1SD5A

Crystal structure of rv1626
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
PRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative antiterminator
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd5A01
3K69A 2FEZA 1F51E 3L9FA 2FMYA 3IHUA 1ON2A 4CHUA 1R7JA 1ONVA 4HX8A 3FM5A 3ILHA 5KQLA 5HDNA 1B9NA 1LK0A 4MS1B 2IA1A 3GT7A 3DXJF 3KKEA 3LUGA 3OQNA 3HV2A 3NEUA 1QKKA 3CUOA 1Z7UA 5HS9A 3O2PE 4ZZLA 4ZYDA 2KJCA 3V8LA 2XAJA 4ZYEA 1FPQA 3ZP5A 3ILYA 3DQVC 1SXGA 4MLDA 3H1FA 4RZSA 3HJFA 2XAFA 4M72A 4L85A 1E17A 4RSMA 5C5CA 4Y13A 3GBVA 4W5RA 3FF5A 4G0OA 2HQOA 5ILUA 3IKVA 1RUNA 5IEJA 3ABUA 3QP5A 1URPA 3IP7A 3I64A 1OPCA 2VOPA 4KZKA 2RKHA 4H0EA 4ZMRA 1RZRD 2Y75A 2PQ8A 3OQOA 5FO5A 2NAZA 2DI3A 2RN7A 3OMXA 2XUBA 1Z6TA 3L7WA 1HQCA 4O6JA 5EWJA 4OIQF 2PUCA 3EAFA 1PUXA 3KYIB 1O3RA 2TMYA 3CUQB 3QU6A 1FQWA 1QQIA 2DU9A 3QLVC 1F4KA 2P6SA 4BHCA 4IRGA 2VUIB 4Q48A 1TTYA 2YX4A 4RXMA 1R5GA 4E70A 3EUHA 4RK4A 4EYKA 4I2OA 2IPMA 2F8SA 2STTA 1ZGZA 3TKYA 4Z9BA 4LK0F 4G8XA 2YHAA 3ROFA 1OYIA 3C97A 2E4VA 2K4JA 3KSMA 4IRXA 2M98A 1T98A 3K0LA 5E1WA 1OXBB 5TPWB 1TLHB 1LJUA 2FNPA 1AB5A 1EWKA 1USSA 1R5HA 1T2KA 2RV8A 4KIFA 3JSOA 3C6QA 4D74A 4MQ9F 4YFXF 1EFAA 1VTNC 5TQ0A 2PUAA 4MGRA 2K02A 1YVUA 2WWYA 4G94A 2HPHA 5JS2A 3NRVA 1RXIA 3EQZA 2FEKA 2K4BA 3EGCA 4LJZF 1HEYA 2EWNA 4WXMA 3G73A 1PHRA 1J0RA 1U0SY 4YGXB 3VNAA 4N47A 4A0XA 3SZTA 3F6OA 1YW8A 1Z2DA 1XDUA 1QO0D 4G0MA 1GXQA 1RI7A 2IPNA 2FBKA 1Z13A 3QELB 3TO6A 4XLTA 3HDGA 1R23A 3J80Z 5EWMA 3CZCA 1YYVA 4UUVA 1DZ3A 1G3YA 5L3EA 3GW2A 3WTYC 3OO1A 3Q41A 3DPTA 4ETSA 1PUEE 1USGA 3H5IA 2QVOA 1P6RA 4EJOA 2L2QA 3H5OA 3EYIA 1NXOA 1DPRA 4MEXF 1S8NA 2XGXA 3UKJA 5DYMA 3FFTA 3B02A 1P4AA 3WGIA 1HSJA 1O3SA 1FZPB 2WY2D 3M6MD 4MEYF 3ZMVA 4O5AA 4D6YA 4LDZA 1G6NA 2ZAYA 1FSHA 2NZUG 2M1BA 5HVQC 2IOYA 5EWLA 4NHJA 3LKVA 2HTJA 4IRHA 4A6DA 2ISYA 2E4YA 2QVCA 3C3WA 5K1YA 1KYZA 3OV8A 5TQ2A 4EVSA 5CVRA 4TMYA 3GYHX 2H0AA 5IT3A 2FW0A 3IP5A 1P6QA 3IWFA 1TQIA 1NXSA 4FB4A 2F2EA 1EWTA 1J9IA 3P9YA 2O03A 4M74A 5LHHA 3HRSA 1XWWA 1IAWA 3TO9A 5ED4A 4GYGA 1P92A 1T0FA 5T3YA 3HXMA 1DBQA 3LMKA 4Z99A 1HKTA 3QX8A 4O5VA 3FMQA 2PL9A 3O21A 4MQEA 3FXUA 3QEMB 4XSZF 5LBQA 2R48A 1K68A 1FBSA 4AWXB 4Q7EA 1G3WA 3DPLC 1NY5A 3TGNA 1J7KA 1LDKB 4WXCA 2IT0A 3H6HA 2A5YB 3BILA 2RJNA 3ROUA 1APBA 3F6PA 2QBYA 3H75A 2IVMA 4U0YA 3H92A 2DTRA 4XLPF 1E6MA 2L4AA 1LQ1A 3R0AA 4PE5B 4LDAA 4A5MA 5E3JA 3V8KA 3ZMSA 1BC8C 3K1NA 3F8NA 1SFEA 3OM0A 1B6AA 2IP2A 3GBPA 2R7FA 2H27A 2P5VA 4IF4A 4MQVA 1MKMA 1ISRA 1ZYRF 2AYZA 2A68F 5J8FA 4XASA 2XAHA 2RVCA 5GOTA 2N9UA 5D8LB 5LRRA 1O7LA 5K5OA 2JVJA 1USTA 2YR2A 3NBMA 4N76A 1FSPA 5CNMA 4R79A 1GCAA 3MMNA 1AOYA 4KA4A 4MR8A 3J81Z 3BDDA 2CFXA 3T8YA 2HDCA 2WMYA 3FFWA 4HA8A 2IPAB 2GIVA 1P6UA 1KU3A 1I1SA 4DN6A 1SFXA 2GBPA 3F8MA 2FTKE 4KUMA 2HQBA 2JVIA 4RY0A 4JB0A 2F5DA 4KICA 2Z9OA 3MA0A 2EFPA 3OLYA 2OENG 2FN9A 3MF4A 4H3HB 1VPWA 4HNSA 5BR1A 5FGMA 3CTAA 5DCMA 1ZITA 3R61A 1Z2EA 4WF2A 1ZVVA 3KP7A 4UHTA 4A2UA 1DBWA 4MPTA 3N53A 3M9WA 2PEXA 4LGWA 4DQDA 2V9VA 2YPRA 3HSEA 1CF7A 4EGSA 1XGMA 2B1JA 3TO7A 5CVUA 4BNCA 4YIFA 3LSTA 3LTEA 3RVRA 5DEQA 1LDJA 3GX4X 2PUGA 3QPHA 4N0BA 4P98A 4UV9A 4EM0B 2M30A 2XAQA 4PGGA 3HS3A 5T7BA 4MHGA 1M5TA 4JAVC 1U2PA 1WRJA 2QU7A 2YHBA 4W5TA 2X4HA 2HEOA 2OQGA 1BJAA 1IW7F 2MSWA 3T0YA 4LE1A 3F73A 3FMRA 3CJNA 3BROA 4MR9A 3LWFA 1JFSA 1U5TB 2EK5A 1XCVA 2BGGA 3HUUA 2CYYA 5LGUA 1QNLA 5JNTA 3GRCA 1F9NA 3RTRA 2VT3A 3ZMZA 1XD7A 4UVCA 5BPDA 3F21A 4FHTA 1O57A 1KRWA 2K7LA 5IT9Z 5KK1A 1EWVA 4ETNA 3M8FA 3JAMZ 3O2JA 1SMYF 3P9IA 2FSWA 3P9CA 3JW4A 4XBFA 1Z12A 4MQFB 3ZMDA 3CO7C 3F6CA 5LGNA 4H60A 3V7RA 1ZGJA 3WODF 1RPJA 5D4SA 1IIBA 3E5UA 1ZESA 4MRMA 2ISZA 5DV5A 1NXTA 3VNBA 4OLBA 5JHUA 3E61A 1ZH4A 4ENNA 3V8JA 2GKGA 4WK8F 2PLYA 4UNOA 3LFTA 1OYYA 4B8XA 4HLXA 3FX3A 4M9ZA 2JBAB 3S99A 3CU5A 1D4ZA 1Z15A 3A10A 1HW1A 3RPQA 4KVFA 3EULA 2AYXA 3N0WA 4JQFA 3F8BA 2WJAA 2EFWA 2D1HA 2O0YA 5BQ3A 4RXUA 2Q5CA 3MZYA 1DBPA 2TDXA 5HM6A 3RVOA 3O1JC 1E2XA 2FEPA 2ZWMA 1I27A 4UHKA 4F3TA 1PNTA 3M9XA 1QPMA 2HWVA 2DAOA 4FE4A 1G4DA 5CVJA 4PZJA 1BA2A 3JSPA 3UK0A 3LQRA 3R0JA 1KQ0A 2PFBA 4WUTA 1XCBA 4MS1A 1QZYA 3HUTA 4NCBA 3NHMA 2Z5UA 1JHFA 4OTZA 1UHMA 1DCFA 4EM1A 3HIFA 3HRTA 1OR7A 4PDKA 3E3MA 4NQWA 2FA5A 1BVHA 1JX6A 3H5LA 1FBUA 5DKFA 3R4KA 2NNYA 3LAJA 5E8IA 2FSPA 3HEBA 5C5EA 4ZYLA 3HTSB 3NNNA 2R4QA 3KP3A 1J2XA 1SD5A 2VUHB 3WTWC 1W7PA 5BMZA 2PG4A 3F72A 2IA2A 4IVNA 3PQJA 4F06A 4PYRA 1L0OC 1R00A 1ZLJA 5JNSA 3BY6A 4EYOA 5L3GA 4EVRA 2PUEA 3G85A 3PQKA 5E8GA 2MA3A 2O20A 1D2AA 3ZMTA 1B59A 1XMAA 3WTUC 4ENKA 1SRRA 4Q6BA 3MYYA 5IEBA 3W6JB 3I54A 4HV6A 3N6VA 2W25A 3QK7A 2ESHA 1BN5A 5AIPA 5BS6A 5J8CA 4WT7A 2A3SA 1S6LA 1CHNA 2DFIA 1MVOA 2JRLA 4M88A 4MR7B 3O3KA 4GPAA 2MD5A 1U8RA 2CWEA 2E4WA 5D5XB 2KIMA 1QQBA 4N41A 4I09A 2OZ6A 3Q9VA 4M6XA 4HX4A 2ZKZA 3E3VA 1H9TA 2CQKA 1RUOA 1ZG1A 3JPYA 4XARA 5DDGA 1JGSA 3RVQA 3K9TA 2YSRA 2A69F 5TPWA 2M1ZA 3KP4A 2HR3A 5A2QZ 1JXSA 2V79A 4HF2A 2HGCA 1D5VA 2LSOA 4QWQA 3F6VA 2FNAA 4ESJA 3SAJA 4IHSA 5KVRA 3H5VA 4RGUA 1IN5A 3F8FA 3HZHA 1HW2A 2GA2A 3ABTA 3E6DA 4LG0A 1DCKA 2L19A 1K78A 1SD4A 2FRHA 2VBZA 1YS7A 1UB9A 3GXOA 2LF7A 1YTUA 3VEPA 2EV0A 5D6EA 2PMUA 4BAYA 1R8JA 3LUAA 4LFUA 4IRIA 2W57A 3R6SA 5ICGA 5HLHA 2AXLA 1P8AA 1YQAA 2JB9A 4EY3A 3HHGA 3OOPA 5DTEA 3Q7TA 1TMYA 4YWHA 3KZYA 4XLNF 2BBYA 2PAFA 2OD5A 1K7AA 3SQNA 3T1BA 1A0OA 2BEOA 4I98B 2OBPA 2DRIA 4LX8A 2F5EA 5EEGA 3KTOA 1FFWA 2CWDA 1L3LA 1Z16A 3QELA 2EFQA 1PP8F 3JTHA 3OM1A 5B3JA 5K5QA 3KZZA 2IW5A 1YG2A 1P4XA 2KKOA 4RB0A 3FMVA 3W9SA 4MLCA 1JFTA 4G0ZA 1FWZA 5BOXA 2R7DA 4L9JA 3H1EA 2CHEA 4F12A 4M9XA 1PEYA 3C3KA 2YX7A 1DJMA 5TRDA 4JP1A 3WTZA 1IXCA 2QQAA 1DC7A 3KCNA 3GZ5A 1FP2A 5LRSA 3E6CC 1JDNA 3G3ZA 3ZN1A 1SAXA 3QP6A 1EAYA 4XSXF 2E7XA 2FXIA 3HSYA 2OU2A 4KDPA 2VE8A 2QM3A 3KP5A 1DP7P 1OKRA 1T34A 3QX9A 1MJAA 2O6GE 3IRRA 4RY8A 3RJPA 4IPAA 1H9CA 4M73A 4Z4GA 4OINF 4MS3A 2UWMA 2R25B 4CGZA 3SM9A 4RGXA 2FBHA 3B2NA 2ELHA 4AD9A 1KMIY 3E6MA 1FBQA 3WTXC 2UZKA 3BJOA 3DZDA 2RGVA 3CHYA 4LB5A 1OYWA 1R36A 4KFCA 4RK6A 2HKOA 1BBYA 1S7AA 3RVJA 3CZ5A 4KV7A 4L5IA 3JTEA 2VC1A 3RVSA 5B3JC 2MYUA 2HFHA 1NXVA 5E17F 5TPZA 4RKQA 4Z4CA 5JNWA 5KC9A 2MSLA 4RWEA 1FFGA 2XHKA 3EDCA 2E1CA 1XGNA 3EDPA 2RQPA 5DUKA 4ENJA 1TW2A 1EHCA 1YW7A 1FX7A 1PDNC 3J7AO 1ZH5A 3DP7A 1A04A 3EQLF 3ROTA 2EV6A 4A0ZA 1W5TA 1NXPA 3E5XA 5FLXZ 2ZBKA 2FVYA 3GL9A 2FLWA 2FF4A 2KIUA 4DNCA 3WU1B 3O1IC 1IZ1A 2PMHA 4WX9A 2HOEA 1WI9A 3I59B 4G0QA 1FC3A 1DG9A 2XVCA 5H20A 1RIOH 2XV4S 4YS6A 4BHPA 1J56A 1O3QA 4MS4B 5BQTA 1M2FA 1H0MA 4BHBA 3D8UA 1BDHA 2DBBA 1GUBA 1D8JA 3KFWX 3OLVA 2W85A 4G97A 4P55A 3ZMUA 3LFKA 2XRNA 2RNJA 3H1GA 3H5WA 3I5AA 3LUKA 1JYEA 2VN2A 1C0WA 3ZPLA 2VK2A 2LNBA 4XFKA 3CTPA 5LEKA 4RV5A 3H3ZA 4OMYA 3TO5A 2V0NA 2Z3YA 1T6SA 2IYNA 1DCMA 2IJLA 4CBVA 5HSGA 4P96A 1JE8A 3T6KA 4ZZDA 2QW1A 2L54A 2BYVE 2PUFA 3RVPA 1W5SA 3MQ0A 4Z4IA 2PMCA 3W6KB 1BDIA 5DD8A 2FMLA 1K6OA 5ERIA 2Z99A 5EEHA 3T8RA 1F1ZA 2HS5A 1R58A 4JA2A 4LD5A 5EWJB 2DW4A 5D6FA 3HK2A 2UXNA 1TQMA 5CYVA 3RI4A 2FEWB 2KYRA 3LUHA 5CNKA 4RXTA 2M5WA 3ERED 3RYRA 1DDNA 2NNNA 3GLXA 2AS5F 2KJBA 3BJ6A 3J81K 4OBBA 3IP6A 2WC2A 1TQPA 2Q0OA 4NV3A 3IPCA 4KRFA 3O2SB 1Z05A 4HLYA 1KYWA 3K9CA 4D6XA 1RNLA 3I53A 1IUYA 3M9AA 4IMIB 1S29A 1IRGA 1TBXA 2VT2A 4XRFA 3LUDA 4KN7X 2V1UA 1T39A 4N9HA 3S2WA 4EM2A 3T38A 2WWVD 4UHJA 3WTTC 4RS8A 3KEQA 4Z4HA 2QENA 5DD4A 1U2WA 1DRKA 4N0PA 1U5TA 3DLHA 5FB2A 4HX7A 2LPMA 5CNIA 2LDUA 4AIJA 3DGFC 3MWMA 1V4RA 3N8IA 1TNSA 2QVGA 2H6CA 5KI6A 3OLZA 6PAXA 2E7WA 1YK1A 1SD7A 2ZJ2A 3RVKA 3CG4A 2BV6A 4LZLA 3I4PA 2JVKA 3O1HB 1JDPA 4G86A 1YMVA 3NNDA 3HVRA 1IN8A 1U6GA 4MTDA 3JS5A 3QPTA 2A9RA 5TE9A 4YFNF 1M5UA 4A0YA 2FXAA 2RC4A 4S04A 1BIAA 3SNKA 5D2CA 2EA4A 5ICFA 4HZFA 3GO5A 2FMHA 2EB7A 5FWYA 3HSFA 1BI0A 4GCVA 3CLKA 2STWA 3HHHA 1MAVA 2MLKA 1JF8A 4ZMSA 1J5YA 2VXZA 3IC7A 1D8KA 1ODDA 3CS3A 4A6EA 4YLEA 4QPJC 2Y48A 4I0AA 2MYNA 2UXXA 1A2OA 5CNJA 1BI1A 5FD5A 5IT9K 4KT5C 4OIPF 1E2BA 5FWXB 1Z25A 3KCCA 4LE2A 4Q4ZF 4PZ0A 3KP6A 1FSEA 6ABPA 1Z91A 3UUGA 4I02A 5EWLB 1QBJA 4Y17A 1YTYA 1USKA 4HQMA 4ESFA 1QP7A 2B0LA 4KMRA 3R60A 3K1PA 2DO7A 2ZO4A 1IXRC 4KIGA 5LLQA 1ZN2A 1ZAYA 1DC8A 1XGSA 3ELKA 4LRQA 3AAFA 2P9HA 4KQ9A 3PFIA 4KYWA 1ON1A 1IF1A 2LF8A 3RKYA 2C6YA 2ZXJA 3WGHA 2V6CA 5CHYA 3CFYA 4R8HA 2WTEA 4UVBA 1F4VA 4BXUA 4MQEB 2Q8KA 1NHAA 3DFGA 3CO6C 1R1UA 1TNTA 2QV0A 3O75A 1WWXA 5ICEA 1EV7A 3Q15C 1G3TA 2CD7A 3O2QB 3IKTA 4MGEA 2NT4A 5JNUA 3RVLA 3L49A 3Q7RA 3BWGA 4I7HA 5FFZA 1MDMA 4LK1F 3O74A 4EJTA 5LHGA 3DV8A 1B1BA 1Q1HA 2OAZA 2FBIA 2WRZA 2HKXA 2E4ZA 4CO8A 4G0XA 1I6XA 5J6XA 5HDKA 3F3XA 1JHHA 3RIRA 2VBWA 2OA4A 3ML6A 4IJAA 4HQEA 4KIBA 2DPDA 4HW0A 4IXAA 1ABEA 4RB2C 3GV0A 3E6BA 4IGAA 3GWGA 1DUXC 3OLXA 3U2RA 2YU3A 1L5YA 1B9MA 4OOIA 1OMIA 2PJPA 1LJLA 4PEVA 1BM9A 4EGZA 4EQQA 4KNYA 5HLIA 1D5WA 4KPYA 3D02A 4U7BA 3H3UA 2GZWA 3WGGA 1GUDA 2HTSA 2HQRA 1ISSA 1F5TA 5L3DA 4MR8B 4Z4EA 2E4XA 2A6EF 5JI6A 1LBIA 2D1VA 2JPCA 1XSDA 1EH8A 5KQPA 5L3FA 3FHZA 1YFHA 2ZNZA 2RGYA 3OLWA 1FYMA 3NQOA 4W5NA 1ZLKA 1JL3A 1GCGA 4E7OA 2GXGA 1Z9CA 1LEBA 2RJOA 1J75A 5H6QA 2QQ9A 1VRVA 2LIVA 3REOA 4Z4FA 2Z33A 3LA3A 4EYQA 4ZYHA 3SXYA 3KS9A 3EJWA 3TX6A 1LEAA 4YRZA 3SZPA 5DCMB 3FZVA 4HDUA 3GA5A 1RXEA 3GWZA 4E7PA 5A2QK 3V7CA 3G1WA 4NCAA 4G6QA 4BQAA 4BH9A 1SD6A 3RDIA 4L0ZB 4IMJB 4EJWA 2HYFA 4JBAA 1CF7B 2COMA 1LJ9A 1IN7A 4ML3A 2JRTA 2FLKA 1U04A 4Q6WA 4WCGA 3L00A 3QOPA 1JBEA 1GHCA 5PNTA 2MYPA 5HQJA 2HZTA 3WE3A 2L02A 7ABPA 3N0XA 1HKQA 4OIRF 4JK1X 3I0TA 2L01A 1VLZA 1BIBA 1BAPA 3TDUC 1MB0A 3CUQA 4P9FA 1TJYA 4KK3A 4AIHA 1MIHA 3FGZA 5IC5A 4MR9B 3GVAA 3IP9A 5BRJA 1QP0A 2KIFA 2LP4Y 3IRQA 4GO1A 1ZRDA 2NT3A 1LDDA 1SFUA 1DPUA 4RY9A 4RK0A 3P9KA 3MZHA 2MH2A 3A3KA 5LHIA 2XROA 2HSGA 5JS1A 2P5LC 2QSJA 3F8CA 4LB6B 5D5WB 3WTSC 3VB2A 2XAGA 2PE5A 4U0WA 5KC8A 1CEYA 4MYRA 4RK7A 3MQ4A 4JB2A 4G7OF 2PBIA 1LVAA 4CXFA 4RAYA 1QO0A 2A9QA 1Z17A 1H9GA 3ECHA 3A0RB 1P4WA 4TLLB 1D1PA 2MLGA 4L5JA 3RKWA 1ZDMA 4MRMB 1KU2A 4KMUX 1XGOA 2K27A 3GFIA 2QQBA 4GNRA 1R22A 3LUCA 1CGPA 5D5VB 1ZRCA 2A6HF 1BDJA 1NTRA 3C3MA 1KQ8A 4WXHA 4XAQA 4YR7A 4AVPA 1FOKA 4H3KB 5DLEA 5ILSA 3BZ6A 1NXXA 1IRFA 5HS7A 4RB1A 1LBHA 3M8EA 4MAAA 4RK5A 2JK1A 2FQXA 3V4GA 4HYEA 4TLMB 3KETA 1C4WA 1JH9A 3GZ6A 3F7NA 3OO0A 4MS4A 4LLGF 4EVQA 5L3BA 4LLLA 2NZVG 1UDRA 1Z6RA 5DUIA 3RYPA 2R3SA 4NB5A 3CLOA 1YLFA 3C1DA 2P7VB 2FU4A 3KJXA 2FOKA 3ECOA 3VOEA 1ZGAA 1NXWA 2JSCA 2PUBA 2MBFA 1DRJA 5BRAA 2PKXA 3QEKA 4W5OA 5HOOA 5HKOA 1ZHFA 1YMUA 3KLNA 1X3UA 5CVVA 4RKRA 2ZFWA 1W7PB 2QXYA 1YO5C 1L5ZA 3L2CA 2CSOA 5FLXK 4RS3A 5IUNC 2EA2A 4NQRA 4P9UA 5HS8A 3WU0A 3FXQA 3F23A 1B4AA 2XKOA 4MTEA 4G0YA 3JPWA 1EH7A 6CHYA 2ZMEB 3H6GA 4CDGA 2L18A 3N75A 1DP4A 1KRXA 1NATA 4Q5SF 1YS6A 2VONA 2FN8A 2DQRA 3J80K 3HOSA 1ZHHA 2MSKA 5KQMA 3QLTA 3E97A 1OXKB 3MFKA 5IBQA 1BI2A 1UFMA 3FXRA 2ID7A 2P4WA 4L0YB 1PP7U 2X7XA 3HCWA 4U88A 2QR3A 3QEMA 2WV0A 3HRUA 1ABFA 2EFOA 1HBXG 1S7OA 4ON0A 2CHFA 1W7PD 3SFZA 4DADA 2B4AA 4DQ2A 2XASA 1ZRFA 3CNBA 2A9PA 3CKMA 3VODA 3MAJA 2A9OA 5IUKC 4YIIA 4NICA 3T95A 4PICA 4HNQA 3KG2A 1D1QA 4TV7A 5FBKA 5KWSA 2VE9A 2IPLA 1B00A 3N97A 2PUDA 4Y9TA 4W5QA 4I0BA 4LG0B 4RB3C 1K78B 2P4UA 3ULQB 2O3FA 3BBLA 3K4HA 3DEUA 3ZQ7A 3JVIA 1Z18A 3NHZA 4G7HF 4ZH4F 1FT9A 4YCSA 2PLNA 1D3YA 5F64A 2V1DA 3GF2A 4JOQA 4KN4X 4MNUA 3GUDA 2XIGA 2GXBA 3RPUA 3P7NA 1I1GA 3I45A 2I6FA 1GXPA 4EGYA 2JT1A 2J5OA 1LB2A 2G9WA 4HOBA 2ADUA 4LMYA 2FMIA 3BJAA 2ID9A 3RVNA 4I01A 1V3FA 3EYYA 4G6DA 2V1XA 2CW0F 5IX8A 2KRFA 3I09A 2QZJA 2QZ8A 3GEZA 3K1MA 2HJ9A 1T38A 2E4UA 3KP2A 4M9SA 2WB4A 2FQWA 2L3DA 1ZG5A 2GQQA 4N9IA 3FWEA 2L4MA 4G0PA 4L9VA 3TMYA 2JTVA 3TOBA 5FWXA 1WKMA 2GX6A 2VOOA 2DK5A 2CO5A 2Q2EA 3T5XA 5TJJA 5ILVA 1SXHA 5CJ9A 3JY6A 4ZJPA 3GYBA 4B09A 4ENMA 1K66A 2JPBA 4WWHA 4PCQA 4UXNA 3FM3A 5AONA 4HDVA 2FKAA 1P2FA 4XXHA 1MGTA 2DPUA 3V7SA 5DCLA 3L6UA 1JFVA 4TN5A 3F22A 1FYKA 5JNRA 1HKSA 3SHFA 4EV0A 4HV5A 4MS3B 2F5FA 3WG9A 1AWCA 2FMFA 2J5PA 1E6KA 4HF0A 3HTUA 4EJUA 2MH9A 3TQNA 3U9GA 2MYTA 2P8TA 2VC0A 2W24A 2FE3A 2XDYA 4WWCA 5H6RA 5FD6A 1JYFA 2VYCA 5TQ0B 5LGTA 5GQSA 1BC7C 3NNSA 2GAUA 2G7UA 2DLLA 4OMZA 4QLCU 1G3SA 4U0VA 2BGCA 1XN7A 4YV7A 3OMWA 1FNNA 2DQLA 4MQFA 1IN6A 4L9TA 1TVMA 1AB6A 3Q5FA 2Y0MA 1QP4A 2CG4A 2J48A 4EMSA 4OU0A 5E18F 3E5QA 5E20A 1ZG3A 4KK4A 5IULC 3GFLA 1ULYA 4L4UA 4Z9AA 4YP9A 5I4CA 5KQGA 2H09A 1FLIA 2O61A 4UV8A 5EWMB 1ZARA 1U2QA 4IHTA 2JBAA 1LNWA 2VODA 3C7JA 2PJUA 4GXOA 4QYMA 2EV5A 2ZCWA 5TPZD 4BYYA 2IPQX 3DGEC 4ESBA 3EODA 3I42A 3QLUA 5F6FA 4Z2YA 3QAHA 1CYEA 3HRMA 4EJVA 3OQMA 2L17A 5E1ZB 1TLFA 5FFXA 3BPVA 2NS0A 4GGGA 3JAMK 1R1TA 3VFZA 2FQ3A 3HO1A 2R47A 1U5TC 3BPXA 3RQIA 4KMFA 3M7GA 1FY7A 3LUFA 4QICA 1ZH2A 5JNVA 2P6TA 5TQ2B 2P5KA 3TOAA 1XHEA 2LKPA 2H3HA 1PEAA 3LAPA 2A07F 2M87A 3QRFF 3B73A 1HXDA 2LUOA 3LQQA 3T8TA 1IXSB 3LKBA 1IN4A 3JTGA 1U78A 2QWWA 3KE2A 4RGRA 3N0RA 3IDOA 2NUBA 4HF1A 3FFXA 1QGPA 2W84A 5JFRA 2WJWA 3D0SA 4RU1A 1MB3A 2E1NA 3HM9A 3IL2A 3HUGA 1XDSA 3U1DA 5JVTA 2GWRA 4U7DA 3LA7A 2FQYA 4M71A 1GLGA 2JZYA 1QZZA 3JVDA 1WQ2A 3DKWA 1YIOA 4A5NA 3EETA 8ABPA 1Y1LA 5K5RA 1QMPA 5CLSA 3QU3A 2K86A 3TB6A 4EYGA 3LA2A 5AIQA 1PNRA 1S3JA 3BRQA 4M6YA 2QBYB 2GI4A 2EFNA 3EQ2A 3K2ZA 4O3MA 5TQJA 2VBXA 5IUJC 3LUJA 1ZREA 3I5UA 3QLUC 1XSVA 2ZNYA 4FT8A 3I71A 4FX0A 4F11A 2F8TA 4YO7A 1BI3A 2EJRA 3ISPA 1K79A 4G7ZF 4K2EA 4MR7A 3N4MA 1ZAOA 1W9HA 2LBPA 1W4MA 5ABPA 4ASNA 3FDFA 3MEXA 9ABPA 1FP1D 4RDCA 3URMA 1WSUA 2QLZA 4KQCA 2A61A 1J59A 1I5ZA 3M1EA 4A12A 2GA1A 3IWZA 5HDGA 4N0QA 3ZN0A 3KYJB 4WXDA 1HW5A 4HBLA 3LOPA 3D5LA 3L09A 2MC3A 5JR3A 3MM4A 5CVIA 1R1VA 4UVAA 2H94A 3TD9A 1U3EM 1KQ9A 3WE2A 1W25A 2HQNA 1MZBA 5FWYB 3I58A 4CICA 1KU9A 1RZRA 3SG0A 1ZGGA 1O3TA 1JHZA 2XKPA 4P5OA 2FMKA 2DT5A 3A0UA 5DGCA 3Q7SA 4EUKA 3O6BB 4F7ZA 2BE5F 3HOTA 1XSXA 3RH0A 1I3CA 4RGSA 4HNRA 1BOAA 1YK0A 4L9NA 1VKRA 4OG2A 2ESNA 2QUFA 3BRSA 3KEOA 3FMSA 4AIKA 1M2EA 1UCRA 1MD0A 4ETMA 3CDHA 2D45A 1KA8A 1XB4A 1WETA 3MIZA 3H5TA 5FBHA 4S05A 2OZUA 2M8EA 2RDMA 4OLAA 1FFSA 3SY8A 4YG2F 4Y15A 3RKXA 1GVJA 3CRNA 1O7FA 3MCZA 4D0PA 4IILA 1XHFA 4WXEA 3KLOA 1KU7A 4OATA 2VBYA 4JASB 3BP8A 1QNTA 2PN6A 4KREA 1JWLA 3IPAA 4LLNA 2P7CB 2M45A 5D4RA 3DBIA 4QYWA 1U8TA 4EVIA 3HDVA 2OQRA 2O8XA 2ETHA 1E6LA 2D2WA 3BREA 5L3CA 2IRFG 4Q47A 2ACJA 2H6BA 2QYOA 3TDZC 5LEJA 2ZMEA 3DF8A 4FX4A 5ICCA 3KHTA 4P1ZA 4O1IA 1MDMB 1HSTA 3RVMA 3DLBA 2RDPA 2X0LA 5E1XA 1ZY2A 2PI0A 2IDMA 1SMTA 1USIA 5D8KB 2NYXA 3WTVC 2DK8A 4L18B 2JCGA 4Z0NA 1MJBA 4CZZA 1Z26A 1FYLA 5DCFA 3C18A 4YFKF 4LE0A 2CGPA 4WZZA 1TM2A 1YW9A 1TW3A 1C0EA 4PGHA 1SXIA 1REPC 4OIOF 4ZYGA 2G7HA 1QQAA 4ZPJA 1EH6A 1QPZA 1KGSA 4O1HA 4R1HA 4RK1A 1STZA 3HSRA 1Z1DA 5BPIA 1RZ4A 1Y0UA 4FE7A 3GFJA 3GFMA 2PL1A 4N03A 4G9YA 1MJ9A 2NRAC 2IA0A 5D5UB 4F8JA 5F1RA 5HLGA 1JLKA 1UHWA 3Q9SA 3QLVA 2IKSA 3BOQA 4RAZA 3COAC 1XMKA 3HYIA 2W42A 2F5CA 4GYIA 3I59A 3CUQC 2HYGD 4ETIA 3CG0A 4CYDA 4HAMA
chains in the Genus database with same CATH superfamily
3ZGXA 1WLYA 3LHIA 3PFCA 4HX8A 3HV0A 1EP3B 2QRJA 3HV2A 5C7IO 1HEUA 3OAAA 4X94A 1N0IA 2M6KA 1BSVA 4YRPA 3AU9A 2YWGA 3B53X 3QXSA 1SXGA 1XT6A 3TL4X 2XCUA 1E17A 3NXSA 3WOHA 4NVRA 3HGGA 3IP7A 3PITA 3HRKA 3I64A 3DF9A 1K7CA 5AW8A 3VSCA 1ULBA 4XH9B 2AKYA 4KXXA 2VUIB 2EZKA 4GH5A 2XE7A 3NC1C 4B7XA 1CQTA 5K20A 3F9RA 1YGPA 1EXWA 2YY5A 4NOJA 2J3MA 3W5SA 4D4IA 4M8SA 2FQ1A 5TPWB 1XWFA 4Z49A 4KIWA 1H85A 4HXGA 1TLHB 1AB5A 3ZQKA 3T1YB 1J9EA 3ONNA 3JD4A 3ZXYA 5B64A 1A50B 3X1WA 4NKRA 2HPZA 4MGRA 1H0KA 4PIMA 3H1AA 2YBDA 4C0SA 2JW5A 5JFGA 2HWKA 2QDXA 4RA2A 4L0MA 3G6WA 2RBKA 3BUSA 3PQFA 2M32A 1C41A 3OPMA 3K70D 2VP9A 3FCOA 2H2DA 3DA8A 3CGGA 4JLPA 4ETSA 2YN4A 3ROQA 4B9AA 3PDWA 1VLJA 3H19A 1DPRA 3KB2A 4A15A 4XJVA 1NFQA 4LGMA 5IY5H 3MTQA 4M55A 1HE8B 3WL5A 2XQGA 5EJIA 3MB5A 1Q15A 4DAEA 4MK4A 3FHCB 3SHTA 5CVRA 5FTMA 1XELA 3LNTA 3TIFA 3Q10A 3A1DA 3PM1A 3IUOA 1E5XA 4M22A 3JX9A 4MA0A 1C0KA 5BRNA 5HBRA 4HMPA 1X7WB 2Q1WA 5T3YA 2I0FA 2C1XA 1E9DA 4F04A 4W6ZA 5ALPA 4OYYA 2BKLA 1ISPA 1P5HA 5MDHA 4DQVA 2R7UA 4EMBA 5ED0A 3SDSA 4I9FA 4A8TA 2ORED 5J40A 1J0EA 4LDAA 2AMLA 2AMFA 4MIYA 4PG6A 1XF9A 4IF4A 2P2NA 2FP3A 3U9TA 1Z8HA 1YQ9A 4OJQA 2YWCA 1N0UA 3HDQA 3W5BA 1PS0A 3S3MA 1YVDA 3H05A 2HAEA 5CNMA 4R79A 4E4TA 4OYRA 3WDKA 2GB4A 2ERCA 3RR2A 1T0FC 5F27A 2RIRA 3T8YA 2ON6A 2GJ4A 3ZDDA 3QEBZ 4QXQA 4DN6A 1JILA 2JVIA 4KUMA 3HWSA 5C0OE 5CA0F 3FYUC 2Z9OA 4KGVA 1N8TA 2QD2A 3C39A 4HNSA 5J59A 1UODA 4S1PA 4HAIA 4U7FA 2Q2EB 5EJ6A 3IRUA 2WMOB 5SZKB 2V9VA 1LDBA 4JS0A 2B1JA 2GF2A 4CLRB 2FX3A 4ALKA 2ZAOA 4U7GA 2RGUA 4HN4B 5DEQA 4IZZA 3O6VA 1SXJC 3DV9A 4I4TF 5ADVA 5HK8A 2VPQA 3MD9A 1FTWA 2X4HA 3NGXA 4LF8B 1ACLA 3BROA 2Y4NA 4CG1A 2O9LA 1JFSA 5DPMA 2IU3A 2Z3ZA 3LAWA 2VEDA 4HWGA 3IILA 1K63A 1MG0A 2MTBA 4MVYA 3B38A 4CR8A 1QVTA 3IAHA 1SPXA 3WODF 1ZESA 3CVVA 4KYTA 4HDCA 3BXPA 2C5BA 1VLVA 1WSAA 3W2TA 3IR7A 4LHWA 1NONA 3A9CA 2XBLA 2O4UX 1R27A 1QO9A 3GFRA 3GTQJ 1RBYA 1G7TA 3CCYA 5KYXB 3A10A 2PSJA 3EULA 3PS9A 4D2IA 3X1YA 4YXFA 2H5EA 3IVMA 1LDEA 1SVOA 2X8LA 3BORA 2PQ2A 3EJ6A 3MT9A 5AO9A 1MX1A 4DCCA 2FEPA 4QOGA 3M9XA 2HCFA 2M6LA 4C0KA 4PZJA 2VYNA 1QKJA 1XVTA 2Q5IA 3PQ2A 4L4SA 5EIXA 3HRTA 1BU8A 3NTUA 2BMJA 2NNYA 3FN4A 1IU9A 1HV8A 1VNDA 3F72A 3HKCA 3GBGA 4KPFC 2UYOA 4NZ9A 2CUTA 2R5WA 2DFVA 1RESA 3H42B 4EDHA 4KLRA 1DT5A 4LXYA 4DFDA 2MIIA 5EPUA 2PD4A 2PPVA 3Q2KA 2FPUA 1TE2A 2BZ0A 3SHWA 5T6MA 2FWRA 2JRLA 3OIFA 4CF3A 2PWZA 4FJ0A 2MD5A 2BISA 2QRGA 2ZYDA 2E4WA 5EJAA 5FBRB 1US8A 4G36A 4L75A 2JN6A 1F6DA 4JJEA 2GOXB 4YV1A 5A4IS 4ZVKA 3C3EA 2GAIA 4P34A 1W9MA 1IEVA 1OWPA 4UBOA 4IQJA 3LL7A 3P4XA 1R0SA 5DGDA 3L0BA 3LWNA 3KQKA 3ZBTA 4ZYTA 3R6SA 2QN9A 2DA3A 5LJLA 3IAAA 2EFDB 3TIIA 1PBTA 4CTJA 4DYRA 2B78A 2LY9A 5B7GA 3CNEA 1T6ZA 4S0XA 1DFIA 4JYKA 2FFHA 2VHQA 3DL7A 4I4IA 4HXEB 1B4DA 5FBZA 4PCAA 1PP8F 3OM1A 1SBQA 4M9QA 2GCNA 3QNMA 1BW6A 2OY0A 3B78A 3OZTA 1JFTA 1PP4A 3F74A 4B75A 1G1AA 2R7DA 5BYJA 4F12A 4MQBA 2YCLA 4FGZA 4XRSG 2ROQA 5CDGA 2Q1TA 4L5CA 1CF4A 2O1WA 3VOBA 1RYBA 2A14A 3MYRA 1CG6A 3FUCA 1DP7P 1KZ1A 3ZRGA 2ZG6A 4RY8A 2BFFB 3VXKA 2G08A 3BFPA 3RU7A 3IJPA 2YFQA 2UKDA 3HC7A 5M3MJ 4ER0A 2MYUA 4M54A 5LXTF 3BWCA 5TEVA 4IIYA 2P27A 2BXZA 3S28A 3M89A 1PDNC 1D04A 3A25A 4X44A 2EV6A 4J1TC 3W79A 3ZOZA 2ZBKA 3GL9A 3VI3B 3W6UA 2PMHA 2EKDA 5JYCA 1USUA 2AN9A 4OGKA 1YJXA 4HWTA 4YS6A 2XKKA 2D8MA 3BMCA 3RRXA 5M5XJ 3QG5A 3LECA 2DBBA 2IAIA 1T5OA 4AXXA 2G5GX 3GLTA 1Q95A 3LUKA 4ZARA 3H3ZA 4OMYA 3K4MA 5FA8A 1KJWA 3WWEA 1QIKA 2IYNA 3WWCA 2O7RA 5FUQA 4RGBA 3NCHA 1W5SA 1LY1A 3KQOA 1BDIA 4BVAA 1WB4A 2VJCA 2OKGA 3KEFA 1T5LA 2HRZA 4R1SA 4UXJA 3NT5A 3KDSE 4MINA 3RIXA 1XXLA 4LY0A 1TTQB 3CCCA 5EJEA 2EILH 1CJCA 3ZNNA 1XRPA 4UQLA 3M70A 2FPWA 1WMEA 3H0CA 3WNCA 2ZYSA 1V11B 1C4KA 4ZQIA 2MSCB 4KWIA 4V0NA 2V1UA 4I3FA 2IEDA 2BR3A 4XUGB 2ZXEA 1L3BA 3IQIX 4DYHA 1QAOA 5KJCA 5DNDA 3MAAC 3EUKL 1P1FA 2BF7A 5C46F 2WWTA 1WPRA 5TLSA 2HIHA 4L6IA 3WZLA 3K6JA 3TAXA 4HR7A 3S2SA 3FF1A 2FSIA 1MMNA 4BQOA 1IUKA 1JSRA 4AO7A 2JVKA 3RBVA 3EB9A 4DIQA 2HSWA 1KY3A 4UM9D 4MTDA 3JS5A 2PGXA 4FYIA 2HK7A 3VSAA 3T7JA 5TS2A 1AGNA 1M2GA 3JQAB 4K6GA 2P9GA 2JATA 2BFEA 2QD4A 3NC0C 5C3UA 3ZWYA 3QF4A 4CF6A 3SP1A 3NYQA 4Z53A 1HDOA 2VT6A 4BX9A 2QGZA 3Q1KA 1SBTA 3NS7A 3RJZA 4KT5C 2EX0A 3W4IA 5DEOA 1ZJ4A 5EWLB 1FP4B 2WYIA 3PD1A 3HOXJ 1P2SA 4JYZA 1JSLA 4MWOA 3Q2OA 3R60A 3U4DA 5A4JA 5AVRA 4RC9A 4AP9A 2XOKA 4AYTA 1WXWA 3E9QA 3BZBA 2ZE6A 1EA7A 4X63A 3U39A 4Q9IA 3G7SA 3STYA 1KH2A 4WW0A 2W0SA 4A8HA 3B85A 4GKBA 3ESXA 3QU5A 3JASB 2KE5A 4MQEB 1P0MA 5C7OO 2RGDA 4DOZA 3CY6A 3V8PA 5E3MA 1IRXA 1EV7A 5DLYA 2NVBA 1G291 3OU6A 4AZVA 2NO5A 1RQGA 3O8LA 3I6BA 4DNFA 3ZXXA 5CJJA 4Z4QA 2HVQA 5HDKA 2JJQA 1WVMA 3RIRA 4FMBB 5CDYA 2Q6LA 4LFCB 1Q50A 2D13A 3NYRA 2H9IA 3Q3IA 1AQIA 2ZAIA 5LLSA 4C6TB 3ASZA 5A7HA 2XGOA 4LBYA 3NWJA 4EGZA 4UKDA 5G3YA 2G71A 1YA6A 1QU2A 4GSYA 1OCPA 2Y31A 3K92A 1XN1A 3ZPXA 1U5CA 4MYTA 4X65B 1VKJA 3GRZA 3OYFA 5BUZA 2CV0A 5JHFA 1JDSA 4W5NA 1CNEA 3OEWA 3H9UA 1K5GA 5A5FA 1LEBA 3MAGA 4NMXB 4NU5A 4O4IB 3A4VA 1S7CA 2BW0A 2ATXA 1OCOH 1H94A 3MS2A 1ETWA 3EVEA 3DTNA 3F8WA 1UFKA 1CY7A 4D46A 3GWZA 4G6QA 2ENWA 3FRHA 3RDIA 2Z2XA 1Z8DA 4JBAA 1WNFA 4JWTA 1LV7A 1EFPB 1G2HA 2MCFA 4JI4B 2GNOA 1GRQA 1U99A 1AM4D 4K9QA 4I1PA 4FGUA 4ZZIA 1WTCA 3R5JA 2FJ1A 3HXQA 3FISA 3H9CA 1IB0A 3WFIA 5GP9A 3HH8A 3ZWNA 4WNIA 1DJQA 4IXTA 3N2NA 3TGWA 1QC5B 3HRHA 2HMYB 1XEWX 5C35A 3P9KA 2I4NA 5EZYA 4R1OA 2OL4A 2DBYA 4YAOA 4U0WA 3TWOA 3ABZA 4GYYA 2IHVA 1YGYA 1YS2X 1GGNA 1GFWA 1H9GA 5FXMA 2LTPA 3ECHA 2SKEA 3F7OA 3VU8A 4CIWA 1IZ0A 4YO8A 1EESA 2IIBA 2MLGA 1KU2A 2IHBA 3H99A 1XTTA 1HYGA 2OORA 4GNRA 2ZBUA 5D5VB 1PV1A 5DCWA 1KQOA 4UAGA 1GPWB 1KJJA 3I5YA 2P7IA 1UBTS 4NS4A 2G25A 4A6PA 5EGNA 4X9XA 4E7HA 3BVPA 2AH5A 5HS7A 3PD7A 4HS9A 1PF7E 4CTKA 4AUNA 5BNFA 1TIKA 2VS1A 5F0FA 2GGSA 4HYEA 4RHUA 4R5MA 4FKMA 3TE6A 1RS0A 3AKDA 2VBGA 8LDHA 3FWNA 2R8PA 2JA8J 3QUTA 3GNSA 4MZXA 2AC7A 1NJ6A 1V3VA 1W7PB 2CSOA 4IFBA 4NQRA 2X9NA 2NQTA 3AXTA 3WU0A 3LC2O 3QTLA 3QVLA 3ULKA 2XKOA 4PO8A 3ILVA 2HX1A 4V0QA 1DP4A 4NFYA 4DMRA 3UB3A 1CUJA 3O47A 4MHSA 1BYUA 4C29A 1YFKA 3QP9A 2JZOA 5IBQA 3ZYZA 2I4MA 2QEQA 2P75A 3K5HA 4OAYA 3L8GA 4PPYA 4M9UA 3L46A 2HQAA 5D6OA 2YVKA 3MSCA 4HNHA 3OT1A 1KYYA 3KSUA 1WJBA 4RV9A 3DFIA 3GBSA 3X2QH 1I7PA 3ZI0A 2GZ3A 5H1YA 1PNOA 2WIKA 1WPKA 3UAXA 2PUJA 1S72I 2OV7A 4XTCS 2IELA 2F00A 1DC5A 4PLTA 2IPLA 3TVDA 1J5XA 1B00A 1V8PA 4B6OA 4W5QA 4I0BA 5ALHA 3ULQB 1DKLA 1HTWA 1RPTA 3HN6A 4KQ1A 5EJ9A 2KMLA 2W2VA 2CEAA 3DT9A 4P81A 1YOVA 2EFEB 3G2NA 1NPYA 1F2UB 2FLVA 2JJMA 4D7MA 1S01A 4GVPA 2QX6A 2GM4A 4B7AA 5FUWA 5BWMA 2G9WA 1N2CE 1HMPA 4E6EA 4OHZA 4NMHA 5FNVA 2KB0A 2PN1A 4CE6A 3FCSB 1X7DA 4O0LA 2IPOA 1L5LA 1UXJA 1H0HA 5EUMA 1BKYA 1I4TD 4KSBA 3SEZA 1WE2A 1OLXA 4H6VA 2ODNA 1A4UA 1SXHA 2VUTA 2JPBA 4KO1S 5JHGB 1KQGA 5BNTA 2DPUA 4A3BJ 3KEGA 1SB8A 3PUZA 3F22A 5LOVB 2QXTA 2JFVA 4OQFA 4YIRX 1U2EA 1ES9A 4EHAA 5LU9A 4PIVA 2J7PD 2J5PA 3ESDA 3U3MA 4Q9NA 1OB5A 1P9NA 5AK3A 5B30A 4R5HA 3ZQLA 1CJBA 4O59O 2ID8A 3L79A 3E27A 2XZTA 5REQB 1E2NA 5FD6A 1JYFA 1EKXA 3OHPA 3DOUA 1ZKMA 3PIIA 1N2CA 1U8YA 5FL3A 3H5NA 1C2YA 2QUAA 2FSVA 2GXAA 3AEXA 3GZNA 3GELA 4QODA 4MVWA 1TVMA 2CCJA 2OYRA 1IQUA 4Q34A 2JDIA 2JIQA 3MRVA 2G4LA 2F1IA 1LTHR 1CY6A 3L7KA 2JVGA 4KJZA 3NM4A 4XKBA 3I2IA 2EV5A 5JCPA 4ESBA 5CJ2A 3CURA 1SY7A 4Q66C 1MXFA 3GQBB 2J0UA 2R47A 3DTTA 5GJCA 1YR7A 3DZIA 3UEOA 1O6BA 2OCCH 3JWEA 1GOTA 4TKZA 2Q9CA 1FRNA 4MGIR 3L9WA 1LUJB 1XHEA 2OOSA 3H4TA 1YR9A 2AMJA 8GPBA 1IXSB 3QFTA 1YL5A 2CLLB 2AF4C 1UELB 3VPSA 4YONB 1WCV1 1H6BA 3NHUA 3SYTA 5ALEA 3ZE0B 2X0FA 3CVUA 4V2GA 3KJQA 4DR3B 2R0QC 1CZNA 4HDMA 4FK8A 1GSOA 4OBWA 1XSVA 4Y2RA 4CCAA 2RBEA 4IHWA 3TW7A 2DWUA 3OIYA 3SKXA 4Z3DA 4WAUA 3RC8A 4LVCA 5JXIA 2ZK7A 3N4MA 2IVFA 3WHKA 2OGSA 3T3HA 3HJAA 2WIGA 3I4CA 1CWUA 3GEEA 2E21A 4GKAA 3OT4A 2JFWA 2A61A 1QF6A 1W2HA 1KJ9A 3EXHB 3ZN0A 3R9KA 4L4YA 3OZFA 3CMEI 5JR3A 5IP9J 1Y7TA 1VM6A 5AW6A 1NM5C 3BFXA 5K3AA 3E7DA 3MWFA 3FSRA 3BR1A 4E2FA 3WGJA 4TM7A 3ECSA 1L8XA 2DT5A 3CDLA 3ABMH 3QNWA 1B3RA 4WBNA 3BRWD 5AHRA 4F9TA 4RGSA 4XICA 1JG1A 5AH0A 2R6ZA 4K26A 4OXNA 2OOKA 3GEMA 3HL2A 3ANMA 5JD4A 3MIZA 4DA7A 4X6AJ 1J2RA 3X44A 2ADMA 2EFYA 3W2HA 4MVJH 2VQHA 1H3NA 4YJGA 1TKAA 2QQ8A 3CRNA 1Z6XA 1O7FA 3CCEI 4URZR 3UAOA 4ZZ0A 1KU7A 2QE7D 4JASB 1JTFA 2ZKLA 5BWBA 2X5JO 4M1MA 1U0OC 1JAIA 1QYXA 2QX9A 3HMKA 3YASA 1SUFA 4NLLA 4YCDA 2QPTA 2GK6A 3QUBA 1THZA 1T1RA 2F67A 4F85A 1DAIA 3LBHA 3LUBA 1XJCA 3FMIA 2ZJ5A 4GMGA 3UH0A 1E2FA 4DDTA 1QTIA 3G88A 2VHVA 2KIQA 4MW7A 1USIA 2GLXA 4IIJF 3BQZA 1YHZA 2XUOA 4OKSA 5SZHB 3HADA 3R1IA 3I9OA 3GVXA 3ZQIA 1TAQA 1YW9A 3HKZA 4TX1A 1P9WA 1DJOA 5LZ9A 1OXTA 1KGSA 4I3HA 2QT1A 4RK1A 3DMRA 4IOLA 4KN8A 9LDBA 3GFJA 1RABA 2OV6A 2PNFA 3CH6A 4G9YA 2NRAC 2P77A 5EJ7A 2ZZKA 2ZWOA 2ZI7A 3M07A 3OPYB 4QTZA 3EXG2 4HP8A 5A0VA 5F9MA 3FR8A 5IT4A 3BB4A 4EPYA 1QWOA 3A1UA 1TUGA 2W42A 2F5CA 1U9JA 5D5PA 3A6EA 3L8YA 1Z7YA 3VR3D 1U7DA 3K69A 4KQEA 4YK7A 1MIOA 4Y7DA 4CHUA 3NBUA 2EFCB 4MS1B 5BW5A 1U65A 4KGXA 4IXMA 3O2PE 1KK3A 4D3FA 1U1CA 3ZP5A 3LDGA 1TZ2A 2IX9A 2NTEA 1P0CA 4GXNA 2ZI6A 2B8NA 2XAFA 3O8OA 4Y13A 5ILUA 1OPCA 4QOHA 5ALUA 2CUEA 5EE3A 3C8HA 2WJZB 3CNLA 4MO9A 2R87A 1ZM9A 1PWEA 3DS8A 3OYGA 4KO2S 2H4WA 3RRJA 2CLOB 3S3NA 2ILTA 4X1IB 3WO1A 2A0YA 1XZMA 5K3EA 4GDMA 1Z4PX 4RXMA 1LPSA 2ZVQX 1KE1A 3K8OE 4KH1A 3GC6A 3KXDA 2PFSA 2FZWA 2I1VB 3KELA 3SR3A 4K9RA 5T3UA 3W5DA 3MEQA 1KFEB 1R0RE 3BE8A 1C9NA 2Z2JA 3MLAA 4AZ3A 2YWFA 4OP1A 1KSFX 1XAGA 1T5HX 3H3XA 3VOSA 3EX7C 3P2MA 4Q7QA 1U0RA 2AKAB 5E3IA 4WLFA 2C84A 1EFAA 2I55A 2E0IA 1VL6A 1N2BA 3PKJA 2FPIA 3SF8A 1TUBA 1WU8A 4G94A 3JYHA 4BEVA 2BVMA 4COOA 3UTCA 3HEFA 1JZQA 3G0BA 3VNAA 1DAFA 5FAKA 1N32B 4NL4H 5KSYA 3INTA 3QELB 3TO6A 5EWMA 1SKYB 2GJ9A 4XLEA 4UUVA 5HFJA 4ZYUA 3Q41A 4RABA 1USGA 3P19A 4Q4HA 1I33A 1D4AA 3U26A 3WGVA 1BRMA 5CT5A 4JEHA 4XIYA 3HWRA 3VSKA 3KPJA 4MOWA 1ZCFA 1P4AA 4IOKA 1PGOA 1TYDE 4DR2B 1T5DX 4LDZA 5DYNA 5K8TA 2Q3FA 3QEAZ 4W1QA 3MWEB 4PLYA 3KCQA 4UM7A 4DWOA 4G37A 5K1YA 1TZLA 3MMXA 4TM8A 4L4RA 5KX5F 3GDWA 1AHIA 1N1EA 4PK4A 2GETA 3FDZA 3GROA 3TO9A 4Q3BA 1GPDG 5IT9A 1NC1A 4ZCMA 4UUMA 3BIWA 5IP7J 4PSDA 2PUHA 5IM4A 3JYOA 5GONA 1U8CB 1XEAA 3L06A 5FOQA 2WAYA 4BRSA 3TINA 4LQLA 3EUAA 1DTWA 2YMPA 5LP6C 2YWBA 4YUXA 4A5MA 3U4HA 1EM8B 4JI5B 1VJCA 4NI5A 4KYIB 1ONSA 4QXMA 2ISSD 2J07A 1MHPA 3G0CA 3SK0A 3ITDA 4Q4JB 5HF8A 2VKHA 4QDZA 4U2FA 2VUMJ 3BMQA 5B5EC 3VDXA 2QPLA 3RUEA 3NBMA 2ZFUA 2EATA 4XDHA 2CL0X 1Z67A 2D3TA 3QPAA 3V3TA 4JMLA 3OZCA 4AMGA 4PU0A 1V26A 1C8LA 4C4AA 4YGYA 1J07A 2X2OA 4AP5A 1CU1A 3RF7A 2I7CA 1VJDA 4RSGA 4HUTA 4ZI3A 1IYZA 4K6MA 4C4PA 5EHGA 3LNCA 3K7AJ 2OQIA 5NLLA 3N0TA 2OENG 2FN9A 1MO5A 3MF4A 2C9DA 4CKEA 2PKCA 5FGMA 3ZZ1A 3CCJI 3L1IA 5THKA 4WF2A 5FOSA 2GHQA 1ZK3A 1PR4A 4LCEA 4BU1A 1SCBA 4DQDA 2NVUA 4EGSA 4XRSA 4F21A 3KQPA 1NLYA 3RFVA 1MW9X 1OU4A 5EVJA 2F48A 3IVGA 1Q6ZA 5CVTA 2Q4EA 5IBCA 2C4WA 4KE9A 4O08A 3CV3A 1U5TB 2IS6A 2BGGA 5CVEA 9MHTA 5EJ4A 4R6WA 5FYDA 3G9UA 2XAAA 1JSZA 4UATA 1O57A 4RFSB 5IT9Z 1K75A 3ZLJA 4RKFA 1N6RA 3C7KA 4MVJD 3K4LA 2JJ2A 2BH9A 2QGFA 3VV2A 1RPJA 2G83A 1V96A 1S2MA 5DV5A 4F4HA 1QGYA 1CS0A 4ENNA 2GKGA 4DCNA 4BO7A 4FKZA 5EZSA 3NHRA 3HB4X 3R6DA 1QIGA 1T29A 1XK6A 1J0BA 4EB6A 3R8CA 2WK1A 5IF3A 1BCRA 4XGIA 5LZ4A 2XVZA 3RYIB 3AXSA 3CRMA 5IW8A 3WMXA 1TCCA 4MUBA 3N0WA 3F8BA 4R9SA 2H92A 3MJEA 1ZA2A 4MUNA 2ALJA 2Q2QA 4TVOA 2JEOA 1QH8B 1G4DA 1JHYA 2V7WA 3LQRA 2PFBA 3BGWA 3EEYA 1QANA 4KPUB 3I9JA 3RGWS 4EJSB 2NZWA 1DCFA 4C3OB 1HZZA 5JSQA 4C1NA 5BVGA 5DKFA 1G9SA 2C57A 3LAJA 5KWVA 3NNNA 4OHXA 1J2XA 2PU5A 4ZCLA 4MI9A 2DECA 4IVNA 2I4TA 2HH9A 3V6LA 1VL2A 5FBVB 5EMNA 3I4NJ 2PYIA 3BE6A 4D99A 4CT4B 2AFHB 3BD9A 2BOVA 3B8EA 2Q45A 1HURA 2X6OA 2H48A 3AR8A 3TB4A 5J8CA 3IDAA 2EBIA 4URFA 2FPGB 2RHBA 5K4HA 1E7RA 4MO7A 2R5YB 4ZYAA 2LLKA 2PRSA 2X1DA 2LDBA 4HFJA 4M8IA 2ZKZA 4ZK6A 2ANCA 2WHQA 2NZ2A 3WK9A 3NHLA 3ND6A 1BJTA 2AOXA 4EBFA 4F93B 3TM5A 1SZCA 1YTUA 1L2TA 5L53A 3H2BA 1YBAA 3CWZA 1P8AA 4CMEC 4B40A 5M34A 4CDNA 4E51A 4FGJA 5FI1B 2OD5A 3SQNA 4LMPA 3GAAA 3PPVA 4RVHA 1DCTA 4ZVMA 4TV8A 2I7XA 2KW5A 4A2WA 3VRHA 4IHJF 2KKOA 3OYMA 1C81A 3DKIA 2ONYA 3GO4A 3NARA 1JJBA 2JKYA 2G77B 3BH0A 1ZH6A 1P9QC 1WBBA 3QUAA 5EFOA 1EUQA 1P81A 1N75A 3ZN1A 2CXHA 5KTKA 3HSYA 3C45A 2JJ1D 4RPJA 2VE8A 2QM3A 4WN3A 5KNBH 1F8GA 1YZFA 3BD6A 1O6CA 4O4HF 4M7OA 3RJPA 2YOFA 2FG6C 2JI8A 5D85A 3C3DA 4G2NA 1F3OA 1R36A 1Z6QA 1MT0A 3RS2A 3QVVA 2VC1A 3OF3A 3RVSA 1ENYA 2QN7A 4KIJA 2BDEA 3ACBA 4KDCA 2QXUA 4QEZA 1I2CA 4JVLA 2VKVA 3A9SA 1X1BA 4OHUA 2RQPA 1TW2A 1C9KA 3OFKA 2ZXUA 1V3UA 1X8KA 1YDFA 1NXPA 3LT2A 4MEAA 1RC0A 4JLVA 3FLBA 4TKUA 1LBSA 2EIKH 2FLWA 5CLJA 1C0PA 3IT2A 3G1UA 1WI9A 4OQEA 3QVMA 4V0MA 2P9TA 5AFSA 1R4ZA 4V1CA 1J56A 2OV8A 3QXGA 1NVVQ 1VCOA 1O03A 2RHDA 1QU3A 4LYHA 5GOZA 3D8UA 1JNYA 3WHCA 3GGCA 3EEQA 2QTRA 2RNJA 3H5WA 1C0WA 2WZDA 4XFKA 3JD1A 2PG3A 3EDMA 5IZ4A 3IHLA 4LRTB 3T6KA 2L54A 3QEOA 3T3MB 1VQ7I 1ETVA 1K86A 5EEHA 1F1ZA 4X97A 4W8OA 1GRNA 1QH1A 2C9BA 2EQRA 4D02A 4BLRA 4OB8A 3EVZA 2JHGA 2C4NA 3ZCVA 3L84A 2HJWA 2WC2A 3SYNA 4OJYA 4Y2VA 4WXPA 1SULA 1CYDA 2VT2A 2YR0A 3LUDA 4KX3A 3MINA 3LLUA 4PCLA 5EA2A 4A0HA 1CY1A 1PYGA 1WCIA 3MTDA 1M0EA 3S55A 4B17A 4LIUA 1X1TA 4HL6A 3T9FA 4QJ5A 3MWMA 3RC3A 1NQWA 4JCCA 1RWWA 4ZEWA 2OT3B 3SQMA 6REQB 2DMQA 3GHYA 5F1YA 2CXXA 3RVKA 1LFDB 3TI9A 4LXQA 1WDKA 4MV0A 4DMGA 2KLHA 2R8YA 1Z77A 4DQKA 1IN8A 1RHQA 2G1PA 1SBIA 2HOTA 3OSZA 4JB3A 1W0KD 3PDCA 4S04A 3CKYA 1K5DA 4D26A 4AO6A 2ZIXB 2QLJA 1XLTC 4GXTA 4UU1A 4G6TB 2IZ6A 4YECA 2J5XA 5K6TA 1J6UA 4YMTA 1PTKA 3CLKA 4G26A 4A6EA 2UUBB 1UBOS 1I9CA 3I72A 5EQJB 5KVAA 2X9QA 1UQUA 2NUTB 4GRDA 4E4RA 3B2QA 1DWQA 2NGRA 1YF3A 3O83A 4E2XA 3L43A 3IAS1 5E6UB 1CUWA 2DO7A 2OD9A 2LY2A 1HA8A 4Y98A 3EXFA 1DX9A 1OAOA 4TWIA 2W8BB 1PR5A 2EBHX 3THSA 4QTTB 1PSZA 3JQQA 4OXYA 4KN6A 1JDVA 3DFGA 1W96A 3MT7A 4DM4A 3CBGA 4FTHA 3KYCB 2FX0A 3L49A 3TOCA 5JSYA 3N76A 5F3WB 1Q1HA 3IQEA 5F7ZA 1RE1A 2R4GA 4DLBA 4BJ5C 4HMOA 3IMKA 3HKZN 3NXKA 4Y6GB 1M10A 2DPDA 4HW0A 1KSHA 5E9WA 2R92J 2H00A 2QYSA 1QLWA 4WCFC 4LQCA 4HXYA 4MUEA 2P69A 1WVIA 3H3UA 4IP0A 2HQRA 3B6ZA 2NXCA 2ODBA 4AG5A 3L07A 4CQJA 2JPCA 4C4RA 2DFTA 1W52X 3MG9A 1OLUA 4G0VA 5LP6F 1Z9CA 1Y7PA 1GZ3A 4B48A 1T8IA 1UDWA 2W90A 4IVPA 5A02A 1HFEL 3REOA 1NRIA 4MIKA 3FHTA 4ZYHA 3RIEA 1MMDA 4AS2A 1ATIA 4OXKA 1EVLA 2Q3LA 4ETWA 4QO7A 1RI4A 1P9RA 4B6GA 3GD7A 3O8QB 2Q1SA 3JREA 1ZCJA 2WG2A 2NYAA 4M1KA 4L0ZB 2BEWA 4EJWA 5F2EA 1VJGA 4EK9A 1C3XA 2ZPTX 3VTAA 2PRIA 1GHCA 4HHEA 4WKGA 2AC2A 3E9EA 4JLNA 4UFPA 4JC8A 1QPIA 3CMYA 3B7WA 4BYMA 1T4CB 2HOQA 4IMPA 4Y2QA 3OTHA 3FKQA 4MR9B 1Z07A 1H8AC 2KIFA 1LWOA 2CYCA 2FG7C 3OF2A 5EIBD 3CCVI 4KLCA 2QSJA 2R1VA 2FW1A 3DD5A 1M1YA 2PNJA 2PBIA 5IC6A 4OQPA 1LVAA 4AUEA 5ALYA 1DU0A 1ODIA 5L7TA 2ZSDA 3PKIA 4R8RA 2HBRA 4N12A 3ORSA 1L3IA 5JS7A 3W7AA 2WSSA 3OE4A 3NM5A 4JEUA 3E15A 3WDSA 4F5WA 2P90A 2GSWA 5KJEA 2B92A 4GOND 2GBCA 1TO2E 1SKQA 3G9ZA 1Y39A 2XD4A 3MMSA 5KNBD 4L16A 1SKMA 1W49A 3O4GA 4JBIA 2E87A 3PSFA 2W4SA 1E8MA 2I3BA 3PR2B 2CXRA 3IURA 4V24A 4MWDA 1A8IA 2GEUA 1I0IA 1EGHA 2PKWA 3OCYA 4RPIA 5BNZA 4I4CA 1ZOIA 5GIOE 4II3A 2XAUA 3UMFA 2ZRAA 1M67A 1ZNWA 4F5EA 3GHHA 1KNQA 2OXIA 5HOOA 1ZHFA 5GIPE 2ZB4A 3D4OA 2WD8A 1FVOA 2QXYA 5JEEA 4UQPA 4M37A 4O33A 3PTLA 3PTZA 3H6GA 3DHNA 2EOAA 3GVIA 3PLAE 3ZHCA 1RRGA 1GGEA 2FN8A 1JDUA 3ZY2A 2A7XA 3HPRA 3E97A 3LSPA 3L3BA 2C4MA 2A1TR 2VZEA 5LMNB 3UWOA 2R7WA 2AEEA 4M4SA 4RVFA 1HGXA 2EKPA 4L9WA 4MWZA 3ZJVA 4B3JA 2GVNA 4RTSA 3IUMA 1S7OA 4MFDA 5AIAA 5KIAA 2HBZA 2IIPA 2Q3DA 4KR2A 1TL7C 2QTFA 4JKYA 5DSZA 5EI5A 1T8RA 5ALWA 1OV4A 1R4MB 3D6HA 4OQLA 1W44A 2D0IA 3DDNA 4NONA 4OU4A 3I32A 2XCQA 2RGBA 1I2AA 5KU7A 3AHIA 5BW6B 1AS2A 3VPXA 1S0UA 3HOZJ 3NHZA 1M2VB 4OP2A 4ZRNA 1G8KA 5BO5A 2VJ5A 3TQCA 3UMSA 3A6GA 1PJTA 3SM3A 3I45A 1GXPA 5BNWA 2UUAB 3GXBA 3RCOA 3MFQA 4EH1A 3EZXA 3EGIA 4ZYZA 2ZRBA 1WGXA 4XR4A 3OIWA 2X8BA 4OLJA 4XM1A 1MGPA 1DXYA 2WB4A 3K6SA 3AF1A 1FOWA 1KSJA 4GKKB 2JTVA 2DK5A 2Q2EA 5TJJA 5ILVA 1V8BA 5CJ9A 3ZY5A 3MRXA 4PCQA 4WDRA 3FM3A 1GTZA 3A4IA 4CLRA 1MGTA 1V48A 2RGRA 3FK6A 1YL6A 3LBNA 5KAIC 4X92A 5FPPA 2DVMA 1AWCA 2HGZA 2Z6AA 1E6KA 3HY3A 4RYDA 1J8QA 1E9EA 3QUSA 2C94A 5DTRA 4CR7A 4MMYB 2QRHA 2DYRH 4TOIA 2DJNA 1H66A 2OGUA 2H63A 5JXJA 2VC0A 2R8RA 4HWOA 4WWCA 3QOWA 1LU9A 2F7SA 3FVRA 3ZCXA 1NUQA 3DPUA 1EDZA 2B9SA 3E5NA 2AIRA 1G3SA 3TNYA 2BGCA 2J4FA 4GGOA 3E8MA 1OT5A 1AB6A 1OI4A 3Q5FA 3FXOA 2Y0MA 2FU5C 2OK8A 3T15A 2RAPA 2RGEA 4HV4A 1VQMI 3C3AA 1ZARA 2YQZA 2J3DA 4BKUA 1Z35A 1LVHA 3KUUA 5KYXA 1EJ6A 3ZQ6A 2FW7A 4OMFG 5IAJA 4BYYA 3DFKA 1A9OA 4NDAA 3CQ9A 3HSKA 4TTTS 1XSEA 1FJ2A 3HRMA 4EJVA 3LWBA 2NS0A 1XDBA 1L4MA 4B3FX 5EYPB 2GRAA 3TR5A 1IY2A 5IK2A 2H7CA 2ENUA 3EAQA 1NUTA 4PGFA 2P91A 1N4DA 4HZUA 4QC2A 4AN4A 4KQ2A 3ONDA 1LVUA 4C2UA 3EIXA 3N2YA 4BO9A 3LM8A 5BT8A 3U61B 2CNOA 5IDYA 2C2GA 3AL0C 4RU1A 3H18A 1T1EA 4PSUA 2GAFA 3V7WA 4Y0NA 1YIOA 3EETA 5JCZA 1L8LA 2QKMB 3IALA 5CLSA 4XOTA 1AK2A 4EYGA 3QM1A 2HDHA 4DNQA 3FFAA 5IC4A 3UANA 1A4RA 3L2QA 4LNAA 2IDKA 3BGDA 2BGNA 5JDIA 3AL3A 3DDSA 5EKUA 2QX7A 4YWJA 4X1EA 4A93J 2J33A 2V0GA 3E8SA 3CR3C 4RA6B 1KFKB 1UKEA 2CXSA 2GA1A 4BQIA 5JT1A 4N0QA 4BJ3A 1DXOA 5KYVA 3GTPJ 3NR2A 2Z5GA 4WFKA 1B14A 2B8EA 3ZHZA 3MM4A 2HUNA 5EKSA 2G8LA 2V6FA 2JLWA 1HKHA 1VZ0A 2YIMA 5AESA 1C1XB 1MZVA 4AF8A 4OOEA 4CVNA 4P5OA 3BGSA 4CIAA 4BKRA 3FNFA 3JRXA 1VKRA 3GPLA 2GWHA 1U0GA 2PQMA 5EZQA 2QYTA 3T4EA 1Y89A 1Y56A 3EGXB 3CN9A 1GGJA 3ZV7A 3CE6A 1AT1A 3H7AA 4D0PA 4EYEA 1FQOA 2FSFA 4JP5A 4V19K 3IR5A 2PN6A 3G59A 4UU0A 5TJ9A 1MOSA 2IW1A 3ENQA 3M1CA 3WG7H 4PW0A 1VPEA 4GMDA 3WWOA 2O7QA 2WYHA 5G0UA 1S8AA 1V9CA 3WKAA 4R8LA 5DM60 2BFFA 3O93A 521PA 3LC1O 3TOSA 3SBXA 1S2DA 2F59A 3MOSA 5K09A 1UH5A 1SIBE 3OFNA 1RCUA 1M74A 1JEQB 3K05A 2VAMA 3CF6R 3PHBE 1EH6A 4PQEA 1T0IA 4YP0A 1RZ4A 1KZHA 2FJUA 3V2HA 3LHFA 3JQ9C 3WV4A 2IHYA 3UWKA 1GD1O 1Z2OX 1RZUA 3QF7A 2O19A 3JWIA 1I6MA 3LP5A 4Z3KA 2D06A 1CQIA 4RM2A 3KE8A 4GYIA 2QTBA 3O8NA 2EBFX 3EVTA 3L9FA 1U6KA 3IHUA 3DLIA 2DMNA 5TMEA 4GP9A 4K9DA 4DRXA 3GT7A 3LUGA 1TWGJ 2JCBA 4PANA 4MDHA 2RONA 4G0UA 2BUAA 3UICA 2WV9A 4H1WA 3FVTA 3LBAA 3OOUA 1O5OA 1DMRA 1SBHA 4KZKA 1G5RA 2NO6A 3ZHSA 1WF6A 2YMLA 5FO5A 3OMXA 3L7WA 4YDQA 4N0EA 2XDQA 3QLVC 3GCGA 3F6SA 3O1LA 3JZAA 2B34A 3PSIA 1ZRNA 4ZD6A 4KNWA 4Y0VA 4Z9BA 2K40A 1V11A 5DXAA 5F5LA 1ZJZA 4IDNA 3NOVA 3VSDA 4L8YA 2VB6A 1AKRA 2OPBA 4CA0A 1EGAA 1V2GA 1SRQA 3EIQA 1E2PA 1Z7WA 3FA2A 1EDDA 2V4MA 4JLOA 1ZEJA 5IT0A 5HX7A 1UDXA 5BV8A 1ADYA 2EWNA 1C9JA 2WA2A 4RF4A 3F6OA 1CVRA 2M34A 4UTRA 3NHJA 1PG2A 4B4WA 2B3TA 3JQAA 1G3YA 2OFOA 2PX6A 2I76A 1TQDA 4EJOA 2L2QA 2J7KA 4DMUB 3W6ZA 1Y6FA 4YUYA 5DYMA 5H16A 2LCFA 4LXUA 3ZJ5A 1VBMA 4DJ5X 2E1OA 3F71A 4DR7B 1YC2A 2V1NA 5EWLA 3L0CA 1SVUA 2Y9PB 4IRHA 4LDPA 1KMHB 1JIJA 1DQNA 1TQIA 1XVLA 4WKPA 4O2AF 4P36A 4C07A 1EWTA 1W85B 1XJ5A 5F77A 3WZMA 5ED4A 4RD1A 1AV7A 1NVKA 2SNIE 1JFRA 4O5VA 3JASA 4MQEA 2OXFA 2J9RA 1M6EX 2HDOA 4AWXB 5JSHA 1L7VC 1RLJA 5IYCJ 3F6PA 5AW7A 1S4QA 2UZ1A 3GZ4A 3UW1A 3H92A 3C3BA 3TXXA 1LQ1A 3R0AA 3KYLA 1D03A 3V8KA 1VE7A 1J2YA 1R0LA 3GBPA 1FNCA 1S2OA 1SKBA 1VGRA 4BNIA 5KNCA 4YRJA 1PQPA 2Z5VA 2X4LA 1HYBA 3VKHA 3KHKA 4M0UA 4D9EA 5A9TA 2CFXA 4RJ2A 3VM6A 2GIVA 4OB7A 1HL3A 2ZE8A 5BR7A 3ONEA 4MA4A 4O4IA 1WL8A 3H65A 5AKKA 1U0BB 3ECCA 1R0BA 3ZK9A 5BR1A 4JI6B 1KVRA 3R61A 4FMPA 1Z8NA 4X6UA 4A2UA 1GCIA 2QJOA 4NFSA 2P6MA 1V35A 1R10A 4LGWA 2FN4A 2YPRA 3R4CA 2UYCA 1XN4A 1EFPA 1H3FA 4BNCA 1OT3A 3LTEA 3RSOA 3T5TA 1LDJA 4I8IA 3FUUA 4XB6B 1C7JA 1XKLA 1O94D 2CQNA 3A2LA 4Y2JA 4CNBA 3GCDA 3LY9A 1EJ2A 5JVDB 4CM6A 1QC5A 2QMYA 2OGZA 3FTPA 3DB1A 1F9NA 2BHLA 3L7MA 1YX5A 3GFGA 5IMSA 5C5DA 1UBLS 3M8FA 2BHNA 4EENA 1N2JA 3JW4A 3S32A 3Q5DA 3NASA 1Q1GA 4B33A 1JI8A 3V7RA 5KVSA 3A1NA 3BIXA 1SWWA 4OQ4A 3F98A 2ZT7A 3CRQA 3R3HA 3QLJA 4ARIA 3OUTA 2I29A 2IXBA 3K94A 2ZDGA 1WMFA 1S9DA 1L4YA 5DNAA 2EFWA 1YC5A 4Q39A 3EVDA 4XR9A 5B3KA 2D5IA 5HM6A 4PR3A 2Q7XA 2I62A 1PNTA 4DSTA 5ITWA 3GLIB 1MNQA 5CDHA 4DARA 1DFGA 2BJWA 4WUTA 1CF9A 1ECFA 2WJ6A 3RIGA 1EUZA 2FA5A 3H5LA 3UAVA 1KZ9A 1QZUA 5AR1A 4QUGA 4JZYA 3U44B 3B1XA 4LF9B 1W7PA 2PG4A 1BOBA 2IA2A 2HVRA 4PYRA 2IHUA 1BD3A 1O58A 621PA 3ESRA 1DU4A 2PRZA 3NBXX 2A78A 2PUEA 5E8GA 2O20A 4WV3A 1B59A 3HCAA 3BH7A 4XCQA 3P2EA 2VP5A 3O3CA 1DKOA 2DFIA 1MVOA 4HQKA 1A8SA 3A27A 1CHDA 1VXOA 3A2NA 2JS7A 1UPAA 3E3VA 3R5HA 2Q99A 1ORVA 2M1ZA 3C98A 1EBUA 1DIGA 5KTRA 1XXHB 3PFWO 4FLFA 1IN5A 1L0BA 1XE3A 2L19A 3SN6A 2C4TA 1UB9A 2KWIA 2KBFA 3N5CA 2C8KA 5G41A 3IBCA 1D0XA 3T0IA 4UCFA 2EEZA 4J6FA 1A9XB 3O84A 4K6HA 1F2UA 5EMHA 2FGKA 1K7AA 4HNVA 1A0OA 4NPCA 5EEGA 3AHCA 5IWAB 2CB0A 1YR1A 1ZUNB 5B3JA 1CY0A 1OX6A 2Y1EA 5AICA 3BE4A 4R7TA 4QUJA 4E5UA 4FOTA 4GBJA 1X9GA 2Y0SN 3KALA 1GNSA 4MI3A 3RD5A 4J75A 2IEAA 3H9BA 4L74A 1G21B 5A6SB 3HZZA 1K8XB 3UPUA 2R97A 4NY1A 3GVHA 3H1PA 3QX9A 5LOVA 3E9MA 5CFPA 1HSOA 1GAJA 5EEAA 4GQAA 2EZ8A 1YJBA 4YLGA 1CDEA 2FBHA 2CLDX 4GI2A 2J09A 2KBEA 4LB5A 1I0LA 5BQ5A 4RK6A 1O87A 1T9GS 2VOEA 3TTXA 2IEYA 2RK3A 5REQA 5CFOA 5E17F 3HHEA 2PKEA 1LI7A 5C1DA 5KC9A 3WP0A 4QEKA 1QZTA 5INTA 4Y33A 1DWUA 3J7AO 1ZH5A 3DP7A 4A0ZA 4L28A 4YMVA 3FOWA 1VSBA 3H6KA 2NNLD 2ZRQA 2XMPA 4LTDA 1L7OA 5LQSA 4RV4A 4V02A 3KYBA 4CWAA 4P4LA 1R2QA 2X22A 3FHLA 3ZMUA 1QFZA 4H0NA 3UO8B 3A6DA 3V4RA 4R1TA 2OGTA 1VMDA 1X58A 2QSFX 3JRGA 3E18A 1MMSA 1YULA 3GQBA 4B71A 2V98A 2Z3YA 4C4ZA 2GXQA 3C1UA 1A35A 2O5EA 3LY8A 1JV2B 3W1WA 4UPDA 1AVTA 1R58A 5L45A 4F60A 4HDKB 5D6FA 2UXNA 3UKGA 5IDVA 4AN1A 5KHDA 3CPEA 3JWPA 3ZVKA 1U0HC 2NNNA 3OOWA 3G1MA 3J81K 2G04A 3SEQA 1MVNA 4D9KA 3OE1A 1XTVA 4MUGA 1I6HJ 1KYWA 1L5FA 4LOCA 3CUTA 4EO9A 3M9AA 4BZXA 4IMIB 2VJKA 5E4JA 1K4TA 1U8FO 2R44A 4RS8A 3EASA 2YZMA 5C44J 2GM5A 2LDUA 2WUDA 4MYUA 1HTBA 2JBWA 3ILSA 1PEKE 2BHTA 3KSZO 2ZJ2A 3CG4A 5B58C 1RRFA 3HYRA 3WYCA 3DVQX 3TAUA 2XSDC 4HWRA 3EXHA 2E5NA 4NOLA 2WFMA 4N3CA 5IFLA 5HM8A 2WZBA 4G23A 3BQYA 4A26A 4DV0B 3M33A 5D2CA 1M1NB 2CDCA 1T3HA 3C15C 1R0WA 2ZTLA 1N2ZA 3HHHA 4PR0A 1JF8A 1A36A 1Y4ZA 4W1SA 4GNKA 4YRSA 5K8VA 3R7DA 4H15A 2VJBA 3KZIC 2JCSA 3L4JA 1Y3AA 3DZ8A 1GPUA 4Q9HA 4PZ0A 6ABPA 4BBSJ 5CP8A 1FFBA 1NP7A 4PHHA 1ZJ6A 3DFFA 3LFUA 3ERMA 3RTEA 2AI2A 2IL1A 3R3YA 1ENHA 1U8BA 5LLQA 3TJZA 5FOUA 5HR5A 5I3ZA 3L93A 5DJ5A 2Y0DA 3WGMA 3AAFA 1BXRA 1TD1A 2P9HA 4HS4A 3K35A 1P62B 1XBTA 5LKRA 4XI9A 2VDKB 2Q2VA 3O8DA 5IDQA 1Z21A 2QD1A 5AI8A 4BTEA 2CDNA 4GFDA 2HKXA 2FRVA 1U5AA 1W76A 2Z5FA 1WPQA 4KIBA 4P38A 1GAXA 1K5PA 2OPHA 1UJ6A 4IGKA 1MO6A 1DAOA 5LCXA 2YU3A 3HCRA 3OX1A 5FUVA 2CYAA 4DQ0A 3ZHBA 2X7JA 3VTZA 4Y7NJ 2OBLA 4PQFA 1JE0A 4HGZA 1V1MB 3OPYA 1VQ1A 5F7XA 2WFAA 3S68A 4C3UA 5DGHA 1GCGA 4E7OA 3D9QX 1RFGE 4MP3A 3TIXB 3WMGA 3RC7A 3PE4A 2PZLA 4Y0AA 2QU8A 3SXYA 3L1VA 3TX6A 3WNDA 1CKEA 1HNZB 3A6KA 2HL6A 1H0SA 1FU8A 4RIGA 3HA7A 1HDEA 4ON9A 1PFWA 3X2FA 2XF7A 3DAPA 2P5TB 2WW8A 4Q6WA 4O3FA 3QOPA 1FZQA 3IFSA 4NFHA 1V8OA 2W1OA 5G1PA 1KOGA 4BQFA 4QTRA 2ZRCA 3WFJA 1SKYE 1FX0B 2D2XA 1H2HA 3T3IA 4QELA 4XRMA 5FTWA 3TDUC 1TJYA 3GMSA 4ZWNA 4KK3A 4CKXA 4X1IA 1F06A 4AJ2A 3WGKA 3GFOA 5TVKA 3HB1A 1RBMA 2GSDA 3U0BA 1AGRA 1EJ9A 4LB6B 1R37A 1GNLA 2ZIAA 4L02A 5KC8A 4GAEA 3TLBA 4ZFNA 2XDWA 5HKKA 4K6OA 1AGYA 1WO8A 2BR4A 2COKA 4R3NA 2FVXA 1XS9A 1CVIA 4CHTA 4IGFA 3OICA 1NHGA 1ZVKA 4FX2A 2EJTA 3WYAA 3RG2A 2XUQA 1HOTA 3AI1A 3T3DA 3BR0A 3BGVA 3WKEA 2EZ4A 3GRFA 2NADA 2OPTA 4DWVA 1O0BA 2K9LA 4MGHA 1RWPA 3VYWA 4G41A 4CRWB 3ZHRA 2O5VA 1U7OA 2QM0A 2Y0CA 3PUBA 1LFAA 3EQ8A 2WKSA 4MAAA 2CFIA 4RK5A 3QWFA 3BPSA 1AKQA 3I0ZA 3IEMA 4FFVA 121PA 1U98A 5BOSB 5FLEX 1YIAA 3ZGOA 1ZKGA 3KJIA 2X51A 2WSMA 2XKJE 2PX8A 3ER6A 3BL6A 3EIOA 2KJQA 3QYFA 4MVJP 5IOYA 2TRSB 3ECOA 2ZATA 2O8EB 1BE8A 4H1TA 1FY2A 3O91A 4QDKA 5HKOA 5JPIA 3PZBA 1KKLA 4GKVA 4RKRA 1KU0A 3NU1A 3MWEA 4LGCA 2VDLB 1DKPA 3AVVA 1CUCA 3IULA 4E12A 3D3QA 2DBZA 3ZH2A 4AJOA 1Q7TA 4B43A 4P4UA 5F73A 3RUHA 2Y0PA 4CMBA 3LWZA 3THOA 3KQSA 3K20A 1AZWA 1JQJC 1UFMA 2HIGA 2OTJI 2VPLA 5IBRA 3MGGA 2QR3A 2XTMA 2WICA 1RWXA 4GI7A 5JRDS 1W0CA 4J0JA 3SFZA 4TV9F 3TQRA 4UOEA 4BEBA 1W47A 4FFPA 2XASA 2WQZA 1V7ZA 1UUFA 3C16C 1G17A 3OBIA 4L72A 1LCIA 4YIIA 1Q1AA 1D1QA 4TV7A 2IBDA 3FZEA 2HLDA 3KZNA 4L8LA 4EJ6A 3N97A 3RBAA 1EM8A 4GE0A 1JU4A 2G7MC 1G7SA 1K78B 1VE6A 4DW6A 1I4EB 1U9OA 4Q4JA 1F8YA 5CBPB 4QRIA 2H1HA 4BFXA 4QYSA 2XIGA 3RPUA 3G2LA 4EGYA 5FNZA 2ADUA 1HSZA 3UUFA 1GWNA 4GOMD 5J2TA 1TZCA 4L5YA 1N5RA 1NVEA 1NBIA 2G5PA 2PSDA 3AO0B 3F5QA 3L7NA 1KFJB 2AFRA 1HY3A 5C37A 2CEKA 2MSYA 4EW1A 4HVCA 2WU0A 4PSAA 2BF4A 4PC6A 3W5AA 3OFJA 2P5UA 4GL4A 5KTTA 4MP8A 1WZIA 4W9RA 2HXYA 3WY9A 3RTDA 3V46A 1I10A 4UAVA 3TKLA 1LPAB 2OHFA 3ONWA 3M6FA 4QGHA 1JXQA 3ETJA 2W70A 3UJAA 5B1EA 2D7DA 3ZDQA 3IQZA 4TS4A 1EUCB 3NFYA 2FGJA 2R60A 4GF5A 2DQYA 1JEDA 1T9AA 4BBRJ 3ZKAA 4P7BA 4GZ5A 3UK2A 4IL6C 2FE4A 1LNZA 2VYCA 1XX5A 5LGTA 1H69A 4RFSA 3KZOA 3DNFA 2VG8A 5JAZA 2G7UA 1P39A 1PTJC 1TPYA 3WLPA 3I6IA 2AFHE 3UW3A 4EMSA 2HA6A 4YDSA 4L57A 4B7ZA 5BOVA 4QDJA 1ZNQO 3I6MA 3C7JA 1MO4A 5A7FA 2NU7B 3WLNA 1H93A 3RYIA 3VR2D 1YR3A 4MARA 2GBGA 2C99A 4J0FA 3QAHA 2HXSA 3ZR4B 2PY6A 4DLRA 1M76A 1O95A 2W71A 2WR8A 3TR0A 5EL0A 5JI2E 1R1TA 5IBPA 2E5WA 4KPUA 1OKKA 5B2ZA 2A07F 4EJSA 3TEMA 3TECE 4LC1A 5AM5A 5BXQC 3ABLH 2VJYA 7ADHA 4J19A 2HB6A 2QWWA 4AM8A 3UMBA 4GI1A 2PXXA 2QLLA 3U1DA 4B5KA 4M71A 3DKWA 3U3OA 1B3BA 2WWWA 2AFHA 1AY0A 3PI7A 1PNRA 2C04A 2XX3A 3SVZA 2DE0X 4UREA 1JZTA 3AERA 4E5MA 2NV6A 2FPGA 1PJ4A 1D6NA 1Y48E 3PUVA 1D09A 5CA1B 2R5YA 1QO7A 2QG4A 1S1CA 4EPTA 1FP1D 4JL5A 4YJFB 2MMGA 4ONEA 2FUCA 1Y4UA 3L1JA 5THQA 5HDGA 1NP6A 2WVJA 1B0ZA 3LOPA 1HT3A 5JZBA 5B58T 1RYZA 4RBOA 3BXFA 4ILEA 4CR6A 1R1VA 3KP1A 5BSFA 3IPXA 2PGIA 3EPKA 1LX6A 3M5PA 1YQDA 2VAXA 4BTLA 2DB3A 1VQPI 1WOMA 4FE3A 1K6MA 2KP6A 3R74A 4IUCS 4PYJA 4LF6B 1UC5B 2ESNA 3BRSA 2QTLA 3HDDA 3A9UA 3W3AA 1M2EA 1NAHA 1F8FA 1XK7A