LA 4DSOA 3WB2A 4EVSA 1NM5C 1HYHA 1MJNA 2C4NA 2J9FA 2Q8PA 2WB4A 2Z43A 3DYVA 3F8WA 4JJIA 4Q1CA 5FV7A 4FGWA 4GP7A 1UMKA 2E5LB 4J6EA 3AESA 1J5PA 1K0FA 1L7RA 5KIAA 4OQZA 2A5JA 3RSFA 1HFJA 1GPJA 3CW8X 3WK7A 2ESRA 4OK5A 1GRCA 1HYEA 1ZMXA 2H85A 1L2TA 3KE9A 3OUUA 2ACKA 2DWOA 2EKBA 2NVWA 1IBKB 2XBMA 4LDPA 4HSEA 4YDHB 1J9ZA 3P0RA 1ISGA 1L8AA 3CX4A 3MJ4A 3OEHD 1JL3A 2VDKB 4NNPA 3W6UA 1C7FA 2VJAA 2W2KB 3O2JA 1TMGE 1XZEA 5CD9A 4J0JA 3M1IA 2ZT6A 1OH8A 5E3IA 4NBVA 3V8EA 2DCUA 1KTIA 3DLHA 2REQA 1SIOA 4C3ZA 1S2DA 5C9ZA 2BW0A 2V3WA 3QX3A 1W49A 2ZSDA 5CX1A 5UKDA 1ATIA 1KJNA 3ESDA 3PU6A 4BYMA 5E8RA 1PX2A 4CL0A 4IGFA 2M6LA 3U4MA 1KJIA 1ZL2A 3K9HA 4M88A 1UWKA 2V5AA 3D2AA 4OQPA 1ZSYA 3BBLA 2PEZA 4AG6A 4I4LA 3RVMA 2CDAA 3AB7A 4FMPA 4ZJYA 5SZJA 3WWDA 2AW5A 3E0XA 3AP2A 2P1ZA 2ATEA 3FUTA 5KNDA 2D7CA 3UPDA 1W5AA 2HK6A 1TC1A 2QIOA 2H8GA 4RPGA 3UMFA 1OX4A 5KSYA 1T1SA 3THXB 4BV9A 2CK3A 4GS5A 4JELA 1UKZA 1MOZA 1Z25A 1O9HA 1BMQA 1EB9A 1WSDA 3M5CA 4FXOA 5GONA 1TKCA 3H4IA 2I1QA 3OTHA 3IALA 4MYHA 5J2TF 2Y2VA 4UASA 3R0XA 1RI4A 4JHLA 3ANMA 5AM3A 2ENUA 2HQOA 3ZHVA 5DEIA 1J0CA 2W4MA 1JHDA 4HJXA 1QFZA 4LBYA 3U40A 4DDMA 1AKEA 2IY7A 4UPEA 1QIGA 4WCVA 3HK2A 2QL7A 3BDAA 3NIGB 3P2EA 1LPBB 3R0JA 1TA4A 2DBQA 3WB9A 3FFAA 2CLCX 4IQ0A 4ZEXA 4FFDA 1SB9A 2VLBA 2VJNA 4KPGA 5DGHA 5JG7A 5CB4A 1YZVA 2YHUA 3KTOA 4U02A 4BKOA 4P0PB 3NJ8A 2JS7A 4M9XA 4CIVA 1G8GA 2IIVA 1FVXA 1E61A 1P6QA 1WDTA 1YQWA 3FPEA 3M49A 4OBWA 1WF6A 1JR6A 4IJVA 4M1QA 3PEYA 5HWSA 2WDPA 1AGPA 2FN9A 1G59A 1YHYA 4QXAA 1E3IA 1NGSA 1SHKA 1P1HA 1FRVA 2WF5A 3NHJA 4FS8A 3VHQA 4ARBA 2WWHA 5IAEA 2FUG6 1BGWA 5G4LA 3HCDA 1P3DA 5LVAA 2AYYA 1IOVA 1N5KA 2I55A 1DWQA 3AP3A 3GUZA 3HWWA 3RTGA 4AMGA 3K15A 2B69A 1U98A 4MR9A 4Q02A 5DNUA 4EZIA 2NVBA 1OXBB 3KHTA 2FSUA 2X23A 3WOHA 4DQLA 1QTRA 3GIDA 2HJHA 2XGSA 2C7QA 2ECPA 4BE4A 1XZNA 4BB5A 4F60A 1JLRA 4CTOA 1E5DA 2EGGA 4RD1A 4B7CA 3DH0A 4OAOA 1S7GA 4XIGS 5CH5A 5T64A 4B3CA 2VF5X 3L5KA 4EKIA 3AG5A 2X1HA 2CL7X 3CH4B 3RYFA 3FN4A 4CLEA 3WYGA 3PVZA 1NASA 2YCBA 2XMGA 1YB7A 3D3NA 2PA3A 1KMQA 1UK6A 1Z4PX 3DW1X 5M29A 1UBMS 2FFJA 2XMBA 3QFRA 3R7NA 5JSZB 2V1XA 2ZBDA 4LV8B 4UE3S 3BB3A 4FBMA 4DILA 2R7NA 2W90A 3ZLTA 2MDTA 4AZ0B 4C0LA 4POOA 4RTOA 5J40A 2YXPX 1N5DA 4AJ9A 2QTAA 2YFQA 2ZJ6A 2PGLA 1L5YA 1QH8A 4I4NA 5I47A 1PG2A 1WHTA 3DG9A 2FN7A 1FYDA 1NJ6A 5FL7D 2FCAA 1TI7A 1XLWA 2GZHA 4P80A 1IUPA 1LNZA 3ROFA 1L7QA 3O8OB 4US2R 3COZA 1J07A 4KQKA 1RXYA 3BICA 4MPPA 3QE4A 3Q5EA 2FJUA 3EASA 2PUHA 1F8XA 2F2TA 2IA5A 4K6FA 3GJ0A 4U4AA 3T5CA 3UC5A 2WF6A 1EK2A 1WEKA 1EGQA 4TXNA 3KQVA 3SVTA 2ZM5A 1FP1D 4FB5A 3OWXA 3VPXA 3QKRA 4L0CA 1V16A 1CHNA 1EE9A 1MZVA 2DM6A 2VDVE 5C1DA 2XIJA 4X8MA 3I6YA 4C78A 3D2BA 2HF8A 4B3DA 1QGAA 2WE8A 1VSUA 2AV6A 2PRJA 3WBBA 2XMQA 1CP3A 1R27A 1X7XB 3WRYC 4WJLA 4PQEA 2UZ4A 4P5DA 3AWDA 1SKBA 2WU1A 4IIUA 1QYWA 4DDVA 1MPXA 2NVUA 3CNHA 5JHGB 1PD1A 1TDJA 1UWVA 5FR1A 5JPCA 1XXLA 3K09C 1U0EA 2FFHA 4GEKA 4BZQA 3WBKA 1N5JA 4EA6A 2Z0MA 4ADSG 1DIGA 4DEVA 1T24A 2BGNA 1L4MA 2DZDA 1XAIA 1BC5A 1L4EA 3K05A 1ST3A 4H7HA 5BXYA 5IWCA 1JJBA 3GFBA 4F9EA 1PTKA 1OAKA 3ORSA 4FBLA 5EOVA 3O8RA 1E66A 3DE0X 3HJNA 4P7GA 2J45A 3ZH9B 1DQYA 5AVYA 4MUFA 1UXKA 1S9HA 4ECAA 3CNOA 5FAXA 1R16A 1YHNA 4PC6A 3CW2A 2HU5A 4EDFA 1P81A 4UU7A 3IAFA 1EFAA 5BYKA 5ITZA 2OLJA 1W25A 5FOTA 3GB9A 4I0WB 1UBFA 4D9MA 1G64A 1Y5NA 1NW9B 4BVGA 3NHZA 1HM5A 4C5BA 3DT8A 1DDOA 1EDBA 1Z4QA 1IY8A 3NAZA 2ZWAA 4R8VA 4A6PA 4JXJA 4BLQA 4CM4A 3NBYC 5H0IA 1K5HA 2PQ0A 3R1IA 3CF4A 5DSZA 4LXXA 3RUPA 3IAUA 3RH0A 1PVDA 3REQA 2HPAA 1W30A 2O50A 3OLZA 4LCEA 1N92A 3D5TA 3RHTA 4A0FA 5BQXA 4E5PA 4ROSA 1FNMA 1SA0B 3AP1A 2CV2A 2VXOA 3DC2A 1FL9A 1UR5A 4H59A 2EX1A 3P2JA 4RY9A 4XD2A 3AF2A 1P91A 3LS2A 3E3AA 3ACCA 4N49A 3A6GA 4CM8B 4E13A 1WLYA 2EZ9A 1EFUA 5HIJA 3SHVA 4MYSA 1NN3A 4W5HA 3AF4A 1PVOA 1D6SA 1D7OA 1PR6A 1ZA2A 1ZNXA 1NG9A 3ANXA 2GAIA 4RZHA 2GBPA 5DLQC 1F5NA 1T34A 4HVTA 1AB5A 3EGDA 5HR5A 1K8YB 1KMHA 2GCIA 5CLHA 1P7ZA 2CCKA 1PG0A 3E35A 2EJUA 4QTYA 3PXCX 1SD1A 5AK5A 1FP4B 3I2FA 3V4SA 4PBSA 4IJMA 3SHOA 3UUEA 2VHQA 3K0KA 1EGVB 3K3PA 4HQNA 4W5QA 1TVKB 3E22A 2MSNA 1DQPA 4MWEA 4COOA 2CF6A 1H0SA 4MSUA 1M6NA 1I9GA 2YW2A 2ZWMA 4LEIA 4C7OA 4PCAA 2C1EA 2O5VA 3C1OA 3QVUA 3SQNA 5AIAA 2QSYA 5JISA 1JTVA 4ZGGA 2CLDX 5LLSA 3ZC3A 3Q88A 4MVJE 1QTNA 1WXQA 2PKXA 2P2DA 1T0BA 3H9GA 4V2IA 5CT8A 5KAMA 4F71A 2QNRA 1M8GA 2ORVA 3A1WA 4XW2A 4NHEA 3DLTA 4GBED 1GXSA 4OO3A 4TLLB 4UVEA 2FW9A 1IU9A 3U39A 4MB6A 4LJRA 5LQJA 2Q8QA 1ESZA 1Q0RA 2HLHA 2VG8A 4ZOLA 1GRNA 1LJLA 2FPIB 5FUXA 4IJ6A 4R1MA 2HQRA 2OAEA 4OJQA 1SQ5A 3A1NA 1Q50A 3E7DA 3DM5A 3VSBA 2HEIA 2B99A 3HU2A 3QWBA 4WL0A 2BYTA 4YCCA 3DCJA 5CM9C 3AKYA 3V8VA 5LDGA 2PUEA 2N75A 3M3DA 4JLVA 2IYVA 3LE8A 2FF5A 4EHNA 4BQEA 3ETDA 4FYMA 4WLEA 6REQA 5KO2A 3OU2A 5BW5A 3BRCA 2JHCA 5HOEA 3V1LA 4TZTA 2H92A 1AHNA 1UP7A 3Q9UA 1T8YA 1SXJD 1NXQA 2RH8A 1ISSA 3DE6X 4RORA 3B36A 4RS3A 4JBNA 2COEA 2HFKA 2G04A 3KB1A 1VKJA 1QB7A 2I7XA 2ISSD 2V6IA 4WIAA 2JCVA 3TQIA 4X85A 3LKBA 2DHCA 4KL8S 3HO8A 1RBZA 2CXHA 2E9SA 1DJLA 2HDNB 3L7IA 4O8CA 2XB9A 1ZHFA 2NU6B 4QDJA 4EG7A 1TYCA 1QOZA 3RU3A 4X44A 4TRJA 1DC3A 4D2IA 5CB6A 3I5AA 5JWHA 4BO3A 1ZESA 3DC7A 4RAQA 2JFOA 3ZGLA 4UTNA 1P2UA 2A9FA 1XCBA 1NOJA 4RHTA 2HTEA 1X1DA 2I5PO 2PX4A 5F3RA 1NYTA 2YZNA 2ZUFA 2B0CA 2XCOA 3GJRA 4FHDA 3RVDA 2FJ0A 4HTAA 4QQKA 5A3SA 2FG7C 3G1TA 4RA6B 1WE2A 1Y1KE 1MOPA 1UMBB 3QX8A 1AUOA 4QULA 3KFXA 4QUEA 3SF0A 1E3EA 3K1AA 4BQFA 1CUFA 4WGFA 2OXTA 4AMZA 1YVDA 3IV9A 4MARA 1G6HA 2J5KA 1ODCA 2VNSA 5IH7A 5FXMA 1T6XA 4YLYA 1ITZA 2RJNA 4OGFA 4ZPXA 3RVBA 5DHAA 4V1CB 4QLAA 1U1GA 4A0RA 1XU4A 4YV1A 2VP6A 3L4BC 2CCJA 5KYUB 2P5UA 1ZM3A 4Q3DA 4UFOA 5FAKA 4TSFD 3HFRA 8ADHA 3CKYA 3DL7A 4XWAA 4QVGA 4BAUA 1Y5MA 1P2DA 2ZYIA 1RJFA 1E0JA 3GLSA 1E64A 2MWMA 3B7WA 1J8DA 1FC0A 3BN3A 3PEVA 4NMWA 2DPMA 4YJ2F 3RVNA 1WMBA 4KJXA 4U7PB 2XLBA 5DM70 1LI5A 3HV2A 4AF7A 2QBYA 2Q3LA 1U6KA 5TMEA 2EX0A 5HQTA 3QU5A 1CSEE 4LE1A 2QX6A 2HNAA 4HWKA 4CMBA 1I7LA 5BQOA 1L6IA 8LDHA 1U7TA 3B1ZA 3UAWA 3WHPA 5JROA 3CZ4A 2O0JA 3QTTA 4MRMB 4JLSA 4G0MA 3T7EA 3VZRA 4DIDA 5LQMA 2G6BA 3ESQA 1GR1A 5GOZA 3ZGOA 5TB5A 1EZ4A 1H0RA 1JTEA 2LP4Y 2XUPA 4PO9A 3TFOA 2W2LA 5T4EA 3GGOA 1NVBA 3DV9A 1KDTA 1M7HA 2BH2A 1R6BX 1BDMA 4JAVC 1A8HA 2O06A 4FIDA 2IRWA 4YAJA 5LUAA 5C4GB 5JAHA 2B7LA 3C7KA 1U6JA 2VNKA 3JAKA 3TKYA 2WKSA 9ATCA 1ES9A 2X42A 2V98A 4PZZA 3VGPA 3NYWA 1JHXA 3A9TA 4U2DA 2GYVA 3F7TA 4WN9B 3QHQA 4Y1EA 4OYHA 5BRJA 3IJEB 4G3XA 4MITA 5TMDA 5BMVB 4IZIA 4PCVA 3WGZA 2OO5A 4WMLA 1E2LA 3K31A 4JIGA 5IAOA 1JU3A 1R2QA 2PBFA 1T3SA 1Z2OX 4FM9A 4ALKA 4IIXA 4KVZA 3CSDA 3K0CC 5IYZF 4GR9A 3OIGA 3TI9A 4DNOA 5CYGA 2O8FA 5DCUA 4BCDA 1V16B 2Q0XA 3GOQA 4C0HA 3SE7A 1GZUA 4EY6A 3U9LA 4R8SA 5KQRA 3DMTC 4CM7A 4HYTA 5ICEA 4IV0A 1D8TA 2Q5CA 2P0YA 2DRIA 2VP2A 3QEOA 5CYPA 4ZYUA 2RGRA 5DSXA 5D3MA 2OLEA 2CUNA 5U9CA 1K3UB 1TO1E 3LX6A 1LPNA 3MMZA 1F51E 4U6QA 2NO4A 2E4YA 5EWLA 3V6MA 4QUBA 3X1YA 1QVZA 2CBGA 2R1TA 4BMZA 1O5OA 4GKBA 2CVQA 1A9SA 4R1UA 4DYHA 5EFOA 3KYBA 3EZ2A 3CRQA 4JVLA 3DMGA 3LPAA 2OQVA 3VJKA 2Z5VA 1TVMA 2A88A 4NYIR 5E6SA 5IASA 4KLAA 4ARZB 1GNPA 4P4SA 2EG5A 1UOOA 1FE8A 3H0KA 3PNYA 3AEYA 1D1PA 2Y92A 1J22A 1G21B 2GR9A 2I67A 3GEMA 5K3CA 1PUIA 1XTRA 3TZCA 4F93B 5IPFA 1FJXA 1H22A 1K7YA 2CNBA 5JPIA 2OAQ1 2Q3MA 1GQRA 5HF6A 2H7YA 5ALYA 1QHSA 1SUBA 1P4RA 4UQLA 3RARA 4QYMA 2WMYA 2DQYA 1II9A 1HZJA 2XWJI 3M4ZA 4JXZA 5B7GA 3HA7A 2JJ1A 3LCRA 3P9KA 4DPLA 5KTTA 1D04A 1V41E 1VIVA 3MCWA 4IFBA 5DMXA 4YMLA 1HGXA 1MC5A 3TOVA 1O57A 5HZGA 2Q9AA 3OIVA 5FOXA 2XUGA 3OO0A 1QHHB 1QZZA 2CSUA 4J91A 3EIWA 1PDOA 3KAPA 3KR0A 2VBIA 3PWSA 5EP3A 3UM9A 2PPVA 4EIWA 5L9AA 4LHSA 1NI5A 3A6KA 4DV6B 1IBMB 1N8KA 4UHCA 4UZSA 5FNVA 1OXVA 3QPBA 4G8BA 3TXYA 1KH3A 2QUKA 2E55A 3KOXA 4FI3C 4LHEA 4RFVA 3Q5GA 4TL6A 3I62A 1Q6YA 3I5MA 4JA2A 2NZYA 2FWMX 4RSGA 2VT2A 4NCIA 3OJLA 1XQYA 3BK2A 1O2DA 1PQYA 4FCWA 5FTJA 4Z54A 2DQSA 3PXAA 4DIEA 4EY3A 1WW8A 2CXOA 3VVMA 2H06A 3CJQA 3DP9A 4X62B 4BGVA 3GXOA 3GJ6A 1SZDA 5H02A 1UXJA 4YHBA 4Q03A 3STWA 1EX1A 1Z5WA 3AY3A 1E9CA 4JOSA 3WIVA 2BD0A 1K5GA 2HIHA 3O1HB 2BGJA 1CQZA 1TMYA 2CLFB 1PP4A 2A5GA 3JWEA 3T41A 1X8JA 3L7YA 1P80A 3PWZA 3W1WA 1RFGE 3SBEA 3AY6A 5FCDA 1P33A 5FYDA 3UYLA 1FFGA 4B3BA 1E18A 3UW1A 3FROA 3LVBA 1I2BA 5KVQA 1IQRA 1AGXA 1DUIA 1WZCA 2J85A 2Q2NA 1B3RA 1OZHA 4OXIA 4DJFC 1IONA 4B4OA 1ODKA 3WDLA 1ZM7A 2UVPB 3MJFA 3TG8A 2C42A 2BFCA 2OGZA 3ZI7A 4HDMB 4HH1A 4TSKA 4CKCA 2I76A 5F7ZA 2RHJA 1Z28A 4CMEC 2EW8A 4PSCA 4NJEB 1FUEA 2GXQA 3R40A 3EMKA 5KVSA 2W8BA 1IY0A 3K0HA 4PZEA 4B3RB 1R0YA 1F17A 4KFRA 5DM2A 4F9FA 1E2NA 1JB9A 1QMGA 3CLRC 1J5XA 4TROA 2OUIA 3KD2A 5D51S 1YIDA 3NORA 1DO0A 3EC2A 3LDGA 5I7RA 3FYSA 5EHZA 2ZSIA 3VTKA 1M1XB 5FWYA 1NUTA 1MMFB 1XG5A 5KYNA 2Q1WA 1DBQA 1QGDA 2OA0A 3AERA 4BN5A 1I5OA 4BV8A 1YZ3A 3CF2A 1EX6A 1RLOA 3G2MA 4ER5A 3NBXX 5CD1A 5I01A 5AKEA 2GN9A 2IYQA 4I4TB 1H1LB 3GGCA 1CJVC 2EF0A 2QK4A 2VS1A 1IAQA 1TAQA 2HT6A 4Y6PA 3CNQS 1HEUA 3PXGA 4W5TA 3LTNC 4TQAA 1KFBB 1D4OA 3JD3A 3RRFA 3TCKA 1Y3FE 3E2IA 5KHAA 4EJMA 1NQOA 1QR2A 1U4OA 4YAKA 5CB4B 1DCTA 1XFAA 4Y6RA 3CT4A 1H0KA 1R88A 3ME5A 3SI7A 5DH9A 1SJ9A 5AKZA 4DRXA 5K8CA 3FHTA 1MA0A 3NRBA 3QE3A 3VI3B 1N7HA 1L4YA 3O0TA 1CQJA 4XJTA 5LOVB 1L7DA 1QF7A 1UZLA 4YCAA 2ZYVX 2ZVQX 3UH0A 3FGOA 2ZIUB 1YXMA 3PE3A 1W87A 4S1NA 5LBTA 3GEIA 3ZJTA 1GTRA 4HFJA 1NIJA 1Y7LA 1M9NA 1YS9A 2HRZA 3BEDA 4UEJA 3LQFA 1ZK0A 3V34A 3E9EA 2C2GA 3RFFA 2J0VA 4WUVA 2DHQA 3DE5X 1JWAB 2CEKA 1KJYA 1ETHA 2H4ZA 2QU8A 2ZUUA 5ALEA 1DLJA 4MWBA 1W85A 2GBFA 1QCZA 3LXMA 5JNWA 2FRDA 1XAGA 4GX5A 4O4JB 3THWB 2G71A 4I8DA 1AA6A 1K3FA 3AI3A 3VU1A 3CB4A 1QQAA 1YB5A 3NNSA 2H52A 3MXTA 3K0FB 4WT7A 2I6FA 4C0JA 3SWWA 3O82A 1TGYA 3RG2A 3R7SA 1E5VA 4N54A 1TQ8A 1VFPA 2P90A 3K1AB 3KKOA 2HN9A 4HKTA 5L7WA 1YBHA 1JHOA 4JGGA 2FWBA 1NOIA 1TJ5A 4UMEA 1JHQA 1OLUA 4H31A 1KO1A 4UUAA 5A71A 3VR4H 3GCWA 1KMNA 4IEIA 3C3CA 3AYZB 3RSSA 5K8IA 4JITA 1SXPA 4RK6A 4IXTA 3ET5A 2B4KA 3EA0A 3F3KA 3QV2A 3D7MA 2JFNA 2B92A 2YL2A 1R0WA 3N05A 3STTA 2EFYA 3OCWA 2ZIAA 3OJCA 1HORA 3MJSA 1GZHB 5ALPA 2OHXA 1A4UA 2SECE 4DN6A 3M4YA 1WQ3A 4NBKA 4GMHA 4RSRA 3FVRA 5B7NA 5EJFA 1HY3A 3GW8A 1FDIA 4YWJA 1GA1A 4ZZ2A 7GPBA 4DUYB 4ZIRB 2GUWA 4CMIB 4CR7A 3VNSA 5A1JA 3PNBA 1Z7EA 1TU4A 2KX7A 2SKDA 1RKVA 1TU3A 2NTEA 2DPLA 2D62A 4OJYA 3E3NA 4L02A 2GT1A 3AJRA 2IXGA 3GFPA 4HSGA 4D9HA 4V2UA 4D25A 3DBHB 3USZA 2IPXA 4QEZA 1PJZA 1KJZA 4EH1A 5HZKA 4EVIA 5BOSB 1ZGBA 3QIAA 1L4BA 1M34A 3MRTA 4GUAA 1WZUA 4MI3A 1ZGZA 3HJHA 4AZSA 3K4HA 2RH9B 4MI9A 2PWAA 4S05A 4KFCA 4AKIA 5AMXA 3V1MA 3GAMA 1CULC 1NNEA 3NLLA 2CNNA 1X0VA 1GGJA 3D54D 5AJZA 1P0FA 1Q22A 1QRAA 3PSAA 3GK3A 3QPVA 3ZWXA 1N3BA 5B2FA 3D1LA 2BDEA 2D0OB 3FE2A 1ZJ4A 2QVXX 4HBZA 2QMOA 2UYYA 3OZFA 3WFJA 1CVIA 1O6GA 1GU0A 2P9JA 2Z2XA 4YAEA 1EA5A 4QQ8A 4LGVA 4OQMA 3A3YA 3UXMA 4OXKA 2YJZA 3WLKX 5JWRA 2PT6A 3NC0C 5BSRA 3BRQA 4N5MA 1Y8ZA 4IIEA 1PEAA 3N75A 3IDZA 5I8WA 2XCRB 2DSTA 5A4MS 1MJGM 3T3OA 1QJ4A 2GA9A 4NI5A 2QD1A 1NC1A 4L16A 2WUWE 1HSZA 1NDUA 2QVLA 2HMUA 3IDSA 3IH5A 3OJXA 4I5GA 3BHNA 4KX3A 4NOLA 4TTRA 1U0TA 4G9BA 2FMXA 3D6NB 4RPKA 5BYBA 5FX2A 2Y93A 3BFPA 5B6IA 3H87A 5TGTA 4G4JA 3K1ZA 5FWXA 3ZV6A 1JFVA 2RGUA 5DSTA 5DTEA 2X1LA 4IHJB 4G5GA 5E4JA 3U7JA 4NFLA 2JGMA 2RD2A 1E2FA 4D9GA 3NB0A 2BM1A 4JA0A 1I4DD 4BNZA 4B5KA 1JQEA 1SHTX 1XD2B 2GRAA 3HR7A 2CVHA 2Y1KA 2ZSBA 4JMLA 1SVMA 4QPJC 1UIMA 3Q0TA 4H3SA 1E96A 2NZUG 4MPDA 3FSGD 1Q1EA 3GAAA 3FNBA 3PGXA 1F8GA 2VPXA 3MMPA 1DJMA 3PF9A 3TRDA 3ZWNA 4N0EA 2FXVA 5FORA 4OSEA 3C3WA 4FLFA 1E0SA 3C5CA 4R2JA 3IDQA 4LN1A 2HA4A 1N2JA 1XMSA 1IVSA 1FXWA 2ZWIA 3ADPA 1XROA 1LA2A 5LD2B 3BE6A 3NBKA 2XB8A 5JJ5A 1DBVO 2XE8A 4M55A 3L0DA 4HDMA 4BP8A 3VHLB 4BHTA 5BORA 3H1GA 1PX0A 1SQFA 2QVCA 2B1JA 2VZEA 2UAGA 2WUGA 3BM5A 3ELWA 4L07A 4TRRA 4YC7A 3TM5A 1RAIA 5CEEA 4G0OA 1SC9A 2WM2A 3AEXA 4TS4A 4UEWA 3OM9A 3HKEB 3ANYB 3RVSA 4Y9TA 3RYHA 1AURA 1OX4B 2RK6A 4L8GA 2FLKA 4MR9B 4NRDA 5F7XA 4G1FA 4X6LA 3S1AA 3OMXA 2VT6A 4LQLA 3SDSA 1JAHA 5DFAA 1VBFA 1G4HA 2Z56A 1X1TA 1NKVA 3Q12A 1KFJB 2XOEA 2QM0A 2PT7A 4RV9A 2JHFA 1M2GA 4YLEA 1OBHA 4D41A 4FYIA 4B32A 3IVRA 2LCFA 2XQVA 3B1WA 4K6MA 4EMBA 2O9JA 2I65A 3AR6A 1TW3A 5KQGA 3UMSA 1SUSA 4BNTA 1U8XX 5FD8A 1JR3A 3YASA 3P0FA 4EMSA 3U61B 1P2VA 3FCSB 3KQNA 2ZE6A 1YONA 5LB4A 4RMGA 4FXPA 1E94E 1T9AA 2AE1A 2BBOA 2IBMA 4DLKA 2FNAA 2JKVA 2CMDA 3AR3A 4D6YA 3S7ZA 5JSZA 1DIHA 5AVJA 5JBNA 3JSXA 5IFLA 2JGDA 5A5GA 4XWTA 4GKAA 3NT5A 1B8VA 2RHGB 2ENWA 5DYWA 3HY6A 4YUZA 4R2LA 4JI3B 3GFGA 2HBQA 3DFMA 2CLSA 5KDLA 3QV1A 4QD3A 3JRNA 4R31A 5GVRA 3C5WP 2E4ZA 1FUIA 4B4UA 2X3YA 1XRRA 1FSPA 3BB4A 2Q5LA 4EVQA 3MTQA 4DHWA 2COKA 3BIJA 4TYQA 4UDNA 3RV4A 4JT8A 4CKBA 3TAHA 2X7HA 2VHVA 1E4EA 5JC8A 1G18A 1H2WA 3H5TA 5KNCD 3PEWA 3MTAA 1EM8A 2ZR9A 1KNQA 4YAIA 2D1YA 2FPPB 4NH4A 3R5JA 3AQIA 6NULA 3G88A 4HNTA 1KU6A 1XHFA 1NLYA 1TKRA 1KYTA 1R64A 2MYUA 2ZVPX 2ORWA 5JDCA 4CEHA 3BXOA 3VYWA 4ZI7F 5JNTA 2GETA 9LDTA 1CUZA 1UBOS 3WR5A 2ECKA 4P35A 4ZT3A 1JDJA 2JGIA 3UOWA 3DBIA 2Y1CA 2J3QA 2PEYA 2QB5A 3ZCQA 4E70A 4ZYZA 3D1VA 2F9LA 3O9MA 2OGWA 1IEVA 4LHZA 4QFCA 4BIIA 5GWXA 2WIKA 3UV3A 3MPOA 3OWHA 4R8RA 1RZRD 3TNFA 1OZ0A 1DPFA 4P7KA 4YS6A 2POCA 4P22A 2H18A 2BTOA 3I39X 2QN8A 3W7AA 1OLSA 4ZRNA 1Y63A 4AB1A 3BMNB 3EIEA 1G63A 4N0QA 4IRXA 4PGMA 4OI1A 4X6UA 2VVTA 3CBQA 3Q15C 3MS4A 4ND6A 4RA6A 1U7OA 1IC6A 1OAOC 4IFTA 3TTXA 1YKFA 1XVAA 1LD3A 1NZJA 2PIDA 3JQAD 3RK0A 2ZAYA 3SE0A 1KI6B 4MUBA 4ENUA 1LLQA 1MOSA 3WB0A 4L57A 1XK6A 4ED9A 2DPHA 3UBTA 2PMKA 1C8LA 3D2LA 4M1OA 2H1WA 3ZCSA 4LRXA 2NTNA 3EODA 3WGJA 4CQJA 3GCXA 5JD6A 2Q7DA 1LY1A 1XI2A 1AO0A 4KQ6A 3QTBA 5L53A 5AJXA 2QYSA 1VHTA 4AK9A 3IL2A 1LWNA 2J5XA 2Y1XA 2WF9A 5MN6A 5E2IA 4BMYA 4JD5A 4D56A 1PE0A 3N2ZB 3U80A 1JSLA 2ZSHA 1JN0A 4AZWA 2CW5A 4P4SB 3I9KA 3PJDA 2I71A 4PQYA 1U3WA 5DGDA 2JK1A 5CJJA 2I4MA 4C21A 2FMFA 2ODNA 2PRYA 4YRLA 1OLUB 1L5NA 4Y9UA 1SURA 5FI5A 1GPDG 3AFGA 4X63A 4QU8A 5AKKA 3M6IA 2VQDA 3A8TA 3DUFB 3C3YA 4MWDA 4S35A 4K9MA 3HKCA 5HG0A 1C3LA 2BFWA 5IT0A 2CV1A 5IT5A 2R97A 2J8ZA 1RQ7A 5CIWA 3EMDA 4LPSA 3WGMA 3ZOZA 4B2PA 3RYCB 1Z6QA 1G16A 1HE2A 1NSFA 2ZR7A 3Q0IA 3QWHA 3MNFA 3Q0EA 4II2A 4LKRA 5IBPA 2X5NA 4FW9A 3F4LA 4MEBA 3SD7A 5JAUA 1QHHA 3HP1A 4KTTE 1IPHA 2QR2A 3QPCA 3KVNA 2PUDA 2VWGA 1GARA 2ID9A 4C89A 4QICA 3MA0A 4HS9A 3U0VA 3A1EA 2YX1A 1KBOA 1ZN8A 1OXMA 4Z9YA 2CLLB 3H97A 4ZI7B 1Q91A 1X80A 3K0BA 3HBJA 3RNOA 1UJCA 3TW0A 3Q7IA 3CUSA 1KHTA 1N6KA 2OGTA 4JLOA 2BKEA 1E7QA 5EEHA 1SBHA 1F38A 1G42A 1LBIA 2GN1A 2VRCD 2CVFA 2YIVX 3IHKA 3PQ3A 3T1NA 2VEDA 4QGFA 3R6GA 1NP6A 5HRUA 1YR2A 2O8BA 3PFFA 3FGZA 1BFKA 3T0IA 1KY3A 1K98A 1JQ3A 1G8YA 2VJKA 1UC9A 3L0ZA 2YXLA 2XITA 2VP0A 3E58A 1MG5A 3I0ZA 3NHFA 4L2IB 4N0MA 5E38A 3GLFA 5EZ5A 1F2TA 3UK2A 1OXSC 4HDAA 1TYEB 2P91A 3H9BA 1QHFA 5K3BA 1N0VC 4RK1A 2ZDHA 2CLMB 5A03A 1FRQA 4IR7A 1ZLXA 3TG2A 4LQDA 3U4HA 4K40A 2V74B 1WHSA 2QL6A 2ON6A 2R8EA 3OJEA 2AC7A 3CRVA 2Z57A 4TYYA 3WL6A 2VDQB 1EIWA 1VPEA 3M2PA 4TUYA 2XUOA 4KR9A 1P0QA 4FEGA 2YVKA 4LUCA 4XDGA 3NALA 4FEEA 3ZCPA 2JAUA 1G38A 4KXYA 3L8HA 4Q05A 1KZ9A 1JFRA 2H51A 2J31A 3L02A 5H59A 3W04A 3B7GA 1HDEA 5JVDF 4IMJB 3VH1A 3DZKA 1XX6A 2ZDGA 4BNLA 1U3FA 3NVMB 3IP6A 3CPHA 1UWCA 2G70A 2XXAA 1USKA 2B7BA 2QENA 1U3TA 3NTQA 4J0EA 2XQIA 4EPXA 3RFXA 5C8YF 4N40A 4D3YA 4NOKA 3GPDG 1YMQA 4MW5A 3R23A 3FDFA 4PY2A 4ZXFA 3OE1A 5C34B 2IH5A 2H9AA 2LD4A 2AMVA 4GPTA 4IP0A 2Y68A 1OBCA 2YMLA 4G63A 4RVNA 4YUWA 3DOEA 5FEMA 2CLEB 2ZT8A 5F4ZA 5EZQA 1RHJA 1UMDA 2ZVJA 1E1QA 3LH5A 2X5JO 2DTDA 3GDFA 1ABFA 3IPCA 1N2HA 1OXKB 5ESRA 3OOYA 2P2GA 2WZBA 3NYRA 4DTCA 5L4NA 3RRMA 2JAWA 1H66A 3E9RA 3L41A 4YXWD 4AYTA 3L8MA 3JSAA 1G0NA 1DRUA 3SDBA 2P1RA 3FOFC 4IFIA 1HO3A 1PWEA 1XCOA 3FHLA 3FJ1A 1ZZGA 1RWVA 4UTXA 4PZDA 3KLMX 2XUZA 4WK0B 1CNMA 2WIJA 4HNVA 1CZUA 1GFSA 3IJ5A 2CC2A 1EP9A 4CE6A 4KC0A 3R5XA 4DLAA 1MC4A 3PUKA 2DWQA 2I4NA 4EG6A 2V55B 3GA5A 4ZJUA 3DZDA 4XX1A 3CO5A 4I8IA 4KXMA 4F72A 5AH0A 3L1JA 4FCCA 3BIFA 4C4ZA 4ETWA 4GOMD 1B93A 4CLOA 4UM7A 2QJWA 3IOCA 2M2IA 3OT1A 5BR1A 5HRAA 1RBMA 4BKMA 2KI5A 1A8IA 1L9XA 4TKVB 3I73A 2EZUA 2GF2A 1XKQA 5HM8A 1U7PA 5DB4A 3EVNA 4RZXA 3CURA 1AUPA 2L42A 4LHWA 4MV3A 2JI4A 3K1JA 1XRPA 1YRWA 3KLBA 3WJ1A 1COWD 5JD4A 3IQXA 1JDPA 2QZJA 4YFVA 4TZ6A 2I99A 4HS4A 3ORHA 2GZ3A 2UV8A 4NPCA 1DELA 1MT3A 3TI7A 1XRQA 1N9GA 1DHTA 2J4FA 1U9CA 1ESMA 3CH6A 4HFNA 1ZINA 2ACWA 4KWCA 3A4NA 1JWLA 1JECA 3UMBA 2IX3A 2IHZA 5A4FS 1NULA 3L04A 3FYUC 5E1OA 4DUGD 3C6ZA 4YN3A 3STHA 1FBNA 4R9VA 4DCSA 4PQFA 4WXHA 5EHXA 1F60A 4FWTA 2QTVA 4IIJF 1LZLA 5FPTA 2XMPA 2WG1A 2JGFA 3O2NA 4EFNA 2ZGVA 4YV7A 4D9IA 3EDMA 1IPFA 2EATA 3C6YA 1NJ1A 3SSNA 2WP0A 1TIKA 2Z2IA 1GM5A 2DUMA 1RWQA 1OHHA 4U2CA 2CJXA 1Q1QA 4TT3D 3HACA 3KTAA 1N2CA 3IBCA 4E21A 1W4AA 5DTQA 4NICA 4RVFA 2AZDA 2XW6A 3IEPA 1NRIA 5IW8A 3S2GA 2AG0A 3VKHA 3I2JA 4DUZB 1QE3A 3V1TC 3WNDA 1JR3E 1F0KA 5CT5A 4BB6A 5F98A 2WTUA 3MN1A 1ESCA 5ALKA 2ATVA 2R8ZA 1VHDA 4MUMA 4KAAA 1ZVQA 2CY0A 2WWGA 4Y18A 5L95A 2NU9A 2OOSA 3IR6A 5D86A 1NMQA 3H5VA 2VSFA 4AZ0A 1SG0A 1WPQA 3NWBA 3WQBA 4ND3A 1JIQA 1PFYA 2X13A 3WGVA 1C41A 2A94A 5ALLA 5U4XA 1TYDE 2YJGA 1D2HA 4U2EA 2GQ0A 5K5EA 4L8VA 1NF9A 3F0TA 1FW6A 4BB0A 4IQ4A 4LRSB 1ZJYA 4DDKA 4D5GA 4Z4IA 5C8YB 2AH5A 1FNNA 1P5FA 3E9YA 4WJZA 5EZYA 5I3ZA 3KBBA 5K0BA 4BVBA 4DB4A 3A70A 4ENTA 1RQGA 2YNMD 1SQ6A 3H1EA 4L5BA 5J2TB 4IMPA 3VR2A 5BWCA 1OQAA 1S4QA 4DLSA 1SK9A 1DE0A 2J4DA 3MMXA 3ZIAA 4WD3A 3LWBA 2B30A 5AXAA 2AN1A 3VYTB 4RELA 2JHPA 1TTQB 5TEVA 4ONEA 4DV3B 3JV7A 1NDHA 3OCXA 4Q5IA 1T5LA 3AVUA 4RU1A 2JDID 2EL7A 3BGVA 1YFKA 1UT6A 2FEMA 2EHJA 4BU1A 4GZLA 4ZVMA 1IN4A 3IP1A 5IT9A 1W93A 3PC2A 3CC8A 2OB1A 2GLUA 1G5IA 4F6CA 4YRZA 4JKIA 1CUJA 3QHPA 1DUSA 2EBFX 2IHYA 4JLJA 4XFJA 1LLDA 1BE1A 1CK4A 1KFCB 2BI7A 2Z2YA 4ZYTA 5JI2E 4DZTA 2H5LA 5JSHA 4FVTA 1PTJA 1W0JA 5IULC 4JJ4A 1UOPA 1ZW6A 2JFYA 5HQ3B 2BHSA 4KIFA 4JFAA 4FHZA 1DLIA 4J16A 2F4VB 5A0VA 1JLMA 1ACMA 3KT6A 2PGNA 3N2EA 4AKEA 4RZQA 3CJTA 1EBBA 1M74A 3ZHXA 1WULS 3DHYA 3LC2O 2WJHA 4JLAA 4RCYA 1TIBA 2HMYB 2CZCA 1Q77A 4YCLA 5AVUA 4Z53A 3LU1A 4OFXA 4QOJA 1U4NA 1SXGA 4LYEA 2WHPB 5CTAA 1KQFA 2NUBA 1Z7GA 4XGKA 1NPDA 4AWBA 3OF5A 3TX2A 1IM8A 4QJIA 4B4KA 3A1DA 3TCXB 4WOCA 1FSSA 3T1QA 1M34E 3QXJA 2GZ2A 5KJ6A 1UQTA 4FFBA 3IAAA 3W5CA 3TRKA 2YWHA 4I1VA 3GZJA 4DS3A 4EUEA 2ODEA 1E3QA 3O92A 3UWDA 3VSEA 2W6PA 1OYWA 3FPCA 4UHJA 5KYWA 5JSUA 1WSAA 2E4WA 1MLDA 1NA5A 2ZIEA 3PSHA 4FYPA 4Q47A 4WFJA 5IARA 4P3KA 2V96A 3ZHSA 1VLZA 4P4UA 3DD1A 2P4UA 5FA5A 4DR6B 1ZU5A 1EFRA 2CD9A 4GVXA 3RSZA 1KRWA 3OP1A 1G2PA 4MDHA 3RS4A 5A4KA 4ZU1X 3B3AA 4EYEA 4DM3A 4WEQA 1ISMA 5KTKA 4LF5B 2B98A 2IEGA 4OTZA 2ZR0A 3U9TA 4A9AA 1DJPA 2DETA 1GIAA 1KOFA 3GROA 5DI3A 3CY6A 1EINA 2AHRA 2PKYX 2A1UB 1T5SA 3RF7A 4LMAA 3ND8A 5IAAA 4LOJA 2G40A 1EVEA 3OZWA 1FFBA 3NXSA 1LVHA 3ZQ4A 5CFPA 4ZDWA 1UZMA 2ZRPA 4QPZA 2QOEA 1ZD3A 2H54A 2ZJ1A 3C7TA 2X0FA 1YVRA 1XTBA 1RZVA 3V7NA 5CBPA 1RYYA 3U7QA 1E5QA 2OHJA 1AUXA 1UMCB 2RAUA 1TT7A 4AT1A 3RIMA 2GN6A 1JHVA 1MVOA 1M8KA 4EY5A 3EPKA 3QSGA 1NBWB 4KDCA 2CBXA 2VAVA 3WLFA 1FOEB 3P71T 1T1EA 4PX2A 3VR3D 5DHQA 4K2HA 2DGDA 2OXRA 5CDTA 1EQAA 1N8TA 2X4IA 2HBRA 1X1QA 1JIKA 3HYTA 4L8FA 4X0EA 3W8EA 2FEPA 3S55A 3DFZA 1UC4B 4UHFA 2I4OA 1VE6A 1O0BA 1Z4NA 2R6DA 3PFWO 2L17A 4EHAA 3ITDA 3ELBA 1E6UA 1NI4B 3H2YA 3TZBA 3UPTA 4URFA 2V9CA 1XNHA 4QQRA 4HLUA 3U13A 2FQXA 1MEOA 1TJ4A 3EFHA 3HB7A 4UUMA 1BDHA 3O8QA 3BMQA 5I8ZA 2Y0EA 3DZIA 2ACVA 3JVIA 4E5VA 5GQSA 4N6GA 2XYGA 3M3PA 1P31A 4GC5A 1CDEA 1QZUA 2J0UA 4HRVA 5IZCC 1GZ4A 2CXUA 2X77A 3EJWA 2O57A 1QQTA 1THZA 5KHLB 3QPDA 5JEDA 5CNMA 1CEXA 1FFHA 1K8RA 1RWXA 1SCIA 1KZ1A 2NPFA 4A2QA 3USES 1ZVJA 5AVSA 1A5ZA 2O2DA 3JQQA 5A5EA 1ILEA 4AQ7A 4Z0PA 5EWJB 1WXGA 1VJDA 2GEUA 4PF1A 3ZYCA 4Q7EA 1JFLA 1Z18A 4R0VA 2WYOA 1HC7A 1X7YB 4MW0A 5IJXA 2P2NA 4ND7A 1LPMA 2Q0SA 4DV7B 5DK4A 4G97A 2ZEJA 3W9YA 1KK3A 3N1UA 2WPNA 4HQFA 4N6NA 4OHUA 5TVKA 1KETA 4DCJA 1YUMA 3JQBA 4F1WA 4HZGA 4IILA 3GJQA 1VLVA 4Z1OA 1RXCA 4QWWA 2LPMA 4IDNA 1BOOA 1CF9A 1G9XA 2CYCA 1P4HA 1VPDA 2HWXA 1ISHA 3QF4B 4V0SA 4ETMA 5E9QA 1NAHA 2V9PA 4REQA 3VX3A 3A9RA 4DJDC 4CXMA 4BXOA 2J6BA 3WNZA 4BLTA 2PH1A 3FOWA 4KYUA 1JEJA 5AI0A 1Y8QB 3TTTA 4B81A 4J75A 2NUPA 3QUCA 4MV6A 4BMOB 5HXAA 3QG1A 1NQWA 3OM1A 2CSXA 5FYQA 1EESA 2B4YA 2IDZA 2IZ5A 2FP4A 4JI4B 4NS4A 4U39A 1CUXA 1H3NA 1QCYA 2PFSA 3DKIA 4P3PA 4Q16A 3SM9A 2R86A 3ZVLA 3CUTA 2J3EA 4A2PA 3R3WA 1GYQA 3HM2A 4QIHA 4EB6B 3DOUA 3IQWA 2FPGB 1KTVA 2FDRA 2W6IA 4MH0R 5DLYA 3GOHA 3GMSA 4TMTA 1US8B 4JT2A 1KSJA 3M8KA 2P41A 5EQFA 3KWLA 2CDBA 3ETJA 1FFDA 1GLGA 2V7QA 1ORHA 4G37A 2W4IA 3TL3A 4W9NA 1NR5A 2FPOA 3O3NB 4B46A 3CHYA 4Q24A 4EUSA 3A26A 1Z06A 1D3AA 2JFQA 5FLEX 4PPQA 3VR6A 4TRMA 2RK4A 3AI7A 3GRCA 4R9RA 2C4UA 1E0KA 1AY0A 1X6VA 3E9ZA 2VYQA 4IJ5A 4R16A 1KMCA 1WSBA 3H99A 4YRKA 1HKUA 1Z38A 1C9YA 1G8KA 2UVPA 3ANLA 4PC3A 4RVHA 3S40A 4DW8A 5H4HA 2Q2OA 1PIWA 3AEZA 4OUKX 1PNRA 1R4ZA 2W58A 4HNHA 3RJZA 1B6SA 3EPJA 1XEXA 2WHXA 1L7XA 3N76A 2FMHA 1C7RA 3PLNA 3BXGA 4JX9A 1HNNA 1NC3A 4YJHB 3NM5A 2BEWA 4IDCA 2YRXA 3FZNA 3ITEA 3FZGA 1TE2A 2FOXA 4J43A 1V5IA 3OCZA 3VSDA 1WMEA 2XNCA 1LUAA 2ZVDA 3VR6D 3EDRA 3F6CA 1J2EA 1XQ9A 3O73A 5COQA 3SN6A 4AXXA 3WTBA 2FRDC 3EBOA 3DL0A 4OBXA 5IJZA 1M1YE 2XE6A 1XRJA 1Z5NA 3SIWA 1R6XA 4BNUA 1QYCA 2FW0A 1J1ZA 1KORA 1WW2A 2PD3A 1K9VF 4B85A 4HTFA 2QMHA 3JASB 1I6LA 1DAEA 5AXCA 4CYMA 4ROTA 1KIMA 1YH3A 3FB1A 3U31A 1QF6A 1AQ6A 3DULA 1XTKA 1U8TA 3N6RA 4NC9A 1HEIA 3EHEA 3O9VA 2Q1TA 3EIHA 2WHPA 3OY2A 2WM8A 3HUTA 5LC1A 4TV8A 4AZ3A 5B7QA 3L7BA 5AI4A 1X7XA 4OA5A 4HN2A 4P7JA 5E7QA 3SYMA 1TUGA 4U8HA 4AJIA 1M2VA 3RSGA 3T9CA 3FFTA 2GVDC 3LI2A 2FSVC 1AN0A 3LXUX 3EC1A 1JX6A 3GBSA 2FPPA 3O4VA 1RKQA 4OLAA 1RWBA 4RY2A 3CZCA 1IATA 3DKRA 1FNCA 3RIGA 1E59A 4BTEA 4GF5A 4KO8A 2VDLB 1KR5A 1W1IA 2BMAA 4PRZA 4QQFA 4RF2A 4ARAA 4CBVA 3Q2OA 1A2QA 2RIPA 3QBJA 3U5ZB 1NDQA 2F9MA 4X45A 3SEAA 1KU0A 5ERYA 3GRVA 4JUIA 3WQHA 1U99A 5AWFC 5KUTA 4JLKA 2I6UA 1ENZA 3DNMA 2WJVA 1NW7A 2RHRA 1FSGA 3A6LA 1CUUA 2WHQA 3DTTA 3SM3A 3WLEA 3TS1A 1MAAA 5CA1F 4DM4A 4QFMA 1U1DA 4QRDA 4X93A 5AVXA 3ERCA 4DR1B 3W2EA 1I01A 5J4LA 3GLGB 1KYWA 2FUEA 4PG7A 1X9GA 4B8YA 2RI1A 2H4YA 1VI5A 2AJDA 3Q7EA 1QAOA 3G2OA 4YCMA 3M5WA 1UM9B 2JJMA 3WYBA 3OTQA 1QP8A 2FWJA 4Y2UA 1VCMA 1Y34E 3I9OA 3RRNA 3RV3A 1ULZA 2WTMA 2PANA 3O8DA 3C98A 1SQ0A 4OP3A 4DLLA 1HZZC 3R0VA 3KJQA 3A9VA 4MW1A 1V11A 1KZGB 1U31A 4J1QA 5EI5A 4F91B 1J8FA 3ES9A 1Q83A 1FMTA 1F6DA 1ECPA 4QWMA 4PYOA 4B3SB 3PHLA 4XD7D 3E1SA 4FFBB 4DAOA 4C6TB 1JH8A 2P4EA 3JTEA 1RKUA 1ONBA 3IKLA 1GTG1 1JE1A 1Y3BE 4IJWA 5BOVA 3AF3A 4UXJA 1RKBA 3DEKA 3GEDA 4CEJA 2NPOA 4NYJR 1VIDA 4ZIRA 2C20A 2ZUTA 16PKA 4MUIA 1SBYA 1VQ1A 2WD8A 1ZWKA 3B9BA 5KNBA 3G0GA 2FR8C 1EFPB 3I1YA 5AKJA 4DA4A 4LBZA 2CLOB 4L22A 4B1FA 2NWQA 3I2GA 4GECA 3QMVA 1JJFA 1Z56C 5HOQA 5KU1A 1UK7A 4GDFA 3FM9A 1ZNWA 4P81A 1Q7BA 4ACBA 4QOGA 4A5SA 1WIWA 2RHHA 4MB2A 3VJMA 1XJCA 4PO8A 3T3PB 1FP2A 3F71A 4X6XA 3U5TA 4TXMA 2Y8EA 4J7XA 5IMBA 2BUAA 2JATA 3HYLA 2A0WA 2XF8A 1CR0A 3B8HA 1YJ5A 3K4PA 3NEJA 3DDCA 4WA7A 5EP4A 3T5MA 1OUMA 5F78A 3QLUC 1WUTA 1W5FA 3CCFA 1YR3A 3HY4A 2V7BA 2AE2A 3I4LA 1FYWA 4HDRB 4NLLA 2RAPA 5FPSA 3VDMA 4HYYA 4WZAB 1GDTA 3IESA 2R68A 1BHO1 1GSAA 2H17A 4BQPA 1RJ9A 3KZVA 3IXQA 3HO1A 1TCVA 3A3PA 2DECA 1D03A 4NFYA 4LNAA 3IVCA 3NVAA 3HU3A 4FP9A 5ALZA 4HWRA 4BO4A 1F12A 4P3OA 4NBLA 1SD5A 1OFTA 5DM0A 4OFBA 2EQBA 4QVIA 2E1RA 1NLMA 5F2KA 3QVJA 4ZT7A 1P1BA 4FJ0A 1VCNA 1GN9A 1FW8A 4BXOB 1SEVA 4EUKA 2HBYA 2FEAA 1RACA 3LCJA 4NHOA 2G0AA 2VXYA 4XSGA 2GXAA 4Q18A 5JTUA 3Q7RA 1AG9A 1DI0A 1NVMB 2CVOA 2OXEA 3C16C 1E2JA 2J6CA 1OD6A 3QVXA 3VYRB 1DQSA 2V0GA 1XZQA 4MGYR 1ZCZA 4BP9A 1VB5A 5K0LA 2YWCA 4TKUB 5G3YA 3I3OA 1TADA 4QHTA 1UBTS 1YI8A 3LVRE 2UZ1A 3PICA 4NV0A 1DQNA 5JJKA 3AU9A 1S3SA 1O77A 4LG1A 5KQLA 2R44A 1P7YA 3CZ9A 1O95C 1PQPA 4MJ3A 1K7FB 4LY3A 3BERA 4TYPA 1OBVA 5EXXA 3CWZA 3H5IA 3I9FA 3AL0C 1CR2A 2LDXA 4Q9HA 1PWYE 4I1RA 2CZGA 1K8QA 1UPXA 4MQUA 4CLDA 3G8BA 4BC0A 3ECCA 3L18A 2X8LA 2DUNA 2G77B 1PJ4A 3M4JA 3VKUA 4E33A 3OLWA 2D1FA 2PSEA 3AYXB 3B3FA 1NNSA 3VYSB 3AVWA 1QKIA 2CNDA 2O2GA 3CZPA 2OHFA 5J9FA 3TW8B 1XDDA 1OKKD 3GQBB 4AVYA 1ZGHA 4L9AA 4YJKA 4N1AA 1VHJA 4J94A 5A4JA 4AUKA 4DPMA 4DV1B 2DXIA 1K8ZB 1CEQA 1YBVA 4OI4A 3EVZA 1XRNA 3ANTA 4CCYA 1O08A 1YGPA 4YJ2B 2BFFB 2XNJA 1ULBA 2GLXA 3SF8A 5CLFA 3J81k 4PYMA 3W6PA 1H5UA 4EJSB 3EXAA 4Q1FA 3MWDA 1Y8RA 4QXPA 5E0OA 4PQGA 5EHQA 1QTIA 2HKIA 1TM5E 5K4AA 3HXMA 1LTQA 3C8ZA 3EWAA 4FT2A 1Y3CE 3FFBA 1VGQA 4BASA 1CETA 3ZD9A 5BWNA 1YE3A 2J9YB 2KYRA 3I6IA 3O7WA 2EFDB 3OURA 3AHHA 1XA0A 2VDRB 2AR9A 3T15A 1I13A 4E12A 4YPFA 4CT0A 3WIEA 3TEFA 5DHUA 2Q1UA 2DE0X 3VJRA 1BW9A 1SBCA 1T8RA 2EBUA 2VQFB 1THMA 1N2GA 1PHPA 2V7EA 2NVOA 3JY6A 4IJQA 4UPVA 2AKAB 4F84A 1KY2A 4IVQA 3O83A 2VYND 5FNZA 2YY7A 4YECA 2D06A 1L7VC 2R2GA 3GLVA 4ZVKA 1CY8A 2ZBUA 2E3JA 3FMFA 2BI4A 3BZBA 2JEZA 3H3XA 1Q11A 2OORA 4OY3A 3LUJA 2ODAA 5K05A 1DTWB 5JQGF 4DNFA 2WDZA 4OP2A 3N07A 3N2LA 4XPIA 1USVA 2QM7A 3EXG2 1K5PA 2X41A 2KHZA 4WLFA 2H4WA 4BKRA 3ABIA 1W36C 1U65A 2AK3A 2QAGA 4FFNA 3E8SA 4HMOA 4QDKA 1A04A 2R751 2OOKA 4K6KA 1T29A 5FOWA 3OLQA 3WGTA 1BVUA 3ZZ1A 4Y9DA 3K73O 4DCVA 3FSJX 5H82A 5FTMA 4FW8A 1C14A 3EQ8A 1OE0A 1RRFA 1XQVA 4YAFA 1SIUA 2OFWA 4H17A 4IEFB 3ZU6A 4G1UC 5HIMA 2L19A 3FZEA 1AMOA 3QQ5A 1E4EB 3E0QA 4Q6WA 4QXRA 4PHTA 4BVFA 3NDIA 1L4GA 3KQLA 1U2RA 1J56A 2R79A 3COSA 3OESA 2EYQA 3RRZA 1PJ3A 3WL4A 3DE2X 3ELDA 2FOIA 1XQXA 2W2NA 1LDEA 3FOBA 2XTZA