1SD2A

Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
262
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine phosphorylase
publication title Structural Comparison of MTA Phosphorylase and MTA/AdoHcy Nucleosidase Explains Substrate Preferences and Identifies Regions Exploitable for Inhibitor Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 262
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd2A00
1ECPA 3FOWA 1RXUA 1T8SA 1OVGA 1Y6RA 3P0FA 4DANA 4L5YA 1NC1A 3DPSA 5B7QA 5ETJA 2QDKA 3OZEA 4G8JA 3UAXA 4NY1A 1Q1GA 1U1DA 1JYSA 5F73A 1Z39A 4F1WA 5KB3A 4H1TA 3EEIA 3OZCA 4OEHA 1JDZA 1U1EA 3BL6A 2OXFA 4TXLA 4L5CA 4R31A 3PHCA 1PR4A 1JDUA 3ODGA 3C74A 5F7JA 2A8YA 4JP5A 1ZL2A 4PR3A 1A9OA 5B7GA 5DK6A 2PGAA 1V3QE 1JP7A 4G89A 1TCUA 5CYGA 3UT6A 2HWUA 1PR6A 3NM5A 1V2HE 1LVUA 3D1VA 3U40A 3OF3A 5CXQA 3FB1A 3MMSA 4TXNA 5FAKA 1XE3A 1A9TA 2A0WA 3K8OE 3EUFA 4LKRA 4TTIA 2Q7OE 5K1ZA 3OZBA 2H8GA 4TTAA 4UC0A 1PW7A 3P0EA 1TGVA 1U1GA 4X24A 4D8VA 1YQUA 1YBFA 1RYZA 3KU4A 4L0MA 1PK7A 1OV6A 1G2OA 1SJ9A 4BMYA 3T94A 5EFOA 4DA0A 4E1VA 3O4VA 1SQ6A 5F7ZA 4G41A 3UAZA 4BN0A 4M3NA 1Z5NA 3DJFA 2P4SA 4FFSA 3QPBA 4ECEA 1I80A 4WKPA 4GKAA 1NW4A 4QAQA 5C80A 4OGKA 4TYMA 4QARA 1ZOSA 3GGSA 5I3CA 1Y1TA 3EMVA 4QEZA 5JPCA 3DF9A 4YMLA 1JDSA 3BGSA 3KVYA 3OOHA 4DARA 4JOSA 1Z5OA 2HSWA 5F7OA 3DDOA 1RT9A 4TS3A 2OECA 4BMXA 4DABA 3OZDA 4GLFA 4LNAA 1TGYA 2GUWA 4F2PA 3INYA 3GB9A 2QPLA 3FWPA 5CCEA 3ONVA 4LZWA 1OTXA 4OGLA 3IEXA 2XRFA 3NBQA 3O6VA 3TL6A 4D8YA 4OY3A 1VMKA 1PBNA 3MB8A 3OOEA 4LDNA 5B7NA 3LA8A 4P54A 1FXUA 1B8NA 1YQQA 4RJ2A 4WKBA 1Y1SA 3EUEA 4JWTA 3ENZA 2AC7A 4TXMA 4F3KA 4DA7A 3K8QA 1PR5A 5CCDA 4MCIA 4DA6A 2B94A 3OCCA 2AI1A 4WKNA 3LBAA 1A9PA 1JE0A 4GLJA 1OTYA 4KN5A 1SD2A 4EARA 1M73E 4M7WA 1ODKA 4OF4A 1A9RA 1RXYA 1PR1A 4F2WA 3LGSA 3KVRA 1TD1A 2ON6A 1RFGE 1RXCA 5F7XA 1K3FA 3NM6B 4WKOA 4YO8A 1Y1QA 4QASA 1RCTE 4I2VA 3OPVA 1V41E 4OJTA 3KVVA 1Y6QA 1Z38A 5F76A 1A9QA 5B7PA 4TS9A 2ISCA 1Z34A 4D8XA 4IP0A 4TXHA 3E9RA 5EUBA 1JPVA 2OC9A 1PR2A 1CG6A 1Z33A 1Z36A 1JDVA 1SD1A 4MARA 4LNHA 1RR6A 5CYFA 4L6IA 1A69A 3DP9A 1PK9A 1C3XA 5CXSA 4R2XA 4NSNA 3PNPA 1ULAA 4MCHA 3UAWA 1ULBA 4EB8A 4K6OA 4BMZA 1LX7A 1B8OA 3PNSA 4DAEA 1VHJA 1NC3A 3IOMA 3UAYA 3BJEA 1T8YA 1OUMA 2OC4A 1RSZA 1WTAA 1T8RA 3F8WA 4TXJA 4YJKA 1ODIA 3FUCA 1PKEA 2RJ3A 5F77A 4PNPA 3E0QA 1RXSA 3NM4A 1TCVA 1V48A 2QTTA 1CB0A 4NS1A 1YRYE 2I8AA 1U1CA 1Z37A 1Z5PA 4WKCA 2AI2A 5IU6A 3BSFA 2HRDA 4DAOA 1LV8A 5F78A 1OU4A 4GMHA 2AI3A 1K9SA 1QE5A 1T0UA 3SCZA 1K27A 1VHWA 4M1EA 1VFNA 4QATA 1V45E 2A0XA 1U1FA 1Y1RA 3E9ZA 1T8WA 3KHSA 2A0YA 4U2KA 1JE1A 3FNQA 4TTJA 4D98A 2BSXA 2HN9A 4QFBA 3KUKA 2I4TA 5IFKA 4D9HA 3UAVA 1PWYE 1PR0A 5EPUA 4DA8A 1ODJA 2QSUA 1JDTA 1PF7E 3FAZA 2QTGA 4YNBA 1Z35A 4L5AA 1V4NA 3PHBE 1YR3A 4F3CA 1A9SA 4R2WA 1ODLA 2IQ5A 1N3IA
chains in the Genus database with same CATH superfamily
1DEHA 1CZHA 1F2UB 4YGYA 4C3OB 1NP3A 2EKDA 1U5CA 2DFDA 2Z43A 3GPBA 4NOMA 1VJRA 3C48A 3N8KA 4P4SB 5IBCA 3CMMA 1Z0DA 1DLIA 4NAHA 3S2GA 4EB6B 3DHNA 4HGOA 5HZKA 2F1KA 3IUJA 3NKVA 2GETA 1DT3A 3DFFA 3KDPA 3QA3E 5K0BA 1E2IA 1PI3A 4NV3A 1U3UA 4LRUA 3IAM1 3I5XA 1NYTA 1WY7A 5A5VA 5JAMA 1EB8A 3QYAA 1F5SA 3B9PA 2AJCA 4FPXA 4YLYA 1QRTA 4ECAA 3OM0A 1EA5A 1FTGA 1KY5A 3WDKA 3PPWA 2A58A 4GOXA 1BA3A 3WWOA 1U1EA 4HLUA 4JJ7A 5BN3A 5HS6A 4RMNA 1H05A 1SHZA 1ZQ1A 3BHNA 3H5NA 1QLJA 3HYLA 2QTLA 5E0OA 3RSCA 1C0EA 4W6QA 4Q7QA 5KYYA 4J7XA 2GHIA 4WLNA 4YJHB 4L5CA 1GL7A 3EFOB 1Q0QA 2H54A 3RSHA 3ZY4A 3ZW9A 4KXQA 5IVHA 1Z63A 2WAAA 2AMFA 3MIZA 3KVNA 4G1MB 5JDIA 2W98A 2F8MA 3HCEA 5HKKD 3CVYA 4R1QA 3UJBA 2A8YA 4INZA 1VB5A 1FQJA 2WFLA 1JKIA 3AYXB 4C78A 2A3NA 1Y8CA 3TNLA 5F1PA 3R0VA 1IZ9A 5SYMA 4JLNA 3RUHA 1USUA 3H1AA 4II3A 3KBBA 3R3HA 1WHTB 3QOWA 4D25A 2H3EA 3I83A 4CTMA 1PR6A 5D5HA 4CLHA 3EK2A 4OJMX 3MS2A 2AYYA 2RG1A 1EFRA 1FU8A 4RTJA 1E0DA 1QK5A 1L4NA 4ZANA 4EENA 2D0IA 3ZWBA 4X0EA 2YS7A 1L5MA 3PD7A 1WQ1R 2B1IA 1RU3A 4R6WA 1P1CA 4YMGA 3CQ9A 5J4KA 1MQAA 2PS3A 1ZD5A 2QR2A 4JL6A 3SJBA 5SZKB 2HBRA 4G36A 2BKEA 5EIHA 3WLOA 1PZXA 4LPSA 2FMUA 2QTMA 2CD7A 2A0WA 4RE5A 1ENPA 2XTZA 1XZHA 3ZBTA 2DFLA 5BORA 2Z1MA 5JCJA 3WXBA 5BYKA 3FNFA 4C07A 5KYUA 3R2JA 1O0BA 3FCAA 2VYNA 3R0IA 4PBTA 4DJTA 1W75A 5KCMA 1HLGA 4N0DA 3AEKA 5GONF 3RS8A 3T7EA 1NYLA 3O8QB 3L05A 1MPTA 2XCRB 3PT9A 3DHVA 5SZIA 3CLRD 4GE0A 4NICA 1Y6FA 1DU4A 1DAEA 1B4DA 3UJ6A 4RVCA 3V5NA 4D80A 1QBGA 1NNI1 1ZXBA 4ZRMA 3CT6A 1ZUNB 3UC9A 5CGZA 3PGMA 1YQTA 2SKCA 1I24A 4FYMA 4HLDA 2WHEA 4RK5A 4D4IA 4DRXA 3D64A 4G0ZA 3OE7D 3NTLA 5DRTA 3T1TA 3ZQ6A 2Z5GA 4M9XA 4DLSA 5IF3A 3P0IA 1TW3A 5JSQA 4IHKA 4M1TA 1GPLA 2PSSA 3W34A 3N3BC 1OV6A 3ZZ0A 1Z2CA 2K5UA 3A2MA 1SJ9A 2R79A 1K6EA 4L8FA 5FUYA 1IBLB 5EJ5A 1NG9A 4IF6A 4B74A 1PV2A 4GBMA 5JTUA 4MVYA 2FWAA 2VHVA 5COBA 2HJGA 2BFDA 3QF7A 5JFGA 1I2CA 3AC0A 4G2NA 5AVJA 3ETEA 2JNWA 2BGTA 3IBGA 3USZA 3O8NA 3IA2A 5FJIA 2BZSA 1Z68A 4ESEA 3KQMA 4ZQFA 1ZITA 3FTNA 3PC3A 3A3PA 3PI7A 3KEFA 2V9CA 1OLXA 3ZHRA 2AFIB 3TI7A 3BICA 2DT8A 1H1LB 2JI4A 5E4JA 2GT1A 1XYYA 2NUPB 4ZVNA 2LWIA 1N2GA 1WL8A 1SA0B 4Z9AA 4AG5A 2H65A 4RNDB 2GA9A 5KAMA 4JVSB 4LNUA 3P9IA 1SPBS 2YDYA 3GHYA 1DDOA 4HWTA 1FVXA 3L8EA 1VFPA 4EY4A 1V9LA 3RC8A 4NZ9A 4PZ9A 4HVTA 4MUKA 1F2DA 5AWFC 3RJTA 5K99A 7REQB 2DBRA 3DOCA 3A6EA 3U44A 1M1ZA 4GAEA 2QQEA 1ZINA 3U4HA 2B0CA 2OZPA 1KS9A 1U2GC 3AHJA 5TJ9A 1WB9A 1JDSA 2QL9A 1TVEA 4Z0PA 2F1HA 3GJ4A 1J2JA 2H1LA 1T2EA 4LDJA 3UUGA 5F9FA 3R5JA 1QIIA 4AJEA 5K6TA 2NSLA 3PV0A 3TBFA 4UTRA 4H16A 2DBVO 1YDHA 2RHGB 1G7RA 3CR7A 2CNWD 1KJZA 2GEKA 1QCDA 5DLEA 3UF0A 3G2KA 4CM4B 5DHFA 5FKJA 4PINA 1VC2A 2OWEA 3VGJA 2QRUA 1T25A 3AM5A 4Y2GA 3ZU4A 4XQ0A 3EDOA 2XQVA 3I28A 3INYA 4MLPA 2YRXA 4N7RA 1H9CA 3M8KA 1CZUA 2FYTA 1F1BA 3AJDA 4UAGA 4BFXA 3ZG6A 5FQNA 4ZOLA 2A3RA 4K88A 4PX5A 2GMWA 4LZWA 3RT1A 4QXPA 5FNZA 3HABA 4IY1A 3FPAA 4YXWD 2YZKA 5K5EA 2P78A 1MQSA 1B1CA 4ZCQA 1URPA 4C9BA 1QH0A 3KFXA 4LF7B 2NO7A 3LUBA 3ORRA 1GNPA 2XECA 1J70A 1E5XA 4GICA 4JELA 4TMVA 3VR6H 4C0SA 1XEXB 4TZ6A 3C97A 4O4IA 4B2IA 1GQ2A 5IKMA 3J81A 2FFQA 5HILA 2I2CA 2QA5A 5AYVA 2F4VB 4H7PA 4Q9AA 1P2FA 1A4XA 3UUFA 4BUJA 2DG2A 5AW2A 1E2QA 5AVVA 4IHJA 4R68A 4F9GA 5EMNA 1S96A 1FXUA 4P7BA 4BZPA 4TRMA 1TM4E 1SXHA 2PGXA 2VF8A 5FUXA 3M7IA 5FTLA 4I8DA 2OO5C 5DOZA 2PR2A 4JKYA 4TKZA 5IKPA 3AVTA 2Z4SA 5GM2A 4Y6RA 3BKXA 5HTKA 5EKDA 1AKEA 1WUTA 4GOMD 1GSAA 2AYXA 3WOHA 2Q6IA 3E58A 4L8LA 4QBKA 4AJNA 1DAHA 4BNIA 1TYAE 5KYGA 3TGWA 1USIA 4R7ZA 1SXJE 2JI8A 2ODWA 5ADHA 1SAYA 1GG5A 4G1CA 4FNGA 3T5PA 3HK2A 1FQKA 3L8MA 3H11B 3N2GA 2VAXA 4IIFA 1WBDA 1OV4A 3VV2A 1EXWA 1VE9A 721PA 4LHYA 3SIXA 3OHSX 5CVTA 2WE8A 5HIAA 1NI5A 1JLLA 4MXDA 5J9FA 4Z0NA 3QX9A 3NIDB 4AUNA 2DFPA 3S5UA 3HZRA 3ZVMA 2WEKA 2DUWA 2WIAA 3CG4A 3NYQA 2XTMA 1N75A 2GBIA 2X8BA 4A23A 2WHPB 1OE0A 2WWWA 3EF1A 4HHEA 3V1LA 3MA0A 3EEFA 1T4GA 4GECA 4EARA 1MJFA 1H22A 1IQ0A 2FGKA 2O3JA 3KSBC 4NOLA 2EQ5A 2AUNA 3UY4A 2YWEA 1GGNA 3DVAB 2HBQA 3H5LA 4LZOA 3V42A 3VUFA 4EECA 3WOVA 5DVZA 3WK8A 1J0DA 3NHMA 3WYGA 4XDHA 2FKAA 2ZJ2A 1XHFA 4YAOA 5GP1A 5G3YA 3W5UA 1GPH1 1YRHA 1XJQA 2ZYSA 2WKRA 1XPUA 2V3VA 5LYYA 3FHCB 3ZWXA 3HJAA 2GKGA 4X90A 4B6FA 1E3WA 4YV7A 2EFHB 3BH7A 1E3JA 4OQDA 4Z0TA 1IY1A 5HR5A 1AF7A 3JYNA 3QU7A 3NOOA 3DVRX 4EVQA 3CH7A 3ZQJA 1M8PA 5HKBA 2EDAA 3D59A 2LP4Y 2WU1A 4K81B 4U39A 2AH5A 2DH5A 1QH1B 4KODA 4ZPXA 3WBFA 2O50A 4KUEA 5KTSA 3MTIA 3WGVA 1TAQA 1BOFA 4OXXA 2QX7A 1P19A 5HDBB 4EHNA 3H1EA 2OD9A 3BERA 3UMBA 3TRKA 4CRWB 1GADO 4NQZA 2ATXA 1O96B 4MR7B 1Z5GA 4NATA 3U1VA 1KGDA 3H2GA 5B7PA 2CYCA 3LLUA 3FTDA 3WC4A 1P44A 1WW8A 2QL5A 2FB9A 1KOLA 3HNOA 3DXZA 1X9IA 4L07A 5FO1A 4DCOA 4DV7B 3KZOA 3T3IA 3AEYA 3LZDA 3ZXIA 4LJRA 4BNDA 5EUBA 2ZJ0A 3AGQA 2AEEA 2YXLA 3WB9A 1VPTA 1N5LA 4FGZA 2C7PA 4G37A 4GX0A 1BA2A 4Y9TA 1FC0A 3K5HA 1BEEA 2C8LA 1E4YA 4JLKA 4DLAA 3GLGA 2XIQA 3AVUA 3COWA 3T61A 4CCYB 4CQJA 1PR9A 1AGXA 4QICA 2XT0A 4MQEB 5FI3A 3UQYS 1TAUA 3KHUA 1XNJA 2IBSA 3FUTA 2BMFA 2BHRA 3JS5A 2ONYA 3KKNA 3V48A 1C8VB 5EMMA 2WB2A 2F8TA 3L77A 4FDAA 3AUUA 1C9MA 1WCIB 1E2DA 2GBGA 2O0MA 3E6AA 1CR4A 3DQZA 3EZ9A 3JQ7B 1XLTC 3EXFA 3MPOA 3WBKA 2ZS9A 2GD6A 1C1XB 1ZM9A 3IR6A 1JU4A 1O57A 4KLZA 1KC3A 1RQLA 2XGSA 4M98A 4TT3D 1B2RA 2GAOA 2PS9A 1JHDA 1I6WA 2O9JA 3KWMA 3LAWA 3ZNOA 3AL0C 1I4WA 3DQPA 4QECA 3IMFA 2ASEA 4PFSA 5DGCA 4X91A 3DZHA 3H4MA 2IYEA 2PZLA 3TLGA 1IULA 4KU4A 1B8OA 3RADC 3ZJ4A 3GQBA 4DCUA 1HDZA 3QEOA 4BO8A 5KSWB 1SIBE 3GW8A 3MWLA 5AW9A 5LQSA 4Y3UA 1Q3TA 3I8OA 1MO3A 4H17A 3MHTA 4U1RA 5CFOA 2H08A 1Q1EA 5KMGB 3H1FA 3QP9A 3N0WA 2RONA 3MINA 1MC4A 1KSHA 2WNSA 3KPVA 3AEUB 2GK3A 2PE5A 2R65A 1NJ8A 1NDQA 1XO1A 4IG4A 3VPAA 3DMRA 3L1JA 4FN5A 1A1SA 1SC1A 4DGSA 4L15A 4FBGA 3R7SA 4ZAYA 3WIVA 4Y1RA 4E31A 7YASA 4DY4A 4MW4A 3IQXA 3CB2A 1D0SA 1XAIA 1NA5A 3D0OA 3SG0A 1P72A 5JHGB 1B43A 5KJEA 3GAAA 3VDNB 4LJ6A 4BUCA 1E7MA 1ZM4A 4NTZA 2ZUVA 5BQOA 5B57C 3NT4A 1VPEA 3CVOA 4MA5A 4L1KA 2CE2X 2RSLA 1F4VA 4N0QA 3W5HA 2DSTA 2ZITA 2O8BB 1S02A 1V48A 1YCGA 3G5MA 1C3OB 4GRDA 1PDWA 2VCYA 3VUEA 1TM5E 4NS1A 3HWX1 2YOFA 3L8CA 2BFMA 1LK5A 5LVAA 3FZQA 3LC0A 1DIAA 5DX1A 1YK0A 3H5TA 1Y8RB 5A2GA 5K0GA 3QKWA 5DHAA 4X8HA 4AL4A 2B4YA 2PTGA 5PNTA 4YT2A 1JEQA 2H8KA 1Y63A 4JT9A 1ZH4A 2QY9A 3QX8A 3R6WA 3UMSA 3G2OA 3GDOA 1R5OA 4N5LA 1LV8A 4OQQA 4PG5A 3SF0A 2ENWA 3SYTA 3DO5A 4PNEA 4O2AA 2Z58A 1NLUA 1GU0A 4MV3A 4KR3A 4M22A 1CUVA 1TQ4A 4EHAA 1VCNA 1XYVA 2YVKA 4QNRA 2NTVA 3BRWD 3AG5A 3CE6A 2DPLA 2VBGA 3IIEA 3PQDA 4M1EA 5CDFA 1JIIA 2GPNA 2ZS7A 1P1HA 4KN6A 1A98A 1KNQA 1QVAA 4GMKA 1HG1A 1XAHA 3B2NA 1YB2A 3V2HA 2PMBA 3E9ZA 4WLVA 2HXSA 3KHSA 4F5ZA 3Q5DA 2A2ZA 4UPVA 1UF9A 3F98A 1TCBA 3ZR4B 4NBKA 1PVOA 1D2HA 1OBOA 1YR7A 4WEOA 3UC5A 3GYBA 2I7XA 4ZEWA 5IHPA 1N2XA 5JC1A 1DCMA 3PT5A 4IXDA 4MIEA 3AT1A 1PZGA 1N8NA 2NZ8A 1VOTA 1TT7A 2GZRA 5FBQB 1K2WA 1I4EB 2HCFA 3BHIA 3K1JA 3VVBA 4UNRA 3JXEA 1UKAA 2SNIE 1ENYA 3A1TA 3TZHA 1QHHB 4R1UA 2NAFA 4Z9FA 2JIOA 1BW9B 1UJNA 2BFAA 2R7KA 1XXHA 4ZI5A 2C4WA 4AZ3B 5C32A 1ZOLA 1VTKA 2FN8A 1UJ6A 5FDFA 3TQRA 1OJ7A 1PWYE 1U31A 1VCIA 2VBFA 3LXXA 3RK0A 3W1WA 1ZGJA 3B6JA 2UYQA 3NFRA 3OO0A 1ZNZA 3CONA 3W8EA 1GAWA 2Q5OA 1VQ1A 3PA8A 2Q62A 1QF9A 1WY5A 1ABBA 1PHPA 2VN8A 3K31A 4LSWA 2XB2A 2X2OA 4NESA 2C83A 2OB2A 4NBRA 4PTYA 4RE6A 1Y4AE 1J4AA 1G21E 1DHTA 1DPGA 4KQEA 4PYNA 4D0GA 5FI0B 5REQA 1M34E 1Z0KA 2A9KA 4WBXC 3VPDA 4CJXA 4Z4CA 3V4SA 1Q21A 4FWIB 1Z6TA 2QVYX 3L0IB 4UZEA 1VBFA 4L5AA 4BMCA 1UAYA 3C85A 2HJHA 2YWBA 3ZDYB 4PX2A 1V8FA 4LX8A 1I9GA 1SVWA 1QCZA 4N1AA 3LPCA 5K0ZA 2ASVA 3A31A 4JBNA 1A0OA 2A1UB 1SOWA 3HCWA 4YCCA 1GAJA 1Z08A 2OCAA 2SKEA 2ZUSA 3NG1A 1I0ZA 4HSGA 3R74A 1QRUA 1Q12A 2X1HA 3QV1A 4BNFA 4HGRA 2NO6A 4QUKA 4H1WA 4KGXA 2W5UA 2YTZA 1II9A 3SX4A 3CZCA 3IH5A 3RVMA 4PSCA 3JSAA 4N5MA 4HV4A 1EGQA 1PVVA 5GZ3A 3ZY6A 3CKKA 4GMDA 4RFSA 2MDTA 1LGYA 3W9SA 5KPJA 5B7QA 2C3YA 2VP2A 2FR8C 2A92A 3C6YA 3F6CA 3LX5A 4R1LA 5L7YA 2C31A 2ZUCA 3N6VA 3OC0A 4NL4H 4G8JA 4IIDA 4MS4A 2WHXA 1DBSA 3F6YA 1UMBA 3NHBA 5K09A 3K32A 2VSQA 5DU2A 3VKHA 1P9OA 2J5KA 3SXPA 4ID9A 4XYLA 1KP2A 2R5FA 3Q98A 5I9BA 3MT8A 1QH8A 1XZDA 4NVRA 4XYBA 4F1WA 3IQDB 1B74A 4Y7DA 1JDZA 1DFHA 1Q5PA 4ISBA 1JIKA 5KI6A 1FL9A 1GKUB 2ZREA 3PC8C 4RY9A 4RJLA 5FTKA 3TB4A 1USGA 1ISRA 1OLUA 1P61B 2GBPA 3PPIA 4IOJA 1IN7A 5EJMA 2XXBA 3BD9A 3ISVA 5EJEA 5ILQA 1DO8A 3IVRA 1LI7A 4PLTA 3OX4A 3RC1A 1RHUA 2JKYA 2PS0A 4GX2A 4J6EA 5DN6A 4YWHA 4ED9A 4ABTA 1KK1A 1THTA 5A4KA 1XIVA 2XGMA 4CL2A 4TYPA 2O8CB 2DTDA 4XOUA 5C1BA 1H66A 2H1SA 4JP5A 3WP0A 4DA9A 3ER8A 1L9XA 3ORFA 1OROA 3IPYA 1YHNA 3EXIB 3B6ZA 5AVXA 1W1IA 4Y2QA 5F5LA 3VDRA 1UK7A 1D1QA 1KXZA 1TKRA 2XB8A 3CVVA 3QRWA 1K86A 1JSCA 2ORWA 3E9QA 2G1UA 4GO1A 1YSCA 3FVTA 4YPOA 4HTFA 4JYCA 4C01A 1TZ2A 4BWGA 1G7SA 5G0VA 1PFKA 1NVEA 3LVRE 1V2HE 4Q1CA 3U3KA 1LVUA 2JBAB 3PCRB 2SBTA 3SC2A 1N36B 3FWKA 1LJUA 2ATIA 4TL9A 3D6AA 3IBTA 2Z08A 4Q9HA 4JJGA 3K9NA 1KAOA 4LAFA 1P3Y1 1G41A 1U90A 2IS4A 3F47A 3AV3A 4F56A 4HEA1 4CPDA 1Y7PA 3ZGZA 1P9WA 3E05A 3OLQA 2YVUA 2WIKA 3FMIA 3LPMA 5BV7A 2GHTA 4OQ4A 2FA9A 2ZT5A 2Q21A 3PFGA 4PO9A 3KOOA 1XZKA 3ENQA 2XSZA 1IYZA 2WDPA 4LDZA 4FFRA 3T4EA 3ZD6A 2OGWA 1ZVVA 4HS4A 4TTIA 1FYVA 1TLLA 2RGAA 3M3DA 3UH0A 1UWVA 4OI0A 1SU7A 5TPZA 3S2EA 5DNUA 3I2YX 4IVPA 3AH8A 3WNVA 2P4QA 4ND8B 1OT5A 2GK7A 2QEQA 1Y5NA 4BLVA 1U7HA 3P0EA 3ZD8A 2WFAA 1XD8A 1D6MA 1E63A 2OBLA 4FGSA 2NAPA 4TLAA 3VR6D 2OVFA 4I5IA 3HVUA 1AUVA 1YBFA 1GPMA 2OXRA 2EX0A 2QAGA 5D5PA 3EGVA 3HMQA 4L4SA 5EYPA 4LF6B 3PPYA 4WY2A 2G9ZA 3RC7A 2HIHA 2H4FA 1ZCAA 2H6EA 1DX9A 2WRZA 3BWVA 4C0AC 3OEHA 2TSYB 5DH9A 5K0LA 3WL3A 3ZPXA 4BJ5A 1OD6A 4HDRA 3BIFA 3GMSA 4Q93A 3RRNA 1V1RB 3K70D 2N9UA 3NWEA 5G3ZA 4DHEA 2A9RA 2NGRA 1I1QB 2BUAA 4GGMX 3X44A 5JRZA 2GNOA 2OBFA 4MPJA 5DBFA 3TE7A 4R0MA 2C3PA 4JXZA 2ZE8A 3E7WA 2ZW9A 1YVDA 3ENKA 4BE7B 1LWOA 2BEVA 4X6XA 5D84A 4FLEA 4LZNA 4MWCA 3O21A 4DQ0A 5AK5A 1W5BA 3KQUA 2OXEA 4C6RA 2XCSB 1WNFA 3D7NA 5KX5F 2AOTB 2F7SA 5AHRA 1TZKA 5JCOC 1LD3A 4OK3A 1H0RA 1LCIA 1TRKA 1LRKA 1WKBA 2FZ5A 3JD4A 4GKAA 4IGEA 4DMGA 1PAUA 2PMDA 3HEMA 3GFQA 1XKLA 3D54D 1V11B 3HSSA 4HUTA 1LS6A 4TYMA 1W9HA 2FX2A 5IH7A 2IXEA 4OQMA 4RSHA 4ZYZA 3RVDA 2C8KA 3B9QA 2Q7DA 2O2SA 2O06A 1YFJA 5D3MA 1IQUA 4AT1A 3M5CA 2V7EA 1UKEA 3GG2A 3S29A 5BUQA 4P36A 3TR6A 3BXGA 5BN5B 1UBHS 1U2DC 4IWXA 4NENA 5DYGA 5BSKA 3WMXA 2FPIB 3ZZNA 3HFRA 1LC0A 2R5NA 2QTCA 3PFKA 4Q9DA 1E89A 2HPHA 1JTVA 5SV2A 4IFEA 4ZVSA 4KKXB 1KMHB 4C06A 2P9JA 3Q2OA 4ZAXA 3AU8A 5FL7D 1G3IA 1JU3A 4MS1B 4WXHA 1N5IA 1NURA 2G36A 1SHLA 1JHXA 3OZDA 4IJKA 2AK3A 4URYR 3RGGA 5IRCD 2IYRA 2VKTA 3IBSA 4CIXA 1G19A 1YBMA 4LJAA 4WMLA 1FX0B 4UUQA 1SFRA 4LTMA 2RBGA 1RKXA 4NEHB 5F3WB 2WD8A 2O2ZA 2ZIVB 1J8YF 3EWAA 4HQNA 1R4ZA 3MLEA 1D2MA 2HRBA 2PFGA 5K2OA 1N78A 1J22A 1FJ2A 1G6KA 1N1EA 2EWMA 2ZGVA 3AF1A 4X45A 4W1PA 2ZK7A 1CYEA 3K0CA 3A2NA 1DS6A 2XRFA 3O6VA 2C0PA 1RKBA 1O87A 3DL4A 2I4MA 4H0NA 1FDSA 2HA2A 4OB8A 2COKA 1NXTA 5JZSA 4CEIB 3HDGA 5AK6A 3RODA 4CG2A 1BZYA 3AEZA 4C3UA 1KVQA 4NJEB 3FSJX 4ARAA 5L3QA 1NJGA 4QDZA 3C43A 4GR5A 4YECA 4TLCA 5AVYA 3EMDA 2IDKA 2XYPA 1DAPA 5KTMA 2X5XA 1FRFS 1E1CA 3OOJA 5JWOA 3PHHA 1S9HA 1HQYE 1WZNA 5CVVA 4JWTA 3L41A 3K1TA 2GYVA 3IPRA 4BB6A 2MYTA 1SXGA 4TT8A 5C1DA 1BTOA 2GBLA 2YJ6A 3PCXA 1C0LA 3R3VA 4F3KA 1J2TA 3K8QA 3TO5A 2ODEA 2XOEA 1ZRMA 4ZKEA 4QWWA 4UHEA 3RSZA 5E9QA 1JYEA 3AP3A 3EGXA 3PDUA 3PP8A 1NRXA 2ZT6A 5CJJA 5KX5B 1UFVA 4HWGA 1PDVA 4G0PA 2FW8A 2OUIA 2OHVA 2VVTA 5KHOC 1FDIA 1QHGA 1Q77A 5DI3A 2BELA 3OCCA 1OZHA 2QVCA 3EVGA 4H6VA 1C9EA 1CJBA 1D07A 2Z4TA 3EIQA 1JXQA 1LQTA 3IX7A 1NYRA 3TCKA 3V4PB 1D2CA 1Z4MA 1SHJA 2I6UA 3U3JA 3LBAA 5IVPA 3C7KA 1GN9A 1YE8A 1OOEA 2G9VA 4E7OA 1JLSA 2E4WA 3FW1A 1QIMA 3KFLA 1G1AA 4MWTA 1XRNA 2CXQA 3GNSA 5JY6A 2J3DA 3FYHA 5GIPE 3ZHYA 3P4XA 3UK1A 1UXGA 4B6QA 1LK7A 3W0LB 2IUFA 2WPDA 2DM6A 2ZJYA 3HBMA 3GNQA 1UM8A 5IZCA 1G60A 1V43A 3DWFA 3JYPA 2BMVA 2HRZA 1UBMS 4JDUA 3IDQA 4O4HA 4QYTA 5KTOA 2O5CA 4EL0A 2XUOA 4QXAA 2EFGA 2PFSA 3G1WA 1Y3BE 1C81A 2WJ3A 4UMEA 521PA 3GFBA 4JLWA 1QU2A 1U9IA 3C4VA 4HTAA 1O4VA 3EEOA 3ONEA 2E4ZA 4XJTA 5IZ4A 4B9AA 2YKGA 2HSJA 3QM1A 4UTZA 2G06A 5DNVA 4CUKA 2Z5FA 5E8RA 4UQLA 1J42A 4W5NA 1PO7A 1EX9A 1XX6A 4JSTA 2H11A 3G2PA 3ZV7A 4B3TB 4L5IA 5AQEA 5CX4A 1UDCA 1AH2A 2YXPX 3NANA 3IAUA 4IIGA 3U4GA 4JASB 4EPXA 2AKYA 3CRMA 5D2CA 1WAMA 2XUKA 1CJUC 5HCUA 1E5DA 4OJTA 2X8LA 3UV7A 1QCYA 3EF0A 4LY0A 1GPNA 5EWLA 1I2DA 1FW8A 1U3TA 3LT4A 5DHTA 3Q8KA 2JGKA 2QX4A 3AVXA 3PBKA 1CEYA 1FYEA 6NULA 2XUJA 2QY6A 3AB8A 4B3BA 5DM0A 5DW0A 3EZLA 2FNAA 2X19A 1RTTA 2I34A 1JECA 1CJMA 1X80A 2BFEA 2XHEA 4GPIB 3OO1A 4MUMA 3KE8A 5TIIA 3M3HA 621PA 1KJJA 4P3PA 5EQTA 1ECLA 1KS2A 5LDGA 5LB4A 2V98A 5CA0F 5KSZA 3M6WA 5JCZA 3C3AA 5DCWA 2G80A 3MJTA 5H82A 3ROFA 5M3BA 1FRVA 5CT4A 4OQEA 3UUWA 4IQFA 2RHTA 1NJ5A 1BXRB 1GR1A 5DHUA 3ZOKA 2WD7B 1G20A 1BX3A 2JLYA 1CUJA 2CNDA 3OWOA 4QHYA 3BXZA 2YHIA 4JUAA 4EA7A 3OTIA 2WTBA 2WFMA 1JBKA 5JSHA 3CLRC 221PA 1AS2A 2QRQA 2AZXA 2ZVDA 2EGHA 2G6TA 3PFBA 3E22B 1KBQA 5HPYB 1ARZA 4A5OA 1RHMA 1XTTA 1BFDA 3P9KA 3WAJA 5IBPA 2XVYA 1TA9A 3PIIA 3ZJYA 4MHSA 3PXEA 4PBRA 4QFCA 2PNFA 5C8YA 4K28A 3RDPA 3BT7A 1L4GA 2GWHA 5A4JA 1RWOA 1Y3IA 4TKVA 4UDOA 3BDVA 1QCCA 2CK3A 3C8UA 2Q5CA 3ID6C 4BIMA 3WDLA 2JAXA 3AXSA 4BNNA 2ZWVA 2ZR9A 1AUXA 1GTL1 1Y7LA 3MAJA 4MDYA 2ZB4A 5AW0A 1MF7A 5ALVA 1LX6A 5IUKC 4DG8A 1KYWA 3GWGA 1PX2A 2QD5A 4BV3A 5FIUA 1VLJA 2HLPA 3EPPA 2X0DA 4UOZA 5IDXA 3I5MA 1JEJA 3BAFA 1P73A 1QRDA 4KR0A 2DPXA 2RE8A 2BRUA 3TFWA 4UU7A 4IMRA 4B40A 3EUWA 5H0IA 1OGYA 4DR2B 5IT4A 2DCUA 1GD1O 1OASA 1U28A 2PUAA 3G8BA 1SQ5A 3ED5A 2JIPA 3T5TA 4BEVA 3ZDBA 4Z8XA 2VNHA 1PTJC 3OPYA 4BV8A 1SRQA 3S2IA 2MINA 4ZFNA 2X8WA 2YQ4A 1S3GA 1MJHA 3TW8B 4KV9A 2ZJBA 3DUWA 3OSUA 4R5HA 4KACA 4ZO6A 3ZBPA 2CNBA 3K05A 1J97A 1Q17A 4OKIA 3T3DA 4LMPA 1WDTA 2ACWA 3ZVKA 3FMFA 2WZBA 3L07A 1OJLA 4WI1A 2QL6A 3SBEA 2BP7A 2BI4A 3AVYA 1E1YA 3R44A 4YRPA 3VZDA 1DG3A 2Q0QA 2RHMA 1X1RA 5E9AA 5FTMA 3I62A 4QOIA 3PX3A 1YRYE 3FPKA 1DOAA 1V5IA 3H2IA 4CTNA 3K9FC 4X61A 1D9XA 2CDAA 5JMOA 4NCAA 4KYVA 5AVTA 1MC5A 2CFOA 4FS3A 2EJVA 1WXXA 3JALB 3H83A 4G2TA 3R7BA 1JXOA 9GPBA 1FBNA 4PQEA 5JANA 2X9QA 4XCVA 4KG7A 2OCDA 4GZ5A 1WP9A 5CA0B 1DJLA 3MW8A 4RTRA 2PZGA 3FPGA 4GMHA 5JIBA 3JD1A 1NPTO 4TRNA 1CZKA 1KAGA 4HR7A 2C03A 2F48A 1CNFA 3WNZA 3QK7A 1VHWA 1K8QA 2XYVA 4E08A 3SC6A 5CBPA 4HAOA 4RK0A 4XJXA 3IAS1 4QBIA 1A72A 1AXGA 1NY5A 3EFHA 3KT6A 3HZHA 4Q7EA 3M6IA 3PF8A 4YP6A 2WU3A 4CGZA 1XVVA 3AUAA 2CDNA 1QKJA 1U9ZA 3B36A 1MNAA 4Q4HB 2IK8A 3M3PA 3ORYA 4DL9A 1ODTC 3VJRA 1ZMOA 1GNTA 3D4PA 3ZDDA 2CJXA 4HWSA 1PL6A 3EGWA 4O2BF 3FRJA 1G9XA 4WESB 5BSUA 4KREA 1SZCA 3SKYA 1WKCA 1NFRA 2PVPA 2OP1A 3FYUB 4UPEA 3IRUA 3NI2A 4TWRA 4KQHA 5DGIA 3RC2A 4I1PA 1D6NA 4RFVA 1I7SB 1DINA 3KS9A 3O83A 5IP5A 4M1SA 1D4OA 3REFA 1P5RA 2YVAA 4FOSA 4KE9A 4F92B 1R6DA 4K9DA 3NDPA 2NVUB 5ALYA 2ZAIA 5AIBA 2BSQA 2WT4A 4J4TA 5ECDA 1WZIA 5EPUA 4BFCA 3EZ2A 4ZCIA 3K70B 1IHUA 1F12A 1TTTA 3H4IA 2GAAA 8ABPA 1HR0B 4E03A 2RKBA 3UWMA 1NGSA 4GXRA 2YFYA 1JQAA 4ZOQI 5A3QA 4CL8A 4TLLB 4V2UA 2XXAA 4I4TB 4DWJA 1MB3A 4BVBA 4PZPA 2VF7A 1X2BA 1X7YA 1YZYA 5GJCA 1RWMA 2QB5A 4Y6OA 3LY7A 3KG2A 4R8RA 3R7WA 5BSGA 1PD0A 1XOIA 4UUNA 3AI3A 2RHDA 4LK3A 5CP8A 5BN4A 3QU5A 4KB5A 2X42A 3G9QA 5MDHA 2SICE 3PHBE 1W9MA 2J46A 1XZMA 3GT7A 4M9SA 4C0JA 4CEJB 1XNRB 3JTMA 2ZWIA 1SCBA 1LRJA 3C3MA 3DTTA 2H51A 3LFTA 4I55A 3GUHA 1WSBA 1LSUA 2IEGA 3GEDA 4WK6A 1LLCA 1SMKA 4D9JA 3HL0A 1LXCA 4Q1DA 1J8DA 1R0XA 2OHIA 4B6GA 5KAPA 4D3ZA 4LY6A 2QK4A 4UAVA 1OR8A 4WVFA 4V1CI 2YVLA 1SXIA 1G5RA 1K3UB 2Q9UA 2VXYA 2BFPA 1N7JA 1AK2A 3IERA 3IP7A 3P0FA 3HWSA 4LDRA 4NDNE 3QWHA 5FOVA 4BO1A 1C1DA 4AVYA 2KM1A 1WX1A 4QOSA 1NP6A 4JFRA 2AG5A 1NN3A 3CH6A 3QVGA 3STYA 1DG1G 3JQFA 4NY1A 2VTBA 3AJ8A 2DERA 4MUAA 1W29A 5D51S 5LUBA 5BW4A 2QZ9A 2RGXA 3JASA 3EEIA 1CY6A 1W96A 2BHTA 2YC2C 2EQAA 3DFZA 5EE3A 4B80A 4UMFA 1U8AA 3I64A 4XRGA 3X3HA 1LVHA 1XXLA 1XU9A 3MERA 4M0FA 2FLVA 4G5OA 1US8A 5JJCA 3SLGA 3GCDA 4CFSA 1M1YA 4WIAA 2G5TA 2LGJA 4MROA 2VTEA 3FGNA 4W9NA 1BJKA 1PEKE 1H2AS 1Z7EA 4O2BB 3B7GA 4WFIA 3H2KA 1EG2A 3A6KA 5AKLA 4PFQA 1XN1A 4JBIA 3HP4A 1WPQA 2MHCA 2XA9A 2P3SA 1T0PA 2ECOA 3BSWA 1GZ3A 1MP0A 5EZYA 5HFAA 4DJFC 4HXGA 5HUHA 2AG6A 1QANA 3CXUA 1NXVA 1A8UA 3MTQA 3QE2A 1WMBA 4OJQA 4M1YA 5DGXA 3L1IA 4UXIA 1XKXA 2K4MA 3T95A 1EVZA 4MJ3A 5L51A 3HRKA 3QVOA 4AXBA 3FD8A 4KMSA 3FMVA 4DXDA 4MUJA 1ZLYA 2QUBA 4LXHA 4C22A 1VYHA 4J0JA 3ILVA 3ND5A 1E2EA 1JBQA 2V5UA 4DSUA 4IF4A 1KP9A 3L79A 4OHCA 4GLBA 1I51A 1PSDA 1SCAA 2R2GA 2OGSA 1OHHA 3GFFA 4ETIA 3OOYA 1WDKA 3N05A 4FB4A 4YEDA 4D44A 3H8VA 4HFJA 4LGVA 2F43B 3IUPA 4X7BA 5EHNA 1J0BA 2Y1EA 4YWJA 2I29A 2WNIA 3FNEA 4NOJA 4ODIA 4J0QA 1EUDB 2WJZB 4ZI7F 2IH5A 1UMDA 3W3ZB 2CFSA 2GCGA 3RU3A 1G18A 1NV8A 1M3SA 1H6DA 3JQ9C 1PFQA 3L0CA 4UCFA 4K6KA 3JD0A 3JVEA 1H6AA 3R09A 3ONDA 2H8GA 3R7FA 4TTAA 4YCLA 1Q3HA 5KC9A 1SBTA 3B13B 2NSJA 1F0PA 1F4PA 3TJZA 3TRJA 4A26A 1W5SA 4WA7A 2G07A 4BZXA 4DV4B 2LCIA 1KAEA 1A77A 3UB4A 3WZ2A 1BH6A 2I3ZA 3AZOA 3BA6A 3WLTA 5JYEA 1PVDA 4JT2A 2FSUA 1KQNA 1HA3A 1Z3IX 1WRBA 5CM9C 4B34A 4N6NA 3RU2A 3SR3A 3TNDA 4B2YA 1OXBB 4AJ9A 1JL3A 2QU7A 3PQFA 2XGJA 1QG6A 1S2DA 1KORA 1Y6ZA 2WSIA 3LV8A 1KHTA 3NRJA 4YJGA 3CWZA 2HCRA 3SE0A 2GN6A 5KOIA 3S3TA 1AA6A 1HORA 4M2LA 4CIBA 1KC1A 3SY8A 3KHTA 2WBLC 3IPAA 1VJ0A 2IHTA 2I6GA 2QW0X 3PFCA 4KN8A 2IY7A 3DD1A 3QIAA 4BX9A 3EMBA 4X7MA 1KI1A 2AC2A 2Q1WA 3PPXA 1ZAKA 4YP7A 5HFJA 4D2IA 4DQXA 3DL0A 1BOOA 1TRHA 2JLUA 4JXKA 3AIMA 5AHXA 1JEOA 1ETUA 1I6KA 3LCUA 3QG1A 2I6QA 4GXTA 5LBUA 2G82A 3V1KA 3VSBA 5HX7A 4N82A 1I80A 2A9QA 4R8VA 4AO8A 3EFEA 1GTZA 1W8IA 1Z7GA 4OHFA 2B5WA 3HKDB 3P9QA 1YA6A 1NKSA 2GPWA 3UJ3X 3KV3O 4IHQA 4QAQA 1FRQA 3EHEA 1XALA 5FYQA 1GP2A 2Q0XA 3T9AA 2BMWA 4KLNA 4PO3X 5FBKA 1P17A 3E7XA 3L6EA 1L8XA 3W6ZA 5AUPB 4X65B 4XVRA 2JGNA 2W2QA 3QKRA 4MGIR 1FUEA 1FP4A 1MX5A 3ILSA 4P31A 5JD3A 3OCXA 2IE0A 4FJ1A 4TWZA 4EGSA 1XNGA 2AZTA 4B4UA 4YRNA 3H6GA 3O8OA 1S2IA 1O89A 1XPJA 1NKTA 4GOND 3C6KA 3VSCA 3JQBC 1SXJB 4DJ5X 1X7XB 2AMLA 2HSWA 4LJKA 3WQBA 2CUKA 4PAMA 2XOXA 1EWKA 1AKTA 2AG8A 3IDFA 4NIMA 2FZLA 4DIKA 3GD5A 2OECA 3UBMA 1QVZA 1TQDA 2G4CA 2VRWA 1FP2A 2XPCA 4GNKA 4MB6A 5AR1A 4I8XA 5CTJA 1GQFA 1NT4A 2Y66A 2ZKIA 3BWCA 4URVR 3P97A 5EHIA 5DXAA 1IUNA 4IL5A 2YZ7A 4JK3A 4TLBA 4XGRA 1VLQA 3H8JA 5K3CA 1C0PA 5TXGA 3R7LA 3RRBA 1QWSA 4JOQA 1AN0A 3LCMA 3HJTA 3RWMB 1OH7A 3PRKE 2NZXA 2PXCA 4IKEA 4DNXA 3RKRA 1TI7A 2GXUA 2X1MA 4LHVA 4MQMA 1LSJA 2P7HA 3I1FA 4NU6A 4OHWA 3Q9NA 3B6IA 3N5CA 1RADA 2HQ1A 3GGOA 3NBAA 5CX1A 4B1FA 4ZQBA 3K3PA 5CA1A 3TZCA 1KF0A 1DZIA 4Y2PA 4NR0A 4QNMA 1HI9A 2FSIA 1FTWA 3RROA 4ER0A 3CMCO 4JC8A 4RQAA 2D5CA 5I7AA 1RJ9A 3CF2A 2FWIA 1YOVA 3TLXA 2OV8A 2VAVA 3MJRA 3JQAA 3QVJA 3E61A 4GYYA 5ALEA 1LSOA 1QIKA 2B82A 4KAFA 2ISSD 5E1MA 4ENQA 2QBYB 3GN1A 1TZJA 2XA1A 3GRYA 1YULA 4TKLA 4KQIA 1D03A 2P8JA 5L3SA 1O9HA 2WOOA 4RTMA 3AHDA 1E8NA 1KH1A 3L0PA 3A06A 2WTXA 3MGKA 4JC5A 4QDKA 1G4HA 4ZK2A 2SCUB 4P7KA 1N57A 2FN7A 3WLHA 4Y18A 2YDXA 2REXB 3RU7A 2QRVA 3LVQE 3HXTA 4M60A 4MRSA 4AY5A 1N2CE 1NWCA 4DMCA 3T41A 2IFTA 1U6IA 2JDIA 2YJ5A 1YUMA 1F6BA 2B9VA 3INTA 5ICMA 4HH1A 1NVKA 3MC1A 2ZRKA 2IKQA 1EBUA 3QW4B 5ALQA 5BSFA 1KJ9A 1XL0A 2WABA 1AO0A 2H2FA 1LQUA 4YREA 3RIGA 2A78A 4NBLA 1NE2A 2PWYA 4M6WB 4TL7A 3V2GA 1Z29A 2X4GA 3CFYA 2AN3A 3OIVA 2R0QC 4H35A 3DGEC 5BXQC 4L4YA 5EZ5A 3GZJA 3NAZA 4OXNA 4EYGA 4E33A 1M6YA 3T7KA 5B5SA 2PH5A 2GAJA 3NC4A 1Q0UA 1ZK0A 2DFKB 1SUIA 4GR9A 1LUAA 1WJGA 5FWXA 2NLOA 1E5QA 4L08A 4ZTZB 2N1MA 1UIMA 3CSUA 1PNQA 1Z6YA 2NTEA 2ZFUA 3A9TA 4XX0A 4B3CA 4CYMA 5LXTA 4CKXA 2N42A 4ZYVA 1RWXA 2BBTA 1IN6A 3OFVA 2VP6A 3I04A 3TL3A 3VX3A 2XUDA 3AWDA 1YASA 4J29A 3W2EA 3A6LA 1SCUA 5C3MA 1MABA 1VDZA 3I3SR 4H3SA 4B3FX 1GPUA 2IF2A 3EXEB 3C3JA 3L2OB 5B2FA 1NBAA 2CT8A 4IICA 1OX4A 4MDHA 1Q92A 4XCQA 4Y2HA 1T6XA 4BFYA 4BLUA 1HEUA 2VR1A 3GNTA 1B6SA 1P1FA 3MRVA 2IHJA 2PUJA 1MIOB 2LPMA 4GLLA 3V8EA 4DLNA 4QASA 4ZQEA 1JT9A 3TGLA 3PGKA 3D8BA 4ZCMA 4OLBA 2PMWB 4DY6A 4WXYB 5DBOA 1BWRA 3V7WA 1IBRA 2D3TA 2R8OA 2Z5LA 5ECYA 3A3YA 3GRVA 1UPAA 4EMTA 1YS9A 1R9NA 1VLLA 2X3YA 4AURA 4B7ZA 3BD7A 2YZMA 3MBKA 3G2IA 5DJ5A 2ET6A 2CVOA 2VUUA 2W6CX 4UM9D 1SOUA 4WZBE 3F9CA 3QUCA 4Q15A 4RVFA 1JHZA 2D0PB 3EG9A 1NFFA 3D0KA 3Q7RA 1Z4QA 2PZBA 3PTLA 3CNEA 3FPEA 5EY5B 5CRIA 5K3SA 4URXR 4IGIA 4HL6A 3FB4A 1Z34A 1S2LA 2A35A 3J7TA 3GFPA 3WGTA 3E9NA 3VR5H 5JOQA 2CLIB 4G4SO 1CZLA 2BONA 2EW2A 4CHTA 3VO2A 3CINA 2FJ0A 4UOEA 2VDQB 4LJLA 4NABA 1ORDA 3L49A 3NKLA 2V0GA 2AMJA 1IXZA 2FPOA 1VKZA 4NZPA 2CLDX 2JB9A 3RYFB 2ANBA 1Y5RA 1UBUS 2NO9A 3B82A 2Z6UA 3RH0A 5CYFA 2VNSA 1KE1A 3ZWMA 1FFHA 4FILA 3DDWA 3V4RA 1A95A 4NLLA 4WDQA 4X1IB 1NXWA 1UBNA 1DC6A 4M86A 5KNDA 1C3XA 3HB5X 1AQ6A 2JLWA 2FLWA 4IXMA 3FYUC 2NV2B 3KD3A 3KFVA 3VC2A 1BX0A 2OKGA 3FNHA 4F11A 1NR1A 3OSZA 2QZJA 4XDYA 3DE4X 2I3DA 3NHUA 3OZ7A 5CW1A 3KJEA 4EB8A 3K2QA 1T91A 1ZGBA 2ZRHA 4ZEXA 4AX8A 3DOUA 4RKQA 3MFQA 3IVXA 5DNDA 1EFLA 1WLYA 4LSZA 1YMQA 2E2WA 3DDNA 2OV2A 5B3KA 1ODFA 2B8EA 2BHSA 2Z2ZA 5GZ1A 1NMZA 4U7DA 4X64B 4K6CA 2EV9A 1GTRA 4MIKA 5FA8A 3R6DA 2EP7A 5CYPA 3LT1A 3ZIDA 4D46A 1XRMA 4ZYYA 1V7CA 1X7GA 1Z13A 2AEJA 1X1CA 1IM2A 3R77A 4HRAA 4KUGA 3TX6A 2RGYA 3K4HA 4RESA 3V55A 3DKVA 3SBDA 2XUIA 3UWKA 4OXQA 3HFGA 3GEMA 4WJKB 1PJSA 2JLRA 1JAYA 3VHLB 1Z82A 3UJ7A 4P4UA 3B1JA 1CQZA 4PS0A 2HHCA 1M6VA 5HE8A 4BNKA 1KK0A 4DDMA 2JS7A 1T9ZA 2IOQA 3HO8A 1DXHA 4YBRA 4DNOA 5A6VA 5KQSA 4WLOA 3HVIA 5JVDA 4B6SA 2MOKA 4LHSA 4J0EA 3A4LA 3Q0EA 3Q3JB 6REQB 2A59A 2JFVA 3JAKA 3ZGYA 2PTHA 1V3UA 1ZAYA 2WSSD 3CTPA 5HEKA 3T5CA 4DG5A 3E70C 4TKUA 3FBGA 3KR9A 5ES4B 5JBIA 2QLJA 3EFBA 5K6AC 5D6OA 3QA9A 3MTDA 4XB2A 4KOAA 4X3OA 4KWHA 3OURA 1GSOA 1U1CA 5KQGA 3RJ9A 4DIUA 1Z5PA 2VZLA 2BW0A 3CT4A 2VAWA 3U7EB 4FIZA 3EA0A 3BS4A 1RAEA 4TZ0A 1T9KA 2VP9A 2W2KB 1Q91A 3AOEA 4XSGA 2PQMA 4L27A 5F78A 3GLSA 2NTJA 1U04A 3MRTA 4C0XA 1OVMA 5BQXA 4PSDA 1K9SA 3RVPA 3B1ZA 4C3ZA 3JYQA 3G2LA 1HDGO 3DCIA 8MHTA 1Z7YA 3CNQS 4OYYA 3BWDD 7ABPA 3WLLA 1VFNA 5JTTA 3CUWA 3M4YA 3W05A 1Y1RA 1E9SA 3IESA 1T4DA 1R0LA 2C97A 3N2KA 2DUJA 1G8FA 3ETJA 4NH4A 3LSYA 1UUFA 4V0NA 4AJ1A 4YMVA 1G3MA 2VSXA 3VVMA 5I7SA 3A4VA 1U0TA 3TECE 2VDMB 4TUYB 2PU5A 1XUOA 2HSDA 3FSGA 3HV0A 3O1IC 2Q6LA 2ZDGA 1OSNA 1D2AA 2XMRA 3C7TA 4MYUA 4C4PA 2LD4A 2NUTA 3UWDA 3AV0B 1TMYA 2VK2A 2D0OB 3AHHA 3GBVA 4YJ3A 4YLGA 3CJQA 1BXGB 3FDZB 5FB3A 1RM0A 2I6FA 4JQZA 5I4BA 3W5SA 5M5BA 2J0EA 1DXOA 3WLPA 1IBMB 3CVUA 1H0SA 1PS0A 4K9RA 1WS6A 3M9LA 1G2IA 2FR0A 2GHQA 2OGZA 1Q7CA 3C3KA 3A9RA 3N2EA 5G1PA 4MRMA 1T10A 1VE1A 2HMWA 1OXTA 3OPMA 4MGHA 3V33A 4DBVO 3IL2A 4EKNB 1LJLA 3HA7A 3SXJA 1E9FA 4GL4A 5E4FA 3KLBA 1QTNA 3EXHC 3REGA 4A92A 5D87A 1E3SA 3E81A 4DNQA 2A94A 1UJBA 3O74A 4NX2A 4XR9A 1KRWA 2LKCA 3FAZA 3ISTA 3UXEA 1A4RA 2H9IA 3CEMA 3IELA 4HWOA 4RPHA 3LK7A 1REQA 2GBCA 2WTNA 2B0JA 3ABOB 3TPFA 1Z35A 2R5WA 3BIWA 3P9ZA 1PSZA 4UDXX 1RQ2A 2BVNA 2GO7A 4A9AA 1NNEA 2WKWA 1MB4A 3CU5A 5DM2A 1FFEA 3UPDA 2AR9A 2QQ5A 5GAJA 1B0UA 2A4KA 4D99A 4EB0A 1W5EA 2G08A 2ONKA 1IXSB 3OKFA 4WOJA 3A0UA 4G0UA 1GLGA 1Z0SA 2RAPA 3CX4A 2YWHA 2Q4DA 4CMIA 2J41A 2PX6A 1II8B 1KQOA 1QB8A 1CUZA 1G8KA 2RGNC 4KIUA 1JSLA 1NXOA 3N6XA 1A8HA 1QOQB 3PKIA 1SCDA 4YMSA 2RHLA 2DWCA 3VYVA 5JADA 2FRXA 4E6EA 2JIQA 1WUYA 3NPMA 4R0VA 1PFYA 4PPNA 2EHJA 3UAXA 2P9FA 3B7PA 3LTNC 3WNCA 3V7UA 2PMCA 2CSUA 4PNZA 2QUIA 3AUSA 2CLSA 1SKUA 4D4LA 5K6RA 1KI6A 4S1TA 2A9FA 1QB7A 1RJDA 1Z4NA 2WJIA 3H3FA 2W6QA 4BAGA 3UFXA 3CBGA 2IDMA 4JZKA 1T5LA 2AJDA 2ALJA 3KSDO 1UFOA 3I8SA 3EIXA 3FWHA 4YAKA 1M1XB 5JSUA 2V3CC 4ARBA 4CM1A 5LZ9A 4FQ8A 1KNXA 2J0VA 1J2UA 1EX1A 3BG5A 1NQ5A 1N9GA 2RH8A 3G02A 1O97D 1XU7A 3K30A 3QOFA 5F1KA 3T7TA 1TPZA 2ERYA 4X44A 5I3ZA 1K7EB 4EWLA 4B6JA 4CKEB 5JS6A 4LWQA 4OIMA 4IDCA 3P2JA 1YKSA 2EARA 3D7LA 4IUBS 3VKUA 1KZYC 4W9RA 3X43A 4NCBA 3RRJA 4RQUA 1PK8A 3OCZA 4QXQA 1FS6A 4ZT3A 1DV1A 3L02A 4HB4A 4XIGS 1QZTA 3FKQA 2JGLA 4RLHA 2R1TB 4YI3A 3T99A 1Y82A 4S04A 1PP4A 4D3DA 1MA3A 3KEGA 1TCUA 3R9KA 3F7TA 4GUAA 3T1OA 3GHHA 4JH0A 3UT6A 3ELYA 4FJ0A 2HWUA 2I2XB 7GPBA 3VVCA 3GJSA 1MG0A 2XQFA 3GLIA 2D2VA 5ULLA 3EDMA 1EDOA 3I4LA 5C37A 2OGUA 2WHYA 3BXHA 1MFPA 2C8VA 4PF1A 3D7RA 2OV3A 1NSFA 4JXXA 1RTKA 1GUAA 4H60A 4OLFA 1EK6A 4JLSA 4KWTA 4LXGA 2IYXA 3KTAA 3MWKA 1HEYA 3DMPA 4IAOA 3MTEA 1RKQA 2YN0A 5EGNA 2AR0A 5CB4F 2YHSA 3VPBA 2EQBA 2OORC 5CVDA 2HPVA 1MX9A 1I4DD 1NJ1A 5G1OA 3DTVA 2JEYA 2G77B 2D1YA 4JS0A 2O8VA 3LVBA 2AR7A 5K1ZA 1GNLA 2Y6VA 4O0MA 3T9FA 3FFXA 3M83A 1CQJB 1OXSC 1Q0RA 2YJTD 4X41A 2GO1A 4YQEA 1F7VA 3NBUA 2VDPB 1X7WB 4KDRA 4RHFA 1HO3A 5HBGA 4NPHA 2CGEA 5F1YA 5IHXA 4DUPA 2GPSA 4KQ2A 4YJ2A 1FSSA 3ZDRA 5TQ2A 4QQRA 2C61A 2HF9A 4WERA 2V0NA 5TF0A 4AZ0B 2MYNA 2JAUA 4BO7A 5AJXA 1W1UA 3AMVA 4K9SA 1VKOA 3O1HB 4GI7A 2X8AA 2IE8A 3BQNB 3MG9A 4BNTA 2B83A 1DKPA 2ERCA 2BH2A 2F59A 1IY8A 3DSRA 5H59A 4QM7A 1DRJA 1Z0FA 2BEUA 2QVZX 3IIIA 4ZT5A 3TL2A 1G2OA 1VLZA 2C4NA 3R7DA 2CKMA 3QU4A 1DRKA 2GILA 3KB1A 4JJ8A 1BMTA 5IM4F 3WTBA 2PGLA 4YT4A 3OIWA 2CLLB 8AT1A 2I71A 3G7SA 4MR8B 3QUQA 4A10A 5HHTA 2A7XA 1OC4A 3FZGA 3MWYW 4KNVA 4G41A 3OZTA 3RTEA 3UAZA 3U3ZA 3B51X 1YVRA 1DRWA 5D00A 2ZJZA 1QLWA 2GAIA 2L18A 3PJEA 3QMVA 3WK4A 5LIRA 2D5IA 4E5PA 5FFMA 2D2EA 1NNSA 1P2DA 4N0MA 2CMFA 1KBOA 4ZJZA 4BMVA 5KWVA 3C6XA 3H5WA 2IOFA 1A97A 5CFQA 5AW6A 5AJZA 3WGUA 2GTPA 2W9XA 4GYWA 3QPAA 2QIPA 2DKOA 2CJWB 5G4KA 1UKYA 5EZ6B 5I3CA 1V1MB 1Y1TA 2LRHA 1EJ6A 3DBVO 2C4MA 4M8LA 3D6TB 2O8NA 4KO3S 3TSAA 2GWRA 4FUTA 3DZCA 3ZWWA 3AILA 1KY3A 5AXBA 4HDKB 2H07A 3IPCA 4GI1A 2BFCB 4H27A 1SVIA 1IAVA 1YGYA 3LWZA 4HYTA 3EEQA 1J9ZA 1X74A 1Y3CE 1YRWA 2VBIA 5J59A 3HFJA 1E69A 1JVSA 1FY2A 5AJYA 3OQIA 4D45A 2R8BA 3RWBA 5HM8A 1PD1A 2ZE7A 1OYVA 2A86A 4KBYA 2PX5A 3TINA 1DJPA 2VYFA 1ML3A 4HJRA 1DDIA 1Q44A 3ZIAD 4TWIA 4DCMA 1YJ5A 1RRKA 3DBHA 2GJSA 1VJTA 2O3QA 4O4JA 4BYGA 1QQ5A 1K5PA 2PBRA 4NBUA 2EG9A 1CUXA 1GCGA 3FWPA 2AD5A 4YV1A 5AFSA 2V7WA 1KEVA 1RWVA 1XBTA 2C9CA 2HUNA 3AWIA 4HLUC 3VU9B 3WK5A 5F2OA 2CUNA 4L7QA 3Q7QA 2QSYA 1OXMA 4BNVA 3ZQ4A 4E12A 2JW5A 5ESDA 3JCZA 2HKIA 5ED4A 3ZWPA 2CV0A 3OA0A 1HFJA 5DYWA 4FYXA 3A14A 1CUFA 1NPYA 3C6ZA 1Z18A 2CHQA 3VJKA 1VMKA 4POAA 2QS9A 4N0EA 1Y6GA 4YRCA 3GLKA 1KJYA 1K8XB 1AU9A 1GFIA 3K0AA 3PDWA 1ODCA 1WOMA 3QTBA 3K92A 4KPYA 4Z9XA 3VR5D 3ZDQA 1F38A 1T1RA 1T5SA 3DA8A 4OI2A 4BO5A 2FMXA 3KT3A 3AFGA 4LZAA 3ER9A 2I6SA 4YK7A 4FW9A 3GLFE 4FYVA 1UAAA 3VC3A 1GCAA 4K05A 1G6Q1 4FQ7A 3F1LA 4TXMA 3RSQA 1KEKA 2JIDA 2GCNA 3LPAA 5BSMA 3C1UA 4URWR 2AVNA 4Q48A 4D56A 4CR7A 1S6YA 3CG0A 4A2WA 1KZ9A 3HYSA 2F3TA 4GOKA 4Z2AA 3LP8A 1DAIA 5EC8A 2M9MA 1JAIA 1Y7HA 5G4LA 5HGXA 3D6UA 4F5DA 3Q7TA 1OX5A 3PQ2A 4Q3LA 4QQNA 3FA2A 2H29A 5INTA 2HK6A 2IEZA 2ZKLA 4IMPA 1GRRA 2XZOA 1UXKA 2AI1A 4FFBB 1FXWA 4N0PA 3IP6A 1Z6PA 3KR2A 4B6RA 1TJPB 5DCLA 4BRSA 3PC7A 4GVXA 3K9HA 4Q18A 4UZSA 1QZZA 5KWJA 3IB3A 4N9QA 1QOZA 4JY7A 2GEUA 1E18A 4GOOD 3AF5A 2OCKA 4YRJA 5BRAA 4EJFA 3I73A 1G8YA 2ES4A 1O8BA 4L8WB 4V24A 3R5FA 4FEAA 1JUDA 1QC5B 2YIJA 1ZUIA 3QMMA 4FYHA 3DB2A 4Q3OA 2VT7A 3WLRA 4B48A 7MHTA 4HNUA 3CLUD 1L7EA 1PR1A 5A71A 1I3OA 2B7LA 3ROEA 4ASUA 1CDEA 1LB1B 3HJCA 2HV8A 3NKFA 3UMYA 4PQYA 4F2WA 2WYWA 1Q11A 3DEFA 3OFKA 4RD4A 3DCYA 2IPXA 1WDMA 3DV9A 4OQYA 1WMAA 3VSDA 4DILA 2QRKA 4U9HS 1H8ED 1K7XB 1Z2EA 3ZU5A 1A5ZA 5HK9A 4K03A 1AKNA 3WWZA 1F6WA 2JAWA 3KKPA 4OCZA 3IIMA 1OA1A 4NE9A 3BXEA 4OGWA 2P77A 3R3UA 3ZE2B 2P1DA 4B45A 5B4VA 5TARA 3A4YA 2HU5A 1G63A 1IATA 1YE5A 3CN7A 2D62A 1EFPB 3QOXA 4K9NA 4NBTA 4NPCA 2VRNA 1VGVA 3AIKA 3HYCA 4UTOA 3RT9A 2C54A 4NULA 1RCTE 3P19A 3N0TA 1WKVA 4NS4A 4I2VA 3OHPA 4EGJA 1TM3E 5DLQC 2IIQA 1MBZA 1MZPA 1MCZA 4HX2A 4JENA 5J1TB 4PPGA 3MUOA 1KXJA 1NR7A 5CXXA 1DTWB 5LL6P 2YY7A 1XTIA 5E7QA 4DE5A 5BVHB 5JW6A 1GZDA 4H15A 1XZQA 1ULHA 3GPIA 3FCEA 1TF2A 1KY2A 1L8QA 1S2NA 3A37A 2VHZA 2X5JO 4KFTA 1S1MA 3WL5A 3OUUA 1CQPA 1VJ1A 2O05A 4M9CA 1NZJA 3IAEA 3RFVA 1JH9A 4B87A 4OHUA 2QN7A 3E9RA 4OB6A 3MMNA 1D5WA 2ZXFA 2OA0A 1K1EA 5EG5A 2GARA 1TKBA 4N41A 1NUQA 3GPDG 5KSPA 1SUAA 2P9TA 5AI5A 4CG0A 4NCHA 2WA2A 4M8IA 5FPPA 2IL1A 4LOHA 1W73A 5CPBA 4BTLA 1IMJA 1N92A 3P9NA 1ZU4A 4CT4B 2HEGA 1OQAA 1RWQA 4CM7A 4D79A 4BQPA 2AFRA 2H4WA 4IV5A 3TZLA 1U2GA 2IGBA 4BFZA 3MMPA 1MORA 3INNA 4HY3A 1ZN2A 5JQGF 4GGPA 2WJ4A 1TDJA 3FVVA 4RO0A 4FHCA 5JROA 2PSFA 2O8FA 2TECE 2EFCB 2ZWMA 3FMGA 5H1YA 4NSNA 3T7SA 1PLLA 4G56A 4E5YA 3C14C 1WBBA 4PEVA 1U0HC 4WACA 1J90A 3L4JA 4KNWA 1W5TA 3G8CA 1EXVA 2B98A 1YR1A 1I2BA 5FNVF 1J1ZA 3G88A 2C2HA 4Z9BA 2VDWA 4J3NA 1O5IA 1UBSB 2R8PA 2WILA 1IN5A 1SCJA 1RZ3A 2ODTX 3LQRA 4FN4A 5EEHA 3V1UA 5G40A 2W6ID 1TMOA 2YMMA 2UZ1B 3A70A 2I33A 3K4QA 3LX6A 1M72A 4WRRA 2FETA 2QX6A 4PLPA 3SDZA 3ZXUB 5A2QA 2EKQA 1VRVA 4JWKA 4BIIA 3WIBA 2NT3A 2FDCA 1L4EA 1ZP6A 3B3AA 3U13A 4HNTA 4CF7A 3SHOA 1JG7A 4JB2A 4F84A 3HXMA 3L40A 4PSKA 1R5NA 5M29A 4ND2A 4Q4LA 3UAYA 2DWUA 5A7HA 1FUKA 4H2DA 2V59A 3D8TA 1KSGA 3UMRA 4EG7A 5LKRA 2DHDA 2PN1A 3E5MA 4FNAA 1KOJA 3HA5A 4JBHA 1QJ4A 3BMNB 1I4TD 4C20A 3AX6A 1GO2A 2BE7A 3T7IA 1Z0AA 4OMFG 1PS8A 4L0CA 2ECPA 2WOJA 4Q3AA 3GAMA 3IUMA 4QPDA 1NVXQ 2ECQA 2GCOA 1PU2A 5DIZA 1NTOA 3VH1A 3JQCA 1Q7BA 5F77A 1J2YA 1VA5A 3U7HB 3RKUA 1DRVA 5ICEA 5K8VA 3U7FB 1GLNA 5D7BA 3GUYA 2G1AA 2Y2UA 2NUAB 5KOHA 3CKLA 4K9OA 5TMBA 4QKQA 2GZSA 2OO5A 3VYRB 4L02A 2Y76A 4BO9A 1S9DA 3SI7A 3ECSA 4DTCA 4BXOB 1FUUA 1BNCA 5EJ7A 1SC3A 3OBBA 3NPAA 3TRDA 1XF1A 4BE4A 1XZEA 2Q0SA 2QG9A 2FDXA 2WKQA 3FR7A 3GLTA 4R7TA 3RS2A 2V6FA 2D6FA 5EUCA 2HBZA 3BSFA 4DLVA 2A5LA 2FPWA 4UTNA 4PGHA 4XD7A 1N4AA 5LUAA 3NORA 1XLVA 3RRXA 3A9SA 3FFTA 4PM4A 3I6IA 4ROSA 1U80A 5E6UA 4AULA 2QU8A 2DFVA 4ZCRA 1UP7A 1XAJA 2AX3A 1P2VA 2EG5A 3S99A 3SCZA 1Q7TA 3M0EA 3M4XA 1W30A 3OZXA 4LGMA 1OPXA 1E3QA 4TYQA 3DHYA 2ZSIA 2B4QA 4A0HA 3LLCA 2A0XA 2I7CA 4UBJA 4Q3BA 1J0XO 1VI5A 2WJHA 2G83A 1SKYE 4FDUA 1VYTA 3DE0X 5JQGB 1H8HA 1R1DA 1JE1A 2B4KA 4U2KA 3R4VA 1A04A 3RS3A 3HEAA 4ITUA 1AF4A 1UBFA 1ZMRA 5BSEA 4TTJA 2P67A 3DNFA 3KB8A 2DWPA 4MPPA 3GEBA 5LA6A 5EXSA 2LTAA 4PPQA 2W6MA 1B42A 5LKAA 3CO0S 3MELA 1KQGA 1YDWA 4F93B 4BB9A 2NVBA 3IIKA 3QXSA 4CEHB 5CB0A 2P30A 5D5QA 2CLEB 3B1KA 5LB2A 5L8VA 1IJFA 1DKRA 2ZIAA 1GCOA 4HB2A 4QLBA 3PVSA 2JGAA 1EQ2A 1FX1A 3OM9A 1R4MA 1T1EA 4JB3A 4QGBA 2HLHA 2I2DA 1NY6A 2QHXA 2EYQA 3S27A 4M89A 5HVNA 2I3GA 1HT3A 4DDUA 4G1EB 2WYOA 2FPPA 2YQ5A 3GGGA 1P39A 2GLXA 4CKZA 2MWMA 3KPUA 4HH4A 2IEBA 3N3AC 1JH8A 4RL4A 2NU8B 4F9TA 5FOTA 4X00A 4YNBA 1UJ5A 4C7BA 5J2UA 3GLGE 1N2JA 1VL5A 1EE1A 3NVKI 2XA2A 4IRUB 5AK0A 1IB6A 1M8KA 1E5TA 1DBPA 1L7NA 5IW8A 4DRZA 4QJIA 1JDBC 5EJ8A 5ED0A 1XROA 2JFXA 1N8KA 2QLMA 2ZIZA 3ADCA 4IINA 1E9DA 3TTSA 3R3YA 4ZVTA 1XFAA 3D8HA 4PHGA 4HNVA 2GRJA 3B3JA 2FW1A 3ICWA 3FDIA 3X2FA 4U9UA 4EJMA 4KYTA 4N7MA 2O57A 2W6ZA 2NU6B 3R75A 4OHXA 2B1RA 1GFWA 1L4BA 1T8SA 4IEEA 1T1JA 4L50A 5BR1A 3JQEA 1TAHA 2Y0BA 2CNOA 2GJ4A 1OAOC 3DPSA 2ZM6B 4JLVA 2RI6A 3FPFA 3K6JA 3NNSA 1ORRA 1YZQA 2XW6A 4MW7A 3L6DA 4FFVA 3UA3A 5JSZB 1RLMA 3LLVA 3I4CA 4J9UE 2IPNA 1WUHS 4DT1A 1XLTA 2J6IA 3HGQA 3T7CA 1P4AA 4H1TA 4DYVA 2FPMA 2IH4A 1D9ZA 5LWHA 2IX3A 3WKCA 1JKJB 3R6GA 1UP6A 2IHBA 1MLDA 2HPZA 1TYBE 3AR3A 3EYWA 4Y9RA 5DV9A 3O2QB 1EWRA 4LRWA 3RV3A 2F3SA 3E3LA 4PTZA 1KZ7B 1EFKA 1T2FA 4BC1A 3D2BA 2DTEA 1I33A 1HPLA 3LSTA 4KPUA 1MOSA 5LMZA 5EP4A 1T0IA 3TRFA 4FD2A 3F73A 2G04A 1TK3A 5HIMA 5CVUA 3U81A 1K0FA 1A96A 3C74A 3RBZA 1QF7A 2A1TR 4RNCA 4EITA 1NZDA 4TMXA 3L7MA 5JR3A 1M8GA 3VNVA 5JS8A 4LI0A 3CUSA 4QFMA 2O3TA 1YJCA 4OUDB 5KTNA 1RRPA 5TLSA 4K0KB 3PEVA 2PGAA 5JXIA 3GCGA 3EGDB 4GIBA 3RS9A 1NXXA 3JZFA 1IJBA 1O6CA 2A30A 1B3BA 2FR1A 1KARA 1MV8A 3EVAA 3KZCA 4RD6A 4RD0A 2HV9A 1QMGA 1ISPA 2C82A 3IKMB 1ZSNA 3VQTA 4EKEA 5BRJA 5LQDA 1HG0A 2QRNA 4TSKA 2XUHA 4K6MA 2FHPA 5FOSA 2VUTA 1F2UA 1NULA 4W5TA 3OF3A 3WZMA 3UG7A 3N9IA 4E07A 5JNVA 4B8YA 4UJ3A 4NZZA 1LNQA 1QV9A 3CJTA 1DC3A 1KZ4A 4P7JA 2W2LD 4JHXA 4LHWA 4LIPD 1LS1A 2QE6A 4J0FA 1TNDA 1Q0LA 3IRVA 4MDFA 1Q1BA 4D9NA 2JH9A 5CDFE 1CJTC 2NPOA 2QZ4A 4R3WA 1QHXA 1KYVA 3W6NA 3F4KA 3LECA 1EMDA 2QLBA 5KWEA 5LQMA 4KFCA 1R3DA 5FLXA 5ALSA 1AKWA 2JIZD 1F3OA 1RLUA 1DC5A 2XUQA 1G5QA 2X7HA 4MVJA 5C5CA 4CT5A 3M6UA 1SELA 4FMCF 2BKLA 1OWNA 4L2IA 1H1TA 1RC0A 3I52A 4JEMA 5LBTA 4JL5A 1RYBA 3C2QA 3SC3A 2O7NA 3IE2A 2OMEA 2XGOA 3UNXA 4A6PA 3A36A 4MUYA 3I04M 4RVDA 4MKRA 5HZMA 3RVRA 1BS9A 4KXWA 4YJHA 4A4DA 1VHDA 3AVPA 5CLJA 1IEWA 3TEJA 4LOIA 5DBHX 3U4AA 4EMBA 1XXHE 3FHOA 1L8AA 3WSVA 1T2AA 2OFPA 2Y4OA 2UYGA 4LCJA 4MPTA 1XDGA 1JV2B 3MCUA 4QXOA 3W90A 2H1RA 2V9ZA 1RJFA 1E0KA 1F6DA 5KNLA 1Z5ZA 3AF4A 1A8IA 3PLAE 2ZSKA 2VUSA 2EKLA 3M9XA 1CVRA 3RREA 4BO0A 1OGJA 2NSDA 4RW0A 2QXUA 3KUXA 4L0MA 4F6LA 3AHEA 4PE5B 3H3JA 2P6OA 3WLJA 4A8JC 3OJEA 3L82B 1CW2B 3VZQA 2VJDA 2XB4A 3O4VA 4XYGA 1ZD2P 5JQWA 3TWOA 1WHTA 3DLPX 4BQNA 1C2YA 4Q6BA 2GFQA 1UPUA 3IKJA 5ICFA 3ULKA 5EWJB 2P40A 5EIWA 5T4FA 1R0CA 4POOA 1D8AA 2JCBA 3R5XA 3UCXA 1J49A 4DIOA 1UMCB 4FFSA 4JBGA 4WKPA 1ZVQA 1ZC4A 4K9PA 4ARSA 3KQOA 1WQ4A 5A3JA 5K4GA 5EE1A 1PR3A 1E3IA 1I36A 2PIDA 1E1LA 3TTTA 5C80A 3ZHZA 5TEWA 1U8EA 3AR7A 5IN5A 4LJ5A 1K92A 4DPLA 3AI2A 1CEXA 4OG2A 5AM0A 4U2DA 1W581 1YZFA 1FS5A 4S0XA 3WGNA 1Y0BA 1WV1A 2CEAA 3JWPA 1FJGB 2PCJA 2YYZA 3DKRA 4KK3A 3O8QA 5EKUA 4AKEA 4XQGA 3ZK7A 3W06A 3BGSA 3OOHA 1TFRA 4GX1A 2KYRA 3SPXA 4LX0A 4Z6KA 3MN1A 4RK1A 4L4XA 5F7OA 3T1QA 2C2OA 1K0UA 3UK0A 2VHWA 4M87A 4Q02A 1P1KA 3PNBA 1GG2A 4S1VA 1W36D 1ZUNA 2IZ1A 2QORA 4LS3A 3A58B 4EFNA 2J87A 2QP9X 1EHYA 4BLPA 1QORA 5IJAA 2VJQA 1IOWA 2FR8A 3EBOA 3LD9A 2GFIA 4RD2A 5THQA 3ZZUA 3THXB 3IXMA 5CLGA 2JD1A 1ZUHA 1J33A 3C87A 6CHYA 4YJFB 3EWNA 5P21A 4ZGBA 4ZTUB 1R0SA 1VL2A 4QGSA 5JT1A 4IV0A 4L74A 3FHJA 5IC5A 3SQWA 1RXIA 4UHJA 1O0SA 2ZU6A 2W2VA 3K1AB 4RHCA 4L5JA 4RVSA 3VR3D 4EO4A 5C4MA 1PGJA 4Q05A 1G5TA 3ITKA 3PC8A 3FUUA 4BLRA 3GLQA 2DHQA 3KHKA 3FDJA 2PKCA 2OAGA 2PDAA 3BF8A 3SM3A 2W0SA 5IABA 2VA8A 1JHAA 5KNCA 5CU7A 1XZAA 4N7JA 1YT5A 1A76A 4QDUA 3BFVA 5HUQA 3MB8A 4H4DA 5AOVA 4OLHA 3G0HA 1H1LA 2QN6A 4BO3A 3ETCA 5KQPA 2P3OA 5AVSA 1HLFA 2OTCA 3TD2A 1CY7A 1VSUA 1JZQA 3JZAA 4QODA 4KQ6A 3GX1A 4Q7LA 3PWSA 1F48A 3HA3A 7REQA 4JGIA 4KDEA 3KK0A 3C8MA 1AKVA 3W2GA 2H0AA 2PRIA 4W1SA 3ONFA 2XLCA 3UT0A 2I7TA 5HF5A 5BVGB 3P0JA 4JAVC 4TN1A 2YWRA 3DDHA 1SVSA 3MTBA 5G0TA 1ISGA 5CCDA 3ONWA 2FWNA 2P5YA 2O4CA 4JBXA 4OHBA 3ZTTA 1VKHA 5SICE 4H7JA 1H94A 4FMPA 4PPYA 3JWEA 2D7DA 1MC8A 1RRCA 3K6SA 4YB8A 2Q9BA 3HKEB 2B8JA 4HAUA 3T3EA 4BNHA 3BRSA 4CM4A 3HRIA 4D0NA 1NI4B 2P2SA 3TKYA 1VI2A 2FOXA 2XZLA 4Q37A 1DAMA 3GLHB 3ICQB 4MEAA 4H3VA 3ZDAA 4M55A 4BQOA 5GONA 5FLEX 4BNMA 1A9YA 1M6HA 2Y4NA 3NOXA 3OA2A 2H16A 4QVIA 4XM2A 3ZI7A 1JJVA 5JJKA 3HB1A 1DJOA 2QTWB 1EE9A 2G7ZA 2PUWA 4KWIA 4IVQA 4MB2A 1EX6A 1Q6ZA 1WZCA 3W2HA 4DCTA 1O9BA 2AFHA 4ZDJA 2WICA 3JVVA 5HMLA 4IJWA 5IDYA 4YCMA 3THWB 3BYZA 4G0YA 1O97C 2JLAA 3HB9A 1LDYA 1P5JA 3OAAD 4JDPA 4MVJG 1P5FA 2KPOA 2NSYA 4RPGA 4UJ5A 5JDCC 3OKPA 4JLMA 4CKWB 5CG2A 5ITWA 1Q0SA 4GOLD 2CFCA 1KI3A 1XEXA 4BB5A 2REQA 3DDSA 3UICA 4LF4B 4Z9YA 1W6RA 3JWGA 4QE3A 2DQYA 1XCBA 2P3QA 4EPRA 4AQYB 5BO5A 5H83A 1MW8X 3QLVC 3E3NA 5LLTA 3ZGLA 4QBFA 1GXSA 3E7PA 3ETDA 4KV7A 2F2TA 3I37X 5BUCA 3KKQA 3OM1A 1IXYA 3B1YA 1M2WA 2Q2NA 3ZGXA 2Z98A 3H5IA 5H4GA 1I4OA 4RANA 2PUGA 1D6SA 2OHHA 3EZNA 3WAGA 3BA1A 2FF5A 2I8LA 4DMRA 2OHJA 1SUBA 3DHWC 1EUQA 2P9EA 1EFRD 3ZCVA 3DL7A 2M6RA 4ENTA 3IE0A 1E0JA 3CPHA 4MRAA 4ZALA 3KL4A 5LMNB 4WOBA 1RZRD 1L0BA 2V7QD 1XU4A 2H57A 2V4MA 1Z28A 4TS9A 4GMFA 2ACVA 1CLUA 1V5WA 2CHFA 4EDFA 2CZQA 2AVDA 1IOZA 1TOAA 1VLHA 1BWQA 4UCWA 1JA9A 4WN9B 1XVTA 5JCOA 1WA5A 4AN0A 1CU1A 4DYHA 1SD5A 3COJA 1WABA 3CUTA 2VP5A 3WR5A 4ALIA 5JE8A 3SGLA 4TYYA 1ZS9A 5AXCA 2PUCA 4GQAA 2RH4A 2YMQA 5FHRA 5TGZA 1M2JA 2BDUA 2VYND 1J56A 1E1QA 4P92A 3W8FA 1UM9B 2WT9A 5KJ6A 4W9MC 1WETA 4MWDA 3OQVA 2O7RA 3OOSA 4PN3A 4MI1A 4BLSA 1HETA 2OZLB 2BAGA 1XTRA 2VWQA 4KQ9A 2C1XA 1G1MA 1ADJA 5ELLA 1FDOA 1NRJB 3LX8A 5BSWA 1S4QA 3EGOA 1U2DA 3I9MA 3M4JA 4OA5A 2GEFA 1ZCZA 1Z6XA 1PJRA 2NV6A 3IULA 2VNAA 3P2YA 4DA4A 3NBZC 1E3LA 3EH1A 3WS7A 3DBIA 5KIAA 2VATA 5KU7A 5LOVF 3H5AA 1YFLA 4RYDA 2R7MA 3N0VA 4F2HA 2XGGA 3CUYA 2P75A 4HDSA 4BMZA 1Y8AA 3KEQA 4UNIA 3ZLUA 2BUBA 3ZE6A 1OYYA 1XCGB 1M76A 4GMGA 3TD9A 1FFCA 1LC3A 3GFTA 1NFQA 4C08A 1E79D 1EFHA 3EGCA 4F91B 2BR4A 1N3BA 4KFUA 4RS4A 4ZICA 1UMKA 2NQ2C 3P5BA 4AY3A 3KVOA 1TUGA 1OF1A 1U3GA 2R7LA 1PJQA 2RH5A 1K6MA 4RORA 3AIIA 1BDBA 2J30A 1OZFA 2H06A 1NVGA 4LMAA 4K3UA 3RG2A 1CR2A 1O96A 2VWGA 1PCXA 5FORA 4HQ6A 3BCHA 3F4LA 2JFNA 3D2AA 2JCGA 3A1EA 4GPAA 4S1PA 4DCNA 3MRXA 2A9OA 3VHXA 1NVDA 3IODA 4LJYA 5H5JA 1HT1E 2E4UA 3AYZB 3X2SA 2RJ3A 4IIEA 2MYPA 1GTVA 1FDRA 3GVPA 2PX0A 1XLUA 1YKGA 1PEDA 1LLFA 3C1AA 3EN0A 3EZ6A 1PGNA 5B55A 2QYOA 4N03A 2O4UX 4HG2A 3GQVA 3T7RA 1XQ9A 2AB0A 5HNKA 3E7DA 2MYUA 4MQEA 5AM2A 2J85A 3FVWA 2WKPA 4HFMA 4IDQA 1NRIA 4PYMA 5AKYA 3T5MA 1W0JD 1LSSA 2CLFB 1J23A 2A4MA 3RFFA 3W5JA 2XCUA 2V55B 3R7AA 1FRZA 2DR2A 1WCIA 3P5SA 1TEZA 3Q6NA 1P1JA 4QD3A 4UBIA 2YBDA 1G64A 1CF4A 4ALMA 3ZHBA 1Y42X 1BHJA 1C1XA 1IBSA 1WXWA 2P9BA 1OU4A 2VT3A 1T4CB 4QU8A 3ZXYA 1AMOA 1LEHA 2AI3A 3Q2KA 5K05A 4AI6A 4MI9A 2A5GA 3DHEA 4V3BA 3EZXA 4MJXA 1XPOA 4LOKA 1CUBA 5B4TA 4IRXA 4CL0A 4EX7A 5B6IA 4J94A 4P4LA 1L5HB 2OMKA 2I2AA 5CLFA 2Q4TA 3KXPA 4LCBA 3OFND 3CZQA 3GVHA 4JI1B 4RIIA 2IY8A 1GV1A 4QOFA 4E0BA 4Q24A 4U0JA 2UZAA 3RS0A 4W5RA 1OBFO 3P9SA 1QPZA 1VE7A 1F5NA 1H65A 3FLEA 4RLSA 3SP1A 5KMGA 5FWYB 2FFJA 4LV6A 5E6SB 3VFDA 3NHLA 3W3AD 5LOVB 5HQ3B 3QUAA 2ODAA 1BN7A 1JKMA 2XMBA 5TF4A 3LQFA 1UFRA 4D4HA 4D8WA 1FUYB 4M37A 3WHKA 1YQWA 2WD9A 3CNNA 4IZOA 1JAHA 5FA5A 4DIFA 1KJ8A 3TEMA 1YZLA 1I7PA 4ERNA 3ASZA 1VE3A 4R0NA 3SOPA 3NO4A 1ODSA 5HKKA 4LVUA 2CXUA 4NYJR 2W43A 3H1PA 3HA2A 3G59A 1CYDA 2NX2A 3G0GA 1E2GA 2QJFA 4O4LA 3FCYA 5GV8A 4EW2A 1UFQA 2CLKB 1I01A 3NT5A 4FLMA 1HOTA 1QH9A 1IJKA 4LE1A 4R1NA 3HKBB 1YDMA 4CIAA 3USCS 2H63A 1J99A 4J3FA 5ANRB 3TQFA 5C2JB 1C3OA 4LRYA 1JAZA 1YMUA 2WUWE 1SUEA 4IVNA 1VL0A 1HGXA 1Y8RA 4MTLA 1H0HA 3NBMA 5A1TA 4OU4A 3LP6A 2BBOA 2C8JA 2QROA 2IZOA 2R8RA 2XMGA 3EQ7A 1A5BB 1PT5A 3HCCA 3UJPA 4EH1A