1SD2A

Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
262
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Comparison of MTA Phosphorylase and MTA/AdoHcy Nucleosidase Explains Substrate Preferences and Identifies Regions Exploitable for Inhibitor Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 5'-methylthioadenosine phosphorylase
total genus 93
structure length 262
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd2A00
1RT9A 1VFNA 3KHSA 4R31A 4QFBA 1A9OA 1Y1SA 1K9SA 4ECEA 1Y6QA 1Y1QA 4X24A 3FOWA 4F3CA 4JWTA 4D9HA 5CCEA 1NC3A 4LKRA 4L0MA 4BMYA 2AI2A 1U1GA 3OZDA 1PWYE 1T8SA 1T8YA 1YR3A 1Z33A 3IOMA 1N3IA 2AI3A 1TGYA 3SCZA 1RSZA 3PHBE 1NW4A 5F77A 1JPVA 1ULBA 2QTGA 1ODIA 3INYA 4G41A 4YNBA 3OOEA 2IQ5A 4LZWA 4BMZA 1QE5A 3DDOA 3GB9A 4D8YA 1RXCA 3UAYA 3KVRA 4D8XA 1PBNA 4TTIA 1OTYA 3OOHA 1V2HE 1ODLA 4MARA 1JDZA 1Z5NA 4YJKA 3P0FA 4TS3A 4BMXA 1VMKA 1Y6RA 4WKOA 1JP7A 4M7WA 1RR6A 4TXMA 4DA6A 1SQ6A 1OU4A 4PNPA 3UT6A 3EUFA 4OJTA 1PKEA 5B7GA 3O4VA 4G89A 4DANA 1OVGA 2PGAA 2A0WA 3E9ZA 2BSXA 3K8OE 3DJFA 4LDNA 4DABA 3EUEA 3BSFA 1Z36A 1PR0A 3LBAA 1RFGE 4M1EA 5CXSA 3DP9A 1Q1GA 1V48A 2QPLA 4OEHA 1B8NA 1M73E 4L5AA 4TXJA 1JDSA 3OZEA 2A0YA 4NSNA 1LV8A 1RCTE 2OC4A 1A9PA 4DA0A 2I4TA 1V3QE 2H8GA 1TCVA 4DA7A 1U1EA 1PK9A 4QARA 4YO8A 1PR6A 3DF9A 4LNHA 2HRDA 5FAKA 1VHJA 4GMHA 4GKAA 3UAVA 1Y1TA 5B7PA 5C80A 1A9QA 2QDKA 3O6VA 1I80A 1V45E 1Z5PA 3E0QA 1C3XA 2ISCA 3EMVA 4MCHA 1PR1A 1PR2A 1JE0A 3U40A 4WKBA 1OV6A 3KVVA 3UAXA 1T0UA 2OECA 3NBQA 4GLFA 4L6IA 4U2KA 1JYSA 4TXLA 3FWPA 3PNPA 4K6OA 3D1VA 2AI1A 1RXYA 1TGVA 4YMLA 1G2OA 2ON6A 3C74A 3FNQA 5JPCA 1TD1A 1RXSA 3PHCA 2XRFA 4R2XA 2HN9A 3KVYA 2I8AA 5CCDA 4OGKA 3T94A 4KN5A 2A0XA 3FB1A 3ODGA 1V41E 1U1FA 1OUMA 1Z37A 3UAWA 5F76A 1YBFA 2RJ3A 4NY1A 1PR5A 2HWUA 4JOSA 1Y1RA 1U1CA 4OGLA 1ZOSA 1T8RA 1Z34A 3KU4A 1ZL2A 1YQQA 3ENZA 1U1DA 1V4NA 2AC7A 5F78A 1OTXA 4TTAA 4D98A 1PF7E 5F7OA 1A9TA 3BGSA 1Z5OA 4BN0A 1ULAA 4GLJA 4L5CA 1K27A 2P4SA 2A8YA 1K3FA 2OC9A 1T8WA 3BJEA 5EPUA 1ODJA 4QEZA 5ETJA 4H1TA 5KB3A 1Z39A 4TXHA 1WTAA 4WKPA 4NS1A 3OPVA 1VHWA 3IEXA 4TXNA 4DA8A 4WKCA 1CG6A 4TYMA 4F3KA 1ECPA 2QSUA 1TCUA 1SD2A 2QTTA 4DAEA 1NC1A 5CYFA 2Q7OE 4F2WA 4QAQA 1LVUA 1A69A 1ODKA 4I2VA 3LA8A 4EARA 3EEIA 4QATA 4OF4A 1JDTA 5EFOA 4DAOA 1PK7A 5B7NA 4P54A 4FFSA 3OZBA 1LX7A 4M3NA 4OY3A 5DK6A 1RXUA 3MB8A 4MCIA 5IFKA 4TTJA 5CYGA 4TS9A 1JDUA 1RYZA 1XE3A 5EUBA 4RJ2A 1Z38A 3P0EA 3LGSA 4R2WA 2OXFA 3OF3A 3ONVA 3QPBA 4WKNA 1JDVA 1A9SA 3NM4A 3NM5A 5F73A 4D8VA 4LNAA 2GUWA 3OZCA 4JP5A 5I3CA 3UAZA 1FXUA 1SJ9A 3OCCA 1YRYE 2HSWA 4UC0A 3KUKA 1B8OA 4L5YA 5F7ZA 1JE1A 3K8QA 3PNSA 4F1WA 3DPSA 1SD1A 5K1ZA 5F7JA 5B7QA 4QASA 1A9RA 3E9RA 4PR3A 3MMSA 4E1VA 4DARA 5F7XA 2B94A 1PR4A 4IP0A 3NM6B 4EB8A 3F8WA 1PW7A 3BL6A 1Z35A 3FUCA 3FAZA 4G8JA 5CXQA 1CB0A 3TL6A 4F2PA 5IU6A 3GGSA 1YQUA
chains in the Genus database with same CATH superfamily
1QMPA 1F6DA 4E2ZA 3OZAA 4WBXC 1MB3A 2QA5A 4C4TA 4ZV4A 2CJWB 2AEMA 1L7OA 4R31A 5TARA 5K8TA 4JOBA 1V8DA 1YASA 2AEEA 5DMHA 5DMXA 4PFQA 1E5LA 1A50B 3VKWA 4URVR 4K9LA 1P19A 3L7OA 2X6QA 2YZGA 2G6BA 3GJ3A 4NYJR 3I8SA 4RMGA 3MB5A 1VDZA 3QXCA 2V7EA 4IF4A 4LK3A 4PFJA 3R41A 1KDRA 2CKDA 4LZPA 4N8SA 1GZ4A 1PFYA 4X24A 2AN1A 3LCMA 1TYEB 2Y71A 5B4VA 3PK0A 4AX4A 3H2KA 2QJTA 3MCWA 2J9XB 4KPFC 2I66A 2AD5A 3VTKA 2QX7A 5BVGA 1C3LA 3DWFA 1NC3A 4K0RA 1G63A 4V3BA 2R62A 3C8DA 3NHSA 3W6NA 1KGDA 1YRBA 3MVEA 2WUVA 1HFJA 3OLZA 5EUQB 3W3AH 4M9ZA 1GR0A 2N1BA 1NQ5A 2JZOA 2V7TA 4UTVA 1R6TA 2C8VA 2FEWB 2Y92A 3FYCA 3KKMA 5F4ZA 3ZHTA 5B55A 2OV2A 1JEYA 3B1ZA 1NF3A 1U1GA 3AV3A 3GY0A 4P4LA 3VR4H 4Q4JB 3GLFE 1W4AA 1PYGA 3JWGA 4FGWA 1MIOA 5DHUA 1XZBA 3CH5A 4EDHA 1X7GA 4QPCA 4Q7QA 1GDHA 2HLHA 1VSQA 2WIAA 3N58A 4KIGA 4MYTA 2GCGA 2BKLA 5EHZA 1T3TA 1Z33A 5CP8A 4CQMB 1E60A 1OKKD 2FRXA 2ZT8A 4MW0A 2QRNA 3SS8A 2X1LA 2PUCA 1E6LA 3OFVA 2ZDQA 3G2PA 3TB4A 4IFBA 2GCIA 1KO1A 1NVXQ 2XUJA 2QRQA 3DAFA 2X0JA 2QR2A 2ZU0C 4HEQA 2QVZX 2SNIE 4PQYA 3MNFA 3SDSA 4V1CI 1KP9A 3LQKA 3EQZA 4FMBB 2XUGA 1E9AA 3ZGVA 2A9VA 3RREA 2QLFA 4IH4A 1VBNA 2DWCA 4KACA 4UBOA 3RRZA 3TR5A 4CG1A 4EATA 2IQ5A 1PDVA 4ZCRA 1PZGA 3JAKB 2JIZA 1R0KA 1LC3A 2W2XA 3LWBA 3PCRB 1EWTA 1TA4A 4L1KA 4PCAA 2F55A 4TKZA 5I7RA 4DXAA 1WF3A 2Q5CA 3CMCO 3EZ6A 4RFVA 3BIFA 1SELA 1Z7EA 3R0XA 4ZYXA 2V7GA 4P4NA 3DMNA 2OTCA 3AFHA 1V4BA 1ZLYA 1YZKA 3HUDA 4LXIA 3RRYA 1G18A 4UM9D 3SM9A 1Y89A 2QXTA 1RPJA 1TFRA 1DB3A 1WVIA 2BY4A 3DDHA 4ZHQB 2OMEA 4R8RA 2EIXA 2QTVB 3COZA 5LOVA 3U6BA 2CYCA 4YP5A 2OSVA 3TQOA 3ZIUA 3U3MA 3UA3A 2JIQA 4OYHA 4F4FA 3CTMA 2GHRA 2FV8A 3AP2A 4RD0A 1SM4A 4JFAA 3NVAA 4JD5A 5LA6A 1BOOA 3SR0A 3VPBA 4CT0A 2O8CA 4JU9A 1JXMA 4EM6A 1Y6RA 4HBGA 4BNVA 3PPXA 2CE2X 1RP1A 2JATA 2FZVA 4L5JA 5ILQA 2VTVA 3BB4A 4XQ0A 3ZGYA 4EO9A 1H4TA 4JP8A 4F7DA 1KZ7B 1YDMA 4CETA 4LHEA 3V4SA 2PX4A 2PTHA 4XWTA 3N2LA 1NQWA 5TJHA 3T7JA 1O58A 4DANA 2EWMA 3JQGA 1GPNA 1Q20A 2FPWA 5EGNA 2OCAA 2PGAA 3K8OE 1PCXA 2PKQO 3U56A 1H9BA 1XT6A 1Q3HA 2LRHA 2O1EA 5KDDA 2IXEA 2P40A 4G36A 1LVHA 5AVKA 1QM5A 4E51A 1Z36A 1VHDA 2PT6A 4TKVB 4BBZA 3RVNA 4CBVA 4BTEA 2AUMA 4RAOA 2HZBA 4G0OA 2BMWA 1F8YA 2W2OA 5CXSA 2WB2A 3W1VA 3P2IA 3UY4A 1N9GB 3VPGA 3DEZA 1DHTA 3IB3A 1UEIA 2P2DA 1S2DA 4QGAA 5E1MA 4M9XA 5KKCA 3F3KA 3FNIA 4Z0TA 3VO2A 1PJRA 1RWBA 4MS3B 1D2MA 1WVMA 3G5TA 4C5AA 3CY6A 1QOQB 4BMCA 4YMVA 3Q15C 5L4SA 1R4ZA 3SIPA 2D0PB 1Z7BA 2CHVA 5CVDA 4YP9A 3DO5A 1C3EA 4B3SB 3HWX1 1I1NA 2DUJA 3KUUA 1N0VC 4UPVA 1G8SA 4LVUA 4V24A 3NWEA 4NBUA 3BGOS 3G68A 1M34E 1N3YA 3QXGA 1F8FA 3EK2A 3ER9A 2WPDA 3I9JA 2PGIA 3QENA 4UBLA 1G0OA 1Z0SA 2GH1A 4WQMA 3ENNA 4WBNB 2C1ZA 4IIXA 5H82A 1KH1A 1B42A 2GBLA 1ZH8A 1LDEA 4D4LA 5IVHA 3KJNA 4JJKA 4O5AA 1NPTO 3WISA 5JARA 2ZB7A 1NR5A 3NXSA 2CMKA 4AG6A 3A25A 1I1OA 3VJRA 5BSEA 2B25A 2X8JA 1X1EA 2VKQA 4KFRA 1VMEA 3WDSA 2OUKA 1CNEA 2WBLC 4KXQA 2JG3A 2P69A 3A7DA 5FAKA 3NYQA 3UAVA 3H42B 2BPOA 1E20A 3BXGA 3KTDA 1M2OB 3NUZA 3DAOA 4DJJA 5EZQA 1QRAA 4Q3LA 3PIIA 4KH0A 4QBKA 4PSCA 5FWDA 3UZUA 4L22A 5MF6A 3O6VA 3F90A 5CB6A 3QEMA 5AJUA 3JQQA 5E2BA 3ZV3A 2IIPA 4F0JA 4JB8A 4RW0A 3BCSA 4E2FA 2IH5A 4EHJA 3W3AD 1SZJG 2NYVA 2VHQA 3CG0A 3IPAA 3OEEA 1H1DA 2BI7A 3PNLA 1BFDA 1XXHE 2FEPA 1TCAA 2PM8A 3JQ7A 4WKBA 4N1AA 3LCUA 3U40A 1F51E 3GEIA 3P0IA 5A5DA 3AL2A 3R3SA 4XYBA 2IHVA 4EG3A 4IM7A 5KHOC 2PRYA 3E1GA 4TLCA 1B1CA 5TQ2A 1VRVA 4ECAA 1M8KA 2IHYA 3I09A 2FU5C 2PXCA 5CDSA 2ATCA 2GASA 4DV6B 4YA6A 3QHAA 3T5TA 1PRYA 2FZ4A 3BAFA 4A0GA 3GLFB 3H99A 2J3KA 4YBZA 4HN4B 1QG6A 4B84A 4Z54A 3BZBA 1L3BA 5I8PA 5REQB 4FFDA 4Q6BA 1KQOA 4PHGA 1FJXA 1H8HD 1Y5IA 1EXMA 4PIPA 4UUAA 3EVFA 2GN0A 1BJTA 1ZESA 2E6UX 3PHCA 2VF7A 3WGKA 3RJ5A 4MPDA 2BE7A 5IZ4A 2F1KA 2HHHB 1E1DA 4JUAA 3C87A 4CMJA 3HUTA 3ZBPA 3QFTA 3T7RA 1EWKA 1Z15A 4ALIA 4ZVLA 4HATA 1Z6GA 2F1OA 5TB5A 5IYZB 4JXJA 5FH9A 4ZO7A 1IQPA 5CDFA 1TC2A 4KLAA 2RHHA 5TGTA 1U2QA 1LVGA 3VSEA 4PYLA 3DKKA 1XEXB 3P9YA 4Q3NA 1TYDE 1OUMA 1T2VA 3N53A 2DJIA 1ZGJA 2W43A 3A6FA 3ZD6A 2J87A 1IFXA 2AUTA 1BXKA 1JLRA 1Q17A 3O1LA 4I55A 2CWDA 4U7PB 5BWMA 2X0RA 3EVEA 3WC4A 5E7QA 2CL5A 1MQ8B 1X3SA 4MPPA 2NACA 2QLTA 4R54A 1U7OA 4GPEA 1KEEB 4US0R 3RNLA 3V8QA 4DLAA 4FE4A 4JA2A 3VR6D 3L8MA 3JALA 1K3UB 5DYTA 3KB1A 4G0XA 3R7BA 1FTGA 4R81A 2BEWA 4EYEA 4YRMA 5BW5A 1QSGA 2I1WA 2GZDA 3EG5A 2KM1A 3DE6X 3HO1A 2YJTD 4BV8A 5ALVA 1GG5A 2KJQA 1YBHA 2XZLA 3P5BA 4F56A 3CUYA 4IJKA 4BQNA 2D5IA 2YFQA 2NO1A 4AWXA 2ECKA 3C70A 3FHOA 4EVIA 2V3WA 5JS6A 5FPPA 3ACDA 2ZIWB 3WYDA 5LN1A 4D56A 1OTXA 3QSGA 5IK2A 2JHCA 4XM1A 2JDIA 5G0VA 3THWA 4BWFB 1JQ5A 3ZQJA 5FI0B 5PNTA 3GLIA 1XQXA 2JL1A 1ZL0A 2QOEA 3IVGA 3ZHOA 1Z4QA 5H3LA 2ZI4A 5P21A 1A9TA 1V5GA 3O82A 4DIDA 3BH0A 2OOSA 1TTPB 1MOSA 4IQFA 5KAMA 5CDHA 4DR7B 2AIRA 1V35A 3LF1A 4Y2TA 3HDTA 2CJFA 1NJ6A 4Q4HB 1J56A 1MOZA 3RFTA 4FC6A 3L0BA 4C22A 3TH5A 2Q5JA 3W79A 5B3KA 4MWTA 3QKSA 1WJGA 2X0NA 3E22A 5HPYB 4DV4B 3W7BA 4RCYA 2FLVA 4YQEA 3JWJA 4XFKA 5DK4A 1T8WA 4ND4A 5G3YA 3SHWA 5A2GA 4QEKA 5DHFA 1ZH2A 1RC0A 5EPUA 4MMYB 4AG3A 5KQLA 4AJJA 1ODJA 3UMVA 3FKQA 3GJ8A 2QX4A 5TGDA 4C4XA 3K35A 2GM5A 4F45A 3SQLA 1AUXA 4R3UC 3MW8A 3N2YA 3SC4A 5KB3A 2JI9A 3VYTB 5AK3A 2LE0A 4B3BA 2D8MA 4JT8A 1U6IA 2IYOA 4NENA 3OPYI 4B0PA 2Z2XA 3PR1A 4DQVA 4BYMA 2ZW9A 2O7NA 3HU3A 4IRXA 4OI1A 2DGDA 2A1UA 1GPYA 2Q4TA 4MVXA 4UBMA 4WXYB 5T3YA 7ADHA 1DL5A 3KQYA 3KLBA 2Q99A 1CG6A 4HH3C 2W6OA 1K7EB 2IVFA 4TVOA 2Q6IA 4WKCA 1CR2A 2D00A 1X0XA 4R6WA 1KARA 1VJDA 4C3VA 3DCIA 1U0NA 1KJYA 4EB6B 4WZAB 4WFKA 2EBFX 3H97A 1UANA 4MAFA 5T57A 1TJ3A 2LNDA 3OCUA 4LRQA 4X7MA 3EYAA 4MVJE 3SXJA 3MOIA 2ZT5A 2PS3A 1T29A 3B2EA 3DV9A 3UUFA 4BB5A 4BWVA 3UGJA 3QVKA 1TFUA 3IJ5A 1HDZA 4UJ3A 2ZREA 1INLA 3KR2A 3GUUA 4PSUA 4ID3A 4ZGGA 1WLYA 2O2JA 3ZZ1A 1V39A 3QF7A 1T25A 1BMQA 1N9KA 4LBZA 1RQPA 1TQ4A 1KAQA 2FUEA 3ONNA 1YVUA 4RLHA 1DI0A 5JADA 1RMYA 2FX5A 1Y63A 4B4OA 3U3RA 2DP4E 2PUEA 2WB4A 3FGNA 5FB3A 3V3KA 4BLUA 3I6YA 3PXGA 1RJDA 5I7FA 2EW2A 1SQ5A 2G8NA 1NFRA 3AUAA 1XD2B 5D8DA 4XWKA 3EEIA 3VSAA 4XOUA 3ZCXA 4GPTA 4OF4A 5JO9A 2LVBA 2Q2OA 1YGYA 1ZJYA 4HF7A 1A2BA 1V7QA 1HFEL 4J29A 4K9SA 5B3JA 3EXG1 4GS5A 3GBVA 1MBZA 1RWOA 3ZU6A 7GPBA 1XRPA 3L6RA 1Z2EA 2DECA 2PZAA 5LQCA 2NWQA 4BVGA 1PAUA 1XF9A 1L7XA 2JHAA 4DLXA 4FFSA 4XUDA 5DRTA 3BL5A 3IUQA 4QTXA 3DXFA 5K3CA 4XPIB 4MRPA 4MCIA 2WWVD 3PGJA 1L7AA 1YA4A 2OV8A 3P4XA 4J9VA 4EI7A 4KHPB 3NHYA 4KKVA 1BGXT 1L4NA 3GEHA 3SHTA 4MV0A 2RIPA 2ZBEA 1UBSB 3HZHA 1M0EA 4NWIA 1O3YA 3LNTA 3T34A 5JISA 4QRHA 2VA9A 1HGXA 1QHIA 2CYAA 3AUUA 4FOPA 4RL4A 2RHJA 4PF1A 1RVDA 2GA8A 3OY2A 4YO7A 2CNDA 3RC2A 4LFBB 5F4BA 4V0SA 4O8CA 4BVBA 3SXPA 3BWBA 4AZ3A 4DLLA 2FQXA 3OPQA 2YDYA 2POQX 1BWQA 2P41A 2RJOA 2YN4A 3LECA 1LQUA 1IVNA 1NVMB 2GHIA 3MINB 4H77A 2HDWA 4ZI2A 1E9CA 1L7RA 4WXMA 2JCBA 3LBNA 2FZ5A 3LIPA 3PWKA 3UUGA 3L8DA 2CNBA 3CXUA 4EAQA 1G59A 3JQAB 4DSUA 3QEBZ 3M6MD 4RD1A 1WO8A 2HR1A 1YB2A 1U0BB 3P9CA 1FDUA 3GAMA 5FFMA 2ZUTA 4AZ3B 4UHFA 3WL7A 1RLTA 5ECWA 3VPCA 3GXBA 3H8JA 3RRJA 4XB1A 3TTXA 3O1IC 2ZUDA 4BVAA 1X8KA 1MZPA 3BMOA 3CHYA 4KXYA 1ZN9A 3JZMA 3SNKA 3OCCA 4Q7JB 4RQAA 2V65A 2Q5IA 4WOCA 5JJKA 5JAHA 2IW1A 2J5BA 3BGVA 2PAFA 1JB9A 3DFUA 2Q1YA 3QX9A 1B8OA 3OM1A 2B0JA 3QXHA 5AHKA 3WDKA 4M0CA 2CT8A 1K1EA 4P5DA 1LC0A 4MVJI 3JSXA 1WE2A 2ZS7A 5ALDA 2JIBA 2QTAA 2P4QA 4PANA 3TIXB 3B89A 4OO3A 5K1ZA 4U4AA 5T7BA 4INPA 1JQBA 1GRCA 1DIHA 1ML4A 2VP9A 4YXWA 3T41A 1WCV1 2SICE 3OZFA 2B8TA 4IGAA 4WY8A 3PRYA 4IDHA 3E84A 1H22A 1K5HA 3TO5A 1HMPA 3RPEA 3GG9A 3ZEAA 4ER7A 2JEYA 2J5KA 1E4VA 5K0GA 4EQ6A 4JJAA 2NU9A 4KC0A 2HREA 3VZSA 1DNPA 1XEWX 4EG6A 2D4HA 3MTDA 2L19A 3Q12A 1U99A 4FYJA 1XPJA 2BFOA 5EP1A 2RIRA 2ZYVX 3UCEA 2Q5QA 4DM3A 2CV0A 3KD2A 4FGJA 1NYRA 4IKOA 2IDKA 2IP4A 2CK3A 3IDSA 2XE4A 3P5SA 3EX7C 5JSFA 2XCRB 4ZV9A 2GMWA 1M8JA 3ER6A 1ESCA 4HSGA 5ITWA 3A28A 3NDJA 2JI7A 3IP1A 2HMWA 5CK5A 1ZUNA 2FPIA 4YROA 2ZRKA 2GS9A 3D31A 2QMZA 4TL7A 3NOOA 4PZPA 3RC8A 2DWPA 1Y4AE 4OAQA 4NH0A 2OXTA 1P7YA 2IPOA 3H5WA 3IHKA 4HVAA 1YA6A 3A4YA 3H16A 4CEJA 2XMZA 2ZJAA 3L4BC 1RZRD 2DPLA 4IZIA 1FDIA 3W8FA 3HDJA 2JA2A 1U8ZA 3R76A 1X42A 4QQFA 4AZSA 3D4IA 5AESA 4JY7A 1X7DA 1R6UA 3QMVA 1A9OA 4FZVA 2PUHA 3A9SA 2GYYA 3LXMA 5HE8A 3UJ6A 1QIDA 2WWYA 4LE0A 1F6BA 3PUYA 3SHVA 2OSBA 5KSOA 2J1LA 3D5TA 3IHTA 3Q7RA 1P1BA 4OP1A 2ZI5A 4MWDA 2VNAA 2EG5A 4R9UC 4ER0A 4EG7A 3DKIA 4LJ7A 5AH0A 2GN9A 2Y9MB 3E22B 4IGKA 1HNZB 4N5NA 2J4CA 3BVPA 1AQJA 1UPBA 2Q6LA 1LJLA 3IBFA 4LDAA 4OP2A 4E5SA 3HJFA 2Y8EA 2YFKA 3AF6A 4N3BA 4GI3A 5AW9A 3IEPA 4M1TA 3DOCA 1KNXA 1ZH4A 4G2NA 4R1LA 1GARA 3ZWMA 3EDCA 1S0UA 4DUZB 4YFYA 5FI3A 3HJBA 3I12A 1EIWA 2O2IA 3TQHA 3VO1A 4E5YA 3W5SA 4ED9A 4ESEA 2H4JA 4L8FA 1X8JA 5EJGA 4BVEA 1X80A 1JN0A 4BO7A 5JLAA 4EKDA 5BORA 4IH1A 4O4IA 1N6OA 5BWLA 2ZCUA 4PXAA 2PL9A 1P1RA 4X1YB 2G04A 1GQQA 1XJ0A 1YR3A 1D2AA 3HP7A 1EFDN 1M9NA 4FFVA 5TC4A 4F3YA 2TSYB 1N3IA 1SH7A 2BGIA 1NW7A 1PJ2A 2WNIA 4TWJA 4J2TA 1JPNA 4S2EA 5I7OA 1RSZA 5JUWA 2VJKA 3COSA 5G4KA 4PG6A 3VR5D 2E4ZA 3ZI4A 5LB2A 5JAPA 3T1HB 1JPVA 1E62A 3HCFA 2G5TA 1SXGA 3IAS6 1AKVA 1SULA 4JJGA 4I3GA 3STWA 4C03A 4C3OB 2P7IA 3MJTA 1NGSA 3K5WA 1GNSA 2QPTA 1DRUA 4V0OA 2NVUA 1L4GA 4RYLA 3C6XA 2O5CA 1G6KA 5I5EA 1QE5A 1FLAA 3K2QA 1C4KA 2NV0A 1C1YA 1NULA 3K09A 4OQYA 5L3RA 3TL2A 4PFSA 4D8YA 1NPYA 4WVLA 3M9LA 2PH5A 3BMQA 1CZLA 3EULA 1ENZA 1FU7A 1XMIA 2WWFA 3QA3E 1PJBA 4NONA 3ROFA 1GPDG 1C4WA 1N78A 1RJ9A 5CDFE 5LZ7A 4B1FA 1GUBA 1GPH1 2ODWA 4J0KA 4HFJA 1Y9DA 1RHQA 2ZAOA 2H54A 3F1LA 4KMMA 3WLIA 3NONA 3ZZTA 1X1CA 5B3JC 4JV5B 1EH5A 1XF1A 4OGFA 4EO4A 4L3WA 1TT5A 4PTLA 4CKEB 1NATA 4NHEA 1CQPA 2E18A 3QW4B 4BE7B 4W7HA 1KXZA 4CGZA 2WU8A 1T1GA 3DVRX 4IO0A 5T4EA 3U09A 4MDFA 1QQ6A 1JQAA 2DPGA 3N2KB 4E5KA 3UJ7A 3Q6MA 1P73A 3T3EA 3HKCB 4EJ2A 2OOKA 3AKZA 3KXDA 4B3IA 4AJHA 1I1QB 4ZJZA 1RR6A 3X3HA 3L8HA 1KZHA 5IZCA 1XLTC 3IALA 1WS6A 4O4JB 1O0CA 1I4OA 4QRDA 1OU4A 4RZXA 5G1OA 3UK7A 3UT6A 1T9BA 3PGKA 4O2BB 2ZT7A 5AP9A 1Z7GA 1SG6A 1W47A 3ETDA 1DV2A 2EERA 1EFPB 2BBOA 3LL4A 3PE3A 3STTA 1FDVA 4B3FX 3FHTA 1GA1A 3OPYB 5K2OA 1U3CA 4V0LA 5IT5A 1Z26A 4JI3B 4KE8A 3LD9A 1XQ9A 4RD3A 2C5FA 5TPZD 3QUQA 2FPGB 4ZK6A 2ADFA 3HA2A 3LKVA 4KAXA 2X40A 1MTZA 1MDBA 2D0DA 2HV9A 2AYYA 3ICCA 3AEKA 1GRRA 2PHZA 4ZC1A 4JVLA 4ZANA 3IMEA 2HBYA 1GA6A 2ATVA 4LHSA 4P0QB 2GPAA 2GNAA 1GLNA 3S28A 1QQ7A 2E55A 1J7KA 3DDCA 4S1PA 4UU7A 1XNJA 1NVKA 2WIJA 4OQDA 1AGPA 3UB4A 3ZOKA 4GKBA 5CVEA 1E8NA 3WYFA 3MA0A 1GPWB 2HXGA 2DZDA 1UWKA 2LUOA 2A0YA 3UHPA 4UZEA 1H3EA 1QHSA 1KJ9A 3HWRA 5ES3A 3U62A 1LV8A 4QUGA 4DDWA 5LOVB 1NBIA 3CNHA 3BX1A 3LXUX 1E2IA 3PC2A 4DR6B 1EUYA 4FX5A 3N74A 4GM1A 1DO8A 4PINA 2QZSA 3D8SA 2QU8A 2YUIA 2ZU6A 3BAZA 3LDAA 1AKTA 4PE5B 1CQZA 3OT5A 4UOEA 1M33A 2XE7A 2PBFA 2H8GA 1DEXA 3TRDA 3V1LA 4HDNA 5JD3A 5EKUA 3W2IA 4YDQA 2FHSA 3GP5A 4WXPA 1D03A 3EGXA 2JLSA 5B5SA 1ZM4A 2I6FA 4DNQA 3V8PA 4HZUB 5SV2A 2J0UB 3SDZA 1USIA 4O4HF 3Q3VA 4U6QA 4AN0A 3CSSA 3WYCA 3ZHCA 2RD2A 1FP2A 3EBLA 3AC0A 1YNSA 3PB3A 3VKHA 4ZYZA 1L5SA 3H6GA 3S2SA 5C4GB 3QKRB 2Z04A 3AG6A 2Q4OA 5HJ5A 3HXKA 3H2BA 3I9V6 3OZVA 4IIJA 5DFAA 1XD2A 3WADA 5M5BA 1QFYA 1V16B 5A6SB 5C80A 1QQBA 4HRXA 3HYRA 1B3RA 2QQ5A 1A7KA 4MJ7A 5TGZA 5KCZA 3U9LA 4ZT3A 3KKOA 3ZDXB 2IHBA 2ZIVB 2NAPA 1V45E 2O1XA 3JCZA 3SYNA 3EPJA 1B1AA 2OGUA 1QR2A 2P9CA 4FYXA 2VK2A 1TK2A 3PI6A 1L5FA 1WA5A 2PBLA 4U2KA 1VE7A 5FFNA 5DX0A 1K6IA 2PAAA 2PRSA 3GH1A 2FUCA 3ZQUA 3EH2A 1PFWA 3FWPA 4GYKA 1Z2PX 3PNPA 4X54A 3LP8A 3WS7A 1T9GS 3ILXA 4A2PA 1XAIA 4POOA 3BB1A 3QKSB 1FZTA 1Q11A 1RAGA 1SVSA 4E31A 1PEYA 1YVDA 4XWGA 4BC0A 3FZYA 2M1ZA 1G2OA 2C9CA 2FSSA 4ZREA 4ZMBA 3SG0A 5CJJA 1DQPA 3B9QA 2RAFA 2IWRA 5CFPA 2B69A 1Y3IA 2Q27A 4UDNA 4YWJA 2XRFA 4X1IA 1NXQA 1UT6A 5C4IA 4PFKA 2CXRA 3TVDA 4WLEA 2AFIB 4J7UA 2RMKA 4PSKA 3ZCRA 4TRNA 1DEKA 4MI3A 1QORA 2G83A 3KOZA 1DXOA 3OE4A 4QDOA 3THSA 1T34A 2O8EA 1JEJA 4JJ7A 2RI0A 3FNHA 2AMFA 1QHHB 2D06A 2N46A 1GVNB 1RBMA 2DFPA 2JLUA 3KV3O 2GCEA 1YBFA 2NYUA 3GVIA 5DLYA 4K6CA 2QUBA 1OT3A 2HF9A 3GCDA 3JPYA 4KLNA 4C07A 1I7QB 3IHLA 3PVZA 1SKYB 1MJGM 4PGAA 1UC4B 4AF7A 4RXTA 1ZOSA 5TVGA 5I51A 2C5SA 3DNMA 1HI9A 3COYA 2SKDA 2WVHA 3EPPA 4CGYA 3DE4X 3L7MA 1S6YA 4MUJA 3IKLA 1JYFA 1QIEA 3AUSA 1K3TA 1WY7A 2PMWB 2C2YA 3AINA 3FGOA 1I9CA 1JXOA 5FDFA 3QKIA 1UM9A 3NFRA 3QKUA 4CCYA 5JS7A 4M6WA 5C52B 1X6VA 1N1MA 3SYMA 3DLBA 3W2FA 5JC1A 5KU7A 4HEHA 1BW9A 3UC5A 1C4XA 3HR8A 2R66A 4CMGA 3OZSA 3WLMA 5EYPB 4EW1A 1ULAA 2WHXA 4GLOA 2X1HA 1XN4A 3D2LA 2NADA 1RZUA 3IIEA 1B6GA 1SCNE 3LL7A 3Q9LA 4MICA 4OYLA 5EXPA 3TPFA 4QDUA 4CT5A 4GUDA 4WASA 1RE1A 2C2ZA 2Q3FA 3IFSA 1GV1A 3P4UA 2ESRA 2BFFA 2ZITA 4OBEA 4PPYA 5B53A 5HCUA 3CLRD 1O97C 4JI8B 2WKSA 2A4KA 1VBKA 4OIMA 4DJAA 5HZGA 3QVUA 1QRRA 5EJ9A 3PGVA 2E7ZA 3CLUD 2XUKA 1QTNA 4GM4A 4R2MA 5ABPA 2J5QA 1IXRC 4N65A 1U3VA 1G42A 2AS0A 1SHZA 1ZK2A 2XPCA 3DHYA 1OAOC 1JDPA 1Z0DA 2P65A 3ESAA 2O2CA 1EK1A 4CF4A 4E7PA 3PQ7A 2YWRA 1G9SA 4FLFA 1ZKMA 5H0IA 3VYUB 2CJWA 1TK9A 3FDFA 3PC8A 4OLHA 1CUVA 2H4HA 1OW3B 5LMNB 1HNXB 4DA8A 2R8BA 4RVNA 3DYIA 3ADCA 3VHQA 1TEZA 4BO5A 2HBRA 2WOOA 3RBAA 1G5IA 2G08A 1YDEA 2PVCA 4RELA 4RLSA 5C1PA 4E08A 4UULA 4LNUB 2MYPA 2QSUA 5KWEA 4KE6A 3PJFA 2IYSA 3ENKA 4BLRA 4C6HA 2X8JB 4OBWA 4MR8B 4GC9A 221PA 3L1HA 4MUYA 3VU9A 4RHFA 4BOYA 2POCA 3FPKA 2Z6QA 1O94D 3M81A 1Z08A 4PYRA 4YWHA 3BHNA 3H75A 2PJDA 2Q7OE 1V3TA 5FEUA 3TGWA 2YRFA 3GIWA 3KHUA 4J07A 4R1TA 2P30A 3CZAA 1VSTA 4QD3A 4FEGA 4I19A 2JFPA 4OM7A 2JKYA 4PZAA 2PJZA 4Y2HA 2D1YA 1L4MA 4RA9B 1BMFA 5J43A 1IZYA 4EX7A 1ODKA 2Y99A 1IN5A 4HVTA 1HSOA 3FY4A 1TJ5A 3KR0A 5EJFA 4LXYA 4EARA 1ODFA 3NAGA 1TEHA 3EGWA 3PRHA 1GAXA 2QZPA 1QH1B 5EERA 5HX7A 1NI4A 3SJ7A 2B8WA 3EBOA 1N0UA 1CERA 3K0EA 1Y5LA 1I6KA 4TN1A 3FVWA 4WI1A 1ZICA 2GI4A 2QQGA 5AJWA 5DLPA 2PGNA 5HF5A 2IF2A 4JROA 2C4UA 3EQ6A 1NQTA 1NR1A 2FMIA 4D1YA 4NU6A 4M3NA 3HB1A 1G8HA 3LZDA 3ISJA 1JR3A 5HF6A 1BE8A 1ZW1A 4OQ4A 4KXLA 4V0QA 1YI0A 3S1AB 4B47A 4TMFA 3BULA 1LPAB 1W4RA 1XD9A 2HJHA 4PLCA 3WLRA 3LUGA 4NHOA 1SEVA 2A9KA 2O0JA 1KI4A 3AZQA 1G20E 4KFTA 4QE3A 3U1TA 3PDHA 4AW9A 1IPFA 1SG9A 1UMBA 2LPMA 4K8RB 1AS3A 1PNTA 3WGYA 2ACKA 2X22A 1ULZA 4WRRA 5HS6A 3VC1A 3MAJA 1XHEA 1B0ZA 2C5EA 1SQ0A 2NVWA 2I87A 3RC3A 4ASUA 5G1PA 1EZZA 2X1VA 1ECBA 4CDGA 3T9CA 3DT6A 4JITA 1W1WA 1P62B 1UODA 4OBXA 3UBTA 3HVKA 5DTQA 1CS0B 2CMHA 4UUNA 3QPBA 5CR9A 4G1CA 2X6TA 5C18A 4K9RA 4J1TC 4I6GA 4DMGA 1Y8CA 3SK0A 2G0NA 2PGDA 2Y76A 4NK4A 1CX9B 1I36A 3FUUA 1KO7A 2JBWA 3IH5A 4ICIA 4L8GA 3E03A 5FORA 4PYKA 1WUKS 2H2FA 1KK2A 1XTKA 2QY6A 3TQSA 5INTA 1TJNA 3LDFA 1Y6FA 3KOXA 3MS4A 4G0YA 4JI7B 1M7GA 2YWHA 3AR3A 1CUUA 3DVAA 3U7JA 3X1XA 2PV7A 3L7LA 1FE8A 2DMRA 3ICPA 3L4SO 1XNGA 4PQFA 4PV7A 3AVOA 1ND5A 4C0QC 3Q6IA 2WUWE 3I01A 4AUNA 4HV4A 3FZEA 5JZBA 3T0FA 1KKUA 1FDRA 2XF8A 1LPOA 3TVYA 4JL5A 1Z0KA 4TMTA 3QV1A 1GUFA 4F1WA 3DMPA 4MP6A 1KYWA 2WZQA 1PG2A 4Y1RA 4FPXA 1JGTA 1PD0A 1XZGA 2Z2JA 3N8NA 5HF9A 1M2NA 1V5EA 1KRXA 3MXOA 3K9BA 1DG9A 4LRUA 1FXWA 1E18A 5CAEA 2HA0A 3OQIB 3AI3A 1XMXA 1FMCA 3C43A 5GINE 2SKCA 4ZRDA 2AFHA 2OP1A 4U2DA 2ZDHA 1R4AA 4PU0A 4TYYA 5KNCD 3PXBA 4CL8A 1JS1X 3OBIA 3MJSA 5SZIA 3S2YA 2R8OA 3P2OA 4C4AA 3KQLA 3IULA 1PR4A 2D5AA 1EI9A 2CNWA 2WSSA 4UFOA 3HVRA 4MV3A 3V33A 3AI7A 3WMXA 1FUKA 3S2ZA 3FVRA 2ZJ3A 3JQBA 5JCOC 4JFRA 4XQ9A 1K06A 4KNWA 3C3CA 2F67A 4CR6A 1RZRA 4M0LA 3AF1A 4TWAA 2VH1A 4F72A 3A31A 4E2YA 3VSCA 3ZNOA 1YHYA 1GL7A 1YMQA 2X0KA 3M5DA 4HYYA 1Y6GA 1IUPA 2PRIA 3EW9A 1Y3HA 1JEYB 1CJUC 4O25A 4BB6A 1J8VA 1LPNA 4BXOB 5EKSA 3O75A 1UOPA 1VJ5A 2IEZA 3LS2A 3E5MA 4HCJA 1QBGA 3ENVA 5EINA 4YJHB 4EB6A 5IU6A 1U7DA 4JWKA 4IXMA 1TM1E 1SUPA 2HU8A 4Y2VA 3PUWA 3Q7IA 2VPQA 3B6JA 4YVFA 2VT6A 1GGNA 2HT6A 2R6GA 4I50A 4LJ9A 5ILOA 3WLSA 1OREA 3EH1A 4B17A 1AV7A 2WTXA 1UZAA 2XCIA 1L4HA 2K2QB 1D1TA 2AHRA 2AJ8A 4N18A 1JG2A 5CA1B 2CL6X 2V97A 2Y1XA 1B23P 4YT5A 2HA5A 2YXNA 1CULC 1ZUWA 4BMNA 5DSZA 4XR9A 1KQGA 4TWZA 2HJ9A 4JJEA 4G9BA 4Q24A 1VIYA 3VPDA 4CKZA 2R85A 5KJ6A 3KBBA 3FFTA 1DOAA 4AY2A 2NYRA 1HYBA 4RLFA 4N0MA 4KUEA 4U8HA 4CQJA 4CLRA 4MKRA 1WV1A 3TZKA 3A9WA 3KWJA 1KI6B 5HOEA 3IVXA 2DLCX 2VDUE 3B1YA 3NORA 3NWBA 4DWJA 1G2QA 4HUQA 4F3RA 2WD7A 1QG4A 2EJCA 1QGYA 1KYVA 1TKRA 3FLAA 3IRUA 4HSEA 5D6OA 5HKOA 4OFZA 5AW0A 3ZNQA 4YCDA 3FBWA 2Z56A 3TTWA 3V42A 1C81A 1JRLA 4ZHQA 1IN1A 1P4JA 4PN3A 1T8YA 2QDXA 3LHSA 4FGUA 5BYJA 4NYJQ 3TTUA 2AJDA 1U2EA 1IN4A 5F3DA 4QTTB 1CQXA 3M6WA 4ER3A 3L92A 3NRJA 4FOSA 3IKJA 4GX2A 3D4OA 4ZAGA 2C9DA 2VN8A 4F46A 4KYUA 1TMYA 4ONEA 4X20A 4LRYA 3RJ9A 4H1VA 4CWAA 4LF8B 2C83A 2WMDA 1L8AA 3ZN2A 5HP4A 1MAUA 3I5UA 4KDCA 4WKGA 3VR6H 3VUFA 1AB5A 4QM7A 2XT9A 2QJFA 5T8KA 4RHTA 1X7ZA 2VT7A 4G41A 2AYXA 4B46A 4D9GA 2JLZA 3VC7A 2H4FA 4TZTA 3G0OA 4JLWA 3UC9A 2O06A 3HV2A 2ORWA 5BV8A 4BMZA 1B43A 1L7EA 3BXOA 2JIRA 1Z8FA 4GP7A 3GB9A 3VNQA 5IJ0B 5F9FA 2BFEB 2MSNA 3CE9A 4AYXA 1M0TA 2F8LA 4I81A 1L4BA 3K3PA 2XWJI 3L7KA 3LUFA 3IBGA 4L72A 3OICA 4B7AA 4F5YA 4N41A 4I0WB 3MWKA 3F71A 5EIWA 4MYDA 2ZQYA 4DWOA 2ZR0A 1JHZA 5M29A 2G4VA 1U8XX 2B3DA 2VHVA 3BGDA 4E4YA 4L08A 4MARA 1QOZA 2WICA 2Q3BA 2BBWA 1JTEA 2GZ2A 5FUMA 1P9OA 2Q7DA 3HBNA 3DPIA 2X58A 2EARA 2PL1A 2Z2IA 1R7RA 1XYGA 1ZD9A 4H35A 5AVUA 3WKDA 4LRSB 5JWHA 5CDGA 2QN7A 2GZMA 5A3VA 4D80A 2Q3CA 3MXTA 3V8VA 2HQSA 2E82A 4NLLA 4ZHQF 1W49A 1HNNA 1WKVA 2H4YA 2V0GA 2CLSA 2OPBA 4RA6A 3JWEA 3SD7A 4DKJA 2VH5R 2JFHA 1XB2A 2QAGB 3U44A 4D99A 1Y42X 4AJNA 1V6AA 1KGSA 5EA2A 1KEWA 1R3UA 1SHUX 2R1TA 3GBSA 3KEQA 1N8TA 2VTKA 3F7TA 1DQNA 3SN6A 3S0JA 4D7AA 5K3OA 3ZIAD 3CRMA 5AXDA 5FUQA 4PYQA 3PFNA 1COZA 2TMDA 1WXDA 3CB4A 4Y7DA 4ZEVA 4LAFA 2G7ZA 4L50A 5DI9A 2XT6A 2AD1A 1W29A 3E3MA 5AJVB 1PNQA 3GV0A 2BI4A 3IODA 4A36A 3QELB 2JHFA 2XIJA 3WYEA 2MYNA 4O33A 4CMEC 3OJCA 3EGDB 4WAUA 2P3QA 3NU1A 1FC0A 4Q19A 4DLNA 5AVRA 3D3NA 1H3FA 2HPZA 3SXUA 2BN4A 1SZPA 2Q5EA 3D0RA 3FZNA 4JDUA 5MN5A 1WUJS 2ZSUA 4BKPA 4Z3DA 3Q5EA 2QVGA 5CA1F 4RUKA 1N1DA 1P7WA 2BJWA 3GN2A 3UUWA 1JXQA 2IYLD 2XCTB 5JU6A 4HWGA 3ORYA 1LLFA 2Y2UA 4U6SA 3T9DA 1EYZA 1IBLB 2C8LA 4CRWB 2XRZA 3WYAA 3DE0X 2OK8A 2X5NA 5CK4A 4MITA 2QTBA 3KL4A 1Q50A 1V6CA 4B6EA 1D2HA 1IZ8A 1Q84A 4A1OA 3ANXA 4EZIA 3ITNA 2YZKA 4FJ1A 3LUCA 5FL3A 3UB2A 4DRYA 5JRZA 3BG5A 1R66A 3F6RA 3JQPA 4YMIA 2FF7A 5M34A 1OB5A 1FP4A 3PWZA 4IX9A 4KGXA 3OUUA 4LHYA 4R7TA 3RK1A 1ACLA 3BZUA 3KYBA 3TQRA 1P2SA 16PKA 1CR0A 4MUBA 4ZCIA 2ZETA 4HWSA 2NLOA 1YZTA 2FQ1A 2JI8A 5BSFA 5CM9C 3AMVA 2QROA 1JQ3A 1UDCA 2ZGVA 4HB0A 5EIOA 2Z8YA 5AKEA 4LXTA 5FTJA 1P2TA 1YGPA 3EA5A 3GMIA 4DUGD 2A9PA 5L51A 1ZK0A 4TV8F 4ARZB 4BQEA 3ZJUA 1N5MA 2Q2QA 5F98A 2HSDA 3JQGB 4J3FA 3ZZNA 4F6LA 2XCSB 1ADFA 1WU7A 5LNK6 1UINA 1U6JA 2JK0A 2Y2VA 5FWAA 3HCCA 3VO8A 1ZCJA 1W2GA 1I1HA 2HDNB 2X3UA 1V47A 3DMGA 4E5MA 5G02A 1JZSA 3F5FA 4L6IA 3ZY4A 4G67A 1XGKA 4WV3A 2GKOA 2REQA 3CE6A 3EF3A 1SZCA 3GUCA 4B31A 1XVLA 1XKTA 1P5ZB 3TMKA 3CEPB 5DX8A 1E7MA 1FSGA 2P2SA 2Q5FA 1KR2A 2P2CA 2CV1A 4WTOA 1KYXA 2I6GA 2BRUA 3HGQA 4CM8A 2H2WA 4OH1A 1TMOA 1TGVA 2W6PA 4ZI5A 2CFOA 5P8WA 3SC2B 3C74A 5EWJB 3MN1A 4TX1A 3QVJA 1KZ6A 1RXSA 1TD1A 2PRJA 1II9A 4UNPA 2RAUA 5LUAA 1UJ5A 1R18A 2BJVA 3A6HA 3M3DA 1SN7A 2UVPA 1GIAA 1G21A 3GLIB 2R6CA 5AT1A 5EJ7A 4RDXA 3KV1A 3X1DA 1H1TA 2GRAA 3G3EA 4PO8A 3V2GA 2WF9A 3RYCA 3CX3A 1F1JA 1XTTA 4DHEA 3ITKA 2EW8A 2FZGA 2EX0A 2QLNA 3CWCA 1U1FA 3IKMB 5EL0A 4D4KA 3L6UA 3RS9A 3KHTA 4HYEA 5JTTA 4K6MA 2WFLB 4F1KA 3IUBA 1EINA 4HRAA 4AQ7A 3IEKA 3QWFA 4KXXA 5TS2A 3UAWA 4OLAA 2AA3A 4QEDA 3UJHA 3D4PA 4QYIA 1UPFA 2WUGA 3K6KA 3FMIA 4UHEA 4RF5A 3WLAA 5G4LA 3PTAA 2XHEA 5AJZA 3QJ5A 3JRNA 2YUTA 4LZLA 1KAMA 2UUAB 5IXJA 3TNJA 1Y1LA 4IDBA 3RVJA 3WAGA 2NSJA 5CVJA 2AOXA 4PPNA 2AR9A 2XTJA 4RVSA 4EW2A 4F9EA 2QVYX 5CBPA 1CEYA 2X5OA 3T99A 5EQJB 1E96A 2HFJA 5GV8A 2QTLA 2Q3JA 3MD0A 5E7JA 1A71A 2Q7XA 2BSQA 1A8SA 5I7AA 2PZEA 5B1EA 4D92A 2JD1A 2QLJA 3EGVA 3ZJYA 1A1VA 1CUJA 4M8NE 4RPHA 4DRZA 4DDKA 3B13B 3PF8A 3NASA 3V4OA 4UM5A 4ENSA 3H1PA 1HKHA 3HE3A 3M6UA 3P7MA 4PX3A 1L5YA 1T3LA 4TV9F 1EBFA 4Q4AB 1NE2A 3C1AA 3LVRE 4I3FA 4QU0A 1WCWA 5T6BA 3OP1A 3OBBA 4UHKA 4XRRA 4L5CA 1K27A 5JPDA 1QRTA 4IR7A 1WSBA 3FYDA 4O3MA 3QEOA 4DDVA 2X5JO 3SBOA 2V4UA 4Q34A 4JX8A 2Q8QA 4PIVA 2CLKB 1E9EA 2WAAA 3NLLA 2R1ZA 1WP4A 2R4TA 3E8XA 4G0PA 5CX4A 2OC9A 4QU5A 5D87A 3FLEA 3WJ2A 2R11A 1ZHHA 2IYNA 3A7EA 4DGQA 1NSYA 1XU7A 4DDMA 1HTBA 3U7QA 1QKKA 3MFYA 3GAAA 5HR5A 5J5VA 4KQIA 1Z39A 4GI5A 2GN8A 1UQUA 1FRQA 3EIQA 1RJFA 5LB4A 4FI3C 5I9NA 4O2RA 1JIVA 4ZO8A 1NG9A 1UMCA 2WIGA 4WKPA 1T4GA 2H9YA 2MT9A 3PL1A 2E48A 5FLYA 3KOWA 2ODPA 1OROA 3DKRA 4QREA 1UBHS 2CMDA 2V54A 3CUSA 3LWNA 5SYNA 2BEWB 4L4SA 1U2SA 1USGA 4NIMA 5G0TA 5KO2A 3QVXA 2I55A 4FT4A 2DX7A 3VSBA 5JR3A 1JLMA 3ITDA 4NU8X 4P3OA 3U3DA 1J8YF 1JSZA 1P2GA 4DCTA 3AR6A 1AGNA 3CNEA 5KNCH 5ELXA 1HE8B 1X1AA 2BDTA 2CEKA 4MV7A 2JFOA 1FXWF 2EL7A 4HFMA 4B73A 2DTEA 4M99A 4XGNA 4DLYA 4IOJA 1NC1A 3GFRA 1LS6A 1PQYA 2HF2A 2P75A 3H8VA 4R1MA 2ONJA 4ARUA 2EJVA 4K40A 4F2WA 4YY3B 2CXXA 2HJRA 1L7DA 4R5MA 4UMFA 1X39A 4OQXA 3H9JA 1TM7E 1YOVA 4IEFB 3OZIA 3W1WA 5JEDA 4RZHA 2CHGA 3UG7A 3A1WA 2NXCA 3RYTC 5IXYA 1JG1A 3H7AA 4LXUA 1WNFA 4TT8A 3EA0A 4QPPA 1FLVA 1GZHB 2B98A 2QP4A 5J3JA 2FP3A 2F6RA 4MRNA 3G79A 1T3GA 5FUXA 5JSUA 2NP7A 3QYPA 3DQZA 2OT3B 5AD1A 1WM1A 1C14A 1GG2A 3FWHA 3MPUA 2HCJB 3JAWB 3NJ4A 3ER8A 4GP9A 1D3AA 3NI2A 3AIMA 1VE6A 3F96A 1CDZA 1W94A 2ZUBA 3KC2A 4YR7A 3TG2A 2XDYA 2JNWA 1RAHA 3AESA 3GCZA 1NZDA 2FQYA 2G1AA 3F5QA 4NDZA 1DUIA 1SPXA 1U0RA 5CTAA 1M1YE 5TQ2B 2FGKA 2XA1A 2ZBVA 2FXIA 3UWMA 2FQQA 1CQIB 2OBXA 1VXOA 3ESZA 3SMQA 3NJ8A 3SJBA 1YB4A 3DTNA 5C37A 3DAYA 4NYIR 3ZXIA 5J1TB 5IAAA 3IJRA 3OQ1A 5E9QA 1IB6A 5HRUA 2UUCB 2Q5OA 5AW6A 4HUTA 4D4HA 3EZ2A 4P7JA 1BX3A 4QHTA 4X7PA 1UXHA 3HC7A 4N3NA 5DXJA 1Z06A 3GQBB 1BH2A 1GL6A 1U98A 4R8LA 1SNYA 2BUAA 4DW8A 3VH4A 4NBNA 4RPKA 2QS9A 4U9HS 1C0LA 4QVGA 1BCSA 5HW0A 3GLFA 3F49S 4E6EA 2ZYGA 1E0AA 4NE7A 1E5DA 2PZKA 4ETWA 3WRVA 3G2HA 4HWOA 1I6LA 1LRLA 3GOQA 1L5KA 2VOJA 2HA2A 3ROGA 4WN3A 2PR2A 3QUTA 1KVTA 1L7PA 4RY8A 5CHYA 3S40A 4P7GA 2GXQA 4H7DA 3CEHA 1YB5A 3F6BX 3C45A 3VVLA 4LJ8A 4JP5A 4L74A 2GD6A 3ROXA 5A02A 1MAVA 1RLUA 1V4VA 2YWGA 4FILA 1QYWA 1M2EA 3MF4A 5HE9A 4D6YA 1GAWA 1P3Y1 1UPAA 2HSWA 1B2LA 2WT9A 2VYNA 3N7AA 2NU9B 2BFPA 2QMEA 4QXAA 2DM6A 4KCGA 3LSTA 1KWGA 2Z08A 2W2TA 3F9IA 5CG2A 3LRTA 3HDYA 2VQSA 2BF7A 2Y1CA 4OKIA 3H84A 4TUYA 3CUVA 4Y1EA 1T5DX 5JE8A 3HL4A 5EIHA 3HP1A 1J90A 5KQRA 2KW5A 2VTBB 1IHXA 1KH3A 2NVOA 1YKFA 3FOCA 4L27A 2PSDA 4Q7KA 1O03A 2OLJA 2Y77A 2HMSA 1D7OA 4XGRA 3ZZMA 4TKMA 1FTSA 2XUHA 2ZB4A 1AHPA 3ESBA 5GZ6A 1QS0B 3G9ZA 3S2GA 4Z3OA 1TNDA 4WL0A 1M1NB 3ZU2A 5KTSA 1C4OA 3AUTA 4V3CA 5FBLB 3RIGA 3TXYA 2QSJA 4CYMA 1PHRA 5L53A 2HLNA 1W9HA 1QRDA 1L7QA 2ZJ6A 4BP3A 4C6TA 4EKEA 4G5FA 2YZMA 2EVWX 3KB6A 1W5BA 1HETA 4H6WA 4IIDA 4D3ZA 3D8RA 2JCSA 4IP0A 1E3LA 2HSZA 1B41A 4X71A 1VE5A 4EB8A 1GDDA 1ZC4A 1NAIA 2FRDA 2I80A 2QN6A 2WM2A 3E35A 4RE6A 2RAVA 1E92A 2DHCA 2X3YA 3OPYA 4TRJA 5H8WA 4Q1BA 4BMPB 1NRXA 2AWOA 3DL0A 4TLAA 5HIIA 2HNKA 4QUDA 5FBZA 2FJPA 4BTVA 3LQQA 4IS3A 3T3HA 3DMHA 1SXJB 5DCLA 4RHUA 4BNLA 4DC9A 5AK4A 2BEVB 2MIIA 4KRYA 2ANBA 2WU3A 4IG4A 3WG9A 4LVNA 5DLQC 3SQDA 2VJQA 1P5FA 3MJHA 4QUKA 4AWBA 4B6FA 2V7XA 2J32A 4CG2A 4EG5A 4B82A 1R6XA 3ANMA 2PRKA 1RTKA 1QBKC 4X20B 1T9CA 1QK4A 2A1IA 4OD0A 2CFRA 3VGJA 4QLBA 2GK4A 1TM5E 3CZ9A 1E5TA 3HJGA 5CGZA 1U8UA 4IJ5A 5LD2B 1BRTA 1L5QA 4XX0A 5DGTA 1J5EB 1H9CA 4LW8A 1WQ3A 4EO7A 4EMUA 3OQPA 3Q7SA 2P1ZA 3OEHD 2M1XA 5BSGA 3UWKA 1Z47A 1GTSA 3O4RA 2ZG6A 1JJBA 3O31A 2Z98A 5E9JA 5HBRA 3WLPA 2GWRA 4MHOA 4EY3A 2LIVA 4I4IA 4JL8A 1Y1QA 1K86A 5GONF 4OHPA 4F3CA 4R84A 4DQLA 3S2EA 1FS4A 3R5TA 1VXRA 4FWBA 4IRUB 3ZWVA 4D9HA 5HVNA 3UMBA 1NBOA 3MWEA 5IFLA 1Y9ZA 3KWLA 1ZGCA 2QN9A 2YV5A 3A6JA 1W5FA 1FYDA 4LKRA 3D8HA 5CLHA 1C3JA 1NKTA 3WX0A 5JEEA 1O4VA 2D59A 5JYBA 1GGVA 4YMLA 4UNNA 4FYMA 3AM5A 3JYOA 4IL5A 3SHQA 5A05A 1VMAA 3UA4A 1M2GA 3ZDYB 3HFSA 4U0KA 4D46A 2JGDB 5GOTA 3HM2A 1RFLA 2QL7A 2F59A 4KAJA 4EPRA 1AK1A 1HYQA 3DVQX 4LPKA 1W0JD 2NZWA 3AEYA 1NYTA 1B3BA 3GNTA 1OXSC 3FMVA 4QBHA 5EMLA 1BROA 1ENPA 3FWZA 3HG7A 2ECPA 4KR9A 4R40A 2CUKA 3BILA 2DR3A 4WNCA 3VU3A 4E33A 3IP6A 2KX7A 1Z8NA 3GJ5A 5EJ5A 5KQPA 1DKPA 4TV8B 1CFJA 1EA5A 2PH3A 1Z73A 2QKYA 2ZTSA 4RK4A 2AN9A 3I30X 3SCZA 3QLJA 4G0QA 1FRFS 3A6PC 4YV7A 2VQFB 5K3AA 3NPMA 4M0KA 3ZCUA 4ZGBA 3O5AA 4A92A 3QU2A 3I2IA 1D0VA 3KQSA 5LZ9A 4RTMA 1C9DB 3WL5A 3LX4A 2JB9A 2I91A 4KG7A 2UVDA 4FYKA 4LOIA 2GBPA 5GIPE 2FLKA 1U80A 2B3TA 3JQ8B 4TQUS 1SAYA 4CTKA 4ZVOA 2IXFA 5KHLB 2ZJ7A 1LS1A 3UGQA 1NAHA 3AR9A 1GQ2A 5HQJA 3ZY6A 4UDXX 3X1ZA 1RXCA 1SA0B 1IEQA 3HFGA 3N8HA 1DT3A 1H9AA 2WINI 4DQDA 3KVRA 4B3TB 1PJAA 3PQ2A 4DPLA 4ATNA 1OTYA 5EWMB 3DBVO 5EE1A 4BQOA 2DULA 4MS1A 4N03A 4M9UA 2G5PA 5KYGA 1UJ4A 3N05A 4BO4A 1LBEA 3U3XA 1DFHA 1KDTA 3SXUB 2HT1A 1OVMA 5L3QA 1L1QA 3LY7A 4I8DA 2H7YA 1YI8A 3ORFA 3EZFA 3IAEA 2BSAA 3BRCA 3PQCA 2ETXA 4MYSA 2FFBA 4BL5A 3HY6A 1N2EA 1N8SA 2HMVA 3QELA 3U0BA 2FCAA 1P0PA 5HYVA 5K0BA 4RHEA 4RMJA 1PJCA 5HK9A 1AXRA 2B8NA 3DP7A 4OBBA 4M22A 1F3OA 4OFWA 3ELBA 4X95A 5ITSA 1NDUA 3D3WB 3ZJTA 1NSTA 4LX0A 4ILKA 3GT4A 5ESRA 3LC7O 3UWOA 1GWNA 3F4BA 4C0WA 2C1EA 2FVYA 5ALXA 3URKA 1GRVA 3AWDA 2QYSA 3A06A 3QE2A 2IYRA 1Z3IX 3MRTA 4YJFA 1RM5A 1I3LA 1KK1A 1PL8A 1XO1A 3FWNA 5FQNA 5HS4A 1XZFA 4C29A 2FFAA 4G07A 4KQHA 1X1DA 2FZLA 1GNPA 5BY2A 3IIMA 3GFVA 1J21A 3G13A 4NCXA 5JAMA 3PS9A 1WZIA 4IIHA 1BEEA 2GEVA 2JJ2A 4FQ8A 4M49A 4Y18A 3HI4A 3ZVKA 3DE5X 1PV2A 3IT3A 5B1YA 1H4QA 3OECA 1VGQA 3G85A 4JBHA 4ZT4A 4DVJA 1W8DA 2A0UA 2PMBA 1LRKA 4IKEA 4X92A 2Z8YM 4JXXA 4HGOA 1G64A 1AHHA 4N9WA 3HRHA 2NSDA 2Y1FA 2X41A 4P22A 4BYGA 2NU7A 1HH4A 1N92A 3Q3IA 2BHLA 1L7MA 2P68A 3E05A 3L1UA 4MWCA 1RHUA 1V48A 1DX9A 2CXPA 3BMCB 3G9QA 5B37A 4C4SA 3R5FA 2H00A 3MYYA 4S1OA 4DLTA 2XUPA 1EFCA 1KMMA 3OZEA 1S2OA 4FMDF 4KDEA 4NSNA 2B20A 3OD1A 3ZWKA 4TN5A 1A2QA 2GTIA 2ZR9A 4L6AA 3WRWA 4NZOA 1J49A 2DCUA 4NPAA 2C3MA 4RIGA 3ELDA 5EE3A 2V45A 4XUGB 1EFRD 1HE5A 4MQBA 4K28A 1U3WA 3TPCA 2G17A 5LOVF 4URUR 4CR8A 2I4TA 4UUQA 1CQJA 3AJDA 4WK6A 2AFVA 4PHHA 3GLHB 2IHNA 2GLXA 1BCRB 3C5HA 2GUGA 4M54A 2HA7A 2OV1A 1C41A 4HFNA 1UDRA 4YRDA 4KNYA 1EWVA 3ZU5A 5BN1A 4TV9A 1G19A 4TLBA 3IP3A 1OWOA 3QY0A 4PLVA 4DCUA 3DF9A 3K2EA 3PDIB 5JSYA 5FBQB 1N5KA 4LK2A 4FKMA 2RHOA 2OLEA 2CL0X 2HKIA 1FNSA 3PQ5A 4ZOQI 5EZ6B 3S2UA 1OT5A 1BFKA 4GMHA 3GLHE 2NXNA 1ISSA 2XDQA 4FIDA 4FUTA 4GOKA 5EKXA 5KYUA 3S6JA 4GUAA 1GXSB 2GCNA 2JS7A 2WFZA 4I5DA 1ZOLA 4RSGA 1PJ8A 1W52X 2ATEA 4C0LA 1IHDA 5K0ZA 1CUFA 1O9GA 2O0MA 4K9DA 4EI9A 1A76A 3OQBA 5AHWA 4RTPA 1EUDA 1UZMA 3I76A 4GXTA 5ILGA 4B32A 2C5BA 5EUCA 2VDVE 2XNDA 3I32A 3S29A 4HPXB 2OKCA 1F4LA 1SK9A 5DBIA 1U7PA 4YS6A 4AVYA 5BN3A 2X7XA 4GF5A 4EUNA 3WIBA 2HD4A 1F2UB 4JH0A 4Y2QA 2B1RA 1W59A 4JMPA 4CEIA 1MX1A 1XMPA 2HEGA 2OAEA 4IV8A 1BJRE 3WJ1A 4FGSA 2IZ0A 3ANLA 2OYRA 1YUMA 4OHOA 3D3WA 3LI2A 1MB4A 4CJXA 1WW8A 1AKWA 1Y5RA 2HC9A 1QFSA 3KFXA 4LOKA 4WUVA 5F12A 2OZEA 1UOEA 3U13A 3EVAA 3FNQA 4RH1A 5JHHB 4G65A 1D4ZA 1SK8A 2LDXA 2OQ2A 3EOZA 3FCYA 4DTCA 3PJEA 5JYDA 5LIPA 3CPEA 3I58A 5KTTA 5DTIA 4Y2RA 2QN2A 2WSLA 5KKAA 2QUHA 1AKUA 2VT3A 5FOWA 3FFAA 5ALTA 3WGMA 3WLNA 1LK0A 2OQIA 2EFCB 5ALNA 2A0XA 4KB5A 5FBVB 5JDIC 5K99A 4JYAB 2IDZA 1HLDA 1Y0BA 5A0FA 3WKEA 3MWJA 2XCQA 1F2TA 1XL1A 4L8YA 3CUUA 3DFIA 4LOJA 4Q7LA 2GCOB 5IPFA 3UK6A 2WFAA 1SKYE 5CIWA 2KBFA 4XCVA 4ZCQA 2FZCA 4DG8A 1N6IA 1XJ5A 1LX6A 2PGJA 3OJOA 4D0GA 1GLVA 1QQ5A 1Y3FE 1R00A 2PYZA 3GA5A 3ZYCA 3DG9A 1RE0A 3I5MA 1E61A 3PRJA 3LXRA 3ZWXA 5BR1A 5LQNA 3G9XA 1FUEA 3Q8XB 4UHBA 3W2TA 3ABQB 2QSZA 2ZJ2A 1PWEA 4OJQA 1O9HA 4B2PA 4QUHA 2XUOA 3D3KA 1SCUB 4LYAA 4FEYA 4JYZA 4ND6A 2XF2A 3O94A 4D8WA 2I7CA 4R0NA 5ALIA 4E11A 4EDFA 4COKA 1XPOA 1I2DA 1XA0A 2B1GA 3ANSA 5B2ZA 4MI9A 2HJGA 3I6ZA 3PHLA 3EW7A 1PNVA 2AOTB 4MVJH 1VMIA 4U8GA 1K08A 5B58T 3WYGA 4DIKA 1U8AA 3L7BA 4P93A 4ALMA 1KDOA 1I7DA 1P2VA 5F7OA 1CUBA 5K0FA 1OLUB 2FY8A 2G28A 4PAWA 1IU9A 3NTRA 5TPWB 1CZRA 4G4JA 3JD2A 2D5CA 3RU7A 2FZKA 2K6GA 4KIJA 4ZQGA 3WLEA 4EPVA 1PQPA 2ZWPA 3MJDA 1RRGA 2FWPA 2V9CA 1C0IA 4IWXA 4LXGA 1M6NA 3H9QA 1MXHA 2NV6A 4G5YA 5FPTA 3T3MB 1TQHA 1S89A 3A9TA 5IC4A 5LZ4A 1E4EA 2W2PA 1MO2A 4BJ5A 1QP0A 5TY0A 2CN1A 2Q1SA 2HLPA 3C6YA 5FOVA 1ZYUA 3IQIX 2YWEA 1SQFA 3VR4A 1KH2A 2AG0A 2GILA 1LZKA 3CR8A 2JLQA 1E2PA 1Z17A 3RJMA 1ZONA 2ZR8A 1DO0A 2RGEA 5CH3A 2FA9A 4LBWA 1BMFD 1W5EA 2V5UA 2EFJA 2VIIA 3FOBA 3LSYA 4QLOA 5ETJA 1DRKA 1SVMA 1UL1X 5LDHA 2AFIA 2WHEA 3IA7A 2WJ6A 1CZOA 2Z83A 5D3ZA 1KKLA 4IHJF 2NU8B 3DEHA 4XX1A 2ZSAA 1RDFA 3FF1A 4N7BA 2PMEA 4AT1A 2C42A 3V97A 5LP6C 3Q8WA 1GGHA 3KSDO 2C78A 4GNKA 3DHWC 4X1KB 5KIAA 3I05A 4Q15A 4H7JA 5ENVA 2FMTA 1ZX1A 1Z3CA 3LY5A 3MJRA 3QW2A 4HUJA 3T7KA 4LYEA 5H3HA 1ZUHA 1T5HX 3DW1X 4EYOA 5K05A 3AKDA 2PZMA 1AJEA 5HMLA 2OM2A 3GVPA 1TA0A 1CQWA 1RM4A 1T5TA 2HSEA 3PDUA 3V2HA 4YRZA 4Q39A 4WGFA 5A7HA 3LCVB 1BDHA 1U0TA 1IL0A 1Z22A 3W6OA 5CIYA 2EBUA 2QTCA 1DAHA 3QOYA 4YB8A 3H1GA 4TQGA 2Y05A 4HVCA 2FK8A 2FUNB 1VLZA 2OPHA 1S2MA 1R5OA 1C3VA 2JAHA 2ZBRA 1E2KA 2G1KA 2IE8A 3H4TA 3KPWA 3QMWA 4C7KA 1XMQB 2W2KB 4YRQA 1RRVA 4RZ2A 2Q4DA 4LY9A 4ZKEA 1NBEA 2C97A 1GSIA 3QG5A 4U2GA 4ZAXA 2N3ZA 2YQ4A 5K0SA 5FP0A 4N82A 3ESQA 5E3JA 2J31A 3TLZA 1U11A 4PC3A 3UHOA 5FCDA 3LBYA 4Y6OA 4W5TA 1SXJD 3H3JA 2WUFA 2FMXA 1JEAA 1FYFA 4JZYA 3AKEA 2QZ4A 1J4AA 3VJKA 4NG4A 4P08A 1Z2AA 3AHJA 3JYQA 3PPYA 3G5AA 3TD2A 2O59A 4OY3A 1SO8A 4GVLA 1E1MA 4DFDA 3P9KA 1A9ZA 1Q7EA 3I2JA 4MW7A 4JT2A 4BQIA 3FZQA 3O74A 1OMOA 1L8LA 2HB6A 1C0PA 2H65A 1JMVA 1OYVA 4RDIA 1O87A 1NU6A 5AIBA 2HNAA 3KAJA 1JZQA 4DE5A 4D9NA 4ZICA 3FYHA 3UENA 2NSHA 1L1FA 1N2ZA 1VKOA 2FI1A 3IUSA 4NBSA 5HFNA 3LJKA 1U5AA 2II6A 3OKCA 3QEMB 2C29D 3N86A 3HXLA 2BE9A 1EM8B 4HQFA 5ITVA 1X70A 1USVA 4O0LA 3TVTA 2RDMA 1ZLXA 1XTQA 1XDGA 1ZJ4A 2XDQB 5EMKA 3O38A 5U4QA 4A8JB 2FR8C 3GT0A 1R0BA 2GPWA 3C7CB 4FYHA 1GEGA 1H5QA 4BNJA 1TYBE 1U94A 2XWQA 3ONVA 1XZLA 3U3OA 3ZLJA 1GO2A 1X8XA 2QUIA 4J9UE 3RTDA 2HA4A 2VDJA 5AI5A 4B6PA 5DOZA 1UJMA 4MO9A 5AW8A 1QP4A 1TYAE 3QHPA 4O5OA 2FKNA 4GDMA 4KXFB 3KQNA 2AMLA 3WBBA 1ZW6A 2QIPA 1WU8A 3AILA 4GE3A 3CU5A 3QM1A 2WWTA 4D5EA 2EZ4A 4UNQA 4XLZA 5FTNA 1R9MA 3DDUA 4WNAB 1UT8A 1LSOA 4O4LF 5JTUA 1J0DA 3ORSA 3EFBA 4UHDA 1R8XA 4GYYA 4MS1B 2GJ8A 4QVKA 2RFLA 1JPJA 2WIKA 4UC0A 4RJTA 1G6OA 1D4AA 1WPXA 4YDRA 1EVLA 2Q45A 2ZI7A 3QX8A 4H17A 3S5JA 5K4GA 1PJLA 3F7NA 2QRPA 4J1TA 4R8VA 3VC2A 2AEFA 1K6XA 1W34A 2R6DA 4JP1A 5TQVA 1F9EA 1EG7A 1MABA 1FYXA 3PEYA 5A3QA 4Z1MD 4LXXA 5KX5B 5BQPA 2EJTA 2Z9DA 4PGMA 5HGXA 3KCNA 1XHFA 1A9RA 1N9GA 2P4UA 3Q7PA 2FSHA 2HY7A 3ENWA 1J2RA 2NZXA 3IOEA 3PJDA 4JMLA 4BNHA 1ZCAA 2CXQA 2ZQ5A 3DBRB 4Z9FA 2O3QA 1G4UR 4HJRA 3LZ6A 2B6HA 3Q3EA 5E6RB 3LQ2A 3SYRA 4KJXA 5DB4A 3T9FA 3HTXA 1JJ7A 3ORHA 3T0IA 3BRWD 3WJ7A 1LH0A 2EGUA 2VYFA 3FSGD 4G4IA 5E9WA 4CMIB 1XZKA 4WLFA 2R00C 1UPXA 3OUTA 3EVCA 4ZU3A 4GMXA 2PT9A 1K2WA 2C88A 3NAMA 1WEKA 3LQRA 4M2LA 5LA6F 4UTNA 1QVVA 3PG5A 1J33A 4ZJYA 5JQGB 1KI6A 1J2UA 3TFOA 2CNLA 4LOHA 3M6IA 3IT1A 1BG6A 3PNOA 5I3ZA 4WK2B 4BX3A 4Y6LA 4QGSA 1E64A 2QD4A 4KYTA 3RVMA 2WJ4A 2DVMA 3GRKA 4M9CA 3UJ8A 1AQIA 2WE8A 3VR2A 4B8ZA 2Q62A 4H7HA 3ROMA 4DEYA 1YR8A 2C2XA 3GVHA 4GECA 1U9CA 3WB2A 2G7MC 2FPLA 4HMOA 3C3KA 5AQ1A 3GJSA 1KDVA 3I42A 5MFPA 3CN9A 3R7FA 3VZQA 5DNDA 3PQEA 2WHQA 2ZIXB 1G98A 5TV2A 1UKCA 5AJYA 3FSRA 2R5NA 2HLDD 3QVVA 4O59O 3H1AA 1KBQA 4BFVA 1WHTA 1AQYA 1N2BA 4HAXA 5KNCA 2QV7A 4JJIA 4XSGA 1Z2DA 1JDJA 3FM9A 1J70A 3HKEB 4M1YA 4US1R 1C9YA 2P4EA 1L8QA 1MVLA 1N2IA 3DAPA 3A1TA 5KQMA 1ZGAA 1P45A 4ALKA 3FCEA 2EHJA 4G5SA 3DKPA 3LUDA 5GPBA 3BICA 2RONA 3MC1A 3WZMA 2I7XA 1C7JA 2SECE 3COVA 3PA8A 5HUQA 3HXQA 4M83A 1XCOA 2Q6KA 3B51X 3R5JA 3W9SA 1N2GA 2D2XA 4DCMA 1OGYA 2A4MA 3RBVA 4TL9A 4EG8A 1J5XA 4BVFA 1W5AA 1VL8A 3M0EA 5KTKA 1F0NA 2QW1A 3GROA 3TLCA 3ZE2B 2GJKA 1ATZA 2H1HA 1EK5A 1YT5A 1LTQA 4C43A 2MOKA 4P36A 4XDGA 2A9OA 2P2NA 1AGXA 2BKEA 1KHHA 2BFAA 2C7OA 4LSZA 2ZJ1A 4PX9A 4MI6A 5TRTA 5JO0A 3FVTA 5FJIA 1MIOB 1QFXA 5C31A 1IXKA 1F0YA 1KORA 2IITA 3DFFA 4XSVA 5EG5A 2PG3A 5F77A 1TA9A 1Q0QA 1ULBA 3EASA 4J3JA 3VR3D 2AHOA 2R6ZA 1UQTA 2IU6A 4C76A 3OQMA 1NBHA 2H4ZA 3CWZA 5JIBA 3LCJA 5IUJC 3KQPA 5AM1A 1N6LA 4MROA 1IZ9A 3AB3A 4WK0B 1RKVA 5B1IA 1RBYA 2ERXA 2H0RA 1Z9BA 3EXIA 5H02A 1NLUA 3N6XA 1H4SA 1G8FA 2WTBA 2GX6A 3IO3A 1KO4A 2CLMB 4OU4A 1N36B 3GRVA 4TV8A 1KOLA 1M83A 2EQBA 4BNIA 2B35A 2LGJA 1ZSYA 1MPXA 5JJBA 3A3YA 2ZB8A 3EN0A 2FR1A 3OQVA 3H0EA 1J06A 1SG0A 4Q9KA 5IULC 3BFKA 4FS3A 2UVPB 3QU4A 3M82A 4QWWA 1T4MA 4RE5A 1BHJA 4Q03A 5ER6A 4Q9HA 2WZDA 3GPDG 2A9JA 1L0BA 3GLKA 2WQ7A 1OBOA 4YI3A 3RIMA 4Y1FA 3KT6A 2XQGA 5EMMA 4GL4A 3LV8A 5JD4A 1WZNA 5FUVA 1FDTA 3FCSB 3EXFA 4ND8B 3QF4B 1GPLA 5IHXA 2VJBA 4HLQB 3EAGA 3UMYA 5CPFA 1R4NB 4QTZA 2E89A 2P0AA 4HDKB 1WOMA 1XLUA 1NP3A 1JR4A 1FFEA 5B7GA 3O4VA 1SU8A 4YAIA 2HF8A 3BF8A 3MQ4A 3ENQA 4A10A 1K6EA 1KXJA 3D6FA 5HILA 5KOYA 1YVEI 4CKYA 2DKOA 2EWWA 1NWCA 1MENA 4PZZA 5IC6A 2O5VA 4RACA 4DMUB 3TCNA 1T8PA 3VPSA 5TF0A 3WWCA 2DEUA 3BBLA 1Z74A 1KSFX 4FEEA 5A5GA 2PGOA 5B4TA 4IYRA 1OI3A 121PA 1PGPA 2R8EA 4AMYA 3SICE 2G07A 3PZRA 1QYXA 5BVHB 1O94A 1HE3A 2C2HA 2WJZB 3LZCA 3QFRA 4GLBA 4TROA 3UQYS 1DUSA 3NTQA 2ZROA 3ZYZA 2OXIA 5FYQA 2JJ8A 1Y4SA 2J0UA 3B5JA 1SXJA 5BRNA 2B5WA 1E3JA 1C9NA 1MABB 2QQFA 4Y2XA 3SVLA 1WCIB 1L9XA 1N5OX 1P60A 3CPJB 1ZM3A 3LT1A 4XIYA 1D0SA 1P3JA 4QO8A 4LN1A 2GO1A 4HDNB 5ARCA 4U02A 2V7QD 5CLQA 1KQFA 2AMJA 4YMWA 1F8XA 2YYZA 3KYCA 1RCTE 5DXFA 3WYNA 3GR6A 2OC4A 3RM3A 3V32A 1ECJA 3R7LA 3AI1A 3AY6A 3ELWA 1JJVA 2WV9A 1E6EA 4IDNA 4AJOA 1DDIA 5EVCA 2NMVA 3O0TA 4B4KA 1XRLA 3I0MA 4FFWA 3EIEA 2RGCA 4MVJF 3E53A 3WYBA 2O2GA 5KYVA 3WK9A 5F9HA 3R5XA 5E3IA 1PR6A 2PQMA 4JCOA 4NU5A 5ALEA 1DRVA 4G5GA 4QG7A 2GLUA 4W5WA 3W5VA 1BWSA 2DR0A 2HGZA 4Y6SA 3ZVMA 1QQAA 3EB9A 4JUCA 1RBZA 5JS1A 2HRDA 4NJEB 2EGHA 4RMNA 1LF0A 3TRHA 3LDHA 4XYEA 3AEZA 5TIIA 1Y1TA 3DOFA 3QWHA 3ZH2A 3L3BA 4CI9A 3ABZA 5B7PA 3PT9A 1AQUA 1Q91A 5CHEA 2A0FA 3NS7A 3OLYA 1KJ8A 1CB7A 4AWAA 2G67A 5JCPA 4KRXA 1PK8A 1HDEA 2FNAA 2CZCA 4DADA 1YC5A 3B5IA 2YN0A 2F2TA 3NQ41 1XU4A 3IQWA 3U44B 3C1UA 3UT5A 2DPHA 2VJAA 1YQTA 4XJVA 1JE0A 3RVRA 4Z4QA 1N6HA 5EJ6A 1M2HA 1RKQA 2Q28A 2UZ1B 1AO3A 4CM1A 3JQ9A 4V02A 2I67A 1RVV1 2J09A 2I6QA 3L8FA 3MOSA 1PG5A 2QJWA 2ZAYA 1LSJA 2RHCA 4Q4DA 5A0TA 3DCJA 4H27A 5EIFA 1RAEA 3ITEA 4IMJB 1JHRA 3OU2A 3OVMA 5CVCA 4K6OA 1KQNA 2H5EA 4R1NA 1D5WA 2IPLA 2C61A 1JQLB 1ZK3A 3MIZA 1DTWB 3OJXA 4L73A 2C7PA 3GQBA 1Q1NA 2Q9UA 1MG5A 1PEAA 2H9IA 2O07A 1QZ3A 4HWKA 3AP3A 1Z63A 1H42A 4BJ6A 4C9BA 1EUZA 3CR3C 2IIVA 3DO6A 4R69A 4Y9TA 3AFGA 3NEYA 1G20A 4RKQA 1FTYA 2GRUA 2CZGA 5IT4A 3HCOA 3R5HA 2B1QA 2H3HA 3LOUA 4PQGA 1QGAA 4CQMD 5F33A 1FDOA 4CKBA 4D0NA 2PYIA 4IDFA 4L4RA 2QRZA 4MR7A 3NBZC 5K3FA 1CWUA 2A7XA 2PT5A 4JOCA 2VCYA 4ES6A 1VE9A 4G2TA 2GDZA 2I4LA 2Q4EA 2VDRB 4HNQA 2WOJA 2D1SA 4EYQA 4FMDB 3PD1A 1E2QA 3UFBA 1NM5C 1Z28A 2D2FA 3E2MA 4MS3A 5DP2A 3TIFA 4G4SO 3AHHA 5DKFA 1XKQA 1QNLA 4G84A 2FN4A 3HS3A 4K3UA 4V0MA 5JXWA 3DULA 2ST1A 3L7NA 4ACBA 3CLRC 1U1CA 4EYGA 2ECQA 1YOBA 1EG2A 4KQXA 4OI2A 1BEUB 3L5OA 5EESA 2PUTA 3UHJA 4R2HA 3GF4A 3KHKA 1TLLA 3W7VA 4C2AA 1A72A 1GUZA 3T7IA 5IM4F 5JS8A 3WQRA 4Z9YA 1C8BA 1EEHA 1W4BA 3BKXA 3FPJA 3H5TA 3UJBA 4KQEA 1W36C 5IBRA 1FNBA 1U9JA 2C98A 1J0CA 1SD5A 4RANA 5F78A 1SBYA 1YL6A 2N47A 3DE2X 5DM1A 3KE8A 1S4MA 4EFKA 4Q9AA 2QI9F 3QOXA 5K03A 1YO6A 2E87A 2O0HA 1M6VB 3G7SA 3UICA 4E1BA 1PF7E 3KSMA 1BVHA 4JLBA 2YICA 2A33A 4DLSA 2A1TR 2ORIA 4RIIA 3GL9A 5FBKA 4EB0A 3ZGXA 3RSQA 5FFFA 3X44A 1A8HA 3HDVA 3IBCA 1N4DA 3C39A 4CUZA 5BWNA 4GAEA 2F9MA 1NJ8A 3AQ4A 1EU1A 3ND8A 4NX2A 5BPHA 4FDAA 5WRFA 1EUCB 1NPDA 5LXTB 1VHQA 5ERYA 5I9SA 4O02B 5AOAA 4BO8A 4RJLA 3SKXA 4LYGA 3FFBA 4IAOA 1CEXA 4QQRA 4EHIA 4HH4A 2FSVA 3B52X 3UF0A 4E7OA 3FGPA 3D6UA 4F6RA 1ZVQA 4F06A 4EY4A 1FZQA 4IGIA 2VO1A 3RRBA 1USWA 4EHFA 3R0IA 5EWMA 3RGGA 2FVXA 4I6EA 3GD5A 1N2CE 4KWCA 3NNDA 1DBVO 1DC4A 2BEJA 2P0YA 4YUWA 1G8KA 2C95A 4DB4A 3D9QX 4LMRA 5K7SA 3G7UA 3HJNA 1XHLA 4KN8A 4MSUA 1CZUA 1Z62A 1K98A 3ID6C 2XKJE 3RIYA 3ORRA 3UMMA 5BV0A 1R0RE 2HA6A 1I33A 1PWZA 5DXAA 5LBUA 3RVLA 2WQ6A 3IYLW 2EP7A 2XODA 1L7VC 1XELA 2MDTA 4CQMA 1DC8A 3DZDA 5FOSA 3S70A 4HX5A 4IOMA 3FRIA 1Q19A 1HF3A 3AHCA 4YJ3B 1EM8A 1JLHA 5SY9A 2JJ2D 3PEEA 4MEAA 1YFJA 1QU3A 2ODAA 4L02A 2WY2D 2BMAA 2I3ZA 4G1BA 4YDHB 2ZWMA 1YJCA 2YVKA 4DCPA 6REQB 2O2HA 1GT6A 1XOIA 5F2EA 4D8UA 1A69A 2TMYA 5LNK1 3UUEA 3CISA 4WFJA 2DUMA 4Q00A 8ABPA 1SB8A 3G6KA 4BZQA 5FA6A 1SHKA 5BV1A 5A2QA 5I9LA 2WLTA 1SHJA 4BGUA 2DU8A 1EVJA 4CHTA 1XSEA 5LDGA 1K8QA 1O2DA 4RJKA 3SHOA 1M34A 4BHTA 3VGPA 4XD2A 3EIUA 6NULA 1Y8RB 2EAUA 1DHRA 5HSGA 2CVZA 3TW8A 5AI8A 4BQSA 4D57A 3O8RA 1WLSA 3IQEA 4Z8XA 1NTRA 1ZNQO 3PZBA 2VF4X 5D3KA 4BVLA 4JKOA 5ADVA 2J0QA 4KOEC 1XRJA 1I6WA 2OBMA 2RBKA 3SR3A 4R7ZA 3ZBTA 4JODA 3OPMA 1L7BA 4ZVQA 3RKSA 4JLNA 3CCFA 4YP1A 1YS2X 4LXQA 1FUUA 3RS5A 4Z4GA 1OSNA 1XFAA 2XCLA 2QORA 3DMTC 1YBMA 4R68A 2QNRA 2I5PO 3LPAA 3EJ6A 2PZGA 4NCIA 1IN6A 4LX8A 4RKEA 3LGXA 3D59A 3V7UA 1E2LA 5KPJA 1OX4A 4RCVA 2DR2A 4R2WA 3DCYA 4L9SA 3EDOA 3HXTA 3OF3A 4IEEA 4AN4A 4ZYVA 4KWTA 3GDOA 2PXAA 2VHJA 2C00A 2V74B 4Q7MB 5K20A 2WLSA 3MINA 4H2DA 4F9FA 4RJIA 2A5FA 4DPKA 1WW2A 3C3AA 2WT8A 1FX0A 3A4VA 4D2IA 5I5GA 5LM3A 3BJIC 1U28A 3BK7A 2C0PA 3WIUA 5JY1A 2UYCA 3QLTA 1F48A 3K30A 1YJXA 4RKRA 3Q5DA 5KHAA 3VTFA 4RK7A 3N39C 3WAKA 5BNZA 4RD2A 1UP4A 3JQDA 5M3BA 4A2WA 1G8MA 2IZ5A 1ZISA 2GVZC 3GD7A 4BNZA 1JHMA 2UUOA 3WWEA 3KQQA 3LX6A 3OLQA 1D8TA 3L46A 5I4KA 3HO6A 3CRW1 2PGXA 5IJ0A 4NJMB 2Z4SA 1KS2A 3RK0A 1PWXA 1IY8A 2WC1A 3FYSA 1GU0A 3H9GA 1WIWA 1ZGBA 3LOPA 4IQ8A 2VJNA 4BPRA 5GZ3A 4P98A 2V7VA 3LOQA 5U1PA 4X63A 2VK4A 3N6RA 3MELA 1XTVA 4MS4B 4QQKA 3NHPA 5D6NA 3C1OA 4Q0MA 3UMJA 5BV2P 5EAIA 3BWXA 1NI4B 5BUSA 1I01A 4ZV7A 5LWQA 3KM0A 2QI9C 3P9IA 4N0EA 3MT9A 3WGVA 5K4AA 4NULA 5SY4A 3TW4A 1YB1A 1VA5A 1LJUA 1I0LA 1MV5A 2RH8A 2ZXEA 3HBMA 1KO5A 4J75A 1FNCA 4B71A 2JLVA 1RWXA 3MTBA 2MSEB 1NFFA 3GRUA 4R1PA 1D1PA 1JFFA 3CNQS 4FSDA 2QAGA 2WU4A 1YCGA 3AYZB 4YR9A 2HQOA 3NWOA 4G1MB 5IJ9B 2EGGA 2G4LA 2VPPA 2D4AA 3S55A 3PUKA 2NU6A 1KE1A 2VP3A 3HZOA 1UQRA 1E99A 3E3LA