1SD2A

Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
262
Chain Sequence
b'AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine phosphorylase
publication title Structural Comparison of MTA Phosphorylase and MTA/AdoHcy Nucleosidase Explains Substrate Preferences and Identifies Regions Exploitable for Inhibitor Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 262
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd2A00
1V48A 1ODIA 2QSUA 1PR6A 4X24A 1Z5OA 1TGYA 1CG6A 4I2VA 1A9OA 2OC4A 2BSXA 1RYZA 1RSZA 4TXLA 4QATA 1N3IA 4DANA 4TTIA 4GLFA 4F1WA 1YBFA 3ODGA 1JP7A 1LVUA 4ECEA 4F2PA 2AC7A 1RT9A 1T8SA 4U2KA 2OECA 4GMHA 2IQ5A 1T0UA 1YQUA 3NM6B 4OF4A 2QDKA 3ENZA 2AI2A 5CYGA 3DDOA 4MCHA 1K9SA 1U1EA 4OEHA 2AI3A 3FOWA 3OZBA 4JOSA 2I8AA 2OC9A 3LBAA 1U1DA 3P0FA 3MB8A 4F2WA 4LNHA 1YRYE 2PGAA 1M73E 1JPVA 2XRFA 1ULAA 2QTGA 4BMYA 4QEZA 3UAYA 1JDZA 3DPSA 3PNPA 4TTAA 3DJFA 1RXUA 2OXFA 2HSWA 5F73A 1XE3A 1VFNA 1PW7A 1RXCA 4L5YA 5F78A 4LNAA 5CYFA 1PK7A 1A9TA 1A9PA 4DAEA 1JYSA 2H8GA 4D8XA 1PR4A 1PWYE 4TXMA 5I3CA 3BJEA 3FUCA 1Z39A 1OVGA 1RXYA 3OCCA 1V4NA 3UAWA 1K27A 4LZWA 2B94A 1Z33A 4TYMA 3E0QA 3UAVA 1OV6A 4NSNA 1OU4A 1WTAA 4WKOA 3KUKA 1SD2A 2GUWA 5B7QA 5CCEA 1JDUA 4DABA 3EUEA 3OZCA 4K6OA 4D8YA 3EEIA 3FAZA 4OGKA 1Z38A 1SQ6A 1SJ9A 1Z34A 3FWPA 3KVRA 2ISCA 3KVYA 4G8JA 4TS9A 4DA0A 3C74A 4R2XA 1T8WA 1PF7E 5F76A 5JPCA 2QPLA 4DA8A 4JWTA 1B8NA 3OZEA 4TXNA 5IFKA 1ODJA 5F7XA 3E9ZA 3K8QA 4PR3A 4KN5A 1B8OA 3DP9A 4OY3A 1NC1A 1PBNA 1NW4A 3TL6A 4L5CA 3PHBE 3NM4A 1V41E 1A9RA 3U40A 2Q7OE 1Y6RA 4G41A 4NS1A 3UAXA 1A9QA 1Y1QA 3PNSA 1RR6A 3SCZA 1V45E 4G89A 1ZOSA 1YR3A 3NBQA 1ODLA 2A0WA 3O4VA 4D98A 4OGLA 5ETJA 4TXJA 4P54A 1PK9A 1ECPA 1I80A 3OOHA 3O6VA 4PNPA 3INYA 1U1GA 3UT6A 5F7ZA 1LX7A 4L0MA 5EPUA 4BN0A 4FFSA 4TS3A 2ON6A 4TTJA 5DK6A 4YMLA 4OJTA 3T94A 2HWUA 2A0YA 4M7WA 3LGSA 1U1CA 3OPVA 1TGVA 4IP0A 3KHSA 3GB9A 1V2HE 1JE1A 5EFOA 3KVVA 3DF9A 4LDNA 1PKEA 4E1VA 3UAZA 4JP5A 3F8WA 1JDSA 1PR0A 1Y1SA 1K3FA 1TCUA 5K1ZA 1PR2A 3K8OE 1V3QE 4F3CA 5KB3A 3OF3A 1ULBA 4YJKA 1Z36A 4QAQA 4D8VA 4QFBA 4YO8A 4QARA 4MCIA 1A69A 1TD1A 3MMSA 4LKRA 1OUMA 3EUFA 5F77A 1T8YA 4MARA 3NM5A 5IU6A 1RCTE 4WKCA 1Z5NA 1LV8A 3BSFA 1C3XA 5FAKA 1NC3A 1RFGE 1SD1A 4DAOA 1CB0A 1Z37A 4R31A 1YQQA 4M3NA 3E9RA 1QE5A 5C80A 1ZL2A 1Y1TA 2A0XA 3IEXA 4DARA 1Y1RA 4M1EA 4GLJA 1Z5PA 5CXSA 4WKNA 4GKAA 1A9SA 3ONVA 4TXHA 4DA7A 4YNBA 4BMXA 4EARA 5EUBA 5B7GA 5CXQA 2QTTA 4RJ2A 1PR1A 4NY1A 2AI1A 2RJ3A 1OTXA 3BL6A 3P0EA 4BMZA 1U1FA 2HN9A 4DA6A 3OZDA 1Q1GA 1JE0A 3BGSA 1FXUA 3FNQA 2A8YA 1T8RA 3GGSA 3EMVA 4QASA 5CCDA 1ODKA 1VHWA 4L6IA 5F7OA 3KU4A 5F7JA 1PR5A 3FB1A 3QPBA 3OOEA 1OTYA 5B7PA 1JDVA 3IOMA 4F3KA 4L5AA 3LA8A 3PHCA 2HRDA 4UC0A 4H1TA 4D9HA 1RXSA 1VMKA 3D1VA 4EB8A 1VHJA 4WKPA 4WKBA 1JDTA 1TCVA 1G2OA 2I4TA 4R2WA 2P4SA 1Y6QA 5B7NA 1Z35A
chains in the Genus database with same CATH superfamily
1G18A 3IP9A 2IXGA 2OBBA 1GQRA 3WNVA 1D2NA 5JS8A 2HPZA 5AVUA 1P4GA 2FW1A 2R00A 2Z4RA 5E6RA 1ODIA 2NV2B 1SPXA 4WBXC 1E94E 3U5TA 3G5MA 1R0KA 2QSUA 1F2TB 3FTEA 5DTJA 1ZIOA 3HFRA 2O06A 2C03A 4C0LA 2F43B 2FP3A 4Z0NA 1ZAYA 1VMAA 2ZSFA 4HDNA 3BM5A 1Q7TA 2D7CA 2CLIB 1EGAA 2A0FA 4M1YA 221PA 2COKA 1DQZA 2AJCA 5JWOA 1GPYA 3ONFA 4MKXA 4RKEA 2I03A 1GPH1 3SQXA 3IILA 3IQHX 4AUEA 3ZCQA 2XBLA 2ACWA 3PDHA 4O08A 1WZCA 2Y99A 3ADBA 3ZBQA 4Y2SA 1DAMA 1FTWA 4G8CA 4NQZA 5DN9A 1U3WA 4ESVA 1B16A 5U4QA 2XTZA 3CPJB 3Q8WA 2AQKA 4M8KA 3PD7A 2PQMA 2WIKA 1T8UA 4EPTA 1DUSA 3LQYA 4F5ZA 3ZDRA 1YBFA 1ZUNA 1QP7A 4GECA 2QTWB 1OWNA 1Z2EA 2AXNA 4FSXA 4JCCA 1PG0A 4MR8B 2QUZA 1E18A 2LPMA 1NZFA 3BORA 4MYHA 1WXQA 4HQRA 5CA1A 1YMVA 1XF9A 2AC7A 4YWHA 4ZYYA 2FQ1A 3D31A 3EDYA 2B1RA 3UB2A 1N9KA 4G0UA 2JAXA 1JJBA 5F9MA 1GN9A 3FDZA 3IIMA 4URWR 3ELDA 2EP8A 2XDYA 1HNZB 5C7IO 1BXZA 2FHSA 4MVJG 4ATNA 5JSHA 5LB4A 3K9WA 3F5FA 3SQDA 2FP4A 3TTVA 4L08A 3THSA 3OIVA 3FYCA 5CFRA 4KO1S 2QD1A 3CXRA 2BC9A 3J7TA 3O0TA 1R5NA 1CJTC 4PSVA 1Z5WA 2Q7DA 4K1XA 1KMIY 1E0KA 2YUIA 3NC4A 1YI1A 1JDBC 4JX9A 5I7RA 5TDHA 5LWHA 2HD4A 1VCNA 1QG4A 2RGNC 2PSJA 3THYA 4AKHA 4JUBA 1DRVA 2P2SA 1F2UA 3F3SA 2CLKB 3JATB 2PGLA 2VUSA 3KJNA 3MB8A 4HB2A 5HGXA 1H69A 4R8SA 1Z8HA 4CM8A 2PGAA 2CWWA 2H07A 1VE1A 4LGYA 3BFVA 3JQBA 4YAUA 1IZ0A 3OJXA 5CD1A 4TV8B 2XRMA 4ENRA 1PLLA 1KSFX 1OASA 4N5MA 4YCLA 2BGGA 1WB6A 1LW7A 3MWKA 1C9YA 1NURA 1S1MA 1TVKA 4P7FA 2HMUA 3CKKA 2WHRA 4RZ2A 3BVPA 2PUWA 1QHHB 6YASA 3KELA 2C9CA 1ZJYA 1L6RA 4ZWNA 4EJMA 1X1TA 5K05A 1NATA 5JR3A 1ZH6A 1LUAA 1SHZA 2E4ZA 4IX1A 4E3WA 2YQ5A 2QRNA 2P6MA 3T0IA 3U09A 1S3IA 3KQHA 4Q1EA 1T4DA 2QTBA 3B13B 4JYAB 3AM1A 3M6LA 3QLUC 3HPQA 3ISVA 1TQHA 4IAOA 4MUEA 2BGLA 3R9XA 1N6LA 1TUIA 3PEUA 2X0JA 3I2KA 2QBYB 4ARCA 2PZGA 3WKEA 1KI8A 1FSFA 1VHQA 1JXAA 1ST3A 3I37X 2OV4A 3SE7A 3VYSB 4ZTUB 1RPZA 2V74B 1VDMA 4G25A 3VR5H 4UTXA 1NBHA 4C21A 4ZCQA 2DUWA 2D4HA 2QVZX 1L4KA 1VL8A 3OY2A 1WO8A 2NV0A 3GEGA 4OVKA 5HR5A 4KR6A 3OCXA 3OKAA 1PL6A 4YQFA 4YPFA 1CJSA 1ISJA 3MOSA 3ZNPA 4IZ6A 4BP8A 2HOQA 2QTLA 5JAIA 3RSSA 3ZHVA 2D59A 2NT4A 2QA5A 3O1LA 4IO0A 4JQCA 5JZBA 3UPTA 4MPRA 5AOBA 4FYVA 4AYWA 4DMFA 2ZI3A 1X7YA 2BFNA 4N0PA 3SSNA 3LG2A 4KWHA 3D2AA 3D81A 4RJLA 3RQSA 3JALB 2J5QA 3BA1A 1JR3E 5F3RA 1H1LA 1QVAA 3O92A 3SXUB 3V4OA 1Z0DA 1Z18A 3KLNA 3NO4A 2D1FA 3WQSB 1ICEA 1B6SA 2CKDA 2I4NA 3QPAA 4TYMA 1TVMA 2VR1A 1U0NA 4U7JA 2RAVA 3FLMA 8ATCA 5H9VA 1CB7A 4FCVA 5CFQA 2HYDA 2R48A 4J0JA 4KDCA 1RWOA 5F35A 3COPA 3EJWA 3VAZA 1OY1A 3OLWA 5CYPA 3AESA 3IQIX 1PWZA 3L1KA 4JNCA 3VJMA 2A0KA 4TKVB 3P2EA 3NTRA 3KOOA 4K81B 4M0EA 1VKJA 2ZB4A 1HE2A 1XDUA 3FLBA 3T99A 1IULA 3KYIB 3ZNNA 3CTPA 4QLBA 4MP8A 3GLIE 1GYPA 4LSMA 1XQ6A 2BKXA 3RE1A 3X2SA 3IBFA 3OTOB 1EDBA 4KR3A 1FPMA 1R0BA 1GLVA 4BVHA 1B4DA 3FNEA 2Q8NA 5K4AA 2HF8A 2HMTA 1M2WA 3WOHA 1E3IA 4Z0PA 1G21A 1OFTA 3MLAA 2QN3A 5JQGF 3HN6A 2VWGA 3UT0A 1QOPB 2C9MA 2ZBEA 3O82A 4FIZA 1QX4A 1MC8A 4EVRA 4GU5A 2ZITA 5AKIA 4OREX 3SF0A 3KCNA 2GCOA 2FR8C 2WP0A 5A7GA 1LFDB 4R3WA 2CBZA 4UJ5A 4W6ZA 4BUCA 4G0VA 3ANSA 2PWPA 3TAUA 3A4VA 3UV7A 3PR2B 3QOWA 3MCZA 2VSOA 5KOHA 4J0QA 2QRVB 1GD1O 3HV0A 4TV9A 5CVJA 2AN9A 1M2GA 3NEYA 4EL0A 3EXG2 5IFKA 1HFJA 2IL1A 3PUHA 4C4RA 4ZV4A 4BE4A 3B3GA 4HWRA 4MLPA 4WNIA 1FMLA 2IHVA 4KN5A 2O4UX 4RMGA 3UCXA 1SPBS 1X2EA 1T9CA 3KR2A 2UUAB 2CW5A 2ZKIA 3D8SA 2C96A 1ITZA 2WHYA 4BWVA 3U7HB 3PJFA 1DQRA 1NSTA 3OZVA 4TQGA 4BQNA 5EHGA 4RIFA 4DBZA 3VU1A 1SEPA 4L7VA 1AV7A 1MC1A 3MXOA 1B7GO 1Y6RA 2X1MA 3AT1A 2BP7B 3BK7A 3GLKA 3IIJA 3MTEA 4H7DA 4TTPA 3HH8A 3U3JA 1IN7A 4PPYA 4TMKA 2YWBA 3N2LA 2RDMA 3LCCA 4M0DA 5DO9A 1FFYA 3ZJ4A 2UKDA 1QYCA 2JAUA 4AB1A 4P08A 5FL7A 2IYAA 1KFEB 2HCTA 2OCXA 3A1NA 4AX4A 2IDZA 3DEIA 2MYUA 4PNEA 3LY5A 2WR8A 3SCZA 3LUKA 3ZXXA 2N42A 5I51A 4BU1A 4ENPA 3H6KA 4RS3A 3A32A 1XP8A 3F0TA 4C29A 2W2PA 3KXKA 4CUZA 1B8UA 1RKBA 4X93A 1BX1A 2IS2A 1KBZA 3KM0A 4OCZA 3ZEAA 1W9MA 2NUAA 5M2QA 1N75A 3DT8A 1SQFA 2DUJA 1Q1NA 3AGPA 4YJFB 4CIVA 1LLQA 2IH2A 2NOAA 2A5YB 2GFIA 2JK1A 4TLDA 4WFKA 1U80A 3TLXA 3IMKA 3WZLA 1RM0A 4A6XA 3Q5EA 3L5OA 3O2QB 4BRSA 5K0NA 2ZJ3A 1XLUA 2LIPA 4CR8A 1RXVA 1C5KA 3GZNB 5DCWA 5G2OA 4C6TA 2PKEA 2PUBA 1VECA 4UUAA 1K5PA 3TX6A 4FMCF 4GRIA 3JQEA 2OE2A 5A71A 2GBPA 5FO1A 4A6PA 3AFNA 3N2ZB 4DUGA 1R0ZA 2Y1EA 4HEQA 4F9EA 3T1TA 3IALA 1P9WA 1RMYA 2FMIA 2V7GA 3FZEA 1IN5A 3BD9A 1HQYE 2SBTA 3HNOA 1XA4A 3ND7A 1FJ2A 4DPLA 3K6RA 4IKEA 3SS9X 1SBTA 5CIQA 3M4XA 1EXNA 3U1TA 1ISIA 4L0MA 4DEXA 2YVLA 5JYCA 1Z3IX 2YJ5A 3HCAA 2G4LA 4CBVA 3U4IA 2OCAA 4HNUA 4FFSA 1UZLA 1ZIPA 4TS3A 4C30A 1WQ4A 2OXEA 3ZK9A 5AXAA 4AJ4A 3PVCA 2RE8A 1Q1QA 4X84A 1RJEA 2Z6VA 2WWGA 2V7QA 4WLFA 5D5PA 5J2TF 2PCJA 3AFIA 3EC2A 3WLEA 5B2FA 2B0JA 2HWUA 4H77A 1ZVQA 4NENB 1Z62A 3TZBA 1OA0A 3QFRA 5DRYA 1IHOA 3OPVA 1NZJA 1LS1A 2IJGX 4COKA 5JD4A 3O75A 5IWAB 2WMOB 1W0JD 1FDVA 3PDCA 4EYQA 1OLUA 3KNZA 1ZH8A 2G67A 1QR6A 3GX1A 1JE1A 1UOEA 4MULA 2BFFB 3WGTA 5ECYA 3AQ4A 2C77A 3WSTA 4JP5A 1RAEA 2Y71A 4CR6A 5EP1A 5EZYB 4TM8A 4B3CA 4BECA 5AW4A 4DBLE 1Q17A 1F8UA 1PR0A 3PCXA 4CM9D 4UTPA 1L4MA 5K3SA 1P1RA 2HZ7A 3T6KA 1HKUA 2FRDC 2VLBA 4PANA 1O4VA 1PR2A 3BMNB 4CMEA 2VP2A 4GUAA 1A3CA 4FMDB 1FTQA 13PKA 4XWKA 2BKAA 4RHCA 2YN0A 1RMTA 3SOZA 3L84A 3NFRA 2ISSD 3OF3A 3U81A 1E1CB 3C48A 5IJAA 4IWXA 3UJAA 4R8KA 4DC0A 2C04A 3LNTA 3DR3A 4D9NA 5A3JA 3AUUA 2OAGA 4BTVA 2LUOA 4JBIA 4K6CA 3SMVA 5BQFA 4LE2A 3F5QA 1N6RA 3D1JA 3I58A 3OCWA 5EQTA 1K08A 1FFCA 5ELMA 3Q3VA 1G63A 1NFRA 2B5OA 2JASA 1N5DA 4Y0AA 4D0LB 2FWIA 5ERXA 3QITA 1P2SA 1B42A 4NMXB 4TLCA 2GN1A 4WLUA 2VHYA 1F4LA 3WDMA 1A69A 3QPDA 3AVWA 1II9A 5IP5A 1NL3A 2WWXA 3CEMA 1RHMA 3HJRA 3UXYA 1FFXA 4YECA 4RW0A 1JTVA 4RC9A 4HMOA 2QK4A 2W6OA 1DJPA 2BFMA 4A2QA 3VNRA 1MX1A 1PQPA 1XL1A 4BP9A 1E5VA 2DWCA 2NNWB 1R3DA 2XUDA 2A1TS 3O3OB 1Z5NA 2PUFA 1II8A 3LCRA 5T67A 3F6RA 1JQLB 3OMWA 2CB9A 1HKHA 4BMDA 2AOXA 2XE6A 3D3NA 2IGBA 3WHLA 1ECBA 1UZUA 3EXG1 3UMCA 4S1NA 2DEUA 5JNRA 3INGA 1Z37A 3ZE0B 2FG6C 5DLEA 1YQQA 5EUCA 5HFJA 1ODSA 5BYBA 4YMVA 1L7PA 4F4DA 5GONA 3EQ2A 5DTMA 2I7TA 5I48A 3NOXA 1SU6A 4Z3DA 3SZMA 1CRZA 3V1NA 5CDYA 3ZY2A 3TS1A 1XZLA 4CM4B 1NQUA 4TYPA 2KW5A 2YIJA 1M6VB 4IRMA 1F51E 4J3NA 1NMXA 2H06A 2P90A 5HIMA 2J3DA 4FHDA 2X23A 4I1RA 2XHZA 1N1DA 4KQGA 4O4JA 1DC6A 1ZIYA 2FFRA 1ADYA 1NJ1A 1HTWA 4Q4CA 5TS2A 1T2UA 3UOAB 3WC4A 1P2UA 4EJ6A 1OAOC 5J58A 1CS0B 4H7EA 3U4HA 3FYUA 2NVBA 3ZV6A 1U28C 5JMOA 1O77A 3ICCA 4ARZA 4D6PA 3QUAA 5JI2E 3OQBA 4J0DA 4BFWA 5J63A 2IV2X 2GZ3A 3DZHA 2Z8YM 5A3RA 1GZ7A 3Q7TA 4PONA 2DPMA 4Z54A 4URVR 1HFKA 2AMJA 1KPIA 5IK2A 3LT2A 1GQOA 3E05A 4LVNA 4D81A 2H2IA 1OX4B 4G1MB 4QXPA 4PU0A 1FZQA 3FCYA 2VP0A 5KKAA 4HAIA 1ZMRA 4NATA 2AW5A 4CMBA 2C8VA 2I7DA 3AINA 2P9YA 1KRWA 2HJHA 3AFHA 2WPDA 1K7XB 3KR1A 3PUXA 3K5PA 2TMGA 1YRAA 4CFZA 2C7GA 2X0IA 4AZVA 4WXHA 2M6SA 1GRVA 4L07A 1WVIA 3VR1A 4MQEB 1PGJA 1IONA 1BXRA 3HE3A 2GF2A 4NAHA 1T0HB 1BEZA 1EFUA 3EGIA 4I6EA 5BYKA 1UK6A 3S7TA 1FXUA 2W90A 4JOBA 3IBCA 3C85A 5KYGA 3D0RA 4Z7QB 2H1IA 3G2HA 1FYXA 2QL9A 2QVYX 3NWBA 4GAEA 3GRPA 1JHRA 2WJJA 3VO1A 1KO4A 4YUAA 5EEHA 2W48A 4GICA 1T5BA 1U5CA 4OUDA 1E7YA 5EC8A 3KU4A 4LJYA 2ST1A 3TSYA 2WFAA 3KQVA 1CZHA 5CDFA 3BXXA 4DIBA 4D44A 3PQDA 4XIIA 2BRUC 1XJ0A 1G5HA 2J1LA 2WZBA 3GGCA 4HGRA 4HH1A 1AQJA 4YGYA 1D0SA 3IP5A 3KHUA 1KYXA 1T1GA 4LXUA 3HY6A 1K6JA 2ONCA 3PNLA 4X8OA 4C9BA 4YX9A 5GJBA 3EXHA 3OSUA 4OMUA 3PWZA 1XTJA 1QJ4A 1QRDA 2XXBA 3G88A 2JEYA 3K0BA 4IG4A 4H1TA 3AP3A 3H0KA 1PEYA 3AF3A 5LMUB 4KGVA 5EQJB 1BJRE 5HS6A 3PEWA 3A2LA 3JASB 4HNQA 2MHCA 4R40A 2P1RA 3GLGE 4DR1B 1QV9A 2Z95A 3KKQA 4Y9UA 1J2EA 4TQUS 4F85A 4MA4A 4LF8B 3G89A 2VP9A 1SR8A 4MYCA 3JW8A 2XOKA 2J9RA 3BMXA 1FVXA 4EHKA 4F9FA 3B89A 1CZUA 2Q2OA 4MS4B 4BB5A 5D8DA 4AJ9A 4F8EA 3N2GA 4WY8A 4RVOA 3GZ4A 5J4KA 1T36A 1JQ5A 4C3OB 5JNTA 1U0TA 5J2UF 4I1OA 2NQ2C 2CJPA 3VKWA 5CAEB 5AD1A 4PPFA 2NMVA 2X8JB 1FUEA 2GXUA 3ABOB 2V97A 2QTAA 1G8YA 4G8BA 1ZN8A 3EYAA 3ODPA 3VUEA 4JYPA 1BYUA 1J56A 3MGGA 4MV6A 5JPDA 2CNBA 4B3IA 1B3BA 2CNWD 2YZNA 2PGDA 3N39C 3NPMA 1QTNA 1RXEA 1W1IA 4UEJA 4KACA 5EZQA 2YHSA 3SBXA 5GIOE 4FUQA 1F38A 2X0FA 5JFTA 5FQNA 3I9JA 5CVCA 4EG8A 5KWIA 2Y0DA 1QONA 3QWFA 1BDHA 2XNHA 3NORA 3ONNA 2VT3A 4NU8X 3CEPB 3DLBA 3OPNA 5LZ5A 4DB2A 1FXWA 1UBMS 3OJ0A 4GEKA 4H4EA 5MN6A 5KC9A 4XOIA 4AO7A 2FGJA 3SLGA 1Z0SA 3RF6A 3E9YA 1ONNA 3L7LA 3LPDA 3C8MA 3ZD6A 5K51A 4PYRA 2F1HA 2HLNA 5COBA 5DT9A 5ARBA 2WVJA 6AT1A 4ZT6A 4UUQA 3KBOA 2QJTA 3FLAA 3JYNA 2O8EB 3FCUB 3Q1LA 4FUTA 4RMJA 4ARUA 4UEWA 1AV6A 5A4KA 2P2NA 4NF2A 5HIIA 1YZFA 1YDWA 5BW4A 2XECA 1QHFA 1Y34E 3I5UA 2YUTA 3F47A 3KEMA 3PD1A 4HFRA 3E7WA 4KYIB 4RD2A 5DGXA 4ND2A 4HZGA 1RADA 3RVRA 4EAAA 1Q0LA 3DV0B 1P29A 1SC9A 2TSYB 3D4BA 3E61A 2J7PA 1OH6A 3EZ9A 3QIVA 1S4MA 1HE1C 4RA6A 4RLQA 3S2SA 2Y0CA 5I8PA 3NQ41 3OJCA 3ANLA 4KAXA 4YALA 3KXDA 5TARA 1NQXA 2VYND 5FBLB 3RSHA 5BN5B 1LRJA 1ILWA 1KARA 3K2BA 1J0AA 3JQGB 1BYIA 4ZOLB 1VBNA 1LLUA 2ZCVA 3DP7A 3MINA 4FZ5A 4II7A 1NDQA 1KA9H 4UBKA 4V0LA 3RSZA 3ZGLA 5E4FA 5ARDA 4DQKA 5LOVF 3WYAA 4AWBA 5AKZA 5FQOA 5ALYA 2OVFA 4UXIA 2VJDA 1NMYA 3KKKA 4NZZA 2XUGA 2WQ7A 1AUVA 1H2RS 5K8IA 4Y9DA 1XOIA 1YA8A 3LFHA 1X80A 2NPOA 1E3QA 3FMFA 1KZ4A 1Y8QA 3L6BA 4LNHA 4X65B 1KEPA 2WM3A 2SCUA 3IB3A 2AOWA 3NKLA 6LDHA 3IVRA 2QMEA 3QBTA 4WZAA 1KR5A 3H2GA 1L5KA 5FV4A 5JV5A 4M9XA 5FP0A 3VYVA 1N0VC 3KSUA 1ACLA 2ZB8A 4Q9AA 2GM3A 1NBWB 2X6TA 2Y0EA 3DW1X 3BB4A 3GRZA 4UE6A 1BMTA 2OZEA 1SBYA 4PAOA 5JSQA 1VL0A 3A4IA 3MMXA 4O29A 4WBSA 4YAFA 3TRDA 4DCCA 5B36A 2OO5C 1SB8A 2ZTVA 5CLHA 4D5EA 1GAJA 1EWRA 4BP3A 2XE4A 2QV7A 1CUVA 2JLAA 2A9PA 3ZTWA 2ARKA 2G28A 4X7MA 4ZVPA 1X1RA 2VKTA 3B82A 1H8HD 1LPBB 1GZ4A 2EX4A 3HUDA 3FJYA 4QLOA 4DLZA 1U1IA 2GB4A 1D7OA 1ZAKA 4LAFA 4QGBA 2UUCB 2X77A 1CX9B 1Y80A 1VBMA 2X5JO 2GEDA 4FI3F 5DH9A 5ERGB 4E2YA 4ZC8A 5B58C 2QMYA 4NQRA 3JR7A 5KYVA 4DJDC 5BNIA 3HCOA 5AM0A 3R0XA 3HP7A 4I1IA 1DEKA 1B76A 3DHVA 2P6RA 1QF6A 2Z5GA 5EKTA 2FSSA 1V8PA 3KJEA 3PNKA 3CWQA 3K0HA 4A4DA 4ENUA 5JOQA 2A2ZA 2W7TA 3F5SA 1PGQA 4JOQA 4L4RA 2XMRA 3ZDAA 1VP3A 4DSZA 3LIIA 2XHEA 3IP3A 4NCKA 1NAIA 4H6VA 1CVRA 4RA9B 5WRFA 3RVMA 4BKOA 4BE7B 3IAEA 5ES3A 4B81A 4CM6A 1E0AA 5DTEA 1CY6A 4KO8A 4CKZA 3AHGA 5EE0A 1DAPA 1XTPA 3ZHCA 4DDKA 4L5JA 1N7IA 2P1DA 5CVVA 2NQ8A 5TPZD 1GNRA 1Z75A 4DGSA 3UNXA 2OXCA 4RZUA 1NT4A 4YJDA 1JHAA 4HX5A 3MT8A 3S8EA 1Z5ZA 3ZW9A 1E4EB 1FYFA 2WJWA 1YWGO 2D4AA 3DKVA 4QHYA 5AVRA 5C37A 1OYVA 2WAYA 3IERA 4FYYA 2X0EA 3GPLA 1Y6GA 4D4IA 2BMAA 1F5SA 1IHPA 4COOA 3V7YA 1JMKC 4G0MA 1SUIA 1GWNA 1QWOA 2OZVA 1C3JA 2CDRA 5DB4A 3RVBA 3UJNA 3RKSA 5T8KA 2UVDA 4MKHA 5FTLA 3FNIA 1X86B 5LKAA 4QOSA 3QKIA 4M60A 2O8FA 3QOXA 4YAKA 3T1QA 5EHNA 5CCEA 4G0WA 2JA2A 4PY2A 2X3FA 4QOGA 3BWYA 5BUCA 2FCRA 1DE0A 3CONA 3D3KA 1XNGA 3EH1A 1YZTA 1Z82A 2QSZA 5ALWA 3IHKA 1U8YA 3CHYA 1TU0A 3EW9A 3QTTA 1JEEA 1KJIA 2OUIA 5KI6A 2WAAA 1EKXA 3ITEA 3ZHXA 3ZHQA 5IHPA 4ZVUA 2YDXA 2YS7A 3KVYA 2WD8A 3LVFO 4Y98A 5FTNA 3Q2KA 4U39A 5E0OA 1A8QA 2NZ2A 1A5SB 5CNMA 5EL0A 1PF7E 4CUJA 3R7DA 2J08A 3B53X 1R0YA 2H1LA 3DHYA 3F9IA 3K5WA 1BW9A 3ZQ4A 1AF4A 4YXWA 3VU9A 2ZI5A 1DXYA 1AHIA 3EVZA 2RARA 1NNEA 2BCEA 1D9XA 1KQPA 1O7JA 1HLGA 2G9UA 1BE6A 1L4BA 2JF0A 2P9TA 3CW8X 2Q5JA 3MGKA 3EEBA 4LHYA 2ZRFA 4CTMA 2Y92A 3ASUA 5EMKA 4Z86A 1JAHA 3THOA 6PFKA 3Q15C 4KO4S 3ESQA 4WZ6A 5ABPA 3HB9A 3W34A 5JYEA 1Y4UA 1N3YA 1B8OA 1K92A 4IJ5A 3L0CA 2HRQA 4J03A 5FLKA 2VDVE 9MHTA 2CLEB 3RI3A 1FNBA 2JFYA 2VIIA 3WMEA 3ZY5A 1EI9A 3VV3A 4L5CA 3DCJA 4UNIA 1TIBA 2XKBA 4KBGA 4DNOA 5BNFA 1IEQA 2ZJAA 2XOEA 2HYIC 3INNA 2D3TA 2JAHA 2ACEA 1X7XA 2EF1A 2CDBA 3RKUA 1XR3A 5EE1A 3KB6A 2JGDA 2DU8A 2OM2A 3QU4A 1LDGA 4KRXA 1XXLA 3AF1A 1XPRA 2XI4A 5DBIA 5DHTA 4MWCA 5EE3A 1J23A 4KGXA 3TGWA 1AB6A 2HPAA 3GXBA 3LS2A 3D5EA 3KYDA 1EUDB 2KHZA 5E6UB 5I7HA 4LY9A 1J9EA 3IJRA 3VKUA 1CDZA 1MAHA 5BPHA 1JT2A 5GADl 1JU3A 1RYFA 3CH4B 2DR0A 2Z4SA 3V5NA 3E2PA 3ZWXA 1Z4LA 1JQKA 2DY0A 2OZLB 1V45E 2P40A 3A6EA 5E6RB 4UFOA 3OUZA 4D9JA 5A4MS 3I05A 2GEBA 5IXSA 1QX3A 1VRWA 4UZFA 2OL4A 1Q0UA 1AKWA 3O8BA 5T4FA 3HUUA 3RK1A 5JNWA 1K75A 1P3JA 1NYLA 2MJLA 2VNKA 3TQSA 1V39A 4OQLA 4BBPA 1IAVA 4KSYA 2V7XA 1JR3A 3JPWA 1YCHA 5TQVA 2PGNA 4E4RA 3QWAA 3V8EA 2O05A 2WIJA 3BBLA 5C0OE 3SEAA 4ESOA 4ZYUA 2IUSA 3S1LA 5IX8A 3N2KA 1U9IA 2RGBA 1SIBE 2PMDA 5H9WA 4HI0E 1F2VA 3KTFA 3ETEA 2IF0A 1ISSA 3H9CA 1Y98A 3R7AA 4PF1A 1J5EB 4C0QC 3AJ9A 3CZQA 3ZIAA 3GEDA 4QTUB 4PNPA 1IU9A 1GILA 2DP4E 2NVUA 1QSGA 3AJAA 4IOMA 4DV0B 2EP5A 1FQJA 1G2IA 4FHEA 2QX8A 5EERA 1H2FA 2I55A 3DTYA 3RHSA 3VH2A 1T6YA 2ZRHA 3H9JA 5HNKA 1WHSA 1XMQB 3N8NA 1V43A 3TI7A 5CA1B 1I7QB 3RVNA 4JNKA 4R1OA 1E1MA 3SZUA 3R8XA 4H3KB 3ZVLA 3LCVB 2PUAA 3OEWA 4JJZA 4PLWA 5E3IA 4FD2A 4JGGA 3QQPA 1PFYA 1Z4OA 4KOEC 4GMGA 1FF9A 3FDZB 2D74A 1SVNA 2ECFA 3Q11A 3BIWA 2GYVA 2V9ZA 3LGSA 3STUA 4IDAA 4A82A 1HTBA 1VLHA 2FP4B 3X1WA 3K4HA 4GQBA 1N2HA 5FOUA 2HCJB 1CK4A 4RZIA 1TQDA 2JCYA 2P2GA 1ABFA 4P32A 4BVBA 4YRAA 4UHFA 3RTBA 1K8XB 3R3JA 4IIXA 5B1SA 2D8MA 3B70A 3P20A 2BFOA 1IXKA 2QD5A 4FJ2A 4QQRA 4JKOA 3VXKA 1K5DA 2EJTA 2NTVA 4YCNA 1VI5A 3THYB 4PGGA 5HE9A 4US1R 3KPVA 1K3UB 1NI4A 1OBFO 1A77A 1TJYA 4Z4IA 4A6EA 1QU2A 4FONA 3BXPA 1DEHA 4ZRDA 1RWMA 4CM8B 4ZT7A 1V3QE 1WP4A 4D92A 1M66A 3AXSA 1YACA 5GJCA 4E70A 2N1BA 3MRTA 2EKBA 3EY9A 3ZQ6A 3F74A 4Q4DA 1E7MA 4E0BA 3HPRA 3SDSA 5JAZA 3LQ1A 4R3NA 2PCLA 1TVKB 2DKOA 3GJ8A 3V2HA 2A7XA 2QW1A 3AEXA 3OX4A 5BSRA 1Z4KA 4ZOCA 5KSYA 3P9XA 4Z4GA 3A8TA 4QXQA 2ZUUA 3KAQA 2QTVA 3EAQA 3IUNA 3GFGA 1SU7A 4YMSA 4ZVSA 3TIFA 3ST7A 1G5FA 3FZGA 2FMKA 3F73A 1NY6A 2C7PA 5G0WA 3U1VA 3KB8A 4EX6A 2AMFA 4JAVC 2FI1A 1L7QA 2PRZA 3R9XB 2EJBA 3UUGA 4MROA 3Q2IA 4BVKA 4BYGA 3GJYA 1RBYA 1T8YA 5BWMA 2VHQA 3RAJA 4DIMA 4OQXA 4EPYA 3F6SA 1CJUC 3G9UA 2FN7A 4XLZA 4CTNA 3SM9A 3TIIA 4HDAA 1L4YA 4XD2A 1AQUA 4B6PA 5J40A 3NIWA 3RUFA 2H5IA 1Q92A 3WK7A 4PLGA 3UMVA 4LJRA 1ZGBA 4I3HA 1HL7A 4BDTA 4F4CA 2BLLA 4HWSA 5KMGA 3UJ7A 4KR2A 1AD2A 3DO8A 1T1EA 2BGRA 2EDAA 2BCJQ 4B2LA 1B14A 2HK6A 1AQYA 1X7YB 4KKVA 1EFAA 3FSJX 2A0XA 1YUBA 4ID9A 3E5MA 5A62A 1ZLXA 1TM5E 5ADVA 5JRJA 1H1LB 2PO7A 5KKNB 3IYLW 4U2DA 4JXZA 1E1QD 2DQ4A 3DTVA 1SBZA 1ZMXA 2PMCA 2IEYA 4OBBA 3EDOA 3L46A 4DA7A 5KTPA 3ROPA 3IKJA 1O96A 1WW3A 1W2GA 3OY7A 3ESAA 4JJIA 2V3CC 3LD9A 4KLZA 3S0JA 4BMXA 4G1UC 3NOQA 3WGHA 2AX3A 2X0RA 3AESB 3ZGNA 1WPXA 4Z9YA 1HPLA 4I9FA 1NY5A 5A1JA 1GG8A 2BMWA 1XA0A 4UBLA 3SICE 3W9YA 2R8YA 2ZAIA 5KTTA 1DELA 5LMZA 3Q8LA 4P93A 1UBLS 1JR4A 4CM5A 3I8XA 1D1TA 1D6SA 1EQAA 2QX7A 4EG7A 3BWMA 9LDBA 3ETCA 1IBMB 4QU5A 2HRBA 1X15A 1TTHA 4UREA 4I1SA 2Q9AA 4IVPA 5CNIA 1RBZA 2QE7D 3NALA 3Q3EA 6NULA 1G21B 4U0JA 1VPLA 4M54A 4UMVA 1FRQA 1KJZA 2V5UA 3BL6A 2ZVDA 1N25A 1NAHA 1XZFA 2HSJA 4HXEB 4DA6A 4Y1GA 3ELYA 4XWAA 1NYRA 3FETA 4Z8XA 3BX1A 1WQ3A 4A92A 1FP2A 1NQ5A 3GD5A 1O94A 1HDCA 4U9UA 4YREA 4TV9B 1OFGA 2Y8EA 3LUAA 1YCDA 2RGXA 2Q1XA 1MB2A 4FFBB 5F7OA 1DCTA 2HGZA 3WWOA 1GDHA 1ZKMA 3H1BA 1Q16A 4KGZA 4PQGA 2V8OA 3K15A 4I9UA 4INJA 4KREA 2C4NA 2JAOA 3FPGA 5FBVB 3G2NA 1HDRA 2NW6A 1QQ6A 3DCYA 2FFQA 3BJRA 3UJHA 5F98A 4KXLA 4MWBA 1I2AA 4H31A 1NWHA 4LMRA 4UC0A 5ED4A 4B0PA 2XCLA 1POWA 2C5SA 2PT5A 1YB1A 3HR7A 4JVLA 1P8AA 4O3MA 2OGTA 2CXRA 4W9NA 6CHYA 1VKHA 2QX6A 3MRSA 4TLBA 3TRFA 1NP7A 2HO4A 2OFPA 4I4IA 3ZHUA 5HF5A 2Q0SA 3DBVO 1SUFA 3O7WA 5LYYA 3AMVA 5AXBA 3QVSA 4B5LA 5CFLA 1RZRD 1N7GA 3VU3A 2FWRA 4BAZA 1U8XX 4C76A 4BGUA 5B55A 2X40A 4GI1A 2JKYA 5EXXA 1V48A 3HG7A 3D59A 1SKAA 2C3MA 3FZYA 1R50A 4NZNA 4YACA 5FUVA 2XQVA 4NYJR 4JMPA 4R54A 1EWKA 3GWZA 3KPJA 1NYTA 1C7RA 1IY8A 3KZOA 4BQEA 3BCHA 4Y7CA 3HJGA 4Y0VA 1L8AA 3N0TA 3PJDA 1K8RA 3K4PA 3IUEA 2BAGA 2O2SA 1XZGA 2C82A 4AFNA 1PR6A 3QE0A 3LP6A 1UMCA 3D6JA 3L93A 5JMPA 2QMQA 4ISCA 1CEYA 2PUJA 3EDQA 3I5XA 4QNRA 5IT5A 2GJSA 5IKEA 3PFBA 3CX4A 4OHZA 4AECA 4KRFA 1P4SA 5L45A 4UAUA 3S1SA 5J2TA 1GO2A 1TKCA 1ZONA 5IEBA 2VTDA 2HCBA 4JLDA 1W4BA 5F4BA 4KPEC 2ZZMA 1T2DA 1E3DA 3SR3A 1D6NA 5L3RA 4TWJA 3MCAA 4E46A 1VLMA 3UBTA 3HN7A 4M49A 4C0BA 5DNEA 4YP9A 4F71A 5I4KA 4KGDA 1ISHA 1YE5A 2Q6VA 2AF3C 3T5CA 5JDCC 2PLWA 2H5LA 4U7GA 3A37A 3C3XA 1E2LA 4RD1A 5LM3A 4RTNA 5AW2A 2C7OA 1DRJA 3LQRA 4Z4EA 4OK6A 3WG9A 3FM9A 2IDMA 5EIWA 4YUWA 1CWUA 1UWKA 2VHUA 1F3OA 3K09A 4BEWA 3FF1A 5CPBA 1SXJB 2PQ2A 3ILYA 4FOOA 4KXUA 5DTRA 4ZANA 1MXFA 1U2ZA 1NX9A 2OV6A 2PMBA 3AIKA 3NDRA 3O03A 1E5LA 1R74A 3LECA 4P3OA 4NI5A 4URHA 5ULLA 2EGGA 2C78A 1N36B 1E2PA 1L7AA 4J4BA 5EINA 3H05A 1HNNA 2OD7A 2PZKA 2ZT6A 1X1AA 5LZ7A 1LTHR 4GMHA 4D9EA 3SVLA 1I51A 3AH8A 3DL2A 4CQJA 1ONSA 1WDTA 5FD8A 1B0ZA 3LWBA 1OLUB 1JQJC 3BWCA 4PXYA 3VR6A 1G8HA 2NG1A 4RORA 2W2XA 1GPKA 1U7OA 1XLTC 2J33A 1YRQA 5CYGA 4DY6A 4KIGA 3PSAA 3OKFA 1S8AA 4ZEVA 2Y0BA 4ETIA 5EIXA 4AX8A 5AW5A 3VR2D 5LOVA 2I8AA 4NE2A 5HTKA 2WHPA 2HRZA 4Y1EA 4EBFA 4EHBA 2IYUA 2NWQA 2ODNA 4EKEA 2ZUBA 2QN8A 5SICE 2E3JA 3U60B 4L50A 4P22A 1QK4A 5I7VA 3KJHA 3UV3A 2Q28A 3BEDA 3SC4A 3HB0A 2OPBA 2ZJFA 3IT1A 3OI7A 4RH3A 3JQ7B 4NPHA 1K86A 1M72A 2XB8A 3EVDA 1ZD1A 3H19A 4EI7A 2WZQA 2Y77A 1NBME 2YWFA 3DMGA 4Z4HA 2HF2A 1KJWA 1T2EA 1WCIB 2P77A 2Q1UA 3HJAA 2RI1A 3GJZA 2QTGA 5AKEA 1Q1BA 3I1YA 4E21A 5ISMA 2HJRA 1L5FA 2QT9A 1USGA 4IZOA 2J5RA 3UN1A 1QU3A 2R11A 1HDZA 1JXMA 5K3BA 2HMWA 2GCNA 3CKMA 1NA5A 2B99A 3A6FA 4UASA 1JR2A 4D9MA 1G8GA 1UPCA 2YJNA 3TMYA 4RPHA 3MSCA 3NRCA 1CY7A 1VJ1A 2DRIA 1MO2A 1EFHA 1FFXB 1T2NA 1TUGA 2GZDA 2HUNA 2R68A 2Z58A 4LQDA 3JZMA 3HWWA 4OQQA 2EBWA 3IAM1 4BFLA 4G2TA 3A6DA 2QLLA 4RFLA 3R5HA 1GQSA 1II8B 3G0HA 3PPVA 1Q84A 3DOIA 4JOCA 3FKSA 1UFOA 5D1NA 1FB5A 3C39A 5JBQA 1YZ3A 4HVTA 2ZRAA 5AH0A 1E6WA 4DA4A 1G291 1A9TA 2AMVA 2VTVA 1MB0A 3D6UA 3M4NA 3DVRX 1OXXK 2WYUA 3EQ8A 5ALDA 1MGOA 1NLMA 2O2ZA 1L3BA 3R7BA 4B8WA 4HEA1 1BROA 1VPDA 2O7VA 4R1NA 3DBIA 2G7MC 5IW8A 3BGOS 4KG7A 2Z56A 3X1KA 4O4JB 4F2DA 1JG3A 3HCNA 2R6GA 3IMGA 1E3EA 2WHQA 3NEPX 3OCCA 5T3UA 4EHIA 4U6NA 1TEHA 2CL5A 4XQEA 3SF8A 4E6PA 4P4SA 4MUKA 2W00A 2EJCA 1EVJA 1OAAA 2CUTA 4BV9A 4EF6A 4DV5B 1A4RA 4DREA 5DT2A 5CYOA 1FIUA 1N2CE 1ANKA 2ASVA 2PBFA 4JA2A 4K9RA 3RHTA 3RF7A 3RSLA 2LP4Y 3UAVA 1OTHA 4MUJA 1PT5A 3NOOA 3K9BA 3OBIA 3CVUA 1P1HA 3WMWA 4ER0A 1YAHA 4XGIA 2H9AA 4Q1FA 1MUUA 2GUWA 3I09A 1U9JA 4MRMA 5ILGA 2PBZA 3T9FA 1D4FA 5DHAA 3F97A 3A6HA 3OOWA 1Y81A 2NSDA 5KNDA 2PVSA 2ZYSA 4KQIA 1TMKA 4L6CA 4DNQA 5KSZA 1E9AA 2PV0A 3IAUA 3JVEA 2EWMA 2WKQA 3DM5A 3FCOA 4NCIA 4B31A 1CR2A 3VYWA 4MXDA 2KX7A 2Q6OA 3BFKA 1CKEA 1TF2A 2ECKA 3L6DA 2RJOA 3U7EB 1YVPA 1TECE 2G1AA 2CXTA 3PQ4A 3L4JA 1BXRB 4A0HA 521PA 2OV8A 3A1VA 1C8KA 4RK5A 2B1IA 4TLMB 1T8WA 3GA5A 1K7CA 2CYAA 4CHGA 4Q4JA 2W2KA 4HWTA 1WZ2A 1B2RA 1RKVA 4KIJA 3OIYA 4MVJD 4JGIA 2UAGA 4F91B 1XRPA 2I9KA 4N9QA 2IZ6A 1RTTA 4GM1A 4OUDB 4UTZA 4JI4B 4DIDA 4R9RA 4G2NA 5I9NA 1ZP6A 5JXHA 4X95A 2HA3A 2WNSA 5J2UA 4Q3KA 5LQDA 4NZMA 3DHNA 1ZCJA 2UUPA 4Z9XA 5TY0A 3U7IA 3VUFA 1IM8A 3K8QA 5AUOB 3KX2A 5NULA 3UPUA 2VEOA 1XK6A 1R9MA 3EXHB 1XK7A 3H99A 4QUKA 3T15A 1NC1A 4IXNA 1QANA 2DFLA 4G9EA 4JMLA 1KQ3A 1PT8A 2JVKA 3NTVA 3QE3A 2C00A 2X1LA 3GFTA 4L73A 2D2EA 5JS7A 1V41E 4GXRA 1A04A 3HABA 4LX8A 3UAOA 1A0OA 1IQ0A 2HHAA 2JANA 1VKNA 4LYAA 3QFFA 3CH6A 3EAGA 2Q3JA 1OBOA 2CVFA 4XJTA 3RVQA 4FGZA 1UXKA 1AMOA 1MV5A 3JRWA 5L6LB 3BSYA 2HLDD 3UGKA 3AERA 1XG5A 5DNAA 2RKBA 1SCAA 2UZIR 3SKYA 3X0DA 2VPYA 1Z6TA 2Z2YA 3F7TA 1HL3A 2XVAA 3LBFA 3MWLA 1KS2A 4MYUA 4ZREA 1PUXA 4P4GA 1VZ3A 4ZHQB 3QXCA 1QIGA 1KAQA 3AV0B 4GE3A 1OVMA 5GV8A 3LY9A 1ISPA 1MJFA 3IHLA 4JU9A 2PKYX 4XA8A 3RC2A 3V7UA 1C3OA 2PLRA 4DQDA 3O3MB 1FNDA 2CK3A 4C22A 4RESA 2LGJA 2F17A 2YWGA 4PIVA 1D7AA 2H4ZA 2YHAA 1DDOA 2RCYA 2I4RA 2REBA 1AUOA 3O7MA 4J94A 3PT9A 4MO9A 4WXEA 4AZ3A 4HT3B 3O9VA 1H22A 3NHFA 4K6MA 3ZQKA 4FB5A 1K66A 4JB2A 3EWSA 1SOWA 4NMWA 3LPCA 3T9AA 4XB6B 3JYLA 2Z57A 2AIRA 3OPYA 2FY8A 2PSEA 3LZ6A 1CUWA 3KLOA 4LXQA 2CXQA 1J97A 2ZEJA 1TA4A 2JGLA 1YZLA 4WASA 5I6DA 3E22B 2B9VA 4BTEA 4PRZA 5TQ2A 3MQFA 2R6ZA 3I39X 3MBKA 3BOSA 3MCUA 4EDHA 2QJWA 2BBOA 4C0XA 4Z3OA 1FC0A 1T9HA 2YRFA 4B33A 2JGIA 2XWBF 4HPXB 2G9RA 3M5PA 4TVBA 4EGAA 1ZU4A 2JCXA 5DN6A 1KGDA 3OZSA 4KVAA 1MX5A 1EP3B 4R83A 4BNFA 2XEDA 4RAOA 1JALA 3U3ZA 1TI7A 4MWSA 3DXYA 1P72A 2CNDA 3NWJA 3PWTA 3O8OA 4RA6B 2E5FA 1P0PA 4TTQA 4F1JA 5BT8A 3I01M 3EXEA 4W6QA 1GFSA 1T3GA 1Z3CA 1DUIA 2C29D 4NFLA 5LZ9A 2HMVA 4ZFNA 2YFHA 4RZ3A 1M1NA 1TGVA 1PD1A 1NMZA 4QGFA 5GJVC 4J1QA 2HC9A 2ZDGA 3L8MA 1KI7A 3MINB 2RGNA 3N87A 2FUNB 2VUTA 2OFWA 4CVNA 1KZHA 2B7CA 4RKQA 3D64A 3Q3HA 5FYQA 3GDWA 4LDNA 3WMFA 2JAPA 5J43A 3R8FA 4QWWA 5BQPA 4KN8A 1XI2A 3UM9A 1QF7A 1R2QA 2Y66A 4UBMA 4ND7A 4WH0A 1RWPA 4FQ8A 4ABTA 1V4BA 1W4CA 1XBTA 4E30A 5GINE 5CX4A 1FRVA 1FMTA 2OHHA 5H82A 1SCBA 1Y8QB 1GNSA 2I6TA 1KEWA 2P9CA 2J45A 5JZSA 4X1IA 4XWYA 2SCUB 1XQXA 2QZZA 1GHTA 1UK7A 1Y3IA 4WZAB 1AH2A 1P1JA 3NYQA 5AP9A 4M9ZA 1GVHA 1TPZA 3A6KA 3NXKA 3QPCA 5JLAA 4J4TA 1MABA 2I0FA 3FNHA 3RYIA 3KZXA 5CCXA 1PYDA 2VUUA 1HEYA 1OGJA 2JIDA 2JCGA 1U0BB 3ZD7A 1AKRA 2NP6A 2IP2A 4E4YA 2YFQA 2YNMD 3BWXA 5F2OA 3TZQA 5KQRA 3QLUA 5KNBA 3SJ7A 1P5ZB 4IDGA 4YHHB 2R6CA 2X19A 2VXCA 3BULA 3N75A 1YE8A 2OHGA 4IQ4A 4QOHA 4FOLA 1GR0A 4JUCA 1FVFA 2W2LA 1CLUA 1MJ5A 2FJ0A 3BB3A 4Y2YA 3V1TC 3IQZA 1THZA 1R9NA 4LBWA 4UVHA 2YXPX 2F55A 3SJZA 3TIGA 3N3BC 3QVWA 4RYLA 5AWFC 3SXJA 1AKNA 3R1IA 4Z3KA 4GKKB 2J59A 4N5NA 3ZJYA 4A9AA 1HV8A 1CC1S 3G7NA 2IGTA 1XVUA 5JJBA 2IZOA 2VWHA 4HVCA 2IXBA 4FOPA 4QT4A 1I1NA 3QZUA 2VT2A 1EJBA 3CU5A 1CVIA 2OM6A 2ZIUB 5JC8A 1DBWA 5D5HA 1X74A 1AGRA 3EF3A 4DHWA 1B8VA 1NLFA 4HATA 4J3FA 4UU7A 4BO3A 2GPWA 1P6QA 4JYZA 1XZDA 4PQRA 5C8VA 1JWLA 4QGHA 2IP4A 4YUXA 1U7TA 1EJ0A 2D2VA 1PVDA 1SVIA 3ASZA 3NNDA 3L40A 4W8GA 4R9SA 4A6DA 4I9GA 3H9QA 4D8UA 1A7JA 2HSDA 3WRWA 3EK2A 3E27A 5A7FA 3FOCA 4TLLB 2AWOA 4Z1MA 3RT1A 4AP5A 3X44A 4MVWA 2QQ5A 5A3VA 4EI9A 4TS4A 3EIOA 5JDIA 3J81k 3HJTA 5G41A 3DEJA 4DM4A 1WABA 2ZJ6A 1ISFA 1XCMA 2HZBA 1XCLA 4TL6A 4A8HA 3AF4A 2F3UA 3BZUA 4J0CA 1EEXB 1VE5A 4LY6A 5EVCA 5IAKA 2VQDA 2X3YA 3LQKA 4JI1B 5LVAA 3SI7A 3DHEA 4RF5A 1RI4A 4TT8A 4DILA 2R751 2X5NA 1O0CA 3BSWA 2OKGA 3AY0A 3B6JA 1U8EA 2NZUG 2WYHA 3RVPA 5LXTA 3DBRA 3H1GA 2O8FB 4EGJA 2HJVA 1EINA 1IG0A 3E58A 4IX9A 4I14A 4DW8A 1JH9A 1WKBA 2QTTA 1P33A 4OHWA 2YYAA 3MMNA 5ILQA 4D45A 4KDEA 2ODPA 2G9NA 4IJMA 2CXHA 1QNLA 4ZU6X 3BWBA 3G1TA 4C4AA 4LEIA 3USZA 5C7YA 3PCRB 3AHEA 4ZAWA 2I6SA 3HI4A 1PYOA 1IOZA 3ACDA 2YZKA 4WFJA 4B34A 2ZSEA 3CX8A 3I23A 1UDBA 1KO5A 2MSEB 3KSAC 2XCQA 2A1IA 1O08A 2BUAA 3H7AA 4FEEA 4IMRA 3WMRA 4BMZA 1U1FA 4CMGA 4CFYA 1SZPA 3BIOA 1PQUA 3UAGA 3VX4A 3FNQA 5ITZA 1ZK1A 1BW9B 1CNMA 3QBJA 1GARA 3FROA 4G1CA 3QU2A 3OE1A 4I50F 4DLRA 4HK4A 4KXQA 4HRAA 2ID7A 1YJQA 2ZUFA 1J07A 3MWGA 5KNCD 5BV1A 1BU8A 4N65A 4JI0B 3LF2A 4QJ5A 2GZAA 4IFTA 2AZXA 1ESZA 1ZCAA 3BZWA 1X14A 5M34A 3OZAA 3VYUB 3ECSA 2IVFA 3N74A 1BCSA 1A50B 2UZ1A 3JAKA 2QT1A 1R5BA 2WKWA 1V2GA 3PEVA 4N7JA 2Z1DA 3IQWA 4DLAA 1TOAA 2EFJA 3CX3A 4B6FA 3TVTA 3B1JA 4J7XA 3WLMA 1I6WA 2GMWA 4DR3B 2FSIA 4G67A 4QTYA 4UNNA 5B4VA 4FGKA 4F7WA 4BWYA 1B1AA 1OPXA 4WBNF 2D62A 4YJGA 3N5CA 1YQDA 2JGDB 1H0RA 2LRHA 4MDEA 2FG5A 5L3VA 5C1DA 3HJNA 4LZOA 3ND9A 4D79A 1YR8A 2PZFA 4FJ0A 3TIXB 5C8DA 5HQ3B 1E9SA 3NC0C 3MFYA 1A1SA 3AY7A 4U6SA 3KYDB 3NTUA 4IJ6A 5HILA 2V0CA 3CF0A 3FGPA 4D3FA 3QJYA 1QHGA 3B7GA 3BGVA 5FBRB 5B7NA 5C18A 2HR1A 4DCNA 3GARA 3KO8A 3SJAA 1A27A 2MSKA 2ZGVA 1KE1A 2JJ1D 1RBMA 1Z83A 4TMVA 1R00A 5UKDA 1O0BA 1GVNB 2QQFA 1HSOA 1I4EB 4YR7A 1R4ZA 5DMXA 2HBZA 3HXMA 3SPXA 2VFAA 2LDBA 5BN1A 3VHLB 2X2EA 4YT2A 1GZSA 1BSVA 1S2MA 5H70A 3RIMA 2AXEA 3H5TA 2G6TA 4FE4A 3ZK7A 4AJEA 5KX5F 4OOFA 4D3YA 2EBHX 3NWEA 3N2KB 4O1MA 3KK0A 2A84A 2DWQA 4QJ3A 3HYLA 4OSEA 2AR7A 1NPTO 1GKUB 2CUNA 5F5LA 3PX3A 2JBAA 4AROA 4C43A 1DOZA 3P94A 4X6YA 2IEBA 1HY3A 4PSUA 2PH3A 1T3TA 4AM8A 1BXGA 3P9IA 1LH0A 1RYYA 4EP1A 2O3SA 2P9EA 1KNXA 2WSBA 3KYCA 4FHZA 2NVUB 3VHRA 4GLFA 1GZ6A 5LQCA 3W8FA 3RIYA 2I4MA 2QAGC 1FDTA 1SVLA 1WHSB 5ALQA 4ZCRA 3ZCSA 3TF5A 2GSDA 2K2WA 1E5QA 1JP7A 5CURA 4RTPA 1N2XA 2PEZA 2OCGA 2O2YA 1TQ6A 3PP8A 4V1CI 5JAHA 4O5OA 4PZUA 5FBHA 3WA7A 2F8TA 1KEZA 2Z98A 3OLQA 1YB2A 1TA0A 5CU7A 1W0KD 1OYWA 3EGXB 5TGTA 3NASA 1F0PA 4FTWA 4Z7NB 2RGGA 3VFDA 4DKXA 3U61B 1YVUA 3Q72A 4YCJA 2OORC 1Z07A 2XUQA 4FQ5A 3FI9A 1WCXA 3SY8A 3C45A 3SX4A 3MQ2A 1HDIA 2IFTA 4CZ2A 1JV2B 5ALSA 5AXDA 2VWPA 1L4UA 1U2DC 2YC4C 4H16A 2FRDA 3TQOA 1GUYA 3KPWA 4IBOA 1AKEA 1SU4A 4EY4A 1CLEA 4MX8A 2ZIVB 2EJWA 3ELWA 4B6QA 5C1OA 4C4TA 2YMQA 3P0RA 3CO0S 3VKGA 1SRQA 3G1WA 1NI4B 2GK6A 2BZ0A 4G81A 1G60A 1HO3A 3EXAA 3QY0A 5BR1A 2ZTUA 3I5YA 3ABIA 1M2VA 1UBFA 1Z68A 3RRZA 1NVFA 1A98A 3NYIA 3RV4A 2X4DA 3AG5A 2JIZA 2Q4OA 4B3HA 1IXZA 2GNOA 2H1RA 1RLUA 3RSQA 1FSPA 1Y7PA 3UC9A 1G66A 2G5CA 4NWIA 5L7WA 2Q5IA 4F4JA 4K6GA 5B4TA 5TIIA 1JPVA 1CNFA 3FY4A 1DAKA 1LY1A 2BOVA 3FTFA 2HHLA 5F1OA 4LDZA 3PQCA 2V5AA 3S4YA 2QTVB 4GOMD 4PQYA 3KQKA 5JCJA 2JCVA 3COZA 2O8CA 2ZYHA 2HQBA 1CU1A 1FYVA 1XNQB 2J3EA 4OP2A 3RC9A 3RTDA 2RG1A 4OA5A 1KJJA 2YJZA 5AK3A 3GLUA 3PVZA 5FFNA 4RSRA 1KPGA 3CJQA 5BVGA 2BPOA 3ETJA 1QNFA 1T9KA 1Z7WA 2AV6A 4PCUA 2H9IA 3G85A 4BJ1A 2D2XA 1KE2A 2Z2JA 4WDRA 3UUEA 1CEQA 3COYA 2REOA 3KZNA 4BMPB 3QKRA 3GDGA 1XJ5A 1C30A 2ORYA 3JQ8A 1L1EA 3PUWA 2IS4A 1D3AA 2P9HA 1L0BA 2QUAA 4FEGA 4WNAA 1VB3A 3WNBA 1WULS 4L4SA 2QYSA 1NUUA 4UVDA 4C04A 4C0JA 4CLDA 3GCZA 1SUBA 3MGAA 5KMGB 2I1VB 3K71B 1LDYA 4JGBA 2QG6A 1STOA 2DPLA 1HGXA 1PFKA 3KFXA 3C3CA 4Y2JA 2GVDC 4U2BA 2GX6A 1PWYE 2PUDA 4EO4A 4RQTA 3FUCA 4FWIB 4IXDA 1OXBB 1MNAA 5AVOA 4C5CA 1WETA 1U28A 1H8ED 2CNLA 2EF0A 2ZYTX 3OPMA 3I9OA 1AMNA 1MLDA 4A0QA 4JT4A 3QKWA 2G5GX 2MYNA 3ORRA 4E11A 5JQGB 4G0NA 1O96B 2P4QA 5JSKA 4X5OA 2YOHA 4RY0A 1KVRA 2C4WA 3AYZB 2O48X 5PGMA 4EZIA 5BORA 1MXHA 1C7QA 2QN1A 4ZU3A 3E0QA 1R8JA 5HMMA 4WLOA 1A4IA 1XDZA 2AQIA 2GK4A 4LHSA 5HM6A 1GAEO 3GRKA 4TWZA 1JPUA 1ZH0A 3MS2A 3NI2A 2VNHA 4NU5A 2XA1A 2V7PA 3F5DA 1J24A 4OYRA 2XODA 1J00A 2GN2A 1JDUA 1YB7A 2CUKA 1OXKB 1EMDA 2IA5A 4FFVA 5IMBA 3NAGA 4K6OA 1BRMA 2QIOA 3CUWA 1QKJA 4KXMA 4WHMA 4CF5A 5G40A 4D6XA 1I5OA 1KYYA 3D5QA 5LQMA 3U56A 5IKOA 1BZYA 3GGOA 3Q6MA 2FQWA 2R6DA 4PPGA 1R15A 2JFPA 2QL5A 3IP1A 5KVSA 1XVLA 1PCXA 3QEBZ 4UM7A 3PE3A 4QYMA 1ESCA 4YUYA 1M2JA 2ZSUA 3E7PA 2H7VA 4DWWA 2AR9A 4AF7A 2B21A 1DIRA 4K9PA 2SECE 3OEHA 4FE7A 1H42A 4YRKA 4QPCA 1M8FA 2V3VA 1RBQA 3A70A 3MT0A 4C88A 1IM2A 4N76A 2BRUA 4P0PB 3R76A 3K0SA 4HN2A 4BQIA 3M0EA 1M1YE 1OYYA 2NTNA 2Z1MA 3HR8A 4V0KA 3GEHA 3THWA 2R1ZA 4HR7A 4HXFB 2XQFA 4NAVA 5F23A 1SXHA 2V0GA 4YC7A 3LBHA 3MERA 4LYEA 4KEAA 4DWJA 4ZT3A 3EVGA 1ZO8A 4YYEA 5A6VA 5AKGA 4HOYA 4DLXA 4XZ3A 3ZBPA 1LJLA 2B1QA 1V9CA 4HRVA 4RTSA 4HVLA 4YRRA 1XLVA 3TCXB 2VHWA 1ZH2A 1Z6PA 3CGWA 4TSRA 1E64A 4WZBE 3ETLA 1OA1A 3ET5A 2BGIA 2DR3A 2JZCA 4KAJA 2IWRA 2AR0A 2DKFA 3N0WA 3ZPXA 4NK4A 1X7DA 2WD7A 4P58A 5EIEA 1ZINA 1IN6A 2IE0A 2I66A 3HY3A 4NZ9A 4X54A 1ZUWA 4ZOBA 2OQVA 4C3VA 2C8LA 3E1SA 2BVNA 4B7CA 2F64A 1DIHA 3L18A 2JIBA 4JI6B 4L2IB 3WBFA 4B7AA 3RCBA 3NJRA 4N9WA 1GRRA 3K5HA 4IOLA 4KKXB 4L4XA 5JG7A 1R9JA 2FH5B 2ZBFA 3DNPA 3TMKA 4D4KA 5GVSA 2FGKA 3BK1A 5HKLA 1OI2A 1Q21A 1JLMA 3NJ8A 4FMCB 4UUMA 4TQ9A 3ZV7A 5C9ZA 3SFVA 4QDOA 4Z2YA 1NXXA 2ZBVA 3DT9A 4OSOA 3VR6H 1O6BA 4Q37A 5C35A 3RBZA 1V11A 4K8OA 3DPUA 2WUDA 3BYZA 4X63A 4W7IA 2NTEA 1S0UA 4FILA 1X2BA 4MR9A 5GMOA 2G06A 1C41A 2YOGA 4Q93A 3BWVA 5ILOA 1ATIA 2V7BA 1L4GA 1B6TA 3I9MA 2YC2C 1UMCB 3BICA 2LCIA 4JVOA 4KC0A 3V9AA 4J0HA 3RS3A 3VPCA 2GBFA 5IH3A 4EENA 5JVDA 4V1CA 4PC6A 5IMSA 1P7VA 3ZTTA 2D5LA 2FPPA 2LW7A 2QUIA 3F8TA 3PPWA 5J2TB 3ZV3A 3JZAA 3WNQA 4DYVA 4L78A 3RVOA 1DPFA 2OOSA 5H8WA 1WY7A 4ISBA 4GX1A 2ZRKA 2W93A 5FNVA 5IF3A 3KZVA 3ROKA 4LZJA 3WMGA 1GCOA 2JRLA 4XCVA 4W1RA 3S7ZA 5T4EA 1QP8A 2XNCA 4RNDB 3RJMA 1QHYA 3HY4A 3L01A 3K31A 3W6OA 5BWNA 1M7HA 1Z73A 5B3KA 2PUTA 3OLXA 4D3ZA 2YV5A 1U7HA 1QK3A 1NPYA 3C5VA 3AILA 3HHPA 2H59A 4NEGA 3IAHA 1YHNA 3KV3O 4U3JA 5EESA 4WK2B 4ZZ3A 4DCGA 3HM2A 4KPFC 4ZI2A 3CF4G 1TDJA 3G9QA 4DLKA 3T5AA 2ORWA 1LX7A 1QG6A 4ICIA 1SKBA 3GUZA 4GR9A 4LV6A 5ALOA 1PWEA 1M34E 1QGUB 4TL7A 1T6ZA 1N32B 1LU9A 2XT6A 1W2HA 1KJYA 1FP4A 3NYRA 2ON6A 3QA3E 3DULA 2F00A 4J29A 4NDAA 4RACA 4M8IA 2EYUA 1MOZA 2BHRA 3O1IC 1DBVO 2XIJA 1VSQA 2QRMA 1Q7BA 1T5TA 1QFYA 3KSDO 3NGMA 3F5MA 3LKZA 5EFOA 3BC1A 3EEFA 2IYOA 1SUCA 4O2RA 5C7LO 5LOVB 3GJTA 4DVJA 2WHPB 5AHRA 3RFFA 3BRQA 1LF5A 5G1PA 4C7XA 4M0CA 1AE1A 2O0LA 2IPMA 1O58A 5FWNA 5HUJA 5IDWA 4OTZA 3DTVD 3LDUA 4YCAA 4B3SB 2QRLA 4ZCMA 1TYCA 2VXYA 4ZZ2A 3GVIA 1SG6A 3GPBA 2C4TA 4I36A 5L4SA 4P1ZA 1YDMA 2BFPA 4TL9A 3RVSA 2OO5A 1PZNA 1EB8A 4F06A 5AVTA 2Q1SA 5ALPA 5K20A 1O6FA 3AV3A 4CIDA 2G1JA 4OAOA 1ULBA 3WB9A 1HZJA 1LLFA 4RK0A 1N1MA 5GJWC 3TXYA 1RXWA 2WT8A 3KB1A 4I99A 5B2EA 4YMUA 4CWAA 4IDQA 4HSEA 2Z1NA 1YQTA 3R75A 1N2JA 4D02A 3HZOA 2IYYA 4ND6A 5GY7A 3RU7A 4CFSA 4AY2A 4QHTA 4GMFA 2IBSA 3GVCA 3CEJA 3WA6A 2GAFA 4KITB 4UEOA 3ZE9A 5HDBB 1N6KA 4HGZA 4LKRA 1DWPA 2K4MA 3DLPX 4EJ0A 1ID8A 3RNOA 2OENG 3EYWA 2UVPA 1JJAA 1UQUA 2C5EA 3TBFA 3W1EA 2WSLA 3RRNA 5F77A 2F7SA 1JA0A 3OU2A 5T3YA 1THTA 1HYBA 2JLZA 5IU6A 1N7JA 2JZNA 3E82A 5DHFA 4G4SP 5C8YF 2FU5C 2W83A 3VKHA 4YLGA 4ZIRA 1C3XA 1SC1A 2D0DA 3PITA 4TRJA 4L57A 1VL2A 2OR3A 3I4LA 4XUEA 1Z6QA 3I76A 3L02A 4R31A 1C50A 3ZY4A 3K70D 1NX6A 4F9GA 4DM7A 4QA9A 1A4XA 1O97D 1Q3KA 3SSAA 1U31A 2PT7A 3KSBC 1P7PA 2IYWA 3CF2A 4JODA 3WWDA 4QWMA 4CM7A 1Z0KA 5E8RA 4AN0A 1DKRA 5FUMA 3VDMA 4HS4A 1NVXQ 1P2DA 3ANYB 3IB6A 1SUSA 2XMQA 4JLVA 4OQMA 1JQDA 3CRNA 2IYTA 1R6UA 1YRWA 4P4SB 3SF8B 4EX7A 5JEEA 4HLQB 4JXXA 1H0KA 2FQQA 2WC1A 4JEMA 4GT1A 1Y42X 1AB5A 3ZWCA 1ZSYA 2J6IA 1KDYA 4BMNA 4W99A 3TH5A 2C3PA 4KLNA 5EXTA 2N9UA 3MRVA 3KKEA 1EM6A 4EARA 1E6MA 3RAGA 5EUBA 1YZHA 1ORVA 4MRMB 4NK5A 2FA9A 1L4HA 4W1SA 5T64A 4WWHA 2C92A 3UMJA 3ABRB 1E2KA 1FVHA 3HCEA 4IIHA 1NVAA 4MVCA 3ZZ1A 1MGPA 1YDFA 3B1VA 3ETNA 3G2JA 1SAYA 1V1MA 1PS8A 1YU6A 4XX0A 2W0MA 4BFCA 4KQWA 5EYPA 3WFZA 3I72A 2VJYA 3NG1A 3QE4A 1PR1A 4BB0A 3L04A 2BFDA 2XMBA 1KJQA 4UJ3A 3PEYA 3PRKE 1IUOA 4LV5B 3TLCA 3K9QO 3QVGB 5KPJA 2YQ4A 4GKVA 4MS3A 2QZ4A 4YB8A 3QI7A 2C5GA 2NZXA 2ZJ5A 1BAPA 2X2PA 1HE4A 2Q3CA 4HWGA 2PSFA 3PR1A 4HH4A 1AZTA 4CHTA 4EJ2A 4HQ6A 1W25A 1X7HA 5C5DA 2VPIA 2Z9DA 1U5BA 3I2GA 1Q1GA 1V8ZA 2W2KB 1AX9A 4Q4JB 1QFZA 3DHWC 4DLPA 1L5ZA 1T5HX 1XD9A 2PO5A 4E07A 3WLTA 4UUNA 4XD7A 4FGJA 3AUKA 3BJMA 4F86A 4ZU1X 2E87A 4FLFA 3BD8A 2RG7A 3EPRA 3SP1A 2BGWA 4IJWA 2PFSA 4KUHA 2RGCA 1QG0A 5J2UB 1MO5A 4EHLA 2NZYA 3VPXA 2O3RA 1SQ5A 2X4GA 3EVFA 3T12A 3FSGD 2J6BA 4YCDA 1X6VA 3T4EA 3TNFA 3VNVA 3P8ZA 4Q82A 1YRHA 2FOXA 1PR3A 1NF9A 3C4QA 2WZCA 4J1TC 2AE1A 1LKZA 4RF4A 4AK9A 2H1CA 3VISA 2VG8A 4D9FA 1NBOA 2Y6UA 2NUPA 5IAEA 3UHPA 3A31A 5LQSA 3R24A 3HU1A 4UFNA 4CYMA 3CE6A 3PFNA 2WG1A 3PHCA 3MD0A 2RHHA 3HCPA 4KDRA 1FL9A 2CHEA 2NU8B 4B47A 2WIDA 2WKPA 4F21A 2YHUA 4B6GA 3NZEA 4WKBA 2ONJA 2AJTA 2ZUVA 4JN6B 5K0CA 1NF3A 5FA6A 3ELUA 1VPTA 1U0JA 2PH5A 5DNWA 1TLFA 3CZMA 1U9CA 3F9CA 4R2WA 3AERB 4NH4A 4FCTA 1HLDA 3BRWA 4Y18A 1DBPA 2Q8QA 3KQMA 4KIUA 2AT1A 4XVQA 5KVAA 3NH6A 4GR4A 3LUCA 4UATA 5HQTA 4WUTA 3BJIC 4IDDA 1W88A 4O8CA 3ZWPA 4LQCA 3ACCA 4D9KA 2V98A 4GHWA 2N47A 3QVKA 1DP4A 4E7PA 4RCZA 1C3OB 1MPXA 3IS3A 1CSEE 2QY6A 1RCUA 4FFOA 5B1HA 1G9SA 2VK1A 4BUZA 4TWAA 4JJ6A 4UD2A 4QDUA 2X5XA 3E23A 1ZD8A 1E2FA 3TZCA 3PXCX 4AIRA 2VO1A 1AY0A 4S2EA 2EOAA 4AZ3B 2CLMB 3E1KA 3SJCA 4BFXA 2O5RA 4BDSA 3PQ6A 2I5PO 1TAGA 3MAGA 4UHCA 1GYRA 4D3XA 3E5NA 1E3WA 1EDZA 1EVLA 1MAUA 3H16A 3JZFA 3O95A 1H85A 4TTSA 5CTJA 3ROTA 3U6KA 2BSXA 3VR2A 1NF2A 3AO0B 4TRRA 5ALMA 1QIEA 1DWUA 4WACA 3WYFA 2YS6A 2A88A 3O0DA 3VR4H 1U11A 4KDFA 4FYKA 2GPTA 4PAWA 5TQ2B 1TTPB 2BFEA 3FCXA 5KNBH 2NO4A 4POOA 4JIGA 1OH5A 4BO1A 2P8JA 4FDVA 1E20A 2C98A 1EM8A 2EQBA 3PXDA 4MGKR 5DLPA 1E2MA 1VXRA 5BN3A 1GU0A 1PZGA 2R44A 3MGCA 4KJXA 2QNBA 5C46F 4DV7B 2UZ4A 3TXXA 4R0MA 1R0CA 2ZSKA 1A5BB 1EAYA 2WWVD 5FR2A 2YJ4A 2HMAA 3RHZA 1SUPA 1PZXA 1A2BA 1DIGA 1MOQA 2CNKA 1E7QA 4OHUA 4JROA 1XDGA 2V1XA 2LZ0A 4Z4CA 3KV1A 3O8OB 3TW0A 2LXNA 3N7UA 3EXEB 2CFCA 2R1TB 4UBIA 2IDKA 5IJ9A 4L8VA 4P4UA 1EWVA 1M1NB 1VFPA 2A5JA 4E33A 1JHXA 5SY4A 1YR7A 3V8VA 1JDBB 2P9QA 2FK8A 3GN1A 4ZJPA 5IKPA 2HXSA 1ZICA 5ARCA 4BEJA 1OLSB 2B30A 1ESEA 1L5MA 1T5OA 2PRYA 4XWGA 4OD0A 4TMTA 3R8CA 2AC4A 3KIPA 4X8LA 1GCAA 5IJWA 4ABYA 1KMQA 1I4TD 3JVVA 4R8RA 3EFHA 2KE5A 3R41A 3RROA 3I61A 1CQJA 1B0PA 2G04A 4CG2A 3T5PA 5HXAA 1F8XA 4X1IB 3O4RA 1UDXA 5CH3A 4KNWA 3L1HA 4UW9A 2JIPA 5L3ZA 4JJKA 4MI1A 4MA0A 1BC5A 2RSLA 2YVUA 3GN2A 2O3QA 4OJMX 4NJOA 1YIOA 3QW2A 3D7LA 4Q03A 2QQGA 3RYIB 4F6RA 4YMTA 3AEKA 3TBKA 3TD2A 3I4FA 1JGTA 2HV8A 2PAFA 1QWSA 4IINA 1XWWA 1SVSA 4B4VA 1QCZA 2A33A 4HG2A 3H2ZA 3I1IA 4L9RA 4MAMA 4OXXA 3OSZA 4WY5A 5BQOA 4O2BF 4MRNA 2EG5A 4A3SA 2OCLA 1E89A 1LGYA 4M76B 3REOA 1QGED 2QTZA 4TTAA 1VMIA 2XV1A 4BNUA 2K6GA 1UJ5A 2ADFA 2CL6X 2RGYA 4TKZA 4WLEA 2F1KA 3BXFA 2BW0A 3UYLA 5KTOA 3HKCB 2HPVA 2OBXA 3QUTA 4H4DA 4A91A 3P2IA 2HH9A 4UVIA 2XUIA 5KKCA 5FLEX 2P3LA 3CLRC 1FFEA 1K7SN 5H1YA 5E9AA 3RTEA 5LP6F 4U7PB 3AF5A 1FRFS 3AB7A 4OXQA 5E2BA 1FUYB 3GP3A 1PSDA 3JY6A 1UT6A 4J3JA 5H81A 3EPLA 3KEQA 3LHFA 4MR7A 3FWZA 3W2EA 1ZEJA 3F7NA 4O2AA 4BVAA 2VDJA 2HA7A 2XYHA 4JASB 2JKZA 4MV5A 4XVHA 2WPNA 4N8EA 2A86A 2NXWA 2XNDD 3RRXA 1M2FA 1NHWA 3M83A 1DI0A 4ZVTA 5AW1A 3OKPA 1U3FA 3PC3A 2GBLC 3DQZA 1H3EA 2WSSA 3FAKA 4DEYA 2GRAA 4CF3A 2JLUA 5CVDA 121PA 5F2NA 1RWBA 1RXYA 4QO8A 1A97A 1SBQA 4XTRA 2QN2A 3M81A 3GY0A 4GQIA 4O5AA 3FYSA 2JDIA 4MI3A 5IYZF 4DN6A 1N9GA 4HC4A 4XXHA 4Z99A 4PGMA 2P79A 2ZQZA 5CJ2A 2DC1A 2NZVG 2EBFX 3CLVA 1AMUA 1CY0A 3MG9A 4LZWA 3OAAD 4KTVE 4PZEA 3DOEA 4B40A 1ZHOA 3J7AC 3GROA 2WJHA 5KVCA 5F2EA 3LYAA 5HUQA 5LXTB 5A9TA 3HU5A 1WOYA 3DBRB 1VM6A 5IT9A 4AI6A 3Q8KA 4GPZA 4M87A 1ZITA 2FAXA 4GPBA 2WE7A 4FSHA 1GPDG 4BV2A 4QECA 3CB4A 4JL8A 2O8DA 2IXFA 2BBTA 1W94A 1IDOA 3MZ0A 1SK8A 4YQZA 3I92A 3HO1A 3Q6IA 1UAAA 5G4LA 3I9KA 4LXGA 5F5XA 2MIIA 4UKDA 1ADBA 4OLFA 4Z0TA 2BH9A 2G76A 3VPDA 1ZS9A 5K2MA 3C8DA 2HWYA 4BBAA 3LGXA 2JFNA 2YN4A 2V3WA 2CK3D 4TTRA 1DG1G 3HBMA 4LISA 4BKUA 4Q3EA 2D3WA 5ALZA 1IIBA 1BTOA 3BH0A 3CUUA 1GL6A 1TJ5A 2VRBA 2EQ5A 3SQOA 1YB5A 5KYTA 5ITZB 4KXVA 2VUIB 3OHMA 4L3WA 3DFZA 1WF6A 1EE2A 2VPTA 2JFVA 5AHOA 1LNQA 4JI5B 2WU1A 2FN9A 2AD1A 3VSBA 1YQ9A 2I6QA 2WG0A 3P52A 3H2HA 1W29A 3O47A 4FFPA 4GXNA 2VZ0A 5BURA 1XZJA 4YV7A 1Y6JA 2IOYA 8LDHA 2P3SA 3PQ7A 3A4NA 7REQA 3AU9A 1SULA 4UNRA 1OB5A 3QHAA 2IYQA 2OO3A 2YJ6A 4YONB 4E1BA 1XQ9A 5F7XA 1BCSB 1Y1PA 2J3MA 2UZ1B 3JAKB 3LYUA 3OMXA 3TL2A 3TK1A 2MYTA 3NJ4A 3PJEA 2Q50A 1N0HA 2HBYA 1C9NA 2GLUA 4KNVA 5AOAA 1F0NA 3NEAA 2M1ZA 3WZ2A 2ZPAA 3BMCB 5CDHA 4AWAA 4FYIA 4ESHA 4EG5A 5CFPA 4CTOA 3G0OA 4ZCPA 2X8AA 2ZAGA 4YJGB 1WPQA 1C9EA 2O2GA 3FF4A 2WUVA 3LPNA 4H3HB 4QICA 4AQ7A 2Z3VA 2DLNA 2PWYA 2R2AA 2AHRA 2R7MA 2D0IA 3AKDA 4DJJA 4ENQA 3T0GA 1Z5GA 2HU8A 5AK5A 5BWBA 5EJ9A 4PLTA 4HEA6 1XC7A 1KP3A 1BWPA 3JYQA 4MMXB 1IH8A 4MYTA 5LR6A 3U7GA 3I42A 4I1PA 3W5CA 4RVCA 4L1KA 3LKDA 2PFGA 3ZWBA 1I0LA 4IJKA 3DEAA 3KZKA 2X15A 1KZ9A 1F9EA 1TVCA 2YN2A 4R6XA 2C59A 1IXYA 3ER6A 1PJCA 4M53A 3VBCA 2AJLI 3AF6A 3OZFA 2VP3A 1ZRMA 4UAVA 5FX2A 3P9NA 4DCOA 2EZTA 4YFYA 1QGAA 1DBQA 4J2TA 3RODA 2Y2UA 3AZQA 3NBQA 4W7SA 1NW6A 4LBVA 4AMGA 2J31A 2YL2A 1UJBA 1JHYA 4BCDA 2D00A 3IDZA 2IU0A 1PT6A 2I2CA 3O4VA 2IXTA 1HT3A 2FZEA 2F1JA 2DFPA 5FA5A 5JDCA 2JBAB 3SZ3A 2C99A 2PD3A 3KOMA 5JYBA 2VDOB 3Q9SA 4IILA 2PMEA 4CF4A 1BXGB 2G08A 5IJ0A 4DLSA 1VRVA 5C1BA 1EA5A 2PPVA 3DKPA 3HSYA 3N3AC 1GN8A 4TYNA 3KYCB 5I9BA 2V4ZA 4CM1A 1A9XA 1I4OA 1KY4A 2A58A 4B82A 3ID6C 4V3CA 4PZZA 5FWDA 1FFBA 4U4AA 3O38A 3BS4A 4JBNA 3IO5A 3M6VA 3ULKA 2FFHA 4FFRA 2OQRA 1GQFA 1UWLA 2R62A 3M89A 4PNHA 4QOJA 3RUIA 1I2CA 4XEUA 3RVDA 2COUA 1Z25A 4AJ1A 3P4XA 4BOYA 4EPRA 4URYR 4PZYA 1OXSC 2OLJA 1YNOA 1X87A 1RAHA 3D3QA 3U19A 3UMGA 2N46A 4X1KA 1V9SA 1XLTA 2MT9A 1Y8CA 1RYDA 3C24A 4FX2A 4RZSA 1Y48E 2VH5R 5EJAA 1DTSA 2EJVA 3MPUA 3VMFA 4C4ZA 3EIEA 2HDHA 2QEQA 4A73A 4CU2A 2WQ6A 3O21A 3OUTA 4F84A 1H2HA 3RT9A 4CNBA 4PE5B 4H59A 2YY7A 3J80A 1RQ2A 1MFPA 3DLTA 1ULZA 2PSHA 2RHOA 3L7BA 4QU0A 2QSYA 1UBCA 3K5IA 4J6EA 4G63A 5DYGA 1E1NA 2RMKA 1JLSA 2V7TA 3L1JA 3QXXA 4FOSA 1C81A 2VDWB 3I6BA 4FR5A 1EK2A 2QZJA 4WESA 4EA9A 1R6XA 1JZSA 4G26A 2GZSA 2O5VA 3B1KA 2VJKA 3BRCA 1EFRD 2QD2A 4RKWA 4DV1B 5C81A 1DC3A 1TT5A 1TT7A 1A4UA 4KVGA 1T25A 5CLJA 2Z6AA 5A03A 3N2NA 1M2VB 4DDTA 4HZUB 1W75A 1VYHA 1C3LA 2V6FA 2R6R1 1NR7A 3GFVA 3H8SA 1K3TA 1FFSA 2J85A 1MT0A 3MWJA 3ZHRA 5AXCA 3CN9A 1GU7A 3C3BA 4ZEXA 4BAGA 4TKLA 2C9YA 4GMDA 4UM9B 4YJKA 2AG1A 3INTA 5IUJC 3P2JA 3G13A 1LQUA 4JT9A 1JKJB 4EPXA 4IMJB 2NU7A 3RS0A 3TL3A 2JNWA 4BTLA 1EU1A 3WL6A 3RD5A 1G17A 3A05A 5DM0A 1E61A 4MDFA 3LPMA 1HC7A 2YY6A 5B37A 1JB9A 4LE0A 4MCIA 5BVGB 3CVXA 4RLFA 1E2NA 4LTNA 1QORA 2QUJA 3S99A 1TMGE 3L0SA 3KXPA 5EIBD 2OLKA 2O07A 3H04A 3QKRB 5DYTA 4YRJA 4RZXA 1WEHA 4DRYA 2QRUA 3C6ZA 1C30B 3JQ8B 3QYPA 4GOJA 4G4SO 4MARA 4ARSA 1YL6A 1XKXA 1EDOA 4F7DA 3KQUA 1XZNA 2G07A 1YRLA 1UBSB 2EZ8A 2Q2VA 2JVJA 1F20A 2R4UA 2HK9A 1X7ZA 4OH7A 1XFDA 3BSFA 1AO3A 4Y6SA 1T0PA 2R6JA 4YRPA 3M5CA 2HADA 3FSEA 3AW9A 3DV2A 3RGWS 3QLVC 1NJSA 3CTMA 2H3EA 3K2IA 2J6HA 5DHPA 3WGZA 2IY8A 1HX7A 2YWJA 1WW2A 2EKZA 2GRJA 5IDYA 1GCIA 1SRRA 1VPWA 5TS3A 4HEJA 5TLSA 3PUJA 1E59A 1BGWA 4XGRA 5JSZA 1R88A 3V80A 4HMQA 3FUXA 5EAIA 4NCNA 5DHRA 2GWRA 3R7NA 2FLWA 1WU8A 4CGZA 3RV3A 1J8VA 3D4IA 3DD5A 5CVUA 1Y5NA 2IIQA 1H2ZA 4PYNA 5H4HA 5DM70 3L3BA 1QGOA 5AJVB 1TTQB 4MHTA 4WERA 4RV4A 5CH8A 1UBEA 4DARA 1SCQA 4PAMA 4TYWA 5FI0B 1G20B 1MTOA 3FIUA 1SXJC 4OLHA 2EW1A 3E3MA 2PJUA 5DWVA 3AVQA 3DMFA 3WQBA 2I22A 4GOND 1M6NA 1M34A 3ZCRA 1JAZA 4YJHA 2EFHB 3MLEA 3JD2A 4GEGA 5DHSA 1JB1A 4I4NA 1NUAA 4U8HA 5TNXA 2REXB 1WMFA 4PYKA 4FMPA 1TFUA 1PLJA 4DRXA 1FFDA 4QRIA 2Z0MA 2YVAA 2A9JA 1J8MF 1D2MA 3JQDA 1U8AA 2ZI6A 1WUJS 1E96A 1ZHFA 3MJFA 2EGHA 1M2HA 4P4LA 4NKRA 1BN7A 1TMOA 1WZNA 4B2PA 4H3SA 1K8YB 2ZRPA 4EZBA 5F1KA 5CA0F 5L3SA 1QPBA 1ZHHA 1ZUIA 5B3JC 2GD2A 3PDUA 3SG0A 4NCHA 3RSCA 1L8XA 4TMXA 1SM4A 2XLBA 1PJ4A 4X94A 5INTA 1HYQA 1OTXA 3PHIA 1ESMA 2VDLB 4N3BA 3B3AA 4UQPA 5DBGA 1R1DA 3TSWA 3P5SA 5JCOC 4LS3A 3SAJA 3R4CA 4JL6A 4QTTB 1HRKA 3S2YA 3AIMA 1NUHA 3B1XA 5EE5B 1JE0A 3H5RA