1SCKA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetone
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
256
structure length
256
Chain Sequence
b'AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-acetone-cyanohydrin lyase
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 99
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sckA00
3CCBA 4QA9A 3E4DA 4BRZA 5DYTA 3R3YA 1XRNA 1LNSA 1Z68A 1CUDA 1SCIA 2XQIA 3PE6A 4RNCA 3M3DA 2PL5A 5JYCA 2ZJFA 4FBMA 3WA7A 1J2EA 1MX5A 3WK5A 1E8NA 5JAUA 1CUEA 5ALGA 2OCLA 1J1IA 3ZPXA 3B3QA 1P0PA 2HA3A 4BVJA 3GBSA 4AO7A 3C87A 5AJHA 1QLWA 3V1NA 5LZ4A 3WKEA 2VT6A 2Y6VA 2I78A 4B7ZA 4E14A 4GHWA 3QITA 4CCYA 1O6GA 5ALFA 1HKHA 1HL7A 5T4BA 3V1MA 2VT7A 2I03A 1BEEA 3WWEA 2DHCA 1ODSA 2C7BA 4H77A 2ORYA 4BC1A 1TK3A 3GZJA 4H7JA 4XJVA 5AKYA 1R1DA 4GLBA 4J0DA 1YSCA 2JGJA 3STTA 4MWTA 3A70A 5A2GA 1YASA 5JAHA 1A8SA 2OCGA 2WUDA 3AIMA 4JEIA 4AZ0A 3EIOA 4UHFA 2GYUA 3EBLA 2JIDA 5F4ZA 1MAHA 4KE6A 5AK3A 2CB9A 5AHXA 5IH7A 1N8SA 3OC0A 2ECFA 4B84A 3I1YA 1VA5A 1QTIA 3K9BA 4UBLA 4G1FA 3ANTA 4M0FA 4Y2VA 2WJ4A 2NW6A 2DQYA 5K3DA 4OUKX 3BJMA 1D07A 3O95A 3QVMA 1ACJA 4P93A 5ALDA 3TRDA 2EDCA 1RP1A 4S0XA 1QIIA 5LKAA 4MXDA 3G0GA 1MX9A 3IURA 2HIHA 3FVTA 4QEKA 2HL6A 1TCCA 5CT6A 3AZPA 1QTRA 5C8XA 3IUJA 3G9UA 4IH1A 4GBGA 1F8UA 4X95A 3S2ZA 2PM8A 3L1JA 1XZAA 2VJCA 3BIWA 1YB7A 1I6WA 4AMZA 5LZ5A 5IVDA 2CJPA 5AIAA 2JEZA 2J4CA 1C4XA 5AM1A 5FP0A 5IVIA 4J3JA 5CT9A 4N5IX 1MN6A 2OQIA 3WK9A 4MEBA 1CIJA 1T4MA 4NVRA 2PSEA 3QPAA 1BU8A 3WMRA 5BWCA 4TVKA 3AIKA 5EIHA 4QNNA 2R8BA 5JZSA 4OYYA 3C6YA 3FYUA 1TQHA 2OXEA 4Y9SA 2O2IA 2Y2UA 3HXKA 4P92A 4BATA 3STYA 3FWHA 2PUJA 4WDRA 2WHQA 1QFSA 4HS9A 4J0CA 5J3JA 5IVKA 4WY5A 5AICA 4HAIA 4JH0A 3R3WA 3WZLA 1ISPA 5AKIA 1H2XA 1XRRA 3KD2A 3WL8A 4V2IA 2H7YA 3PICA 1CPYA 3IUMA 1UKCA 4KE8A 3W06A 3O4JA 3RM3A 4B9EA 3RKSA 4WJLA 4BTLA 4O08A 2WILA 3IBTA 5AI0A 5CMLA 4Y2QA 4A16A 3BIXA 4AO8A 3GUUA 2B20A 4FKBA 3A2LA 1ZGCA 1JFRA 3GROA 1F6WA 2WHRA 2ZSHA 4F0JA 3ESBA 4PO3X 3WWOA 4UBOA 3QH4A 5YASA 4FFVA 1CUCA 5E4JA 4X90A 4KE9A 5AKGA 2WJ3A 1ZD4A 4C87A 3H1AA 2HFJA 4YX9A 4KE7A 2HU8A 3HYSA 2VAVA 2CKMA 2ZVDA 2WTMA 1A8UA 1VJ5A 2HU5A 1PFQA 1ZI8A 2IITA 4N5HX 4DSAA 2HA2A 4Q82A 3WIOA 4EB0A 5HK8A 2WFZA 5ALVA 4YK7A 5E2IA 3C6BA 2DCMA 5DYYA 2XUDA 3HC7A 3TGLA 2DHEA 5DWDA 1MAAA 1UOOA 4BAUA 4E11A 1VXOA 5LLSA 1OILA 4H7KA 4AXBA 2ZYIA 2W6CX 1BS9A 4ITVA 3G02A 4HZGA 4U2CA 2G63A 2D5LA 3PUHA 5FOQA 3IIIA 4RE6A 3G0DA 5CTAA 4J0HA 5ALHA 3H2JA 2WIGA 3TEJA 2V96A 3RLIA 1CUUA 1THTA 1WPRA 1P0MA 1IZ8A 3BF7A 3AJAA 3R40A 2GYVA 2Z3ZA 4K2AA 3M83A 1NU6A 3W05A 5FDFA 1YAJA 3DQZA 4Y2UA 2AJLI 5ALOA 3JWEA 1RYYA 4AQDA 1G66A 1G4HA 4UFOA 2XMDA 2K2QB 1X2EA 2H1IA 4FMPA 4K5QA 2BGNA 4H35A 2PUHA 5ISMA 1DTEA 5A6VA 1PV1A 3HABA 1MO2A 4CCWA 1VLQA 2YXPX 2PSDA 2WKWA 1JU4A 2WM2A 4KYVA 2YASA 3C5VA 1N1MA 4OU4A 3KOOA 2XMBA 5IVHA 1IUPA 1XLVA 3VXKA 2JEYA 3BDIA 2XE4A 5AK5A 3B5EA 1BE0A 4UBMA 1FSSA 2XQJA 2ONCA 4QDTA 5AI8A 4MYDA 3I2HA 4FFWA 3FSGD 1NU8A 4HXEB 4UBKA 2XUAA 4J0JA 2E3JA 2Y2VA 2OAGA 3S8YA 1EB8A 2BUBA 3IUQA 1LBSA 2O7VA 5AKXA 5CH8A 4UHBA 1THGA 1XQWA 1GKLA 1KU6A 1C7JA 3A6ZA 3FBWA 3LS2A 1SFRA 4G4GA 3F67A 2PBLA 4EBBA 1VZ3A 1XZMA 3I28A 2GZSA 1CEXA 4DMHA 5C81A 5JD6A 2OCKA 3OURA 5DTJA 4X93A 4HXFB 3QBJA 3CN7A 2W22A 4Y2YA 1BN6A 1W52X 3NWOA 5H3HA 4EZIA 4JNCA 2XUOA 3Q0TA 4ARBA 2DQZA 1ODTC 3BXPA 5I9IA 3HACA 4F5ZA 1AC5A 2VQ6A 4GXNA 3WK4A 1DX4A 4WDQA 3QMMA 1QIDA 3W9UA 3BDVA 2WQZA 3G7NA 4BE9A 2C0QA 2HA6A 4LYEA 2CMFA 3DD5A 3GFFA 3RARA 3UUEA 1T2NA 2RHTA 3LLCA 1ODCA 1O6FA 5CW2A 1H2WA 5ALNA 4FBLA 5DTIA 3B12A 4PSCA 2V9ZA 1GKKA 1CR6A 3ZV7A 1CVLA 4CG1A 2QZPA 1Q83A 1WPXA 5DLPA 1JT2A 3HJUA 2QRUA 3WJ2A 3DYVA 4QDZA 1S8OA 1MX1A 4CG2A 5AM3A 2IIVA 1R4ZA 2OPHA 3IVMA 3DEAA 3PUIA 2O2GA 2JGMA 2WTNA 4IQ4A 4I3FA 4QWMA 4IO0A 4ROTA 1Q84A 4OSEA 1F0PA 1A88A 5T4FA 2QOEA 2UZ0A 1J07A 5AI9A 3L1HA 5JARA 3D2AA 4NS4A 3D5EA 4X85A 5LKRA 4U2EA 4Q3LA 4AO6A 1E5TA 2P8SA 1R88A 2X5XA 4C4YA 4IH9A 3I2FA 1A8QA 3ICWA 2WSLA 2OLEA 3KWJA 3EF3A 3D0KA 3FCYA 2Z3WA 3F98A 4L9AA 4EY8A 1LPOA 3C8DA 3PF8A 1UOPA 2BUCA 3V1KA 4DGQA 4X6YA 5ALWA 3D7RA 1XQVA 5K3EA 4CIBA 1UK7A 3ILSA 3FLBA 3LIPA 4PF1A 2FX5A 4KJXA 4C88A 3WLAA 5EGNA 3R3ZA 2XUHA 1YB6A 3U0VA 3WZMA 1GPNA 2ZJ6A 3FYUB 1ZOIA 3ZI7A 2DR0A 1VKHA 5ALTA 3QMWA 5CT4A 1YR2A 3G0IA 3LIIA 4G5XA 1ZJ4A 1XQYA 2R11A 4J0GA 4FLFA 2QUAA 3BF8A 3E3AA 4BRSA 4FHZA 3G0BA 1OCEA 4ZRDA 1AKNA 4X91A 4DYHA 1DQYA 2O7RA 5CXUA 1ZJ5A 2CUTA 4OB8A 4DSZA 3V1LA 1LZKA 5JZBA 2QVBA 4X94A 1AX9A 5K3AA 3BL8A 1XLUA 3AFIA 5JZ9A 4HRYA 5LZ7A 2VSQA 5A7HA 1UWCA 1B6GA 3D2CA 1EINA 1XKLA 1Q0RA 4MQMA 1N5RA 3HZOA 4MYSA 4BZWA 4H18A 2JGEA 2QJRA 3ANSA 4FWBA 4KRYA 4PNZA 3C45A 1LBTA 1GGVA 1AURA 3IULA 3SX4A 4W1RA 4NZZA 4XVCA 3EQ8A 4YASA 1XZIA 5FV4A 4BVLA 1XZEA 4C6HA 5CH5A 5C8ZA 4DMFA 4Y2PA 5HKAA 4DTCA 4F60A 4B6GA 3C5WP 3E0XA 5I7UA 1QIGA 1BN7A 2PKYX 2WUFA 2HRQA 3F8SA 1QO9A 4I4CA 5AKEA 4X92A 5JASA 2C5FA 5AI6A 2GBFA 2JBWA 5ALPA 2BUAA 1QIEA 2YH2A 4P08A 4LYDA 3VKFA 4DIUA 2ZYHA 2ROQA 1TCBA 1LPBB 4AX4A 2AXEA 2XMRA 3PFCA 5ALYA 4FTWA 1QGED 4RPCA 4FLMA 4Y2SA 4H7IA 2HM7A 5LZ2A 5KREA 1LPSA 4OPMA 3RK4A 1LPAB 1GQRA 4OB6A 2ZSIA 5ALXA 1EA5A 5AOBA 3JW8A 2GBIA 1GZ7A 1YCDA 4Y7DA 2PU7A 1U4NA 2HDWA 5HFNA 1W4LA 5D3KA 2HFKA 4KRXA 1SCQA 5HF6A 4G4IA 2WU3A 4OU5A 2ZYSA 2V98A 1FFAA 2IX9A 5AKLA 3WWCA 1DWPA 4ZWNA 2CBGA 1UK6A 1B41A 3W9BA 2QUBA 2WJ6A 2QXTA 5DNWA 4BAGA 3FLEA 4LXIA 3K2IA 1EHYA 1QIHA 3R3UA 4DNOA 4WFIA 3G9TA 3MGAA 2XDWA 2WG0A 2WUEA 5SYMA 2GZRA 2PSJA 6YASA 4DMKA 1EH5A 3C6XA 1CUIA 5ALZA 1MNAA 3I2JA 4A5SA 3WKBA 2GYWA 5SYNA 4Q34A 3ESDA 1KU0A 4G9EA 2EDAA 5CXXA 3A2NA 1F0NA 4BDSA 1WHTA 1DWQA 3QPDA 1LGYA 3NUZA 1CUHA 4M0MA 3BJRA 1XQXA 2XUGA 4DMCA 1X70A 4L72A 4WFKA 3AZQA 5ALUA 3DL4A 1XZBA 4JYMA 1YAHA 3STVA 1TIBA 5HF8A 3WJ1A 3WWDA 3H18A 1YS1X 1OXMA 3LP5A 4DNPA 1L7RA 2PSFA 3H2IA 4BCDA 4X6XA 3ZWQA 5EI5A 4JUIA 3FYUC 3STXA 3OPMA 2BFNA 4Y2TA 4QWWA 3FNBA 5HK9A 4K6HA 4FOLA 1QFMA 3AIOA 3T4UA 4X7BA 2OGZA 2XLCA 1WOMA 5FPPA 4X6UA 5KWJA 3HSSA 4LIPD 5T4EA 5JADA 2XQGA 3OG9A 1TKRA 2XQFA 3I6ZA 4DLNA 1VE6A 1K5PA 2C0PA 1DINA 3M81A 1W75A 1JKMA 2WG2A 4BE4A 3F97A 3I1IA 1EVEA 1CUXA 4ARAA 4C89A 3F96A 5A7GA 1K6EA 3UMJA 4BB0A 2WG1A 5D6OA 2C4HA 5AM5A 3H1BA 4W1QA 3FSGA 2BAGA 4UHEA 1U8EA 3DYIA 3WIBA 4N8DA 2XUPA 3Q8WA 2XQKA 4IHAA 4EUSA 5D3ZA 1K63A 4HRXA 3TJMA 2VJDA 2WIDA 2YYSA 5ALMA 3I2GA 5JANA 5LZ9A 5DJ5A 3C8HA 4GDMA 1XZKA 4WCVA 2RONA 4C4ZA 2VJBA 1J06A 4LXHA 1ZI6A 2OQVA 3WA6A 4Y2RA 4WFJA 3WKAA 3HEAA 3I2IA 4PSUA 3VVMA 3HLKA 4GEGA 2BGRA 4BZZA 1LPMA 1CUAA 5LP1A 3FCXA 3NGMA 4E46A 4G8CA 2XUKA 5FRDA 2QJWA 4Y2JA 1CQWA 3PI6A 1LPNA 2Z8XA 2D0DA 5FKJA 4BVKA 4PV7A 1ZGBA 2H7XA 1VOTA 3FYTA 4B83A 1ORWA 3DOHA 5DNUA 2EEPA 4B0PA 5HF5A 3WWPA 2FUKA 1SC9A 5A71A 5ALLA 1C7IA 5HCUA 4G4JA 4GW3A 5AM0A 4IH4A 3G8YA 1EVQA 4QZVA 1XZCA 3ZLUA 1EDDA 4TPKA 2QXUA 3VVLA 2QTBA 5KWIA 5BOVA 4YPVA 4J7AA 1U2EA 1FFEA 2G4LA 4HVTA 2ACEA 4G8DA 4XIIA 3SWWA 2Y1KA 1HBJA 1VZ2A 3ZLVA 1LZLA 3WL6A 3ED1A 3WYNA 1ACLA 5AIBA 1XZFA 1BCSA 4P9NA 4EHBA 2ZJ7A 2HA4A 4B82A 1CUJA 2CZQA 5IKXA 1XRPA 1R9NA 1CUFA 5ALEA 3KDAA 1IZ7A 3QZUA 1E8DA 5HKBA 3N2ZB 5HFAA 1GPLA 1XZHA 2J4FA 2AJBA 2XI4A 4CG3A 1ZD3A 3QMVA 4E15A 4LHEA 4FNMA 4W1SA 3HI4A 3AUKA 1UT6A 2VAXA 4A23A 1P0IA 2QKYA 4LXGA 3D2BA 1QIKA 1CLEA 4PW0A 5BWBA 2DSNA 5AKJA 3OOSA 4G8BA 3WK8A 4ETWA 2ACKA 5D7BA 3DLTA 4B85A 2AJDA 4MEAA 1DQZA 1SOMA 5KBYA 4B0OA 1UOQA 3O9VA 5K3FB 1XZGA 1WB5A 3PF9A 1CUSA 3V9AA 5CBKA 3ZLTA 5A7FA 4EY6A 1MTZA 5E4YA 1TAHA 1ZIYA 5ALJA 4GWLA 2OCIA 1K4YA 1XROA 5A62A 1EK2A 3OM8A 1QIMA 4F21A 1XRQA 2XLBA 4RE5A 2VATA 5AO9A 2QM0A 1CRLA 3NOXA 4KAAA 2JGFA 2JGKA 2ZYRA 1FFCA 4KACA 2BCEA 2OGSA 1FFDA 5HQ3A 4X97A 3STUA 3MVEA 3LCRA 2AJ8A 3O0DA 2B4KA 2FJ0A 3VISA 4BP8A 3C6ZA 1E89A 3K6KA 2LIPA 3ICVA 4CI9A 5JIBA 1XRMA 4EY5A 4KAFA 3WL7A 4W9RA 1FFBA 3D59A 1KEZA 1HPLA 4FLEA 1JMKC 4D9JA 2QS9A 2X76A 5FLKA 1AQLA 1EDEA 5ALSA 5FUMA 4U2DA 1HQDA 2HA5A 3VDXA 1GQSA 2WLSA 2QR5A 2PU5A 1ORVA 2J3DA 4UFPA 2Z5GA 1L7AA 2XUJA 2WIJA 4Y2XA 5AM2A 4M0EA 1EB9A 4H7HA 5AP9A 4MWSA 5K3FA 1BROA 4ZV9A 1UKAA 4X71A 3U1TA 3V48A 2QMQA 3YASA 4MQLA 2VEOA 3IB3A 1ZICA 3DL7A 3WI7A 4BAZA 1CUYA 2PPLA 4W1PA 1XZLA 1XZJA 2RAUA 4XX1A 5CRIA 3JYHA 1NX9A 5FPQA 2XMZA 1BRTA 1EI9A 1AUOA 1W6RA 3EQ7A 5EIEA 4Q3OA 3D3NA 1JMYA 1ZD5A 2XT0A 1LPPA 4U2FA 1HDEA 4BYMA 2XMQA 3DCNA 5T4HA 3CXUA 5LYYA 1CUGA 4ZGBA 1EK1A 2RIPA 2JF0A 4ZXFA 4INZA 4NMWA 5ALRA 1H2ZA 4QLOA 3DS8A 1FJ2A 3KXPA 5EIAA 3M82A 1W76A 1AMNA 1QZ3A 2QT9A 3SC2A 2HHAA 1CQZA 5AOCA 5JD5A 1UK9A 3WKDA 1E66A 4X3CA 4EY4A 1R9MA 1EXWA 4UHDA 2HADA 4OYLA 4B9AA 1UXOA 5AOAA 3WQHA 3CCCA 1IUOA 3O4GA 2XB6A 2GBCA 4BDTA 3PDCA 5HZGA 3H0CA 1WB4A 1YA4A 3HRHA 3DJYA 3DNMA 4QLAA 1CUVA 1JU3A 3KWFA 1DT5A 2O2HA 1K8QA 1XZDA 2HRRA 3O4HA 3WK6A 4OD0A 1A7UA 5AK6A 1TCAA 3DDUA 1G42A 3GA7A 1USWA 3QPCA 2WFLB 1SCKA 1RWQA 3CN9A 1W1IA 5AH0A 4BP9A 3FAKA 3R3VA 1CUBA 2Q0XA 1MU0A 3H2KA 1XFDA 1WM1A 1H22A 1QIFA 3R41A 2X8BA 4B81A 2I3ZA 4GI1A 3MUNA 1QONA 4MJ3A 1GXSA 2C58A 4N8SA 3DKKA 1YS2X 1GPKA 2OGTA 2WU4A 4HXGA 1JJBA 1WB6A 1LLFA 4U2GA 1WHSA 5JAPA 4Z49A 1Q0ZA 3H04A 3KSRA 4UHHA 1CUZA 3WL5A 4KEAA 1G5FA 3QYJA 1QOZA 5K3CA 1TRHA 2HA0A 2RI6A 5K5EA 4BCCA 4ZV7A 4X00A 1EX9A 3WKCA 3I2KA 5I8PA 1H2YA 2PX6A 4I19A 5FXMA 2VF2A 4BCBA 1UFOA 1UK8A 1Y37A 5ALKA 1ZD2P 3G9ZA 3ESAA 4H7FA 5LZ8A 1VE7A 5AKZA 1QIJA 1JI3A 1BEZA 1IVYA 2ES4A 2WFLA 3X3HA 2BJHA 2XMSA 3VJLA 5C7YA 2PSHA 2G5PA 1E8MA 2XUIA 1M33A 4N8EA 1X2BA 2G5TA 4PQEA 4Q1VA 3BE8A 5CT5A 1CV2A 2XUQA 1DT3A 4CFSA 5E4TA 2CEKA 5AKHA 3H19A 3I6YA 5ESRA 4BTVA 1N5MA 4WY8A 1VA4A 3VJKA 2B9VA 4DNFA 4H7EA 4ZI5A 3I6MA 2DHDA 4W63A 1XKTA 4Q05A 5DNVA 3C43A 4QE3A 5HF9A 1E3QA 1ZIXA 4AMYA 5AI4A 3FLAA 5JAOA 4BC0A 4JYPA 4EY7A 2B61A 1P0QA 2HU7A 4QDXA 5EFZA 1CUWA 5AK4A 4H7DA 1VXRA 5DYWA 3OTQA 3BWXA 1H23A 2HA7A 5EHQA 1QE3A 3EQ9A 4XWGA 5ALQA 3IUNA 2WHPB 5CURA 2C5GA 2VTVA 3AZOA 3IA2A 3GELA 4KR0A 4OCZA 2XMCA 4L0CA 3W2TA 3PFBA 4ZREA 2DFPA 3W04A 2V97A 3R0VA 3H2HA 3E1GA 1IUNA 5CH3A 3WK7A 4H0CA 4UPDA 2XUFA 1BCRA 5K3BA 4AN0A 4J03A 1DWOA 4UBIA 5AKKA 4FDMA 4UHCA 1GT6A 4RGYA 1YA8A 2OAEA 1PJAA 5EHXA 3VJMA 2H9YA 3FVRA 4J0IA 4AN1A 3AINA 4UBJA 4UFNA 2VJAA 4PSDA 3T52A 3ESCA 3STWA 2FJPA 2VA9A 2H7CA 2JGLA 1QO7A 2I3DA 1JJFA 3DKRA 5BV7A 3P2MA 2WIFA 3H2GA 3L1IA 3WYDA 1MPXA 2JGIA 1IMJA 5CT8A 1ZI9A 2BKLA 1AGYA 1U65A 4B80A 4TGLA 3R3XA 2XMGA 3O9MA 4AZ3A 4J0KA 5AI5A 1Y7HA 5ALIA 4BBZA 2WUGA 1UKBA 1MNQA 3G9XA 2AJCA 3A2MA 1CFJA 4U2BA 1AZWA 4QDOA 4QDUA 2RHWA 2WHPA 1ETHA 3MUOA 4K6GA 4EA6A 3F9CA 3IDAA 3FOBA 2J3QA 2WFMA 1HLGA 1R3DA 1MJ5A 3AILA 5JATA 5HQ3B 4GECA 4UUQA 5LIPA 1DX6A 4KAJA 4LKOA 4K6KA 1WCYA 5JD4A 3H17A 4CCYB 3N0TA 2WIKA 4Q3KA 5AM4A 3SK0A 3QM1A 1MT3A 4CIAA 4DNQA 1Y7IA 1XRLA 4DM7A 2Y6UA 3C70A 2PVSA 3G0CA 4FNGA 1QJ4A 5JALA 5EHNA 2Z8ZA 4AB1A 1EDBA 4G9GA 4OB7A 1R50A 4UBNA 1UZAA 1XLWA 3UUFA 4C4XA 4L3WA 2OG1A 4C01A 2RGUA 4HTAA 1DU4A 3DOIA 5C8VA 7YASA 2GBGA 3D4LA 1L7QA 1JJIA 5EHZA 3O4IA
chains in the Genus database with same CATH superfamily
1UDAA 2ZB2A 2D3TA 2OK7A 3HGTA 4AVYA 4J8PA 2CK3A 1QORA 2OORC 4MPPA 1XTRA 4BU0A 1HYQA 4BRZA 1YR8A 5DYTA 5LIRA 2HCBA 1EFRA 1K86A 3RSFA 5IKOA 3CVXA 2ZUEA 3KVVA 4IJUA 3ZHQA 3KAJA 1EDOA 1ZVVA 2F1IA 1XVIA 1CUDA 1SCIA 4RTLA 2YHUA 4KTTE 5TF4A 2XQIA 1IHDA 1QK4A 4NBRA 5NLLA 3ZG6A 4IXDA 3EXEA 2DFLA 3PE6A 3LX5A 3B9RA 5DHQA 2I6TA 3UY4A 2ZTSA 1ZRHA 1TM2A 4RD0A 3M3DA 6LDHA 2QAJA 3SG0A 3E4CA 4BB6A 3LFTA 4NENB 1OBFO 3SC4A 5JYCA 5KTSA 1YHZA 4HZUA 1FP2A 4FBMA 1KEUA 4KXLA 1Z5PA 5CBPA 3WA7A 1JPJA 3ANYB 4FJ2A 5JAUA 3VPDA 4UU8A 4RD6A 4ZQGA 3GLKA 4BV8A 1QHEA 2HWYA 4K3VA 3Q1LA 2E0IA 3AKCA 3KLPX 5E3HA 5JI3E 1H69A 2VN8A 5K4AA 3B3QA 4LXQA 4F6RA 4UNRA 2CLOB 1N9GB 2E85A 3GBSA 4NULA 2IW3A 1AKQA 3TTUA 3ICOA 5AJHA 3TLXA 4K9MA 1Y3CE 2H63A 3U4IA 2R4QA 3BHNA 3FLMA 3QOYA 4MVJD 4ZYZA 5BN5A 3H1GA 3WKEA 5CDUA 3AEZA 4Q00A 5FUVA 5LPNA 1BVHA 1IC6A 4B7ZA 3GNSA 4U5XA 1A9TA 4YDHB 4CCYA 1K6XA 3B38A 1N0UA 3P9PA 4JLDA 1HKHA 1HL7A 5ALFA 5T4BA 1DCKA 4QU8A 1FYEA 1TGVA 4IV5A 5LQKA 2VT7A 3IP6A 3UXYA 2NU9A 2DHCA 5TRTA 5JI2E 3EFOA 2ZM6B 3FSRA 3DZBA 2V3WA 1WW3A 4Z9FA 3PWTA 2AV6A 3RCBA 1NLMA 1ESMA 6PFKA 1DAOA 1NUSA 1W8IA 2C94A 3OX1A 3IRUA 2OY0A 1RYFA 4H7JA 4XJVA 5AKYA 3R8XA 4NCBA 3BFPA 1OVGA 4YRFA 2WY2D 1QO0A 1J8YF 1M7GA 1DL5A 2FLVA 3NHBA 3A70A 2YWGA 4LDAA 1I10A 1IY9A 2J0SA 5A2GA 4UE2A 1JR3D 3PYMA 1NDHA 4I7EA 1Z35A 4V0SA 2NUAA 4WTOA 5EP3A 3H8SA 1ELOA 3O73A 4WCFB 5FI0B 3C3XA 5EMNA 2XB2A 4IDPA 2XOKA 1A8SA 1U5BA 3Q85A 1VGRA 1L1QA 2DWCA 4K9LA 3UXMA 1G8FA 3IBFA 2W42A 3ZS8A 2P35A 1LU9A 2V7UA 1KEPA 4B33A 4P83A 1LVGA 2ZREA 4PIPA 4AZ0A 4A6DA 2XKAA 2CLCX 1Z26A 2PD6A 2FGKA 1N2ZA 2NLOA 2XZPA 3EIFA 3L6DA 2P75A 3LLUA 4YALA 3FPCA 2GYUA 4MI9A 5BV2P 3EBLA 2JIDA 3NBFA 1MAHA 4KE6A 2FF7A 1DRWA 1YB2A 4J1QA 3V8MA 4OOEA 4HEQA 3AM1A 4FR0A 3COSA 4KDFA 4WSOA 1KVTA 4BMCA 2PUEA 9MHTA 4IEFB 1QHFA 5JYBA 3G68A 1QF9A 3CEPB 3H42B 4OIMA 3S5UA 3ITNA 4YMGA 3K0SA 1ULUA 4F5DA 1SCBA 3IVXA 4KP7A 2V54A 2J5BA 3BRSA 1SULA 3FDZB 4G1FA 3CVYA 4ZT5A 4B8YA 3ANTA 4M8IA 4P7BA 4RA9B 3E5HA 4M8NE 5BYBA 1B4DA 4B7AA 5E9WA 4S04A 2XGJA 1SMKA 2Z1MA 1IG3A 2ILTA 4LZJA 1D2MA 4MUGA 2Z6AA 1O94D 2CUKA 4K88A 3EGEA 5FR1A 2WB4A 1WMBA 3O95A 1AA9A 2BLLA 4WGFA 1GOTA 3T54A 1ACJA 1YE3A 1F5SA 4JB8A 2H52A 3F3MA 3HCFA 2EDCA 3GV0A 1VHTA 1QIIA 2AEFA 2AG8A 2VF4X 3JQBC 4M9SA 2XTZA 4RKEA 3RIHA 2O1WA 3HCCA 4TSFD 3TBKA 3E23A 3ZQUA 5DM70 2HIHA 2AN1A 1H6DA 1IZ0A 3BEOA 1Z45A 2YQZA 4C21A 1JS1X 3L8ZA 3BGOS 4U9IS 1YQEA 1P77A 5I9MA 2XCLA 4FW8A 3P2EA 5E6SB 4E88A 3ZLJA 4JI0B 2A9OA 5EEHA 5LB4A 3AI7A 1FSZA 2IA5A 2I6SA 4IH1A 1BD4A 4ZD6A 4ZDIA 4X95A 5JDCA 3S2ZA 1ATZA 2I2WA 2WPDA 3NIWA 1KQPA 3L1JA 9GPBA 1IYZA 4WUVA 4ZQIA 3R24A 3OA0A 3BIWA 3M6WA 3GIWA 1RWNA 1Z0IA 4AMZA 1RQ7A 2H1FA 4IILA 3HUDA 1ACMA 4RFSB 1TUEA 2AS0A 2CJPA 1IXSB 1WUJS 1NXXA 1C4XA 4NZPA 5B1DA 3IILA 3VPXA 2XYPA 1HURA 1P62B 2ODAA 3PHJA 4CL3A 3LRTA 4OJNA 1QV7A 5GIPE 5H9VA 1YVEI 2Z04A 3KZMA 3ASUA 2ATXA 4N5IX 4NKRA 2D5IA 1E1NA 1MN6A 2X5JO 3CX4A 3LQ2A 4BVEA 1EHIA 3ETDA 1N0VC 4P6VF 3TCXB 3H05A 1QFXA 3BHIA 2CSXA 2GBLC 2QW8A 3EPJA 4BMDA 1BU8A 4G1MB 3RSOA 3CRVA 4YI3A 3OX3A 3AIKA 3WYEA 2GBPA 3OEWA 5GGXA 1B1CA 3JQ7A 3IPLA 1T0PA 1E6MA 3E2IA 2ZWIA 3PB3A 3SIWA 3Q6NA 3V80A 3K2BA 2H51A 2BFFB 1SJ9A 3DVLA 2EBWA 2GN6A 1QGUB 3LH5A 4TXLA 3THSA 3ZDXB 4Y9SA 1OH7A 4DV0B 3F73A 1G5RA 3GWGA 3PL5A 3GGOA 4A6PA 3KVRA 1SXJE 1DKRA 1NA5A 1P39A 2NACA 3OLVA 4WNAB 2E4WA 1GFSA 4UCXA 5SYNA 5E1MA 1BXGA 1DEOA 2Q5QA 5IM4A 1EXMA 3IQHX 3WMEA 2VDMB 3WHLA 5IVKA 1QSGA 2OYSA 4KX5A 3AG6A 3VQTA 3LPMA 3B1FA 1UJ5A 1TKAA 3IAUA 4WY5A 4DTIA 3LDUA 4KUHA 3LC0A 1DRJA 4H7PA 4EAQA 1VL5A 1UP6A 3NDJA 4XLTA 4EGFA 1T29A 4RKQA 1F1BA 2DF8A 3WZLA 1V6AA 4RVFA 2JFYA 4EW1A 4BNUA 1XRRA 1XDSA 2BEWA 4O4JB 3VNBA 5M04A 1Z7EA 4EJ6A 3JAWB 2GD1O 2FN3A 2WMYA 3AM3A 1C7ZA 3CBQA 3IMCA 4GT1A 1SUDA 4HFJA 1NBWB 4RVNA 3VKHA 4C2UA 1IBMB 1WOYA 2AQKA 2QRNA 5G2OA 1QTNA 1IM5A 1JG2A 3F5MA 3RFTA 4CKYA 2NUTB 3I83A 1YACA 4D25A 4MJ7A 1JN0A 1KWKA 3NAZA 4OHMA 3QE3A 4BTLA 2BI7A 3ONWA 4Z4HA 2QL9A 1USUA 3NIBA 5DGXA 1HDIA 3GWZA 2WILA 1HE8B 2XGOA 5A5FA 3JY6A 1Z74A 1NSYA 5AI0A 2DLNA 1G4AE 3LXRA 2R7NA 4JLWA 3SHVA 8ADHA 5AJWA 1T2UA 4FDVA 2FETA 5JQGB 2AT1A 3C5CA 4I5IA 4I2NA 3GUUA 5EP4A 1VPWA 5ES4B 3H6GA 2EX0A 3BICA 3KHSA 4QOEA 5J59A 4CNQA 2Q3FA 4P2BA 4DQ0A 1NW3A 2A2ZA 3IAFA 5I51A 3TAUA 1JKIA 5DOZA 2JJ8A 4PO3X 3LU1A 2LKCA 2VC2B 4HQ0A 3DEKA 1TEHA 1SK9A 2XWBF 3L07A 2HRDA 5YASA 3NR2A 4IQ0A 5F23A 1G21A 4I5GA 3UWDA 4BRWA 1U8ZA 1SD2A 5J23A 3JARA 2A92A 1K8XB 4FFVA 1ISIA 5E4JA 1OLOA 1CLUA 3A1EA 2WVJA 4KE9A 1X38A 5REQA 5AKGA 2JLQA 1ZCBA 1M54A 2BR3A 1HDYA 1WCXA 3K32A 4MA4A 4MRMA 3O84A 4NZYA 3H1AA 3TD6A 4QJBA 2VPXA 5KWSA 6ABPA 3T7EA 2HFJA 1JSCA 4YX9A 4KE7A 3HYSA 2H1WA 3OOJA 4R1NA 3TQOA 3NANA 2HJHA 2NO4A 4F6LA 2FDRA 2Z9BA 1GUDA 3TVYA 721PA 1QYCA 2IP4A 2HU5A 4DHEA 2BOVA 4URYR 5TQ2A 3LDAA 5CLJA 1R5OA 2R8PA 2XKJE 2DUMA 3R23A 4EA7A 2JD1A 4N9QA 1FP6A 3PL1A 4I0WB 4JCOA 3JQQA 2JIOA 3FB4A 4PICA 4W7HA 3T94A 1C0IA 1L0BA 3KQTA 3O7MA 5HK8A 3SY8A 3M9WA 3OZWA 5EXDA 5ALVA 2D2XA 4MKGA 2CWWA 3W7AA 2J07A 1COZA 3M4XA 5E9JA 3C6BA 4M7WA 3L46A 5IK2D 2JIMA 1JEEA 5DYYA 2FSSA 5FJJA 4YDRA 3IEMA 2CT8A 5J2TB 4A10A 3DVSX 3Q7SA 3IFSA 4RELA 3MMXA 1KDZA 5CVUA 3TW6A 1NV8A 4J49A 2WVHA 3BSFA 3L8DA 1XTUA 4M36A 4RH1A 2DHEA 1EZZA 2ZZKA 2PXAA 3LYAA 1FOEB 2FPKA 3VGJA 3UPTA 3BORA 1UOOA 4E11A 3HH8A 4GMDA 1Q3HA 4H7KA 2X4LA 4OVKA 5CDSA 4YCLA 5HUHA 1WV0A 4HSEA 8AT1A 4C3ZA 5FX2A 2DBZA 1MH9A 1VHWA 4GE0A 5DIFA 3THYB 1MXHA 3HS3A 5HXAA 1RZRA 2K87A 2R7AA 1YVUA 3G02A 1CJBA 3IT3A 3VO1A 1N3LA 3D5TA 4BU1A 1YDGA 4MMYB 5FOQA 4KGVA 4PZCA 3FPAA 4B3HA 2H4ZA 5J2UB 4B76A 4K7JA 4QPZA 1G7CA 3L4BC 5AW4A 1UQUA 3BE6A 3OX2A 3NT4A 1M3SA 2XTNA 2QTVB 2NAPA 4J0HA 1G2IA 1VMKA 3D3JA 4I8IA 5JDCC 1Q5PA 5DB4A 3FYSA 4RETA 4B3TB 3GRPA 2BRUA 1NMZA 3Q7TA 3ZKAA 1WEHA 3QWFA 4IXTA 3RLIA 4C7JA 4F93B 1FX1A 3BWDD 1C2TA 5KSOA 1C30A 4UVHA 2N42A 3RFVA 5CVTA 1YBMA 1KJQA 1R4AA 3A9VA 4KZPA 3VOBA 4RMNA 1I3CA 1L8LA 1V8PA 2PSSA 1ZPDA 4QSHA 1VL8A 4V39A 5ABPA 1Z6QA 4BKUA 1S1CA 5JY1A 2FPOA 3VZCA 1NBEA 2CBZA 4MB2A 3GG9A 2P27A 1F9AA 2CVQA 3E5NA 4L3VA 1U7DA 5CB6A 3FGPA 3VHXA 3QXJA 3C1UA 4C78A 4AS3A 1XTVA 5KU1A 4EG6A 2V7XA 4PRYA 3N76A 2CCKA 4NYMQ 5F9MA 1O8BA 5C53B 1E3TA 1H8HD 1RYHA 4AQDA 3ENKA 3QNMA 4AUMA 3AR3A 2HYIC 4K9KA 5AVUA 4LQDA 1OUMA 1E3EA 1TM3E 2B82A 2D0OB 1ZL0A 2Q0SA 3JALA 3LK7A 2I6UA 4L4XA 4QHTA 2XMDA 3W5JA 5C35A 3R7AA 1KQFA 1K66A 1QGDA 2FGJA 3X1ZA 3GJ7A 2GHRA 2GPNA 5A9TA 1DJLA 2JC3A 2I7CA 3H8JA 3ITEA 1R6BX 3HY3A 4X54A 1JQAA 3HUFA 3BL5A 3I8SA 4TKVB 1NN0A 4WESB 5KCMA 3BAFA 1BC5A 2EFYA 2ZRAA 5G53C 1PJ2A 5ISMA 2P0EA 2Z30A 1QAMA 1DTEA 3PHCA 4IG9A 2QTHA 4XIGS 4EKGA 1RBQA 2G9VA 2C31A 2OVBA 5J9FA 2BD0A 5A6VA 2R1ZA 3BXHA 4LF4B 1MO2A 1Q15A 4CCWA 1UMCB 2FZEA 1BGXT 5D01A 2YXPX 3LECA 3JVEA 2HC9A 1JU4A 2X7HA 1SCNE 4KYVA 4MVJM 2YASA 4R40A 4RXUA 1XWWA 3HDGA 3A1SA 4HLQB 1NSFA 4OU4A 5FL3A 2BGWA 4A27A 1J9EA 1FXUA 2QU7A 3KOOA 4RF4A 4IHJA 3TQRA 3TRJA 3RYCA 3HTXA 4JXZA 1CTQA 3MJ4A 3ND8A 3O4FA 4K03A 1ZAKA 2NZ2A 5FUYA 2GN0A 3AU8A 3IO5A 2X77A 8LDHA 1BE0A 4FI3F 4Z4IA 4TZ6A 2AB0A 3L7MA 4HB3A 4YJ3A 1MO6A 1NF9A 2C95A 5G4KA 1AKTA 3WHIA 4DIEA 3LYHA 3ZOZA 4TKMA 4NWIA 4DLRA 1A9XA 4YVFA 3RAGA 2FP4B 3BK2A 4OMUA 1NLUA 1PVVA 3V7WA 1TJNA 2VDQB 1CY2A 2DQKA 2RJOA 3MOGA 3T7IA 1XPOA 2PTGA 1NYTA 1WSAA 2PUTA 3AVWA 3KRTA 1M0TA 1PS9A 3T1QA 3S8YA 4D8TA 1EB8A 4CGZA 1WZUA 3CF4G 5DGTA 3RC3A 1CSEE 1K0FA 4HT3B 2XXAB 3E2MA 4UU7A 1A95A 3T0IA 3M0EA 3OE7D 4BL5A 5K2OA 4F5YA 1Y1PA 1E4VA 4PHTA 4XSGA 2B1JA 5CH8A 1J21A 2YWBA 4RIHA 2V45A 4UVEA 2R48A 2O8FA 1XQWA 4MUXA 5G40A 1L4FA 3D7NA 5DCLA 3MWYW 3KR2A 4KIJA 1JWLA 1KU6A 5K0TA 1U2RA 3QA3E 1GL6A 1A9PA 4BUJA 1IWPB 4IGKA 4OQYA 4G4GA 1GRNA 1IONA 3BK1A 2H0RA 3DNFA 4N82A 4YN3A 4ZRMA 4LFCB 3SZUA 5H1YA 2OFOA 3ZDDA 2C4VA 2VH1A 1WUKS 3M2TA 1LDGA 1ZJJA 3QKRB 3NP7A 3VU8A 4BX9A 1I1OA 2AFIA 2DR3A 3RHFA 2LPMA 4HFNA 1LS1A 1ZD1A 2ODPA 5IEJA 2NMVA 2WK1A 1T2VA 4EUEA 2O8CB 2X2EA 1SO8A 3ZBTA 4MQ5A 4NV3A 3TECE 5GWXA 5FUBA 2D74A 3L0YA 2XCTB 3NMUF 4WXRA 5EZ5A 3SXPA 4N0DA 3NASA 1ID8A 1MTOA 2Y93A 3DWFA 4O5OA 4PLVA 5JO9A 3U44B 1WULS 3IA7A 4HXFB 2H18A 2FW8A 2INGX 3IIJA 4UTNA 1H2RS 5H3HA 4JJKA 1TYAE 4YMVA 4X1YA 2IU0A 2BFBA 1ND5A 3EGXA 3ZWXA 3X2SA 1A97A 2H65A 1ODTC 4OGKA 1JYEA 2Q1SA 5I9IA 3HACA 1GR0A 1TZ2A 5BQXA 1FW8A 2OENG 4O2AF 1AC5A 2B98A 3HFRA 4UXHA 1CZHA 3TQTA 1AGXA 3PU6A 4Y6OA 1BWRA 3Q0IA 4CF4A 3F4LA 3SBEA 2JL1A 5EPOA 4JYCA 4N3AA 2RHCA 1UXKA 4IDOA 1WLSA 1P8JA 1KO5A 1SZCA 4OXKA 3COPA 4DMLA 4IGFA 1QIDA 2W2KA 1GPBA 1C1DB 4P3PA 1FDOA 1NMSA 3NAGA 3OKCA 3S1LA 2ZIEA 5FI1B 4BO1A 2O8BB 1WUIS 2WQZA 3ZX4A 5F2NA 1A8IA 1HMYA 1HXHA 3E27A 1MENA 1GZVA 3DD5A 4ZVUA 3FXAA 4JQOA 4IXWA 5AVZA 2WM9B 5K8LA 3GYGA 1G8PA 2ISQA 4KQJA 3REFA 4ARVA 3H13A 4LZNA 4DB2A 1XYVA 3K9HA 4EJFA 3B20A 2OXFA 3CX7A 1T2NA 3AEQB 2RHTA 1YFKA 3U81A 1FCJA 1TUIA 2VP0A 2ZYGA 1PV4A 1Y0BA 2NV0A 3MELA 2BRUC 1RYNA 3IHWA 4LX8A 3FYDA 2ZBUA 3I72A 3PC3A 2YWRA 4QPDA 1H2WA 5ALNA 1RAFA 3AQ4A 2DUJA 5DHPA 3UB4A 4KGXA 1QB8A 4N0QA 5BUSA 2C4MA 3ZCTA 5AW8A 1G3QA 3WNBA 1ZBQA 2D1FA 5DTIA 1A76A 1WCWA 1WP9A 3QE2A 4EDHA 2C3OA 1LW7A 3ROEA 3RYHA 4PLCA 3GGCA 3QI7A 1NXQA 5HFJA 2Y1OA 3AP2A 4DA7A 4NE9A 2V3CC 4B46A 1ADCA 1CVLA 4PX9A 5L3QA 5TPWA 1A0OA 1HDZA 4TTPA 4J2OA 4C0AC 3ROKA 3VPHA 3QUBA 3B9QA 1JJVA 3PHHA 1SU7A 4EKNB 5DLPA 2Q1WA 2NNWB 3UXHA 4QQNA 2IYFA 4TYQA 4AWAA 2C7VA 1Y98A 5LD2B 3ERCA 1M34B 4I1VA 2A1TS 3PUYA 2ZIGA 4WNCA 2QQ5A 4GE3A 1JQLB 2P2LA 4NOJA 5KX5A 3IBCA 2DPLA 1BQEA 2GNPA 4HAZA 3ANLA 5ICCA 3QKTA 3IAS6 3S6JA 1EP9A 1O2DA 2CFRA 1EEHA 4GC9A 3QLTA 1JFLA 4JA2A 5K0FA 2F1RA 1N32B 2CXSA 3PQ8A 2BP7A 4RD3A 3PBKA 2EFJA 3CIFA 3FBGA 2O2GA 3PUIA 2O8NA 2WTNA 2A94A 4IQ4A 3RV4A 2FZWA 2QX8A 4MSUA 4JLUA 3EC7A 3LG2A 1BJKA 3EZ9A 4EEXA 2Q3BA 2XVAA 1EDZA 1RQ2A 1J90A 4L1KA 1I4LD 5CLHA 4ROTA 3I6IA 4O5AA 3MJTA 1RLIA 4EHKA 3TQCA 4D42A 3DAFA 3W2GA 3JWJA 5EINA 1A88A 1NYLA 5JNRA 2HZBA 3E3NA 2YVKA 3HVIA 3GBVA 2AR7A 4EHNA 4FD3A 4D41A 1Q1QA 2VRNA 2H06A 3R44A 3D2AA 4NS4A 4RPHA 1JEYA 1ZU5A 4X85A 4N49A 4YRNA 3ACCA 3G7UA 3KSDO 5B5SA 1GPH1 1LK0A 1J33A 4TYNA 1MD9A 1W2WB 3E18A 4AO6A 1P9NA 4QFCA 4JSTA 5IFLA 4DRXA 1H1LA 3GMDA 4YBZA 2DHQA 5JMPA 1U2SA 3QPUA 2PT6A 5BVGA 3SLGA 5IS2A 2X5XA 3PXUA 3QXGA 1ID1A 3EPRA 1HMPA 3HCPA 3PHGA 1CS4C 4IH9A 4FGLA 3X1JA 1Q6YA 1QCCA 2EKPA 3C7KA 1D2EA 4G1CA 4K1LA 4S1OA 4E1BA 4DUZB 3AX6A 2IUTA 1L7BA 2FE1A 3K70C 3GAMA 4OAPA 5GY7A 5T41A 4Q19A 5JJBA 3UT5B 4DRYA 5ICEA 2YXNA 2WNHA 5TE9A 3NNNA 2HDOA 4P5PA 3K0FB 4ALIA 1F6DA 1Z38A 2ZWVA 4KI7A 4BMXA 3PKIA 4B4KA 3KWJA 1QUFA 2V6IA 3D0KA 4EM6A 3PPIA 5CCXA 2AFHA 1XUOA 2ISCA 2W6JA 2DKOA 4REQB 4RY8A 3EXAA 4A2PA 4CT4B 4AKGA 1M6VA 2HWUA 3ZDRA 3NEPX 4WNIA 3F98A 4UVGA 4EITA 5ESXA 4FWIB 3C6KA 4EW3A 1LPOA 1T9HA 4AL4A 3UPUA 5E2BA 4AG5A 5L6MB 4A8JC 4Z8XA 4E3WA 3GJRA 1UC9A 3Q6IA 4US2R 3SEAA 1N2CE 3KJEA 4X6YA 4ZVRA 4RTNA 2JZOA 1SVOA 2QR3A 3CJTA 3VC7A 5DWQA 3VPFA 5FBWB 3NM4A 3NRJA 5LSAA 4HNGA 4CIBA 5LYJB 3FLBA 4N6GA 5LOVF 2X6TA 1UMBA 1XD9A 5I7FA 4ALKA 4JKOA 1AXGA 4HGNA 5E0OA 3RVPA 1E3WA 4BGUA 4NJOA 2BL4A 3EE6A 3WLAA 1LLDA 4PBTA 1GUYA 2WF5A 3OF3A 3RTCA 5GZ3A 1LC0A 1NNUA 1QKKA 1RKXA 3D0RA 1M8GA 1NG1A 1QGAA 4DCUA 3SIRA 5D3QA 4C06A 5A9SB 4X8OA 4QT4A 3ED5A 2QLTA 1YB6A 5DH9A 2GN2A 3ESQA 3L41A 4RLSA 2X0EA 3EUFA 4YV1A 4J0FA 4QXOA 3BOSA 4HK4A 5JXGA 1P5FA 4F11A 1J2TA 1GPNA 1Q74A 4GGPA 2ZB8A 1Z39A 4OL0A 1JV2B 1U8YA 1ZOIA 2B4QA 1POWA 2DWQA 2H3HA 1VKHA 4L07A 3CUSA 3ROMA 4XE5A 4UUBA 1T3GA 9LDBA 3MM4A 3LY5A 3ZU5A 5K4HA 3LY8A 4JBNA 4OA5A 2LW7A 1WF3A 4G5XA 2P3LA 3KM0A 3ROGA 3PXAA 3CS3A 1CETA 1HFJA 3WMGA 4FLFA 4NNJA 4QQ8A 2JJ2A 2QUAA 4ZAVA 4PC2A 4GI5A 3RUHA 2DTEA 3MT8A 2YXDA 2BEUA 4JU9A 4WASA 3AESB 5HM6A 4JLKA 4M0DA 1KJ9A 3MPOA 4C1NA 2V03A 1JA0A 1O96B 4TRJA 4WZZA 3ZU6A 4ZRDA 1Q95A 1FRNA 2IOFK 1P3DA 2FN9A 3BCRA 3EASA 5BXQC 1FNBA 3AUAA 4JBHA 5FWYA 2ZXEA 2O7RA 4HGYA 1VDMA 1W4CA 1WNTA 1XQ6A 4DDWA 1E5QA 2C2KA 4JT4A 4JVMA 3ULKA 5HZHA 1KAHA 2HEGA 1ZLXA 2V3VA 1G0NA 1CEEA 3VR2A 3LBAA 1LSUA 3H7IA 4CUJA 4D9BA 2OZLB 5JY6A 5IWCA 4OQEA 1WXGA 1L4UA 2EBUA 1FTQA 2FWNA 3FTPA 5JAZA 1P3JA 3DBRA 3Q7EA 1Y6RA 1R66A 1EBFA 1QLHA 2P11A 4NPHA 1WCIB 3D6UA 4M87A 1S9DA 2RI0A 2HHHB 1PF7E 4QXQA 3EIHA 2YJ3A 2G08A 3AG5A 2OD7A 5B4UA 5JZ9A 1GSAA 3EA0A 3LW8A 5KTOA 1XQ1A 3EVGA 3T5CA 1L2TA 2QRPA 2QP4A 3G13A 4E70A 2BHRA 2ZJ0A 1N7JA 1B0PA 2Z08A 3KQYA 4PZYA 4F7DA 2H31A 3CJQA 1UWCA 3H1EA 3ZGNA 2OSBA 4ECAA 1RRKA 3NYQA 1B6GA 4ZEMA 3RT1A 3DOEA 1VE9A 4XAQA 1KOGA 1ZW6A 3DBVO 1EINA 3RIXA 3VYRB 4HYQA 1MMFB 1C9EA 1ZCJA 2Y1GA 3BTOA 4Q01A 3FZNA 3U40A 4MYSA 4HAWA 3QA9A 5JHHB 2QQGA 3G8DA 3JYNA 2A14A 2VZEA 4MUIA 3T7SA 2JLXA 2QJRA 5FULA 4FWBA 1DEHA 4LG1A 2QPOA 4F84A 1SRQA 2PRZA 1DCTA 1DTWB 2QT0A 3PFNA 5EWJA 5IG2A 1SWWA 2Q7OE 1GGVA 2FW1A 5B53A 3UJ7A 3QSYA 1BS2A 1AURA 4MYRA 3LC1O 4Y6QA 2P6OA 2NU8A 3V2UA 4HWSA 1N2SA 3ZE1B 4AYTA 2GHTA 1JHPA 3CX6A 1DHRA 4XVCA 2H2IA 3WSWA 3EQ8A 1SHJA 3BXXA 4DW8A 3QVGB 4BLPA 3S68A 4M46A 2YL2A 3UJ6A 3HBAA 1RXCA 3JZDA 4I4NA 3T5BA 2UZ4A 3GLVA 3ZVRA 3T9DA 2BIFA 4Y6GB 1ZBDA 4C6HA 4OQ4A 5CH5A 1MW8X 1G64A 1OT3A 2BMDA 2FPPB 2F3SA 4Y2PA 4PO1A 4C0HA 4DMFA 1K1EA 4B3RB 3M6MD 3PYLA 4V2UA 1GQQA 4P82A 3A8TA 3EMKA 3UMMA 1LI5A 2G83A 4TQ9A 2E1PA 3E0XA 2BW0A 4M6WB 4C30A 1ZC4A 5I7UA 1PVOA 1BN7A 5T8KC 5K6AC 3D81A 5U9CA 1E6EA 1KP9A 3PYXA 4KQEA 1O87A 4I4CA 3DUFB 1H3EA 4QSMA 3UENA 3NCHA 2AOTB 2DFNA 2JD2A 3GJ3A 5KOJA 4M38A 2O2ZA 4XB1A 4XIIA 2MTBA 4DBZA 1IB6A 2WWGA 3IXLA 4EQ6B 3OE1A 1ILEA 1CY0A 4ZOLA 4OYRA 4R1TA 5AI6A 5K8CA 2GBFA 5CG2A 3STHA 4Q37A 4X20A 3L6EA 1N6IA 3W8FA 1P6QA 1QH8A 2OHOA 4KQKA 1AT1A 1EFVB 1EWRA 3A1TA 3M3PA 1E4EB 1IN8A 5F52A 1TF5A 3T7CA 3TMKA 2UUCB 2IEBA 1H0SA 5G3YA 3TI7A 2VP6A 4MUNA 1BMQA 4LOLA 4FIDA 4ZT7A 4ENQA 2HY7A 3KYDB 2H0AA 1VCMA 3KP1A 1JALA 1TCBA 4TLBA 5ELMA 2PBFA 2WHYA 1Y8ZA 1V8FA 1RAHA 2KE5A 3H1FA 3KSUA 3IV7A 2FSHA 5T5QA 1GAJA 4BO7A 1BVUA 1F6BA 1KK0A 2C4NA 2WC1A 3E3OA 4O4HA 2H3EA 5TMPA 5LWQA 1TM7E 1DFGA 1WHTB 3KKKA 4FSHA 1P61B 4GG1A 4FTWA 4NZNA 3EG5A 4O2RA 5ALYA 3RUDA 2YRXA 1DJNA 3FFBA 4O1MA 1A69A 3R5FA 4H3VA 1ZSYA 4FLMA 2EATA 4G8JA 1B14A 5CLIA 4YV0A 4H7IA 4ITUA 3RJ5A 3O8RA 4K8RB 2HM7A 2XAUA 3UV7A 4JGBA 1NUTA 4BNZA 1LPSA 3KYBA 4DPKA 1DAFA 3ICCA 2GK6A 1D4AA 2YMLA 3KTDA 1FIUA 1MVOA 4I46A 2PLAA 4ARZB 2D6FA 2ZSIA 2ODQA 5ALXA 2Q1XA 2RAPA 1U8XX 3LGAA 3QVTA 1QG6A 2PQ0A 1VSTA 4GI3A 4RYDA 3RU9A 2QF7A 4KBFA 1O3YA 4G5OA 5JTTA 3Q8LA 4BIMA 4ILKA 3FHTA 3E2PA 3JW8A 2GBIA 4OJYA 2BHLA 3L7IA 5D5QA 5L7WA 1RHJA 1EWKA 1VB3A 4GRIA 2ZI7A 3TEMA 4N54A 2JH9A 2JJ1D 4CDGA 2Z2ZA 3KLOA 1JMVA 2B25A 5HFNA 3AVYA 3A4YA 4KRXA 1TGYA 2YFHA 1FXSA 1ZOSA 4RCVA 1RD4A 1PR1A 1G3IA 3SEFA 3KFVA 1SXJA 1SPBS 1J9GA 3G0OA 1T1RA 3T5MA 2SBTA 4OU5A 4RDHA 2LIVA 5DLYA 4ZU6X 4W8OA 3RGWS 3QEBZ 3N2KB 3BWVA 2FPGA 5LUBA 1AS2A 3REGA 1J8QA 5T3UA 3RUEA 4ECEA 3A6LA 1SEPA 1TADA 1RWOA 2IX9A 2PWAA 3MFQA 2V7QA 2X3YA 3DAHA 3UAOA 4WOBA 5ITVA 3T1VA 3NX4A 4L2IB 3FWZA 2IH5A 1XKQA 5HGXA 1M6EX 3NNDA 3KPUA 5IUJC 2ZI5A 3ZDCA 2EBHX 1AGPA 4BAGA 3W9BA 3O75A 1YDHA 3P0HA 2ZPUA 3A1VA 4LOIA 3T4EA 1CIVA 1EQ2A 1TT5A 4L9RA 1M1YB 3KPWA 3K2IA 4RY2A 2WJZB 1L8AA 1RIFA 1RWMA 2AL7A 2ZRIA 5EERA 4RTPA 1QIHA 2BELA 2OZKA 3DB2A 3RSQA 1H2HA 3U3KA 2VPWA 4O4IB 1GGMA 3MGAA 1FS4A 2V7GA 3PJEA 2B1RA 2XDWA 2OZVA 4H6XA 4IMJB 1F2TB 4P3OA 2IV7A 1KOFA 4J1NA 4QKQA 3HYLA 2WUEA 3ZN2A 1ESZA 6YASA 1OFTA 3PEUA 3EWNA 4DBVO 2FEWB 1KZ9A 4WIAA 2YJ4A 3ZDQA 2ODTX 1MNAA 5T57A 2ZE8A 3TDKA 3F6CA 4CNBA 4HMOA 2ANCA 2GERA 2W8BB 1YOVA 3WKBA 2GYWA 4TYWA 4BMSA 1QC5B 4YWHA 1KH1A 1OKKD 4POOA 5JSHA 3LXXA 3QTBA 1K7CA 4G9EA 4BO9A 2XCQA 1C3JA 1P7CA 3A2NA 2L0XA 3DE3X 1G8GA 2RBGA 1QLJA 3I92A 4QPJC 4RK1A 1DWQA 3O92A 1TJ5A 3U60B 1XNQB 1RQGA 2ZEJA 5IWAB 3EDMA 4K6MA 1W73A 2PKCA 2QJOA 3QJYA 3D5QA 4M0MA 3FE2A 1L9KA 3RVJA 3TTVA 4BZXA 5KSPA 2GXSA 1Y80A 2QORA 1XQXA 5EA2A 3W34A 4F5EA 3CW9A 2CSUA 5I7HA 4DMMA 3R3HA 4QFMA 2JDID 1SEVA 1XYYA 3GGJA 4HWTA 1I0LA 4NEQA 2B36A 3ENWA 1QP0A 2GFIA 3GO4A 1VRVA 4XXHA 1K89A 5KYKA 1OLXB 2AG5A 2ZT6A 3TLJA 1PWEA 1QKJA 1YAHA 3DC2A 4LDPA 1J6UA 2VP4A 3WJ1A 1JHXA 3UMSA 4ND2A 1JW9B 4NQRA 4QBKA 3TW8B 3WWDA 3I1FA 3ZZ0A 3HYRA 2DPYA 2XRMA 4HX5A 2AOUB 4PAQA 3B1ZA 3CLVA 2P69A 2V6FA 1YS1X 3DT8A 1F48A 1U9ZA 2CVFA 3HJGA 3MTJA 3NDPA 1OXMA 1ZS9A 2I1QA 3HHEA 2C07A 2D2FA 2ZWOA 2J3IA 2UV8A 1AM4D 4RHFA 4DNPA 2YN2A 4HH1A 1Q57A 5F33A 1G2PA 2YICA 1GUFA 3ZK7A 4DKJA 4LXUA 2A3RA 3G8AA 3G2IA 1NT2A 1RWPA 4XRGA 4MKHA 3STXA 4EPYA 2PV7A 3OJFA 1QBGA 1USIA 2BFNA 4MPDA 4Y2TA 3A1DA 3LX6A 3RS2A 3SD7A 1SQGA 2O7QA 3H86A 4MVYA 1OAKA 2Q2QA 4K6HA 4XM2A 2IWHA 3WLIA 1KI4A 4LZWA 3EZXA 4EMBA 2HK9A 1PL7A 2PGIA 2QU8A 4WJKB 5EL0A 3INNA 2B6NA 2OGZA 4Z9YA 1GEEA 1CJMA 1WOMA 3QVKA 1OZFA 5GPBA 3SCZA 3WY9A 2Y1WA 3IODA 4F3CA 1P6UA 5KOIA 1G16A 4G0VA 2GH1A 1HEIA 3FA2A 3LD9A 4FYIA 4MVJF 1O5TA 3GU3A 3TTWA 3VZPA 3QYAA 3I6ZA 4OHVA 4JQYA 4U39A 5IW8A 3AU9A 4O63O 2MWMA 3FUUA 4RM2A 1UF9A 4AMUA 1T0JB 3NIDB 3RFUA 3I9MA 2WAYA 2YXEA 3M81A 2F90A 4B43A 4LJRA 2QAGC 2A1TR 3B2NA 2Q46A 3HCNA 3CE9A 3TLCA 3WGZA 3OHPA 4KXNA 1ZN7A 5IM5A 1OAOA 4UREA 2CHQA 3DZJA 3QVXA 3GUCA 1GRVA 3I1IA 2XWPA 4YTEA 1CUXA 4LJKA 4F91B 1AKVA 4LF7B 3GLHB 2QSJA 2NAFA 2PIDA 3F96A 4BKQA 1K6EA 1YJ5A 3LL7A 4RENA 3UMJA 2CJXA 3IUBA 4OY3A 4ZANA 2C2BA 4BQNA 1QRSA 2NYRA 3RRBA 4O8ZA 3LVFO 2YRWA 1GYPA 3GJTA 1YR6A 4GPAA 1A9SA 2IQ5A 3HB4X 3RU2A 3BBPA 4GX5A 5HCIA 2XTAA 3P27A 3ZS9A 4HDRA 1T4BA 2PZKA 3M4JA 3QHPA 1ECFA 3FMFA 1TL7C 4HAOA 1N2JA 4PC3A 1HETA 4NZOA 5SV2A 4F5WA 4P5DA 5CEEA 1O0BA 1RABA 1RJFA 3EQZA 1XNJA 4WBNB 1FVOA 1R7RA 5E6RB 1VPLA 2BV3A 3U3MA 4IIGA 4IHAA 3I39X 1UBOS 1W30A 5D3ZA 3M89A 1XN1A 2AN3A 4HKTA 4HRXA 3T5DA 3TJMA 4AX8A 4DWWA 2Y1EA 1NY6A 1DOAA 1SB8A 2Q1YA 3CFYA 3DE1X 4D3YA 1PS0A 2DLCX 3PC8A 1CRWG 5DJ5A 4YXWD 4Y0NA 3AY6A 4OXRA 1N34B 3PXBA 2IZ1A 4C4ZA 4U4AA 3FTNA 3NH6A 4YV7A 4U7HA 3TIIA 1VHJA 3DL0A 1UAGA 1ZI6A 2ONYA 4EI8A 1DJQA 4RQTA 4XVHA 1GV1A 3NWPA 3SS9X 2VQFB 2JG3A 4ALNA 4Y2RA 2ODNA 1WF6A 1EM8A 3WKAA 4BQPA 4TUYB 2DFKB 1LI7A 2H9IA 2WYOA 5CB8A 4CTOA 1YIOA 4ND4A 1W85B 4XDYA 5CM2Z 4F8JA 4YCCA 2BT4A 1AB6A 4GEGA 2BGRA 1N36B 1LPMA 3D8HA 1CUAA 3QUSA 3NYIA 1AK1A 2BC9A 3R4VA 4GNKA 4WLOA 2Q21A 2XCIA 4LC0A 1X1BA 2QTRA 4TLAA 4PO8A 1FJXA 1FDUA 3M1YA 3O91A 3FCXA 3NGMA 1Q44A 5T67A 1WPGA 3TJRA 1DLJA 1QHGA 2XUKA 5IJ9B 4ZVLA 3PS9A 1UPFA 2NZXA 3RTGA 3MFYA 3A06A 2V7WA 2R1VA 2H4XA 1QCYA 4M99A 3A6GA 4PBRA 1S2GA 1CP2A 2R65A 4WLFA 1QPBA 1IY2A 3I09A 1MKYA 4JSRA 3H4VA 4PX5A 5KNCD 2WT8A 1N2OA 4OQDA 4RWZA 4DY4A 1IEXA 1IJKA 2W2OA 2II6A 1ZGBA 4P3KA 1Q0UA 2EP8A 4NP6A 4NJEB 2EZUA 2KB0A 3GY0A 4LFBB 2PVPA 3NOVA 4UUNA 4C5BA 5HF5A 1PZHA 1VRWA 2VK1A 3ZQ6A 2XRFA 3L8YA 2MYUA 1S3GA 1VTKA 2ZLBA 4LCJA 5LDHA 4ROSA 1H2AS 1GPYA 2YY7A 3FI0A 3OX4A 5FBKA 4DC0A 3DMHA 1SC9A 2DJIA 3GUYA 1CG6A 2ZTUA 4QIHA 1NV9A 4G4JA 3S99A 4GW3A 5H8WA 4KXWA 1XVLA 2BKVA 3IQZA 4JLJA 1QWOA 3FJOA 1NW5A 4NU5A 3VAZA 3N8GA 1KKMA 4BVBA 4L5AA 1L5GB 3OFKA 3QE9Y 5EPUA 1NVVR 4DCVA 2YYYA 1ZGJA 2I8LA 4R9VA 2QXUA 3IQFA 4YRLA 2BM0A 1DBIA 1GTL1 4XPIA 1JIVA 3TZLA 3KJZA 3QK7A 4EG3A 4F4JA 1MHTA 2BI4A 1A77A 4JXJA 2MINB 4PZPA 3UWOA 4F3RA 3L4SO 1E6WA 2PPVA 3FVQA 2FRDC 2WFAA 4NG5A 4GYYA 3CW2A 4I5DA 3WGVA 1M5TA 2UDPA 1N9KA 4YPVA 1U2EA 2YZNA 3BWBA 3N0WA 1A9RA 3RNLA 4LOJA 1M6WA 1DOHA 3OQNA 2W43A 1T1GA 1V35A 2EX1A 2G4LA 5HCNA 1CY6A 4HVTA 2R47A 3F4BA 3SWWA 2XNJA 1UBGA 2RK6A 2KJQA 3K15A 5K8JB 1RJWA 2X41A 1X7XB 1XEFA 4IDNA 1ORRA 2Q5CA 4IDBA 2RB4A 1R5NA 4KV7A 4RHTA 3HKEB 3ZLVA 4CT5A 3V6LA 5BRJA 3GA5A 5F98A 1VI5A 3OEHD 4TL9A 2OQRA 1Y6QA 2IEZA 5H16A 3QWAA 4ZI7A 1BCSA 1RQXA 4EVSA 3NONA 2P4HX 4ASUD 3HJNA 3M5WA 3ORYA 4GRAA 2GRUA 4TT8A 4YEDA 4B82A 2PUCA 2ZJ8A 2CNDA 2QRHA 4XLZA 1TM1E 1U0TA 4RF2A 2G28A 1TLLA 3V5NA 5KDLA 3GF4A 1NJFA 4GOJA 1SVWA 1CUFA 2ZJ3A 4I9FA 3SSNA 5HKBA 5TMEA 3CF0A 3N2ZB 5HFAA 1WJGA 1XZHA 3I2YX 4MAFA 4MW2A 2J31A 1J09A 1TEVA 2AI1A 3SKVA 2XI4A 2P0YA 3E48A 3KYCA 4R9RA 2WYUA 4CG3A 1PI3A 3AHFA 3OIUA 4LHEA 4FNMA 4KNYA 1OR8A 2CZCA 2RGYA 3LUGA 2NPFA 4MARA 2F55A 2WUVA 1IXKA 3VKGA 4QXPA 3T38A 1UT6A 3WAJA 5EXPA 4UOZA 3UA3A 3PK0A 3TH5A 2PEZA 3P32A 1X7DA 3D2BA 1EG2A 4GOMD 3GBPA 1Q7RA 3KXLA 3MCWA 3QKSB 4MQ6A 3ZUGA 3DLBA 1ZITA 5EE9A 3KZXA 3U1BA 5AUNB 4L50A 5BWBA 2JLVA 1Y1RA 3LP6A 3DMRA 3MSCA 3Q9LA 4FFOA 4X8HA 5AKJA 4FYYA 1VGQA 4FHEA 4L0QA 2O2DA 2P8JA 2GK4A 3HQ4O 3Q87B 4NAUA 2JK1A 3LT5A 3RS3A 3WK8A 2FYTA 3HBJA 3HCOA 2XBUA 3DLTA 1OFUX 2QX7A 3R5JA 4DM3A 1TZBA 3LY9A 2WE7A 3A1WA 3LVBA 3PC7A 4KRGA 2AN5A 4M55A 4MI6A 1SOMA 4AN4A 4MGYR 3J80A 1SXIA 5EYPB 4TSKA 2HK8A 3O8OB 1PZFA 2YWCA 1XEWY 3EFEA 5G0VA 3DMTC 1GQFA 3REQB 5K3FB 1DG1G 4K1XA 4RTMA 3GOQA 1DE0A 2FEMA 3IJ5A 3QV1A 2KS6A 5TGZA 1UPUA 3V9AA 4CXMA 1NQTA 3IUPA 4N7RA 2B6HA 5GM1A 2X0DA 3ZLTA 1QRRA 1TJYA 3PRHA 4EY6A 5I7RA 4OLBA 3HY6A 1U7OA 4H1TA 4X84A 1DQNA 5FNVA 3WBJA 1EE1A 2OG2A 3LQFA 4YCSA 3CVWA 4JI7B 2HJRA 1JA9A 1NXVA 5EY5B 2V0GA 4TKUB 2X3UA 3K9NA 2HJVA 1P1HA 2BMEA 1NYQA 2R6DA 1W47A 2XVZA 2VJLA 2YCLA 3PQ5A 3NV9A 5KKNB 1PR5A 1EK2A 3OM8A 3EFBA 3K0CC 4KVFA 3L6RA 2MSEB 4QJ4A 4TM7A 4RE5A 1N2EA 2J45A 3T12A 1W0KA 2VATA 3KDPA 1V5GA 2GM3A 4MW4A 4YECA 3RAPR 1H0RA 5AO9A 2Q5IA 3OSZA 1C0KA 3CH5A 3OM0A 3N74A 1X1DA 2ZYRA 4MUEA 4J0QA 4YAJA 2R2AA 4OHXA 5IC5A 5L8VA 2ZB4A 3VR6D 3N86A 4N18A 3LTEA 4EUNA 3NRCA 1IM8A 3TWOA 5KYTA 3KZKA 4DLUA 5JPCA 4DA4A 1PZMA 3LCRA 1O54A 3CLRC 3OVMA 2B4KA 2A88A 2H48A 2HF7A 3LX4A 3KV3O 5E1BA 3OMLA 3O8QA 3WK4A 5C9ZA 1KMMA 3CTPA 3L49A 5A3JA 1A72A 2R96A 1X1CA 4LSZA 1NTOA 1UBNA 3HBFA 4UNPA 2C78A 5BN4B 2PGJA 5J5VA 5JWRA 4YP5A 2KM1A 1XRMA 1H6AA 1TD1A 1L8XA 3CNNA 2Q6KA 4EY5A 4K05A 4RA6A 1UP4A 4KAFA 3QVVA 1IOZA 3B6KA 4B4WA 4F1JA 1KEZA 4UD6A 1LVUA 2OO3A 4H31A 1WQ1R 1E2QA 4N03A 4HNAB 4GVLA 2HSGA 3R6DA 3UK1A 2CDNA 5B3LA 5BN3B 2YHIB 1V4BA 1B6TA 4D9JA 1WMDA 1RCTE 2G1AA 1Y82A 3GZNB 3M4NA 1P72A 5GVSA 2MR6A 3HXPA 3I05A 4BLVA 2QTGA 3DXYA 4HPWA 3VDXA 1YGPA 1EGAA 4LQLA 1W44A 4DMUB 4BIIA 4Z9AA 4BNXA 2YJ5A 4BB9A 4E0BA 1U0LA 1VKNA 3A4VA 5MDHA 4CMJA 2JCVA 3GW8A 3TPZA 2PRYA 1H2EA 4HADA 3MGCA 3WR5A 2WIJA 3EC1A 2BHSA 4YH1A 3I9V6 2IHTA 3MMSA 4IHQA 1BWQA 1E92A 1EB9A 2X0NA 4M0EA 4NHOA 4EYEA 5IBCA 1II8A 1LBEA 3TOZA 4V0MA 3MLBA 4ZV9A 2H1RA 2F43B 3MCVA 2WLTA 3TE6A 4P86A 4MRPA 1FBNA 1I13A 1UKAA 1LDMA 1B3BA 5DT9A 3U1TA 3V48A 1MGOA 5JFGA 5KOHB 2OZEA 1MIHA 2VP9A 1MRNA 4NCNA 3R0ZA 4OG2A 1DGQA 1U2DC 3G2NA 2CV1A 5U4QA 2FG5A 2HCFA 1ARZA 1EA7A 4KN9S 3ST7A 3OWHA 1RJ9A 3IO3A 3H6KA 5J1TB 2OO5A 3S4YA 2Z3VA 2ERYA 2YHSA 5HA5A 4D8XA 5BNZA 2PXCA 4GBED 4Y30A 1JFSA 2Z5LA 4CLEA 3IAM1 1YF3A 1JHAA 1G5QA 5C32A 1N2CA 4D0LB 1FP4B 3OFJA 1RYDA 2P40A 2YC2C 4M1ZA 3R8CA 3WBFA 4B3DA 4ZYUA 1VIAA 4NJMA 1TTTA 3A9UA 5HKKA 2Z5VA 1L1RA 1IQRA 1EYZA 3B70A 2PPLA 2EYUA 5EZYB 2FN4A 2HHCA 1KZ4A 4RS4A 1GN9A 2VDWA 3IDZA 4ENPA 2I7XA 4IHJF 1OWPA 1L7MA 3TDNA 3ZNOA 2GJKA 3DKIA 3CF2A 3JZAA 2GSWA 2H9AA 4XD7D 3JYHA 1YDMA 3FMOB 3G0HA 5FPQA 2WTBA 2IUSA 3OU2A 3VGPA 3EQ7A 3LDFA 3MJFA 4NBSA 3F49S 3R74A 1R4NB 3H83A 1YZNA 3L04A 4GWKA 4EGCB 3Q10A 2XCRB 4YJ3F 4C5CA 1Z18A 2ID9A 1X7YA 2X8JA 5E3IA 3UWMA 5IKMA 2O52A 1BYIA 2E6KA 1QHSA 2W0MA 3PIRA 2FPWA 1S2IA 1Q7CA 2F6RA 3D6TB 4BYMA 3FKSA 4HDNB 1O7JA 1VCHA 3DCNA 4X44A 5HGJA 2Q9BA 3CXUA 2AWOA 3GNLA 3KJFA 3L79A 2ASEA 4FMDF 4RK0A 4O25A 5LYYA 4N7JA 4IYRA 4FJ0A 3T3EA 4E5MA 1S3FA 3HUEA 4ISCA 1T0UA 4Y1FA 3FIJA 2VXOA 4JMPA 2WKSA 2ZRNA 3RVOA 4ZGBA 4AY2A 5KTTA 2I4MA 1EK1A 2Z98A 1YR3A 3EK2A 4KQFA 2JF0A 4MOWA 1T1SA 4BLWA 1V4VA 3EIQA 1U3UA 1YTLA 5DSZA 3LT0A 2PLFA 3D9QX 4INZA 2FXIA 4NMWA 1PFGA 1FX0B 1A82A 2PL1A 2XXBA 3DC7A 3BJIC 3UJDA 3WRXC 3VR5D 4D2IA 4W9NC 2XOXA 3RG2A 4RZXA 4FYVA 3PD7A 3L6UA 4RO0A 2R5FA 2PH1A 1X3LA 4KLCA 1G9XA 2PDAA 3A6PC 1KKUA 4B45A 4BNNA 1KY2A 5B3JA 5JQWA 2AUMA 2FNAA 3A6EA 2HF8A 1QZ3A 2G9UA 3WTCA 4Q9IA 4GP9A 2ECQA 1BKDR 5FWAA 2HWWA 2JCXA 2XF2A 4WXEA 2UYYA 2TMDA 1OC2A 5NULA 3GD7A 5BOSB 3TVTA 1WLYA 4PSVA 4ESHA 2N9UA 4XD2A 4MR9A 1Z2OX 4QHSA 4C6TA 2WR8A 4EY4A 1AMUA 5DGHA 1J2JA 2EFDB 2XGSA 3BB1A 4UFOA 3NAMA 5E8RA 4P0QB 4GX2A 1FUYB 1UDCA 2HADA 3BK7A 2UYGA 2QSUA 3EMVA 2QD1A 4MVJG 2X5OA 1E6LA 3CG0A 4TYPA 5CYPA 5TLSA 2IYQA 2QRVA 2FEXA 2JFHA 3UJNA 4CMIB 3KALA 3O74A 2QEQA 5F9FA 2FSIA 3T3NA 2GCIA 1XIVA 4QVIA 1VIYA 4QYIB 2FRXA 4JWTA 3UH0A 4BDTA 1D1PA 1A04A 3BB3A 3V2GA 3I61A 3H0CA 3TX2A 2GXUA 4BVHA 2FUNB 4C20A 3CA8A 4A91A 4MRSA 1ZGAA 4RJLA 4DCMA 4EJSA 4MR8B 5I7SA 1I3LA 5J4YA 5KNDA 2FVXA 1X19A 1Z3IX 3I4LA 2BBOA 1F8GA 2H2DA 3O2JA 3UWSA 1HRKA 3RQSA 2VLBA 5BYKA 1WV1A 3ZI0A 4MKZA 3GRRA 4DLBA 2CJFA 4NAVA 1JQJC 1C9NA 1NDQA 1KY5A 2PX2A 4LN1A 3WK6A 4YR7A 1MB3A 3CNLA 3E9DA 4RGVA 4J3NA 4DUYB 5AK6A 2BDTA 4ARIA 2PMCA 1SKUA 1L7DA 2QZ4A 1V7CA 1YZTA 3N05A 1USWA 2OOKA 3IJPA 3QPCA 5EG5A 1JBKA 2R68A 4FKMA 3K9WA 1RWQA 5BNTA 4NARA 1GGKA 1W1IA 3MA0A 4MIYA 3AERA 3OT1A 4YRDA 2OEPA 3F7MA 1SUAA 2YWHA 3O4VA 4TSRA 3BXZA 3MHTA 1CUBA 1XEXB 5KI6A 2QMHA 5K20A 2Q0XA 3Q3CA 4C4AA 3AT1A 2Z8YM 3KKEA 5BPFA 2GDJA 4KPUA 2J9YB 3O8BA 4KH0A 3B7GA 1WABA 4MLPA 4WLNA 4NFHA 3HU3A 3R41A 2XSZD 1OJLA 2W2LA 4C0WA 1P2DA 3PDUA 3D8UA 4FINA 2W6MA 3GLGB 2UZ1A 3EXHA 5SZHB 3MUNA 1SZDA 2I6QA 3BD6A 4MJ3A 5KWVA 4DB4A 4MROA 3DR5A 3IOMA 2O50A 1YMUA 4RJ2A 2GN4A 3IMFA 2EZ8A 1GNSA 1OX6A 4MA5A 3DKKA 4DCPA 7REQA 1I94B 1T9GS 2OP1A 3RIYA 1USKA 2MU1A 4FPXA 2YQ4A 5IXJA 1V48A 4A03A 1GAXA 4S35A 3OSUA 3N6VA 4QODA 2I1VB 1D2AA 1KI3A 2Q8QA 3L05A 3TK1A 1SBHA 5JNLA 2HIGA 4L76A 4XWAA 2MYNA 4RUKA 1CY8A 1WSDA 5CDGA 2AF4C 1GG9A 1TYDE 1QBKC 3H04A 4UHHA 3TYXA 3X1YA 2RAVA 1PJRA 3IMGA 3KJNA 1O94C 1EK0A 1J99A 4MGKR 3U7JA 1XTSA 4BNJA 4EI9A 5HRUA 2ORWA 1Y5IA 3NVDA 1W4BA 4OHZA 3JRWA 3RV3A 3UVEA 2BFAA 2HV9A 2ZS9A 1E59A 2VDPB 2YNMA 4GP6A 1P1IA 1QOZA 5K3CA 4CVNA 3OOWA 1UKZA 2IYVA 5E6UB 4ALJA 4HWKA 4CV2A 1DXOA 2QV7A 1Q20A 5AJYA 1MV8A 2W48A 2WKPA 1H2FA 2OTCA 4AUNA 5I01A 4PM4A 4GI2A 4HQ6A 3L8MA 4RU1A 4IBOA 1IFXA 4TZKA 4BNWA 4IZIA 3CVJA 1PT8A 2Q2WA 1KI1A 3M5CA 5IMSA 2AMJA 1CHDA 2AC2A 4DJTA 4TL6A 1U2GC 3T61A 5EPEA 4M8LA 5B1IA 1U90A 1BFDA 1T1JA 2VHYA 4L57A 3TLYA 5IH3A 3C7CB 4X64B 4RL4A 4OO3A 2EP7A 3KOMA 1OD6A 1JYFA 3EMBA 3FHJA 2OLKA 2Z09A 3PKJA 1PT7A 3AWIA 3Q9NA 4UKDA 5CVVA 2DBYA 4MKXA 5DLQC 3VO8A 2JGRA 2A9FA 2JJQA 3HDHA 1A1VA 1YVRA 4YV2A 1C1XA 3LUAA 4FYHA 3NNSA 2AMYA 1UC5B 2P77A 4G07A 3K70B 2DPMA 1B15A 1C3OA 2EW1A 2HLPA 3CHYA 2HF2A 4LISA 1L7XA 4RY0A 1SHUX 5CIQA 1VHQA 1XZQA 4YONB 3WYGA 1Y8QB 3D4PA 5IKEA 2O5VA 1EPUA 1BCRB 1Z4JA 4I8XA 4ZEXA 2ES4A 2OE2A 2WFLA 4BMOB 4CKWA 1NW6A 4IRXA 1LCIA 4WOJA 1IZYA 3UUGA 1OFUA 2BJHA 3VJLA 3W5UA 5BQFA 5IRCD 4OEHA 3EVDA 4MUKA 1NVUQ 4CTJA 2CHVA 4LE2A 1TEXA 4RPKA 1NAHA 4RJJA 1S5PA 2GM9A 4HJRA 4ID3A 3BA6A 1NOKA 4I50A 4KIUA 4AUEA 1Y4UA 4DLTA 5IC4A 4JX8A 4A8JB 1KH2A 2G5TA 2J3JA 2WVAA 3BMNB 1O97D 2WF8A 4KU4A 4M37A 4PONA 4Q4AA 4XSVA 2CBXA 2OWEA 4LVUA 5HIMA 5LXTF 3JQ6A 2BM1A 5WRFA 1ZVQA 1TK9A 5H68A 4S12A 1U5CA 2FN7A 2P6PA 3P0JA 3ZE6A 1PL6A 2EL9A 4CW7A 4EKDA 1L5OA 1XMSA 4P4SA 3FNIA 3HPRA 3R0JA 3F0TA 3L6OO 3U61B 3LFHA 5EHIA 1UM9B 1WO8A 4NAHA 3CR7A 4FNOA 4QQKA 3UMFA 2OPBA 3VJKA 3VU1A 3EGCA 4E7PA 2B9VA 4IOLA 3VDNB 5B7QA 4L27A 2OAP1 1OMOA 1XU4A 1AS0A 2B1IA 1XKTA 2DHDA 2P9ZA 3I6MA 3P9XA 1W96A 4OYHA 5TSDA 5JSZA 1G8JA 1QF6A 3NUQA 1JIQA 3GQBB 3LNCA 3QOXA 3CT6A 4QE3A 1KAGA 1NX6A 1E1KA 5HF9A 1E3QA 4W5TA 4O6VA 2EFEB 2PFSA 2XNSA 1U5AA 3IRVA 4PLPA 3CH4B 1DAPA 3AM5A 5FI5A 5FL7A 2C9BA 4BC0A 3QX9A 4CKXA 2EC5A 4M98A 4EY7A 4OJTA 1K6IA 4FOPA 1GZ5A 1HZZC 4LZLA 3RRNA 5EKUA 2HU7A 5EFZA 1CUWA 4GZLA 3P0IA 1P5HA 3TKLA 1HUQA 4B34A 4GYKA 3SSAA 1Q17A 2PBRA 1I1NA 3W77A 2H6EA 2IL1A 1H23A 4GI7A 4QTTB 2R60A 3FGZA 5F1OA 4I9GA 3A27A 1X77A 4N0MA 1QE3A 3EJ6A 1O6BA 3NTRA 5BRAA 1HT3A 1R15A 5FBVB 4TYYA 3FD8A 3TLEA 2J6IA 2GN1A 4BO5A 2POCA 4EJSC 4XWGA 5CFMA 1UJBA 3DCYA 3IHLA 5CD9A 4DAOA 2EW2A 1NF2A 2CF5A 2FG6C 2M6SA 3TR5A 3G2PA 5CURA 2C5GA 3AZOA 2GZ1A 3WJAA 3GELA 2OR3A 4BYGA 1QYXA 2NUBA 1CQIB 3QFRA 4HG2A 5JBQA 3AKEA 4UUOA 1P75A 5K0BA 2QVCA 1DRVA 5KKAA 3RR2A 5KJ6A 1ZM9A 1GCUA 1TAQA 3KC2A 1LVHA 2IZ5A 1N7GA 5DYIA 5GV8A 4ZREA 4E1VA 1X1QA 1ZUNA 2V97A 3A3NA 3T9CA 1ZCAA 2RE8A 4JQCA 3UH1A 4H0CA 3A3OA 2XUFA 3BS4A 2P3SA 5K3BA 3WQSB 1M1UA 3VTFA 4J03A 3VYSB 1VKRA 4UHKA 3W1EA 4Q7JB 1K08A 1Y33E 5DHSA 3BEDA 3FWYA 5C51B 3ID6C 1T5IA 3OWXA 4LOAA 4DL9A 1E9FA 3MLEA 1TVKA 4LYAA 2I80A 4DCNA 5LU8A 3GLFE 1XXHA 2Q2NA 3CGWA 4CQMA 4IOJA 4F04A 3D3KA 3T9BA 1ZN2A 3CLHA 3BMOB 3ZK9A 1J00A 2DHRA 2WF6A 3VJMA 1KQGA 2VPPA 3FVRA 3BUSA 4G5SA 2PLWA 3NFYA 1QYVA 1DMRA 5J47A 3EOZA 4MW5A 1W46A 2CVPA 3SXJA 1IE3A 1N6KA 1WR8A 2VJAA 4UBJA 3W9YA 3D1JA 3IELA 4GM4A 1NMYA 1YBFA 1YNSA 2VA9A 3L7CA 2OHHA 2QE7D 4R0MA 4B44A 3L7JA 2H7CA 4XGQA 2CLDX 4MCIA 3G6WA 2WMNB 2FR8C 3A11A 4LWQA 3C15C 5FOWA 5JHGB 1YFLA 4ND6A 2RHLA 1LSSA 2QR2A 4FD2A 1MB9A 3I9LA 5IAJA 3PEWA 4BMZA 1PVDA 1L5VA 1DKQA 2PGDA 5JVDA 1EQUA 3P1JA 3MTDA 4XIFA 1C8VB 2WJYA 3P2MA 3TLGA 2JS7A 2IIPA 4LAFA 4U6SA 5JNUA 2WIFA 1OWOA 3DGFC 4LDRA 1MPXA 1ML3A 1BOFA 1UWKA 5CT8A 1HX7A 3W5SA 1ZI9A 1EUDA 2O3RA 1RE0A 3LY7A 3DVRX 2BKLA 1ADFA 4J43A 3A0RB 1P19A 3FN4A 1FTYA 3KV1A 4P22A 4ND8A 1AQIA 1SU6A 1PR0A 2B69A 1XD2B 1EXDA 5MHTA 1F0YA 1IMOA 3R3XA 2JIZD 2I6GA 2RC6A 3RS8A 5FADA 2B0CA 4J0KA 5A6SB 3DW1X 4AZ3A 1YQQA 3UMRA 2D00A 1PJSA 2IKQA 4ZYVA 2V5UA 1BWPA 1NQ5A 1YONA 3AH8A 2GCOA 1DRKA 2WUGA 2VXYA 3VDRA 3TIFA 3V6MA 4G86A 2AJCA 2PJUA 4OXIA 1ORIA 3K0AB 4U9UA 5AHWA 2VHVA 3FSJX 3LA8A 4LZZA 3VTKA 2D5AA 1CFJA 1MABA 3FNEA 1E1LA 1NE2A 4S24A 1PNTA 3OUUA 4CMKA 5B6JA 2F62A 4Q12A 3GJ4A 4JEHA 1GLGA 2GAAA 3L84A 3N2GA 3MT0A 5LP6C 4QDUA 2CN1A 3IVRA 2ST1A 4EA6A 3F9CA 3LGXA 3IDAA 4PX2A 3FOBA 4BJHB 1WXHA 3PIIA 4NFSA 4R0VA 2C3MA 2J0VA 2R9VA 4C29A 1P60A 3CZRA 1TZCA 2C9YA 2WOJA 3G23A 4MQFA 3PQ7A 3H11B 1JEDA 5L51A 4ZOLF 2KPOA 1OLSA 2VFAA 4UUQA 5LIPA 4CEHA 1VLZA 4D6YA 2Q3MA 4JY7A 3OZVA 4KAJA 1QHHA 5EQTA 3RRYA 1Q2XA 3D4IA 3W4KA 1GY8A 3AGPA 1RDFA 4IIJB 4K6KA