1SD5A

Crystal structure of rv1626
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
b'PRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative antiterminator
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd5A01
2PUBA 3Q9VA 2PUDA 3RPQA 2ZAYA 3RVSA 3N0RA 2L01A 2L02A 2ZO4A 4PZ0A 2IVMA 2WY2D 3KLOA 4MS1B 5LGUA 1JHFA 2ZWMA 3F6PA 1S8NA 2EFOA 2HEOA 5ILUA 2EV5A 3DGEC 4P55A 2ETHA 3QEKA 3CUOA 2WRZA 1MB0A 3JS5A 1R1TA 2JZYA 4TN5A 3C18A 9ABPA 1G3SA 4YRZA 1GCGA 5LEKA 1K6OA 1LEAA 1USTA 1LB2A 4OG2A 2XROA 2RGYA 4RK1A 1TNTA 1FP2A 4A2UA 4BHPA 2EV6A 2Z5UA 1HXDA 5FD6A 3OLZA 4HNSA 2GBPA 2J5PA 3HYIA 5ED4A 1IW7F 4KUMA 4Q7EA 3E5QA 2E4UA 5JHUA 3IWZA 2PEXA 1ZVVA 2EV0A 2FRHA 2ADUA 1CF7A 1DUXC 1MJBA 4NCBA 4KMRA 1FBSA 2P6TA 3HSFA 3J81Z 4G0OA 2IPLA 3PQKA 3IP9A 4EVQA 2FMYA 3JAMK 4G94A 1RZRD 3VB2A 3COAC 4UVBA 4PGGA 3I4PA 4BHBA 4BHCA 5E1ZB 1LJ9A 4G8XA 3HHGA 4AIHA 2J5OA 4TMYA 3O75A 5ILVA 4U0WA 2OZUA 4I01A 5CHYA 1G3WA 3C3KA 2DQLA 2O03A 3GUDA 4RK5A 1SXHA 2Z3YA 4NQRA 4U0VA 3QLUC 1TBXA 3DXJF 4JQFA 4LB6B 3FF5A 4B09A 1KQ8A 4KQ9A 3KTOA 2UXXA 3H3UA 1ZAOA 3H5LA 1K78B 3K0LA 2KIFA 1DCFA 3NNDA 4LLLA 5BRJA 3KP3A 2CWEA 1HW5A 5EWJA 3JVIA 1QKKA 1FP1D 1YW8A 2XIGA 1Q1HA 2K27A 4CBVA 4ZYEA 1D5VA 2FXIA 3IDOA 2NRAC 1ONVA 2E4VA 1JLKA 1DRKA 4TV7A 1PEYA 8ABPA 1RUNA 1XHEA 2HTSA 2KRFA 1NXSA 4L4UA 1FPQA 1SFXA 4O5AA 2E7WA 3CO7C 2W85A 1U5TA 1FSPA 2NYXA 3F21A 3M1EA 3T38A 4N0PA 4YP9A 4MR8B 3L49A 3EAFA 1H0MA 1LDJA 1UB9A 1QQIA 4G0QA 2OQRA 3ZPLA 3LTEA 3DZDA 5IEJA 4W5NA 2VONA 1E6KA 4HDUA 2HR3A 1ZGJA 1ZYRF 2IA0A 1TQMA 2F5CA 4IF4A 2PE5A 3GFMA 3H3ZA 1BI2A 1PP7U 2ACJA 4OINF 1FSEA 2XAJA 1APBA 4L5IA 2QBYA 4Z4EA 2VODA 2P8TA 1JBEA 3CG4A 2FBKA 2K7LA 4B8XA 1AB6A 3QU6A 5KQMA 1ZH5A 1ZN2A 3FM5A 1YTYA 2E1CA 4G86A 3FZVA 2MSLA 2QVOA 3F72A 4HNRA 2QYOA 4JK1X 4GYIA 3FMQA 3E6MA 3BJOA 1DBWA 3QP6A 3CRNA 1D3YA 2HKXA 4TLLB 4KREA 1J7KA 3L7WA 5IEBA 2L4AA 4Z2YA 4F11A 1DCKA 1J0RA 1ABFA 5KQGA 4Q5SF 1F51E 1FOKA 1FWZA 2P5LC 4FX0A 3OV8A 1WETA 2UZKA 2PQ8A 1SXGA 4F3TA 3S99A 3RYPA 4LLGF 2Z99A 2UWMA 3LQQA 1XSVA 3O2JA 4KYWA 4RB0A 1QNLA 2OD5A 1DP7P 4MR9A 2V9VA 2PUCA 4QICA 3V7CA 4YWHA 2FE3A 3CUQC 3ML6A 4HA8A 5KVRA 1MDMA 1XDUA 1QBJA 1P6UA 1R1UA 1BVHA 1C0WA 2LDUA 4L9TA 5HS8A 1A2OA 1DBPA 1FFWA 4G0MA 2AYXA 1YMUA 5GQSA 4MEXF 2YX4A 3GYBA 2E4YA 1XMKA 3F8BA 2FQWA 4G6DA 2VBYA 4RXTA 3G85A 2OU2A 4EUKA 4XRFA 4LK0F 2A9OA 1JGSA 1QQBA 1P2FA 4GPAA 1XHFA 5TPZD 1DCMA 2MH2A 4CZZA 2QQAA 2O20A 2MC3A 3JY6A 2JSCA 3SXYA 1FBUA 1PNRA 1MAVA 3O21A 4F8JA 1C0EA 3IRQA 3HSEA 1A0OA 4GCVA 4IMJB 4Z4CA 3URMA 1U2PA 4JASB 3SFZA 3J81K 4G0XA 1RUOA 1ZREA 3EYIA 3A0UA 4RKRA 2EB7A 2K4JA 1T98A 1HKSA 4L0ZB 2OZ6A 5JNTA 1M5TA 5HDKA 2XAQA 1FY7A 1Z6RA 3PFIA 3N4MA 1RIOH 2GI4A 2Q8KA 1CYEA 4EJTA 3GEZA 2L4MA 4LDZA 1O3RA 3LFKA 4MTDA 3SG0A 3UKJA 3GLXA 1FZPB 4HQEA 1GXQA 2PL1A 4YFNF 4HAMA 3RVNA 2YSRA 4IRGA 4YG2F 1F5TA 5LHHA 3QLVA 3L09A 5HLIA 4LD5A 4WZZA 3C3MA 6ABPA 2JPCA 2PBIA 5IBQA 3KEQA 4IRHA 3HXMA 4NHJA 2FA5A 1R58A 3NRVA 5BMZA 3SQNA 2QVCA 4KRFA 1F9NA 3MAJA 1F4VA 2G9WA 1D5WA 1MDMB 2VBXA 4I98B 3RVPA 3WTTC 4GYGA 4EYGA 2CYYA 2L19A 5IC5A 4S04A 4W5QA 5D8LB 2LBPA 2H3HA 2FMLA 1ZG5A 1U8RA 1IN8A 3CUQB 2QUFA 4JBAA 2HSGA 3BOQA 1QPZA 4XLTA 3IRRA 4K2EA 1J59A 5ILSA 2HTJA 3H5VA 4A12A 2KIUA 2XASA 4YS6A 5L3EA 3LUCA 2NUBA 3GVAA 2FEKA 2VC0A 3HEBA 5FLXZ 3M9XA 4L9JA 2L18A 2ZBKA 4YO7A 4LFUA 3HTSB 3F6VA 2P7VB 2PFBA 5BS6A 3KEOA 1RXEA 1Z12A 1FBQA 3WGIA 4N9IA 5IUJC 3MF4A 2ISZA 5GOTA 3LA3A 2NAZA 3HM9A 4UNOA 4G0ZA 4FB4A 3QELA 2TMYA 2FVYA 5AIQA 4IJAA 3K9TA 3T8TA 4RXUA 4IPAA 1KYZA 2CG4A 3HZHA 1PNTA 1YS6A 4YFXF 1ZHHA 4KNYA 4N76A 1IUYA 1RZ4A 1H9TA 2B1JA 3V8JA 1VLZA 3TX6A 2MD5A 5KI6A 1OXBB 5E1WA 3CZ5A 4KDPA 3TO7A 2D45A 4MAAA 1RXIA 3H1FA 3OO0A 1L5ZA 4O5VA 5TQ2A 3KKEA 2QV0A 3ZN0A 1QQAA 3BZ6A 5K1YA 3HUUA 1SMTA 4XASA 1SXIA 4LE0A 4XAQA 4OLBA 1ZG3A 1D8KA 5JNWA 4HX4A 3TB6A 1HSJA 3T1BA 5JR3A 4CDGA 3SHFA 4L85A 4Z99A 3E5XA 1NXWA 1EWKA 1GXPA 5D6FA 3BP8A 2G7HA 2ZXJA 2A68F 3RQIA 1Z18A 4MS4B 2HOEA 4MQ9F 5H6RA 2VT2A 3HRTA 2RV8A 4ENKA 1JYFA 2HYFA 4ENJA 4RB3C 2DBBA 1PHRA 2A9PA 2P4UA 3R61A 4DQ2A 3LOPA 1ZGAA 4ETNA 4CICA 2PAFA 3OLWA 4MQEA 2IA2A 3J80Z 4N03A 3CLOA 1H9CA 4AIJA 2XVCA 5CNJA 3QRFF 2CHEA 2M5WA 3KHTA 1LK0A 4UHTA 1MGTA 3RVQA 4IXAA 2F5EA 3ZMUA 3N97A 5F64A 3QELB 1DJMA 1B4AA 3D0SA 3OLYA 5D4RA 2QZ8A 3T8RA 2QLZA 5JNUA 3DBIA 1LQ1A 2EA2A 3H92A 1JX6A 4MS1A 3KS9A 5E3JA 1GCAA 1QP4A 1DC7A 1LDDA 4WCGA 1BIAA 1W7PB 3CDHA 1KMIY 2BGGA 3R0AA 4RS3A 3BPXA 4AVPA 5E1XA 2F5DA 2AS5F 1WWXA 1TW2A 1BIBA 2RC4A 2PUFA 5J6XA 1O3SA 1BC8C 3CZCA 4IRXA 2M98A 3ABUA 3RVOA 3WU0A 3BRQA 4OIPF 2HQOA 4JP1A 3VEPA 4HBLA 2VN2A 4KFCA 3HV2A 4EGZA 1YFHA 3DP7A 2XRNA 4QYMA 2VOOA 1USIA 4ON0A 2XDYA 4KICA 4UV8A 2DK8A 3M8FA 3N53A 5HM6A 3ZMVA 2PKXA 3W9SA 1IF1A 3TOAA 1YYVA 2ZNYA 3FMVA 1R23A 3DGFC 4RWEA 1D1QA 5JVTA 3JW4A 2PG4A 3QU3A 3O74A 3ZQ7A 1HQCA 4G0YA 4HLXA 4Y17A 3LUHA 2PUGA 1B59A 4MS3B 2FNAA 3A0RB 3HUTA 2KIMA 4YV7A 1PUXA 3E6CC 3OM0A 1EFAA 2DPDA 2E4XA 2R7DA 4U0YA 1NXPA 1R36A 3HHHA 4M6YA 1TLFA 1MIHA 1B9MA 5D5WB 5D5XB 5LEJA 3D8UA 4RY8A 5IT3A 4RY0A 3L9FA 3N8IA 3F22A 2NZUG 1W25A 3U1DA 2UXNA 3W6KB 3OLVA 3M9AA 1Z7UA 4KVFA 5FLXK 4I2OA 2BE5F 4D6YA 2JB9A 1K78A 3K2ZA 1J9IA 1JXSA 3HDGA 1YW7A 4WX9A 2V0NA 3N0WA 4KV7A 1BAPA 1Y1LA 2A9RA 1SD6A 4Q4ZF 1KU7A 3JSOA 4F06A 2XAHA 3I5AA 3RYRA 3BJAA 3WTZA 1U78A 2EFNA 5IX8A 5C5EA 3DQVC 4RS8A 3IL2A 3C7JA 4KPYA 5JFRA 4EM1A 3ZMSA 4IMIB 2HS5A 1I1SA 2R4QA 3QOPA 2M8EA 1KU2A 5A2QZ 3H5WA 1XWWA 3RIRA 3G3ZA 1SRRA 4A6DA 1VTNC 3Q7RA 1DG9A 1IXSB 1B9NA 4HW0A 3FWEA 1ON2A 2HYGD 4EJVA 4ESBA 1ZGGA 3LWFA 1U0SY 4MR8A 5KQLA 1TW3A 3IP7A 1PDNC 3I54A 4I09A 4DNCA 2PLNA 2GIVA 3WGGA 4HF1A 2HPHA 5TQJA 4JAVC 4XFKA 3LUFA 3C1DA 3T5XA 2DRIA 2ZNZA 2H6CA 1XD7A 2FMHA 1USKA 4CYDA 4NCAA 5FB2A 3HJFA 2H27A 2HFHA 4CXFA 4HF0A 3E6BA 4PICA 3O2QB 2X4HA 1K66A 4EVIA 4XLNF 3KCCA 4ZYLA 2R25B 5HLHA 1ZGZA 1QO0D 3HSRA 1BOAA 3R4KA 1LJUA 2X7XA 5CJ9A 1J5YA 1FFGA 3SAJA 4YFKF 2VYCA 2BYVE 2VT3A 2R48A 4KK4A 1Z15A 2LKPA 5T7BA 4GO1A 1TQPA 2RN7A 3GFIA 3GRCA 3WTYC 2XKOA 2Q0OA 4GNRA 1EAYA 2OENG 4KT5C 5TE9A 3DFGA 4LK1F 5ABPA 3J80K 2B0LA 3FHZA 4UXNA 2YPRA 2RQPA 4A0ZA 4IILA 2BBYA 4GGGA 3FFXA 3WTUC 1JDPA 3O1HB 3QLUA 4P96A 4LG0A 4RK6A 4ENNA 3V7RA 3WODF 5F6FA 2YR2A 4FE4A 4JB2A 4N41A 5CYVA 1H9GA 1J56A 3GO5A 5FFZA 1ZH2A 1IXCA 2M1BA 3HTUA 3WTVC 3I58A 2FMIA 1O3QA 3N6VA 4M72A 3HUGA 1XGOA 2R7FA 2GA1A 1OPCA 3U9GA 4OATA 2PJPA 4KK3A 1YQAA 1KU3A 4HV5A 3JVDA 3I42A 3H1EA 3K69A 2M45A 3GW2A 3EQ2A 3NHZA 1UHMA 2PMHA 3K1MA 1ISRA 1DPUA 1KQ0A 1ZY2A 3R60A 3BY6A 3QX9A 1QP0A 1YK1A 2RDPA 1F4KA 4LGWA 4HLYA 4MRMB 2FMFA 1GUDA 4LE2A 2MLGA 1S3JA 4HOBA 2XGXA 2VE8A 2BGCA 5TPZA 2DLLA 1S6LA 1KQ9A 2GWRA 4KIBA 5HS9A 3IPCA 1HBXG 4Q47A 3QLTA 1X3UA 2FBHA 1FC3A 3N0XA 4GXOA 4JA2A 4D6XA 1T34A 5IUNC 5CVJA 3IKTA 2XV4S 1EHCA 3F6CA 3ABTA 3HSYA 3QP5A 3VOEA 1FQWA 4LMYA 2HQRA 3FM3A 4Q48A 2FQXA 5DD8A 4KA4A 1WSUA 2E4WA 3RVMA 3H1GA 1KYWA 3MM4A 4ZYHA 4DADA 2HKOA 2V79A 3LUDA 1W4MA 4UHJA 4MQVA 5K5QA 4LG0B 4PCQA 3MQ4A 4KMUX 2YHAA 1EWVA 5LGNA 3HRMA 2R3SA 4HNQA 2IT0A 4EVSA 2PI0A 4YLEA 4Y13A 5LGTA 4M6XA 1WI9A 2BEOA 3C97A 3KZYA 4EYOA 2LIVA 3CHYA 1IN4A 1GHCA 2G7UA 4O6JA 2RGVA 1ZRDA 2XHKA 5TPWA 5IT9K 1V4RA 4IRIA 4PEVA 1IN5A 4M9SA 3T8YA 1OR7A 4UV9A 3W6JB 5DDGA 3F8FA 3IC7A 2DW4A 3BROA 1TVMA 3CUQA 5A2QK 1W5SA 3F8CA 5HLGA 4XARA 2A69F 3HK2A 4G9YA 3Q5FA 4OMYA 4LX8A 1R00A 2EFQA 3E6DA 4OIOF 3O6BB 4AIKA 1K7AA 2DQRA 2F8TA 2KJCA 3O1JC 1JH9A 1ABEA 5EWMB 5KC8A 1Z16A 5BQTA 1TM2A 5IULC 4G7OF 1CHNA 1E2BA 2A9QA 3TOBA 5D5UB 2IOYA 2ZFWA 1D8JA 2NT3A 4L18B 5CVIA 4MLDA 2PL9A 1G6NA 3EDCA 4QPJC 4KN4X 1OYIA 3WG9A 1MKMA 2OA4A 1HKQA 1P4AA 3F6OA 3HRUA 1ISSA 5D4SA 1D4ZA 2O8XA 4LRQA 4G6QA 1Z91A 2DI3A 5DGCA 5KK1A 1P8AA 4LE1A 2ZMEA 5LHGA 3DEUA 3BREA 3TKYA 2NNNA 4BQAA 4EY3A 3DPTA 3LUKA 5HOOA 1O7LA 2Y75A 1E6LA 2W24A 2JTVA 4JB0A 4IGAA 4MLCA 3F23A 3ZMZA 3CKMA 2W42A 4E7OA 3LAJA 2DT5A 1L5YA 2H6BA 2EA4A 2W25A 1SD4A 4KMFA 2NT4A 2GXBA 3WTSC 2JVKA 5BPIA 2O3FA 4P98A 1DBQA 3EQLF 2FBIA 3KLNA 4UUVA 4H3HB 2X0LA 5TPWB 4MGEA 3S2WA 2MYTA 2E1NA 4XSZF 1R22A 2OAZA 4LB5A 1F1ZA 4XSXF 3ERED 4R79A 3Q41A 2RNJA 1QZZA 4MS4A 4D0PA 3ILHA 2WV0A 1NHAA 4L5JA 2O0YA 3KE2A 4W5RA 4Z4HA 1NXXA 4HZFA 2N9UA 3MYYA 4RK7A 2M87A 5D5VB 2O6GE 4HX7A 2YHBA 1VPWA 5TRDA 3ZN1A 2GXGA 2FXAA 4HQMA 3WTWC 3GWZA 1MJAA 1UCRA 4Z4FA 3Q15C 4M73A 5HKOA 3WTXC 4EQQA 3LA2A 2E7XA 3Q7TA 3FMRA 3EULA 2L3DA 1MB3A 2EWNA 4E70A 4ZPJA 4W5TA 3LMKA 1TMYA 4M9ZA 3DF8A 1OYYA 3RKWA 1YO5C 3C3WA 4D74A 4WK8F 5FWXA 5E8GA 3PQJA 2YU3A 1LDKB 1W7PA 5AIPA 1S29A 1DZ3A 3NEUA 1OXKB 4U88A 3K1NA 2ZMEB 3KP5A 1EWTA 4F7ZA 2H0AA 3ILYA 4WXMA 1LBHA 1T38A 4Z9BA 4ML3A 4Q6WA 2D2WA 4PE5B 2JT1A 3T0YA 3MZHA 3IPAA 1Z26A 4PYRA 2ELHA 1ZHFA 2L54A 2M1ZA 1CGPA 5DCMA 4RKQA 5CVUA 2RKHA 2JCGA 4KIGA 2B4AA 3C6QA 3H75A 1KRWA 4QLCU 5LHIA 2PUAA 4ZZLA 4RAYA 1VRVA 3IP6A 5ICFA 3DKWA 5C5CA 2LPMA 5FFXA 3ROFA 2NZVG 4I02A 3OOPA 1LBIA 1LNWA 3ZMDA 4MPTA 1I1GA 4EGSA 3I59B 2FN8A 1XN7A 1XB4A 3TQNA 1YTUA 4YIFA 4ZYGA 2V6CA 3FMSA 2FLKA 3GBPA 2EK5A 4MS3A 1BDIA 3HCWA 3VFZA 2HQBA 3SZPA 4OOIA 4DN6A 3N75A 2MYNA 3EJWA 4UVCA 4RB2C 2GKGA 3GF2A 4OBBA 4S05A 3F73A 1USSA 1FYKA 2F2EA 1FLIA 1HEYA 5TQ0A 1L0OC 4ZJPA 4MNUA 2EFWA 3RPUA 5TJJA 4FX4A 1LJLA 4CGZA 3D5LA 1QNTA 3A3KA 3EQZA 3DLBA 3I0TA 4RXMA 5DUIA 5FBKA 3OQNA 5BR1A 4ZMSA 5KQPA 1L3LA 3O2PE 5DLEA 4CO8A 5DCLA 2LF8A 5FWXB 3KZZA 2CWDA 2PJUA 3WE2A 3B02A 1BI3A 1DRJA 5AONA 3TGNA 1XMAA 3ROUA 5F1RA 3KCNA 2L17A 3RVJA 4ASNA 2FEWB 3MQ0A 2YX7A 5I4CA 4WT7A 1K68A 4O3MA 4RGSA 4LDAA 3TMYA 4M71A 5DCMB 1ZRCA 2Z33A 3CNBA 3GT7A 3CO6C 4BH9A 3H5OA 2GQQA 3BWGA 4U7BA 3ULQB 2P6SA 3F8MA 2FEPA 2GX6A 2MSWA 3SZTA 1BN5A 2WB4A 5KC9A 1FYMA 1BM9A 5E18F 1FNNA 2VC1A 1OYWA 5H20A 3MZYA 4RB1A 2XUBA 1U2WA 1Z6TA 1D2AA 3FXRA 4RZSA 4EGYA 1Z17A 3V7SA 3RVRA 4L9VA 1IN6A 2EJRA 3E5UA 1K79A 3K4HA 3NNSA 3SM9A 2IPQX 1QMPA 5EEHA 1QGPA 4OLAA 2DAOA 3HIFA 4G7ZF 1RNLA 5TQ0B 5FO5A 2LNBA 3GFJA 1JE8A 3EDPA 3JSPA 3G1WA 2HGCA 4XLPF 2XKPA 4UVAA 1RZRA 3MA0A 2IJLA 2D1HA 2XAFA 5HDNA 1E17A 1KGSA 2Y48A 1NXVA 3E97A 2QW1A 4NB5A 4Y15A 3ECOA 3D02A 4MYRA 1QO0A 2QWWA 5J8FA 1I3CA 1YMVA 3G73A 2IA1A 1ZLJA 2KJBA 2GAUA 4P9UA 3OO1A 3SNKA 2MH9A 2QSJA 5ICGA 3B73A 5IT9Z 4RY9A 2IYNA 4MR7A 4RU1A 1C4WA 3V4GA 5DEQA 4LLNA 3QAHA 3RH0A 3EODA 2VBZA 3P9KA 2LSOA 3BJ6A 3VNBA 4RGRA 1YK0A 3O1IC 2FSWA 1IZ1A 2IRFG 1ZESA 5EWLA 1WKMA 4PGHA 1E6MA 1ZH4A 2QXYA 4EV0A 2JVIA 1YG2A 2LF7A 3GA5A 3I53A 1JF8A 1ZARA 3HRSA 4HDVA 5FD5A 4HYEA 4OIQF 2K4BA 3GV0A 5DD4A 1GLGA 3HVRA 2P5VA 1XDSA 4A5NA 1M2EA 5CVRA 1GUBA 2QQBA 5E17F 3GZ6A 1T6SA 2ISYA 2CFXA 4MRMA 5H6QA 2A5YB 1Z9CA 2WMYA 4LJZF 5HS7A 4KQCA 3I09A 2FOKA 5D6EA 3ZP5A 5LLQA 3H5IA 1G3YA 2FF4A 2PMUA 2VUIB 1JFVA 3CTAA 2DTRA 1S7AA 3MIZA 3Q9SA 2IDMA 3CG0A 3KETA 5L3BA 3ROTA 5LRRA 1DDNA 3QX8A 2MA3A 4N0QA 1XCBA 2QM3A 2IKSA 3HOSA 2FQYA 3AAFA 4R8HA 3TO5A 3TD9A 3FDFA 3R0JA 1JYEA 5JNSA 2VK2A 3UUGA 4Z0NA 3E61A 3ZMTA 1TLHB 1WQ2A 4OIRF 1U2QA 4Z9AA 1P92A 2A07F 3BRSA 2AYZA 2NNYA 2HQNA 4IVNA 2IPMA 1T2KA 4M88A 1MJ9A 1BDHA 4HF2A 3KJXA 1IN7A 3RJPA 2C6YA 4MR7B 6PAXA 2CD7A 5PNTA 3OQOA 2H09A 3J7AO 5FWYA 1U5TC 1OMIA 4L9NA 5EWLB 3MWMA 1P4XA 2WTEA 4R1HA 1U6GA 2P9HA 2KKOA 4IHTA 3JTHA 1I6XA 4EMSA 3CS3A 3GX4X 1UDRA 4A0XA 1QPMA 4ZH4F 4Z4GA 3A10A 4LZLA 3L00A 3OMWA 4P1ZA 2BV6A 3LSTA 5FBHA 2DK5A 3HS3A 5BPDA 4ESFA 3LUJA 3GZ5A 3NQOA 3RDIA 3CLKA 2JVJA 1QP7A 2MYPA 4FT8A 4WWCA 1Y0UA 1RPJA 5EWMA 1FX7A 1DC8A 3K9CA 4RV5A 1ZRFA 2H94A 1CF7B 1PUEE 3OMXA 2QVGA 2PUEA 3DLHA 4OU0A 4ZYDA 5L3FA 4EJOA 2D1VA 3EGCA 2J48A 1G3TA 1W5TA 5BRAA 3LA7A 2ESHA 3KYJB 4BNCA 1ZITA 2WJWA 3M7GA 4KIFA 3TDZC 4PZJA 1XGSA 5L3DA 3TO9A 3I5UA 2W84A 1Z05A 5E20A 2CQKA 1ON1A 4Z4IA 3KG2A 4ETMA 1P4WA 1NY5A 3LFTA 1YS7A 4PDKA 2F8SA 2A6HF 2STTA 1MZBA 3KP2A 4RAZA 3F7NA 1E2XA 4P9FA 3BBLA 4OTZA 5CNMA 3GYHX 3F8NA 3TO6A 2Y0MA 2WWYA 2VE9A 4XXHA 3U2RA 4EVRA 1J75A 4O1IA 1S7OA 1B6AA 3IKVA 4EJUA 1R8JA 5FWYB 5EWJB 3JPWA 1KU9A 4WXCA 4WUTA 3ISPA 3V8LA 4ENMA 3P9CA 1TTYA 3GL9A 2L2QA 4WXEA 4P5OA 1SFUA 4RDCA 2FEZA 1FFSA 1M2FA 2OBPA 3DPLC 3I45A 5L3CA 4ETIA 3KFWX 1TJYA 4F12A 3GBVA 1U5TB 4UHKA 3WE3A 2F5FA 3O3KA 3MMNA 1ULYA 4H0EA 2IPNA 4HV6A 3IP5A 4QYWA 4N0BA 1Z13A 3GWGA 1EH8A 3I64A 1CEYA 1HW1A 1YW9A 4WXDA 4A5MA 3CTPA 2HWVA 3H6GA 4EM2A 3E3VA 3EUHA 4DQDA 4ESJA 1NATA 6CHYA 1MD0A 3RVKA 2AXLA 4XBFA 5DTEA 5JI6A 5J8CA 3VNAA 3M6MD 2KYRA 2JBAA 3K1PA 3CU5A 2QBYB 1MVOA 1B00A 1XCVA 1JFSA 4BAYA 3QPHA 1U3EM 1IIBA 2DO7A 3WGHA 5CNIA 4WWHA 3M9WA 4EM0B 3REOA 2QZJA 5HDGA 4MQFA 4OMZA 1P6RA 4FE7A 2FTKE 4G0PA 4I7HA 3RKXA 1NXTA 3EETA 2WWVD 1FYLA 3E3MA 5DV5A 5DCFA 3QLVC 5IUKC 3L6UA 3QPTA 3BDDA 1PP8F 1UFMA 4N47A 4HX8A 1AB5A 1IRGA 3JPYA 4M9XA 1BI0A 1T39A 1I5ZA 2V1UA 1JDNA 4E7PA 3FX3A 1IRFA 3ELKA 5HQJA 2ESNA 5K5OA 3RVLA 1LEBA 4ZMRA 3I59A 3QK7A 2K86A 5B3JC 1T0FA 4NICA 1ODDA 5CVVA 2I6FA 4WXHA 1SD7A 3T95A 2CGPA 5JNRA 1YLFA 4MR9B 1XGNA 2V1XA 2MSKA 2RDMA 1SFEA 2JRTA 3LUAA 2GZWA 1EV7A 2IPAB 1GVJA 2PN6A 5B3JA 2O61A 2M30A 2E4ZA 2PLYA 1U04A 2CW0F 2GA2A 1YVUA 3OLXA 2CHFA 2FMKA 5DUKA 1V3FA 2DFIA 1AOYA 2DPUA 3MFKA 4ETSA 4G97A 3H6HA 1Z2DA 3M8EA 3CFYA 2CO5A 3LAPA 2RVCA 5BQ3A 3MEXA 2LP4Y 5JS1A 2FNPA 4BYYA 2JBAB 2RJOA 1BBYA 5HVQC 3P9YA 3MCZA 1TQIA 3O2SB 2P4WA 4FHTA 4A0YA 5JNVA 4MQFB 2W57A 2MLKA 4MHGA 2ZCWA 1R1VA 2PMCA 5ICEA 1IAWA 2VBWA 2JRLA 4MGRA 2VOPA 3RKYA 1G4DA 4TLMB 2ID9A 3OQMA 2Q2EA 1U8TA 3JTEA 4I0BA 3KYIB 1SMYF 4JOQA 1SAXA 3QEMA 1R5HA 2MYUA 2K02A 1REPC 2Q5CA 3WU1B 1Z25A 5K5RA 1BA2A 2FSPA 5EEGA 2MBFA 2OQGA 3Q7SA 1USGA 1XGMA 3FFTA 1BI1A 2EFPA 1FSHA 2A3SA 1JWLA 5BOXA 4AWXB 1SD5A 2FQ3A 4G7HF 2VXZA 4QWQA 2JK1A 1HKTA 4YGXB 4YIIA 1R7JA 3NBMA 3GXOA 3TDUC 1NTRA 2FW0A 1W9HA 2CSOA 3JTGA 2QENA 3JAMZ 4Y9TA 1RI7A 3V8KA 4CHUA 3LQRA 1HW2A 5ERIA 2HDCA 2WC2A 2TDXA 1EH7A 1JHHA 2ZKZA 1J2XA 4AD9A 4A6EA 3B2NA 3T6KA 1JL3A 2FN9A 3NNNA 5JS2A 2VUHB 1Z1DA 3RTRA 3RI4A 1O57A 1M5UA 1TNSA 3F3XA 3DV8A 1JHZA 1NXOA 5L3GA 3FXUA 3P7NA 2STWA 2P7CB 5LRSA 2XAGA 3FXQA 4O1HA 2LUOA 5CLSA 1BC7C 3R6SA 1PEAA 3UK0A 5T3YA 5D8KB 4EYKA 1JFTA 5KWSA 3KP7A 1BDJA 1DP4A 3OM1A 1EH6A 1YIOA 4NQWA 1AWCA 5CNKA 1W7PD 4H3KB 4U7DA 3NHMA 2FKAA 5LBQA 2WJAA 4I0AA 1O7FA 3CJNA 4EYQA 4L0YB 1D1PA 4RSMA 1IXRC 3HDVA 4YR7A 4Q6BA 1HSTA 3P9IA 1FT9A 1KA8A 4RK0A 4ZZDA 4RK4A 2DU9A 3ECHA 4N9HA 3H5TA 1OKRA 3QEMB 1BJAA 1A04A 2QQ9A 2FLWA 4MEYF 3KP4A 5DKFA 2JPBA 3HOTA 2A61A 3EYYA 3FFWA 4KN7X 1UHWA 4MTEA 3L2CA 2IP2A 1P6QA 1KRXA 2V1DA 1DPRA 4IHSA 2ID7A 2QR3A 7ABPA 1LVAA 2ZJ2A 3BILA 2FU4A 1STZA 1ZAYA 3LKVA 1XSXA 5TQ2B 1R5GA 3I71A 5HSGA 4WF2A 3HO1A 1XSDA 2HJ9A 3LUGA 1ZLKA 4W5OA 3FGZA 3GFLA 2Z9OA 2QU7A 3BPVA 4RGUA 2A6EF 4RGXA 1ZG1A 3IHUA 2IW5A 3VODA 5DYMA 1B1BA 4KZKA 5D2CA 4H60A 1QZYA 2NS0A 2P5KA 2HZTA 1I27A 2COMA 3IWFA 4NV3A 1Z2EA 4BXUA 1URPA 4EJWA 3KP6A 2RJNA 2R47A 3KSMA 4M74A 5FGMA 3LKBA 4MQEB 4YCSA 5ICCA 1WRJA 5E8IA 3SY8A 1ZDMA 1O3TA 1VKRA
chains in the Genus database with same CATH superfamily
2AH5A 3QMVA 5ITZB 1KVSA 4B83A 3DWLE 2L01A 5B1HA 4DGQA 1POWA 3SS9X 3F6PA 4OL9A 1Y1RA 3TL4X 5CYPA 3QEKA 1ZC4A 2Q6LA 4UVIA 3JS5A 2DPHA 4P7KA 4PS1A 3RCBA 1R1TA 4W1PA 4AJEA 4R40A 1YH3A 2Z5GA 3ND6A 3UT0A 3ZZ1A 1KZGB 1RYHA 1C81A 1N5LA 4B6FA 2Z5UA 4QOEA 3OLZA 4UASA 2GBIA 3ZYZA 1IW7F 2F1KA 1ZH6A 3G2NA 3T5MA 3EX7C 4IPTA 4BAUA 2P6TA 4JIMA 1DE0A 1XPOA 1AGRA 1K92A 4BNDB 3MTDA 4TLDA 5JS8A 1EA5A 4QXQA 3LL4A 4F4JA 4G94A 3TXAA 2JFBA 4UVBA 1JNYA 3VR4A 3O8GA 3UJPA 3PBKA 2R84A 1GY8A 2HVQA 2K9SA 2J6CA 1XF1A 4JITA 4D42A 2ZYRA 2BZSA 1I0IA 1XL1A 2PT7A 3C7TA 3DXJF 2Y66A 5JSZA 5KIAA 1W2HA 1R7RA 4CEIB 4M37A 2Y05A 3KP3A 1HW5A 3AK4A 1PFGA 1E6UA 5DNUA 3FM9A 1BEZA 3FJOA 4KAAA 3C3YA 3ORRA 1SCJA 2C4MA 3KEYA 2BGIA 3UV7A 1Y89A 3DZDA 1KONA 4K26A 1UELB 1MJGM 4G23A 4OHKA 3KBOA 1HO3A 3EZ2A 1V45E 2AEFA 2XOEA 1RKBA 1YJ5A 2ZSAA 3QU6A 5FFMA 1G98A 1ZH5A 3T1HB 1JI8A 3IT2A 5LMZA 2IA5A 4CQJA 3P19A 1HYEA 1B0PA 4Z9YA 1XALA 3E8MA 2HF7A 3I2HA 5HXAA 5JSZB 2VHXA 5CVEA 1YZKA 4XLZA 5K45A 3IERA 2ST1A 3KPVA 4B3SB 3A6GA 5D86A 5M3MJ 1GL7A 1KIAA 4I55A 2YV2A 2BTOA 5KNCD 4ZEOA 3INTA 2I4TA 3O2JA 4UHCA 4LNUB 3OEHA 2Y27A 3RIMA 1PSZA 1Y37A 4JLAA 4X1EA 4BO1A 2XB9A 4B3TB 3D0KA 1O54A 3OZUA 1Q6YA 5GQSA 3BLYA 2Q3LA 1E3PA 2VBYA 1LVHA 1UPTA 1Y3IA 4PFOA 2QYTA 2MH2A 5FEUA 2H7CA 3PEEA 5D87A 4JT2A 4OFZA 5AK3A 3NHFA 4W5HA 4M0KA 4Z4CA 5IVKA 3QKWA 2BSAA 4OXRA 1V55H 3ZX4A 4E7HA 2FWRA 3PXAA 1TQ8A 5FJ8J 1QFYA 3Q8KA 3O7WA 1O94D 1M5TA 3FRJA 5HDKA 1CUAA 4PBSA 1JIIA 2WQZA 3KU4A 2YXBA 4MB0A 4UZSA 3LFKA 4F3YA 1GXQA 2YY7A 4WN9A 1PK8A 1GPBA 3IHLA 3K7EA 2R66A 1SOUA 2QGZA 2BMVA 3A6LA 1Q1AA 4QG7A 1OXTA 1Y3FE 4IV0A 4A26A 1DMSA 2J67A 4E94A 4FFSA 2YY6A 5J47A 1SUDA 5K01A 4BY1J 5BYBA 3F90A 3OZBA 4DPLA 2LBPA 4RKFA 3M4YA 3CUQB 1QV9A 4KQXA 1AHIA 3NX4A 1YJBA 1RTTA 2XASA 5L3EA 4OB7A 3UAWA 4L3VA 5EPOA 5FLKA 4M0DA 2HHLA 3TL6A 3ZE1B 2WUEA 3CM0A 4RTLA 2FPIA 4PFKA 5DHTA 2IYWA 5AIQA 3IS3A 4HQKA 4MWDA 5I8ZA 3G8YA 3SR4A 5DM4A 5C52B 1ZYUA 2HU2A 1UOEA 3E9RA 1U3WA 1IJEA 5JT1A 1X3ZB 3L2UA 1NW5A 1UPCA 3QGMA 2BFNA 1ODTC 4ANJA 2B1JA 3OZ7A 2E71A 5KYVA 4ZCTA 3O8QB 3ORQA 3ANLA 4UATA 3QSGA 3H1FA 4KGDA 2ODEA 2X14A 4KQ2A 3K2IA 1NBWB 3G0CA 5I5GA 2VI6A 5JV5A 2IZ5A 3RAEC 1P0IA 1CDDA 1ZG3A 1Z75A 4BLQA 5IT0A 4AKEA 2ZXJA 4PR0A 4W6ZA 2NPOA 3RJMA 1US8A 3TTXA 1SAYA 1RYNA 1VL6A 1S1MA 4Q37A 1BWQA 1FY2A 3OLWA 5FTWA 1R49A 3LNQA 2EZ9A 1J0BA 4KWTA 1MBGA 4NBQA 3CJRA 3R0ZA 2FPIB 4IXAA 3N97A 1DJMA 1JG7A 3DTVD 2Z83A 4YNBA 1JX6A 1E99A 4R8RA 4M98A 2DA1A 1UWVA 4HPXB 1JDBB 1GYRA 4QAQA 1TW2A 2XGMA 3AEZA 3RLIA 1V3TA 2PUFA 5J6XA 3RNLA 2FZCA 1U6KA 3IPLA 3QENA 3MMZA 4Y6QA 3GCGA 4FZ3A 3HBAA 1WXEA 2UZ0A 3W6NA 4CLEA 1X70A 4GXQA 2BXZA 2LE0A 1SR8A 1TC1A 4IWXA 3QU3A 3U56A 4TRNA 2NSJA 1W0JD 1YX3A 1US8B 1VB3A 4FR0A 2KIMA 5ITSA 1XJ0A 3ZD7A 1OOEA 4U0YA 1FJGB 3TLGB 3VTFA 4M1QA 3CJRB 4M8SA 4J3NA 4M0MA 2D3TA 3KHKA 4W8HA 1I50J 4LITA 2ATXA 1C7FA 3TW8A 4X8MA 4F6LA 1J9IA 3HDGA 5EJ2A 4TKLA 2P2LA 3V1YA 3TQRA 1PWEA 1SOMA 2XUOA 2C96A 2W2OA 1NBMD 2I3BA 1NUSA 1H2YA 2ZCUA 2PL5A 1XZPA 1DG9A 4HW0A 2R87A 1ON2A 1GG8A 1ORRA 1Y5RA 4I5GA 5DI3A 3JRWA 5DSXA 4Z9XA 4HF1A 1H2BA 4JAVC 3F6RA 4UHHA 2QB5A 1II0A 3QI7A 2QGNA 4MIMA 2ZB8A 3ENNA 2HWYA 2ZNZA 3WMWA 3DVLA 1FMJA 4RDUA 1S2DA 4X45A 2AO9A 3DOFA 2ILVA 8GPBA 1HDXA 4MXDA 1CR4A 2B1GA 2EZHA 1HFJA 1ZGZA 4DCNA 3R4KA 3UV3A 5M29A 4KB5A 4KLAA 3RIYA 3NJRA 4PZDA 2ZVPX 1DS6A 5CDHA 2NVBA 1OFUA 1MH4A 2CXUA 1R16A 4IIJF 2KX7A 4Q34A 3GLFB 3NT5A 4M9RA 2ZI3A 1XCLA 2TMKA 5TE9A 4DYRA 2FF5A 4ZAFA 3MW8A 2BBYA 3FFXA 3O73A 3MWLA 3HA2A 3NGMA 4RK6A 1C0LA 4HH4A 3V7RA 2UVQA 4PR3A 2EEPA 2OCYC 3AUXA 4TXMA 1H9GA 2IGKA 2SHKA 4Z0PA 3ENWA 3FAKA 2GO1A 3QM1A 3HTUA 4UOZA 1Y8RB 1RVDA 2DTZA 4M72A 1MR3F 5DI3B 3FXJA 5HTKA 3LLMA 3H2GA 4ERXA 1F0NA 3QVSA 2GPAA 5K0LA 4IDFA 1WZUA 1JKOC 3TLYA 2JLQA 1CJCA 1JQJC 3D54D 3KKNA 4CLRB 1R9NA 3PCRB 4MEJA 2C88A 3T9EA 4B44A 1FQKA 1BCRA 3IPCA 1ULAA 5M34A 3R3SA 1J8YF 2NACA 2W2KA 2IV3A 3C2GA 5ILGA 1GGHA 2ORYA 3MSCA 5K3EA 3EGDA 1W36D 1QH8B 1WSUA 2GYVA 4TKMA 4TUYB 1S2GA 2AF4C 3DEYX 5TMEA 4UHJA 1N32B 4MQVA 4FBMA 2WPNA 1G20E 1A98A 2YHAA 4YMHA 4N7MA 3EISA 1GA1A 3L2WA 1H8AC 3SJUA 2VQ6A 5EFZA 4IJKA 3C3XA 2UV8A 5EIEA 4A8TA 1U8EA 4DQUA 5A2QK 1FFHA 3F4BA 4F2GA 4J8PA 2EZUA 3EUHC 1P19A 4LHZA 2EFQA 2G63A 5AUNB 4WHMA 5DASA 5BN4A 1CFZA 1X15A 1W1UA 4JI5B 2K5UA 4PX2A 4E7ZA 1DQYA 1NC1A 1NMSA 5AKIA 2V7QA 3K4QA 3NBYC 4K7JA 2ZJFA 5CGQB 3CLTD 1DRUA 4M53A 3EZGA 1P4GA 1E3JA 4OM7A 4FUTA 1Z91A 1A8PA 3V34A 1GKYA 3IVXA 3W3AA 4JYAB 2WJZB 3OOHA 3SVZA 2B4RO 3M8JA 1I14A 4DMGA 3QIVA 3IJPA 4RGYA 4IGAA 4MLCA 3JYHA 4CZCA 2XCRB 1EK1A 4XRSA 2YHSA 1L5YA 2XRYA 2WFZA 4J43A 4O4HA 2OV1A 2B82A 3WLAA 4UUVA 3HBNA 5DBEX 3HRIA 3S2WA 2MYTA 1NONA 2C42A 4DNFA 3LSYA 3QYJA 1SXJE 4WK2B 1XZAA 5EJ5A 2OXRA 3HU3A 1MDBA 4RK7A 4HN2A 4IV5A 1M6VA 4UHEA 1ZD1A 2GHRA 1K7XB 2WKQA 3LXXA 3KD2A 4LTNA 3DW3X 2JFPA 1TF5A 4D56A 1U0FA 2FKNA 3VVLA 4XVRA 3OJ0A 3THYA 4WK8F 2QMYA 5FPHA 4FHZA 1GZDA 4R54A 2NU7A 4OWRB 5FX2A 5K0FA 3KVRA 4F7ZA 1LBHA 3V2GA 4LJKA 1E1QD 2Q8PA 3G0BA 1FYEA 4HBGA 1HCRA 5FPQA 3KYDA 1FU4A 1ZHFA 4RKWA 5DCMA 5CVUA 1ESZA 5F9HA 5CTJA 2JGAA 3W34A 3Q3VA 5ICFA 1VJRA 1SOWA 4O4HB 5LUBA 2IXTA 3WWOA 4JELA 3IB6A 2V5VA 4BEHA 1UODA 1T56A 2OP0A 1IDZA 1POGA 4L9AA 3DE7X 5JI3E 2OYRA 4Q18A 1SCBA 3F73A 3OIVA 4HNTA 1GTJ1 4Q19A 4BDTA 4JB3A 1TWAJ 3TQIA 3ZKWA 5KMGA 3UEOA 1U80A 2H92A 4F7DA 5JPDA 2VNIA 3RROA 5DLEA 3THYB 3RUCA 1PGOA 4LMBA 3LFUA 4F0JA 1ZMBA 5TT0A 2EJVA 3B70A 1F0KA 3ANNA 4HX5A 3SICE 3CMAI 9ANTA 3VMFA 1VSUA 1PJ4A 3RFUA 1BR4A 3KYDB 3R9WA 4M71A 3NEYA 5DCMB 2TMGA 2WV1A 3CXUA 2I5PO 2O54A 2P9FA 4P32A 4V2UA 3CIFA 3T12A 1Z74A 3U4AA 1VP3A 5AOBA 1T5TA 4F6CA 3FWKA 4F04A 2B69A 3T7CA 1FNNA 1VPLA 2HK9A 3CMEI 1X87A 4X0EA 2A5DA 4RZSA 5BMVF 4P36A 4GVLA 2OWDA 2EJRA 2NVOA 2CD9A 3SM9A 2QWXA 4PV7A 4B85A 1Z6PA 1QUEA 2YR0A 4RGQA 1U0OC 4P34A 4LQDA 1RNLA 3TOSA 2REXB 3IP3A 4XLPF 1F12A 3KQVA 2A35A 4BCDA 4H0NA 2WFLA 5TS2A 2H2GA 5IPFA 4YP5A 1SQ5A 3AZQA 2R4GA 5KMGB 1RBQA 4P3PA 3CC8A 1C1XA 1UBRS 2Q9CA 2QSJA 3FZEA 3D9QX 2KZVA 3T1NA 4RU1A 3OIWA 3WB1A 5J40A 4LXHA 1VHLA 1IZ1A 3VYRB 5FNVF 1YRWA 3AXSA 3VJLA 2QXYA 4BQSA 3FUXA 4AW9A 3GA5A 3WDMA 2A86A 3DL4A 3NXKA 1XEFA 1ZIYA 3H04A 3PC3A 4G24A 4H7KA 1L5QA 4N5LA 3EPZA 1D8AA 3E53A 4LDJA 4BMDA 1RAGA 1MORA 2E5NA 4RFVA 2H7XA 4C5AA 1KIMA 2EZIA 1WXQA 5E8RA 3TZHA 5LLQA 3H5IA 4PO8A 1XI2A 4YDQA 3BXOA 1FOYA 1UOPA 4H27A 2CSXA 5EYPB 4ZXPA 5LRRA 4PJMA 3D8RA 4Y52J 5T8KC 3AAFA 1JDZA 1Q50A 3TO5A 2IE8A 1YI8A 1LVUA 4GVXA 4U7WA 4Z0NA 4OIRF 3E03A 1UBEA 3BRSA 4EG3A 1HL3A 5KPJA 4YXFA 3HGTA 4M88A 2PX5A 4JYBA 1XTUA 1FXUA 4HOYA 4ZAYA 3GG2A 1XDZA 2IJGX 5PNTA 3K05A 3ZQGA 3RS9A 5DCYA 4LYHA 1KSGA 3SBDA 2AF3C 2WTEA 2H63A 4BBSJ 2LV8A 2RI0A 5JMWA 4KISA 3A10A 3L00A 1PZFA 3K72B 5JAIA 1GDHA 4ESFA 1IE3A 5KTMA 2PMZN 2V54A 1LEHA 3K1TA 1Z2AA 5AXAA 4ABTA 2BFCA 1C7RA 3AF2A 3WO1A 4KQ1A 1NVKA 4U7GA 2CUZA 4JC5A 2B92A 3OMXA 4KBGA 2QVGA 3IE2A 3KB8A 1MZPA 1UG0A 1AKHB 2Y6VA 3P97A 2O0MA 1U2GC 3EC2A 4JKIA 3LA7A 4RMHA 5BRAA 2YQ5A 1ZITA 1D2NA 1IVSA 5IKOA 3O82A 4KIFA 3LBAA 5L3DA 3TO9A 3I5UA 2HFJA 4BO7A 3HU2A 1GCOA 3CE9A 1ON1A 2DDBA 1U28C 5JRZA 2BZ0A 4UUOA 3W2AA 2IOQA 4I1OA 1R0BA 3KDPA 1DG3A 1VQPI 3WL3A 3TE6A 3LA6A 2DQKA 4ND1A 3V8LA 2V6IA 2V8OA 3DH0A 3DYIA 3UOAB 4V0KA 4XQCA 4ZI7B 1U5TB 4KMOA 4TVKA 2BMJA 1B1CA 4MWEA 4UXIA 5DW3A 3O3KA 2FPXA 4ARBA 3V7UA 1C50A 2YDYA 2TMDA 1TYDE 1LPNA 1CEYA 1BC5A 2LY9A 2HWVA 4D25A 5K4GA 1N7IA 1NATA 4HYYA 2CBZA 2Z6QA 2IXDA 2Q50A 1CQJA 4JGGA 3M6MD 2PD4A 1MVOA 1WU8A 1KO7A 1EIZA 3TR0A 1W29A 4KP7A 1JFSA 4WN3A 3BMNB 3UIEA 1AVTA 3OUUA 1PR9A 4I7HA 3BR6A 4JDUA 3DLTA 4YT5A 1DI0A 5HFNA 3PXGA 3JPYA 5SZJA 1NRXA 5MFZA 1T1IA 4WASA 5DS9A 3RUDA 5IZCA 2CH0A 2RHTA 3IQEA 3QK7A 2KLBA 3SI7A 5HIKA 2WG1A 1NX9A 3FFAA 2D5CA 4EEKA 1YB5A 2ZBDA 4MR9B 3ZV6A 2W00A 1QX4A 4PFSA 2ZI9A 1JEQA 3JWIA 5EHXA 3LK6A 2ZIEA 3BWDD 1WB4A 5K8IA 3OLXA 1MG0A 3BG9A 4HDNA 5ARDA 1ZTRA 4WESA 4QBIA 3M8EA 4DLBA 4JX9A 4MYDA 2HLPA 4B82A 2WK1A 3FXOA 3WBBA 2NOJB 1MEJA 3EXHA 3C41J 2I6TA 5EN4A 1U11A 2UYHA 5SYAA 1GAEO 4EHJA 1E3OC 2W2LA 5AVYA 3C48A 2VJYA 3BIXA 2Q5OA 3KR0A 4JOQA 1R5HA 1IFXA 4PLPA 5JAUA 3PPXA 5KU7A 5EEGA 1RYZA 2WQ7A 2XT6A 3NHSA 3DMNA 4FW8A 1E3QA 1RI2A 3G13A 2OBLA 1SKYE 4UPEA 4ZYVA 3B6CA 1JEQB 1Q0LA 4AD9A 1ZLYA 3B2NA 1DARA 4BVGA 1PK9A 1OBHA 3L6BA 3NOVA 4WESB 2Y92A 5LRSA 3FXQA 3ZW9A 1BC7C 4UQPA 5CT5A 3AZPA 1TI7A 1DP4A 1Y7PA 2VJLA 1WMAA 1FUIA 2G25A 3PQ2A 2DQ4A 2C4WA 4P3OA 3AYXB 4UEWA 2ZJRF 5J3JA 5IZ4A 2PKWA 1USVA 3HDVA 1NJ2A 4X62B 1DIOB 4RK0A 5FKMA 4R05A 3ECHA 3HXLA 3D5RC 5K03A 1OPRA 2QMQA 1GZ4A 2YC2C 1BE0A 5K8LA 5FPYA 3FUTA 1DPRA 1E0SA 1P72A 2NSDA 3WLEA 4JA0A 2BMAA 1QLWA 5G0VA 2W58A 2BGUA 1C41A 4RGUA 3IH5A 4TTAA 4JXJA 3FK6A 5DYMA 1CUWA 2G7ZA 3OOYA 3M9LA 3B1WA 2NS0A 2YU9J 3BK7A 2EQAA 3OOUA 4MKFA 4LTMA 3AJAA 5LU8A 1T4GA 1GT6A 3PGXA 3LPAA 1LS1A 5E1DA 1E5VA 1P3DA 3RPQA 1NWHA 2XA2A 2ZAYA 3EW7A 5C46F 3H99A 2PZBA 4QTUB 4YMLA 3PHIA 1O4VA 3E0JB 3CQ9A 3INGA 4P55A 5AKKA 3BZKA 2R11A 1MH1A 2JZYA 2QG4A 3C18A 1OHHD 4TMFA 4YRZA 2CU7A 2DJNA 3EIXA 1I6MA 5KX5A 1SBNE 2CEKA 2CLEB 1ZRHA 3RRJA 4EPXA 4YUXA 4HVTA 5LMCA 5JAMA 1G2IA 1UFOA 3QJYA 1YCHA 2IH4A 2FMYA 2VF7A 4XQGA 3Q3JB 4NXNB 3BHIA 2J9FA 3MZ0A 2K87A 5BV7A 4PGMA 4RTNA 2E9SA 3A1SA 5ALYA 2PX4A 5H81A 5CFQA 3KSAC 3GAAA 5CFZA 4KO1S 3RJ5A 4ZTUB 1F48A 4GBGA 3F98A 4GRAA 2QTNA 4U0VA 4HLUC 1CTQA 5CLIA 1VQNI 4OREX 4O4IF 3H3UA 1I94B 3P5BA 3SMVA 1KYXA 3F5QA 2Y76A 4FW9A 1YAJA 3K0CA 4IUDS 1ENHA 2VDMB 2E4VA 2JARA 1CY1A 1PEYA 3C24A 4ND6A 4L4UA 4LVUA 2JLSA 3PFHA 1Q74A 1B14A 5KX5B 1FSPA 4D4GA 1RQPA 2AQEA 4PG8A 3JRHA 3L2QA 4TYWA 1U8AA 4DMHA 1Y6ZA 2E1OA 3QBJA 5AVXA 2ROQA 4FYPA 1LBTA 3EH1A 2ZATA 2HD4A 1LFAA 3OYGA 1Y9EA 3JQAA 4ZYXA 2XAJA 2Z1DA 1APBA 2K4MA 1SEUA 2Q28A 2FBKA 1FB5A 1L5OA 2Q49A 2FRDA 2E1CA 1O9GA 3FZVA 3EDMA 4HNRA 1AC5A 3E6MA 1A4UA 3CLUC 1DBWA 1RMQA 2CXQA 2GD1O 3CRNA 3QUSA 3N7TA 2CBGA 5CQEA 2AW5A 1GM5A 3OPYB 3L7WA 4IIFA 1K27A 2VKEA 2WQ6A 4ZGBA 4UUSA 4PXYA 2HVRA 3N58A 1FWZA 2I78A 4XKCA 1RQ2A 3FYUB 3FKJA 2C0CA 1BIFA 4KR2A 3DHWC 5F7OA 4D57A 4JVMA 2KLHA 2JPDA 3TUZC 1NQTA 3T0FA 2N75A 2MC4A 1YZNA 1HM5A 2GXAA 3NBZC 1QBJA 3N1UA 4CM5A 4P0QB 2P3QA 1A2OA 1J9ZA 4W7HA 3ZWBA 2Q7XA 2UYQA 4HL6A 1Z8HA 2OU2A 2HBQA 3ZCUA 2A9OA 1JGSA 1XNRB 1FSSA 4PY2A 1HLDA 2HHHB 3EH2A 2VJ4A 1HA3A 2CN1A 1YIDA 1U2ZA 2WF8A 3WR5A 4Y2HA 2LC2A 3URMA 1DADA 5EHZA 3IDFA 4C3UA 5CLHA 4FP9A 1K08A 1ZBQA 4BMXA 4GMFA 1V3QE 4GHWA 2FMXA 2PGNA 2CY0A 4XTRA 1FY7A 1OA1A 1D1TA 1A8SA 1JG2A 4PCAA 1DNPA 3HP1A 5BP7A 3LXMA 5DHPA 4NRDA 2PL1A 2MSNA 4D9EA 2XRZA 1EXVA 4RPHA 3TFQA 3K0KA 1YR3A 4HLCA 4V2IA 1DQZA 4FQGA 2WJJA 3G1LA 4IO9F 3BF8A 2ZSUA 2HHAA 3VSLA 4GYGA 4RACA 3M81A 4CM3A 1IN8A 1DX9A 2W6IA 3BA1A 4XFJA 2O5CA 4DG5A 1KPHA 3FDXA 1WPGA 4E1BA 3R5TA 2XBLA 4UUPA 1OX4B 4LNAA 3HOYJ 3HTSB 3F6VA 5LKAA 2PFBA 3KKZA 2CFSA 1FLDA 2CLFB 1FBQA 4AVYA 1H0RA 2XXJA 4JJAA 3CNNA 1SKUA 3ESAA 1WJEA 4DB2A 1YS6A 4EAQA 2R8RA 2RK4A 5H0IA 4IOCF 5E4JA 3E2MA 3TBIA 3D5SC 2HIGA 2ZYAA 4RMNA 1P8JA 1IY2A 5A0FA 1D4AA 5F73A 1IG7A 4E4YA 3JQ7A 1WMSA 1PVEA 4XLAA 2DYKA 5E4FA 1E0EA 1QQAA 3M3DA 3TMKA 2D54A 1CEQA 3GFSA 3HUUA 4M1SA 4LE0A 4CG3A 5LC1A 1YQGA 5JNWA 4K8OA 3A4CA 4CDGA 1OLOA 3BP8A 4MO2A 1R6XA 4ICIA 3NFYA 1VLJA 3DFFA 3UANA 1VKOA 4PSKA 2B98A 2IA2A 1Y3BE 3WC4A 5CX1B 1FBNA 4KI7A 4TL6A 4UHTA 5B37A 3HABA 2XECA 1HMPA 5I9TA 2DYSH 1MTZA 2E35A 3H92A 3K1YA 1TF2A 2Q6IA 1F7UA 1V5IA 2HWWA 5BWCA 4RS3A 1KC3A 3ICQB 3HXOA 3ELWA 2H54A 1NK3P 3CZRA 3OA0A 1NMXA 2YJ6A 4YMTA 5HE9A 5KVAA 1UBFA 4ARCA 4ETWA 3GPDG 5A9RA 3JQ7B 4O02B 2KIQA 4KICA 3I6BA 4FLFA 2V9CA 4ZYUA 1FQOA 3DEJA 3E5RA 5L45A 2YYAA 3BGSA 2HZ7A 4K9LA 4HLXA 1KJ9A 2J08A 2L82A 1LZLA 1TT5A 5HS4A 3K20A 3COZA 4NBRA 5JYEA 2OCEA 1NZFA 4CNBA 2IYEA 3R9IA 2GBLC 1X8XA 1YZLA 4FHDA 2O57A 1ZA2A 5FBRB 2Z95A 2X3YA 4IIGA 3KUUA 1C30A 3FISA 2Q1YA 1NVUQ 3RSCA 3AJDA 4DLNA 3QOFA 2ZJ3A 4RZIA 4OI0A 2QHXA 3I5AA 2GARA 2WD7B 3TF5A 4YJHA 1M8JA 2H17A 5C5EA 1CIJA 2WD9A 4ZOLF 1KTVA 2GLUA 3DQZA 1WXGA 1YR9A 2QQ0A 4A6DA 5FH9A 2EVWX 3FWEA 2XH8A 1A50B 3O9MA 2E1MB 4FLEA 4I2NA 3PJRA 5F1PA 1TW3A 1PDNC 3NAMA 2J8ZA 4B4KA 2X6XA 1E5QA 1EG7A 3IQIX 1LSUA 4IFIA 2CL5A 1YDWA 1TT5B 5BQPA 4EGCB 1J33A 3KJFA 2OM6A 4E46A 1BOAA 5CJ9A 1N5IA 1M8KA 4GZ6A 3FCSB 2LKPA 7ADHA 1KNQA 5IT5A 4FXPA 4NYMQ 4PLZA 3BWMA 2CNNA 4WINA 3FH0A 2Z43A 2X0NA 3WMFA 2GR9A 1T95A 4R1MA 1GL6A 4JBGA 4YJHB 3QLUA 4QIHA 2VLIA 2GF0A 5F9FA 4FE4A 4N41A 3S93A 1THGA 5EJ4A 1D03A 1ZEMA 4OQFA 2WJ3A 4FN4A 3E1KA 1U3GA 3N6VA 3CCCA 4GPIB 5SICE 1U2DC 1GLVA 3QNUA 2M6KA 1OPCA 2VPTA 2PJPA 2OK8A 3B78A 1SFOJ 4Z49A 4NPAA 3ZHRA 4V02A 4EABA 3FDIA 3ZH2A 3L6RA 4JCCA 3DUFA 2WM8A 3BTVA 3FE2A 4HDRA 2I4MA 4WL0A 4ID3A 1TMGE 3A0BC 3T3MB 1Z4NA 4OP1A 2DLLA 2HNKA 1KQ9A 4UEKA 4CSWA 2OHGA 4KE6A 4I7EA 4M22A 4KVZA 4D46A 1BFDA 2C0PA 3AM3A 1FQWA 2IWHA 1CUUA 1U0BB 1MN6A 4YJKA 1YL6A 1GTZA 5JFTA 4L02A 2Q7DA 2BTQA 3FPKA 2R6DA 2EYUA 1FP4A 2OAQ1 2QRNA 2X5JO 3KQHA 1E5TA 5LGTA 1N5RA 4P9NA 3ROQA 5JQGB 1P9RA 3C97A 3CHYA 3K09C 3UMRA 1GHCA 3GJXC 4DA9A 2I3DA 3WVNA 1UWLA 2VYQA 1GV0A 4AKSA 1WPKA 4CMGA 3GU3A 4UHBA 3JSXA 2X0JA 2DWOA 4JI3B 4OHUA 2FX3A 3DUFB 1SCIA 3HK2A 3BMCA 1HA8A 5IASA 2OYSA 1K7AA 4OAPA 1LB1B 3O1JC 1YRBA 5JAPA 4GFBA 1V6AA 1VRWA 3UJ3X 3N05A 1R37A 3NKLA 1FFAA 5EJ8A 4HRIA 3WGKA 3CJQA 3OQBA 1ISSA 4S1WA 4G6QA 3KQMA 2E2WA 1RLOA 3DP9A 1Z6YA 2AHRA 5JCOC 5DV9A 1NVVR 2JAXA 1Y8ZA 4EB0A 1HZJA 2Y75A 2Z4RA 2E7ZA 1ZCAA 3S8YA 1FP4B 5CLGA 1UOOA 3WL4A 3UICA 4F3CA 1ZM7A 1X1AA 2O8DA 2ZANA 4N4OB 1ADGA 3K0FB 1FEXA 2J5RA 4FDAA 5BN3A 2MYSA 2L2OA 2Z0MA 4DC0A 4IL6C 2BXYA 4IJ6A 2VLAA 4H3HB 4MGEA 2GBFA 1GUYA 3B7GA 1F1ZA 1N2CB 5F51A 1QZZA 1XTRA 2ZZMA 5E3MA 2PKRA 5H3LA 2R1TA 4KUGA 1SO8A 4W5RA 2Q6KA 3BMCB 4RSGA 4JBWA 3FLEA 1R5JA 4J3FA 3LW8A 2CWWA 1KDZA 2Y0SN 1FS4A 2YN2A 4HQMA 2PZGA 2D5BA 4HH3C 3TW7A 2G83A 4BB5A 5L6LB 3X1YA 2GN6A 2JAUA 3G49A 3EFOA 4NNOA 3O5AA 5F7XA 1KY2A 4D6PA 2AB0A 5AKLA 5ANRB 4MUNA 5EOVA 2PPLA 4WBNA 3C5VA 2ANBA 4IFTA 1M2VA 2HTFA 3QYFA 3BDIA 3IPAA 4M87A 4NCHA 1Z06A 4CR6A 3GRRA 3Q5EA 4X90A 1M8PA 1CGPA 3L04A 3WLSA 1KJJA 5LN1A 2O8DB 5EQDA 3G0GA 2DMRA 5D7BA 1VL8A 5FFXA 1CUZA 1NNEA 3AIKA 1I1GA 2EF1A 1LI5A 1P1JA 4HSTA 2OZEA 1QQTA 4XR6A 1BDIA 1O89A 5CFMA 4OH7A 2IHVA 4RS4A 2QI9F 1HE4A 2XCUA 1XAIA 3VV3A 3KLBA 3SVTA 4D9GA 3FHLA 1QGDA 4WA7A 1GZ7A 3A6HA 4R9RA 5B7GA 3CLVA 3GCDA 2DN0A 3WRVA 3I0TA 1L5RA 2AJ8A 3OQNA 4XGRA 4ENPA 4RC9A 2P90A 3LDHA 4QATA 4EY7A 4NZMA 4WBNB 1DRJA 8AT1A 1M2VB 5K3FA 1XMAA 3CINA 1KPGA 4OV6B 4P4UA 5I4CA 5KREA 2C5LA 3G71I 3WLMA 3PL8A 1V26A 1AQIA 4BX2A 1U7HA 4K9QA 3CO6C 3AEQA 4HTAA 2R0QC 1U0EA 2V1NA 2VAPA 4UM8B 3QI2A 4MARA 1I33A 2VC1A 721PA 1GPAA 4BC0A 3JRAA 2XB4A 4XB2A 3HEMA 1IN6A 1HOXA 3K6SA 4AS1A 4PX5A 1QMPA 5EEHA 3IOYA 4PG4A 1FMLA 4G7ZF 4NJEA 1D3AA 3EDPA 3DKRA 1ZC3A 2HNAA 4ZCMA 4PNHA 2NWQA 3PUXA 1A1VA 4TL7A 1Z5VA 3N2EA 3JXEA 1WKVA 3C1OA 4A8JA 1C9JA 3SZUA 4YR9A 1UH5A 1FJXA 3TRDA 1YACA 5K3FB 5AW2A 2VPLA 4D0RA 3EEQA 5ALLA 2J3QA 5M3BA 2DMQA 3VNBA 2R7MA 4O2BF 1LE8A 1M6EX 2A0KA 3PC8C 3AEQB 1A9XA 4HAVA 4DMMA 1O95A 4ZEVA 5KWJA 5KYNA 2Z6VA 4K0KB 1S9HA 1IEWA 2WHXA 2DUMA 1POXA 2OWEA 4D3XA 4INZA 4IUYA 5L95A 4ZA2A 1GUBA 5E17F 3BCAA 4GL4A 4J1TA 3H5RA 1UQRA 4OSEA 4LJZF 4ZQFA 3K6SB 2GEJA 1F8XA 4KHZA 5E6RB 3VSAA 1UPXA 3JD2A 4NJEB 3DA8A 2AZDA 4DARA 3FBTA 5LP6A 4HNHA 2D4AA 5K8VA 3T4UA 1ECPA 3TD9A 5JOQA 1VA4A 2NNYA 1UBCA 5JS6A 1U02A 2PDAA 3UGJA 4EGAA 1JW9B 3O31A 3H8SA 3F5MA 3QU9A 4KV9A 2R7UA 2Q5HA 2P2DA 1LE8B 1AD2A 1U0GA 3WLOA 3RWBA 1A9XB 2O7RA 4P4TA 2HO4A 2VPWA 4QLOA 3F2IA 1GU7A 2DK5A 5JATA 4KI0A 3WAGA 3LUJA 3QPDA 1JS1X 1XF9A 2NN3C 4LOIA 4RW0A 1L4HA 2G36A 2XZPA 3VR6D 1DX6A 4C6SA 1SVNA 2ZJ1A 1Z0SA 4DWWA 4LW8A 1RM3A 5BWBA 3RYFA 5LP6B 5JAZA 2BPOA 2R6FA 3BULA 2NO7A 2ECKA 3WICA 4XL9A 1VQ4I 1XGSA 1VDZA 3I4CA 4MJ7A 4YRIA 3KG2A 1QZ3A 1SHJA 1KORA 4MW2A 2C7GA 3AQIA 4KVAA 2OC9A 3GGGA 4TTQA 5DLDA 1IZ9A 3ESBA 3OFJA 1SQGA 4C30A 3KOOA 3L7NA 4R2HA 4X41A 3QFTA 4GLBA 4LRYA 2MABA 4QOJA 1SFUA 2FEZA 2JH9A 1UPFA 4IH4A 3KFWX 1AUQA 3QVWA 4AN0A 1MBHA 5JBQA 5D3KA 5AVKA 4H0EA 1S3SA 1TNDA 3D1LA 2ZT5A 4X3CA 4MQ5A 1JHDA 4A5MA 1A8HA 1DU0A 3KNZA 3OYHA 2Y67A 4OQNA 4A5OA 1MPXA 5A5VA 3RYFB 5EHNA 4EF4A 2YV5A 2OG1A 1IIBA 3ETCA 4PQYA 1P7ZA 3AIIA 4OXNA 5EFOA 5ENZA 1P2BA 1Y4SA 1U99A 3VH3A 3ZVRA 2WWVD 1BA5A 1VCIA 2VPIA 3BDDA 2C4NA 3RV4A 1UFMA 3TTYA 4MI9A 5EJCA 4FN5A 2QRZA 5BPFA 2C1ZA 1EIWA 2X19A 3MT0A 8LDHA 2BH9A 5JDCC 1QJ4A 4LGYA 4KRGA 4I55B 4UXJA 4CM8A 2EFYA 3CT4A 3A4NA 3E8SA 1BCSA 2W6MA 5A6SA 4RZHA 3AVWA 1EZ1A 2ERYA 2GRAA 1PQ4A 3N8KA 2RGUA 2GZWA 2F67A 1EV7A 3CUVA 2I76A 2O61A 2PLYA 4ZDWA 5K51A 3O90A 3DE4X 2FMKA 4F1KA 2ORWA 3GROA 3MFKA 2R7ZJ 3R6DA 5F27A 4UEOA 1ODIA 4YHHB 4GKJB 1DKLA 3T15A 1Y9JA 3WAKA 3N2GA 4MQ6A 1TQIA 3D0QA 4HDMA 3DWIA 1FFXA 3I4LA 4GP6A 2MLKA 1R1VA 1YA8A 2F1HA 1ID8A 2JRLA 3CUSA 5H16A 2G7MC 3ZGNA 1XTIA 2Q2EA 2B83A 2EIKH 1U8TA 2OQ2A 3HSSA 3MLBA 1SAXA 3QEJA 4YYZA 3NEPX 2K02A 3QVGA 5BWOA 4WN9B 1JR2A 1BMFD 4URZR 1BI1A 1KHTA 1Q3HA 2GEUA 3NT4A 2FQ3A 3EPPA 4CM8B 1KK0A 5GM1A 4U1RA 4DGWB 4W63A 2FSVC 3D6VA 5A6SB 1ID1A 3JAMZ 1BS9A 3NYRA 1EUQA 4CHUA 3SSAA 2C4HA 1UJNA 4F7WA 4OAOA 2HA7A 1HNNA 5H83A 3SMQA 3H0GJ 2K9MA 1NXOA 2JGKA 2LUOA 1FMFA 4WAUA 2I2WA 2I10A 2FG6C 2AFIA 1EH6A 3N2GB 1FFXB 4W4TA 1QB7A 1GCIA 1D1PA 2YBEA 3GYGA 3K2EA 2Q2EB 3GFBA 1QIIA 2BDTA 1SVWA 2JJ7A 2VZ0A 2UUZA 2AJLI 2DPGA 4DSAA 1ZMOA 4ZJZA 1A82A 4J4TA 5HMMA 2V7UA 1XSXA 1FBTA 2F1IA 1L7DA 3HCNA 4HGZA 3HJRA 4UY8I 2ZB7A 5EXPA 2JFHA 4NMWA 4DCJA 3Q40A 2QU7A 2W6JD 1ZU5A 1XZGA 4BTLA 3ED1A 1ZSYA 4UFOA 1GGJA 3RI3A 3GLIA 3VR4H 4MV3A 2OO7A 2COMA 3KP6A 3QYBA 3I2JA 4QUBA 3WHLA 1VOTA 2AFIB 5E8IA 1JECA 4L8VA 4B84A 1DV2A 3FY4A 4JJ4A 1SFRA 4UVEA 2IHBA 1RC0A 4HEA2 1U8YA 1MNDA 3DLCA 2ZO4A 4FVTA 2M32A 3FUUA 3GJQA 1YF3A 3A1WA 3B6AA 3Q8MA 1FZTA 1NQWA 3KKMA 4S2EA 2GZ3A 3CUOA 2WRZA 3C8HA 4DR7B 4EG8A 3ETLA 4Z0HO 1G3SA 4V0LA 4LYYA 4GDFA 1BVYF 1NG1A 5JYDA 5LEKA 1K6OA 4A36A 2Q5IA 2R8YA 2MR6A 3WQBA 2EV6A 2WA1A 2GBPA 1SIBE 2F2TA 2ZKLA 4C22A 5J5CA 3KV1A 2UU9B 1TAQA 2GYYA 2RSLA 1RKWA 4I14A 3BMXA 2HSZA 1SUAA 4ZICA 3S28A 3OQVA 3M6FA 3A1FA 3PQKA 3DW1X 1H6BA 3TAUA 4DCTA 4XMYA 1Y82A 4B7UA 4I19A 5AHOA 5IOYA 3DEHA 1ZNQO 4R2WA 2JIZA 2IZ1A 4LY9A 1EM8A 3E9YA 3NASA 3QG1A 1J8QA 2PMKA 3V7WA 1YNSA 1LU9A 5ICMA 3TW8B 3FF5A 1KQ8A 1J97A 4KQ9A 3D5EA 4JBXA 1LDBA 3UYLA 4EHKA 4BFSA 4MUFA 1IG3A 4RYDA 2XGSA 1MOPA 3CSUA 1DRKA 4TV7A 3UWDA 1XHEA 3IILA 2JJ2A 2IF0A 1E77A 3QXXA 1S5LC 2NYXA 4OKNA 2ZIVB 4A3SA 1DJQA 4XM1A 3HKDA 5B1BH 5HM8A 3EAFA 3F96A 4DABA 4OVKA 2GO7A 3K6JA 2GAAA 1A9PA 2NZXA 1P17A 2WF9A 1QVWA 5JSHA 3INRA 2WJHA 4O33A 2QKLB 4EPVA 1PP7U 4OINF 3I6QA 2YZNA 2R79A 3T06B 1JBEA 1QF9A 3ZGLA 3OE5A 3O4JA 4HGPA 3F5DA 3FM5A 1SCNE 1YFZA 4DJAA 3K53A 1I3LA 3GLHA 3U4QA 5A5EA 2PG3A 4DA0A 1AO3A 1S3FA 1QG4A 1OWMA 4BDZA 3NYQA 1A27A 1D0IA 3UY4A 3PC2A 3GB9A 3FK7A 4GH5A 2FX5A 3OV8A 2OGSA 2DOEA 1NLMA 3RAPR 5BUCA 3LC7O 1QIMA 5JEDA 3HN6A 2D0IA 2Z99A 2QA5A 1OR7C 4E3ZA 2OD5A 5ELMA 1MO3A 4ROSA 2IZ7A 1WY5A 1G55A 4LISA 3AMVA 1DB3A 1C0WA 3NIDB 5G0WA 1FFWA 3ICPA 3S32A 2VDQB 3HKDB 4FZ5A 4QEZA 1UBSB 2OL4A 3EFEA 1TCAA 1U9ZA 1LKZA 1ETWA 4OQPA 3UOGA 2JGMA 1C0IA 3CCJI 1P0QA 4Z5XA 1OXMA 2IVZA 3UPUA 3C3CA 5EE5B 2OO5C 1QIDA 2BI8A 4NU5A 3LWDA 1BCRB 3A0UA 5B7PA 3HR8A 4UM5A 1P7YA 1HKSA 1NRIA 1P9OA 2GHTA 2W2KB 3IURA 4YRSA 2Y0DA 3ROXA 1Z6RA 3N4MA 4DR4B 4EJTA 4OI4A 3EGDB 1EFRD 3ZEAA 1FK8A 4ZIRA 2BOLA 4LIPD 5HZGA 3DTIA 3TK1A 3C3MA 4XYLA 6ABPA 2YY5A 4V0RA 4DLZA 4ECAA 4RMJA 1UXGA 4LCBA 4I1UA 2CW7A 3NRVA 2AUNA 5EUMA 3BJIC 1D5WA 2QA4I 4ZCPA 5IRCD 3QQAA 4W5QA 3C3PA 1U8RA 1R27A 3VYSB 5IXSA 2OCLA 4N9QA 2D7JA 3IRRA 1TOAA 1UBUS 5HRUA 1KQ3A 4YS6A 3LY8A 1YVDA 1Z6AA 4L9JA 1PT8A 4EA9A 2ZBKA 3KIOA 3S2UA 1CRZA 5BN4B 3AUAA 1Z12A 3SE0A 3N8GA 3NBQA 1O6GA 2WMDA 3OTWA 5EZGA 2OLEA 4FNAA 4Q1DA 3ZW7A 1YQDA 5AQ1A 3FIJA 2MSCB 1N0WA 2J59A 4BMVA 1UBJS 1G5HA 1Q0SA 2X0RA 4ZIRB 2JIPA 5F0FA 4OKIA 1IHYA 5E1WA 2VUSA 3NWOA 3N7AA 5CB0A 2ZOSA 5K6TA 5GAGJ 4PO1A 3GGDA 3CNEA 3N2LA 4MFEA 4Q3DA 4HX4A 2XYPA 3HUDA 4QDTA 5KB3A 1EWKA 3UQYS 4MQ9F 1M7HA 2OSVA 4MZXA 4MYSA 2XLCA 2DBBA 1M6VB 2R8PA 4ETNA 4LGVA 4A3JJ 4S24A 4F84A 1PT9A 2Z1MA 1PJQA 4R51A 1G3UA 4IL5A 2M4KA 3FYSA 3BSSA 5F64A 4D3SA 1P1RA 5CDYA 3GO4A 4E15A 5CD1A 1QP4A 2IXBA 3NARA 1LDDA 3R0AA 2NU7B 3GAFA 5F3WB 3OE7A 3WLQA 2DHDA 3RB8A 1WJ5A 4LHWA 1F7VA 2GDJA 1E2IA 4FEAA 3U0BA 3ZLTA 3AILA 4YYEA 3EY9A 3GY0A 2BE9A 2QMOA 4ON0A 1QE0A 3TDKA 1NM5C 3N53A 1RJDA 1B6TA 3PR3A 4EZEA 1JIUA 2X7HA 3HQ4O 3KJNA 4BEHB 2HDHA 2FUNB 2DCUA 4CI9A 4ZI5A 4RVNA 3KE8A 3K9HA 2BP7A 1ZXLA 5THKA 4PXSA 2O3SA 1OVMA 1IATA 2XDWA 3WK5A 1NXPA 4UCXA 1EGQA 4CQLA 1XTTA 2PXHA 3TZCA 5HODA 2X0DA 5SY9A 3ZKWB 3M9AA 4G1BA 4ER5A 1UJ8A 2ZK7A 5EJAA 2H1WA 1IUNA 4HSGA 1ZIOA 2XF8A 1LLUA 4DCUA 2EZ4A 3UAVA 5DBGA 4YT8A 4KPYA 4HV4A 4HC4A 3IE1A 2R4QA 4ND2A 1E4YA 4WKBA 3M6AA 4Q7KA 4U9UA 5JO0A 2QE6A 3R9KA 3LECA 2K3FA 4X95A 1U1IA 5C1DA 2WVAA 4B3AA 4RKEA 4ID9A 5ALGA 3IMCA 5JCJA 5AW0A 3TIVA 5G1PA 3WKEA 4HY3A 1U1GA 3E9NA 1Q7GA 4IR7A 3K9NA 4HF0A 4URUR 4PICA 2BP7B 4E30A 2X4HA 2QRHA 3H3FA 2JKVA 4QECA 4MUYA 2JIOA 4G8BA 4FEYA 1T0HB 2M0CA 1Z3XA 3DSRA 2BYVE 1LD3A 2ZW9A 4HFRA 3VZCA 4CQLB 3B7WA 1XA3A 2WFLB 1SC9A 1CQWA 2VO1A 2Q0OA 4LKRA 1BDMA 3IX7A 1LA2A 1C1XB 5HF6A 3O03A 1Y63A 2FF7A 4DBLE 2QRKA 5JVDA 4TQUS 1Q77A 1RM0A 2O9JA 4FYWA 3A70A 1U3VA 3ORYA 1ZP6A 2FMIA 2VDVE 3DMGA 4K03A 3HZZA 3V4LA 4KK3A 3N70A 3GZNA 3FSJX 2IS2A 2GHQA 3REQA 1ZJ4A 2PUVA 3LBYA 4UBOA 4GEGA 2C2XA 1OBVA 3ZE7A 3NWJA 3PG5A 2E2HJ 5TPZA 5FHQA 4N0MA 3M8KA 1BRMA 4C87A 3QLTA 3R76A 1KGDA 5FEMA 3VU1A 1WBDA 3BB4A 3GJ8A 1XA4A 2HYDA 3GEIA 2FPPA 4WJZA 3QVMA 4NJOA 1RRJA 1NF3A 3K8ZA 4JKYA 3W3AH 1CY8A 2DGDA 4LXYA 3FM3A 4Q48A 2H65A 4JC0A 4RANA 5BMOA 4DMRA 4CQMD 2Y1FA 4LPKA 1VIAA 1N6LA 1A5SB 2PIDA 4CKCA 2XZDA 1W4MA 2D1FA 1ZELA 3JQRA 4Q7LA 3C70A 2ORVA 1PZGA 5K8CA 2PI0A 3ST7A 3IH2A 1P77A 3ZDXB 1N9GA 4WFIA 1SQSA 1PW7A 1W5BA 1Z5NA 3IODA 3QYPA 1ZRDA 2HM7A 1A72A 3DZIA 1P0MA 3GZNB 2PMWB 3KWLA 3E1GA 5M3FJ 4MVJI 3REQB 3VPSA 2WBLC 4EYEA 1RJFA 4UMVA 3RHSA 4BY7J 3HVHA 2BFCB 1F0YA 2WHPA 5KC8A 1ZJZA 1XTAA 2EFDB 2QTCA 2AC7A 1OXSC 2VF8A 2BHZA 2FJ1A 2A7QA 4QPJC 1P61B 3F6BX 3SF0A 3I1YA 2OA4A 1HKQA 2PFKA 4UCQA 5D4SA 1ZM3A 1T5LA 1DFHA 4AY2A 1FUEA 3VR0A 5DHSA 4FB5A 2NSYA 2ZU0C 3BFKA 3I5XA 6PFKA 1DTSA 1IZ0A 2J6BA 5ENVA 3ID6C 4EPYA 5G0UA 4CKCB 4XR9A 3GARA 1VLQA 1RWBA 2Q3JA 1T0FC 5DX1A 2A94A 2PYZA 2AZ4A 1EFHA 2NT4A 1N9GB 2G04A 2JVKA 5G4LA 3L8CA 2PFSA 3EQLF 2FBIA 2QP3A 3KZMA 4QWWA 2V26A 1P2TA 3JZIA 2BFEA 1P4HA 2C2KA 2I0FA 5BPHA 3Q41A 3LSMA 4AYWA 5IDQA 2FYTA 3DEEA 3OFNA 1SCUA 3G1TA 3Q10A 3PI6A 1ZQ3P 4G2TA 4NMHA 5GV8A 2XCLA 2ID8A 4QUIA 2M87A 5BYAA 5CFPA 3SU8A 3W6UA 2WHPB 1JIKA 4QBFA 1BMQA 4U6NA 2KMLA 5M2QA 3TD6A 4XORA 4PO9A 1CQJB 3HB1A 2I54A 3QIAA 3PHHA 5DNEA 2J5QA 3C6KA 5CXSA 3IQHX 3R2JA 2XQVA 1T38A 1BN6A 1P73A 3TP0A 4CTNA 2VOEA 3SSNA 1P0PA 3AESA 4WBSA 4WNIA 1IY1A 3WLTA 3ZUGA 2ZVDA 1I0ZA 3P27A 4PGFA 3UT5A 5EUBA 1PGPA 3MEQA 2ME6A 2EZKA 1V4VA 2BFEB 5KOHA 4YIFA 1MEEA 2PH3A 2CB0A 4IG4A 5FT9A 2B9SA 1U9YA 2EK5A 2VFAA 1MAUA 4OOIA 1B2RA 5H5JA 2F2EA 3M7IA 3N87A 3RS2A 1JU9A 4QJ4A 1W59A 4E03A 2RHMA 5TLSA 4HDNB 1YXMA 1Q2UA 5LVAA 1GZUA 4OFXA 4OYRA 2Q5LA 2VHYA 3RYIA 1WEHA 3NHKA 1QGZA 3K0BA 3VM6A 3KZZA 1VI0A 3EXHB 5F12A 4AO6A 4B2LA 3QU7A 1Y3AA 2W90A 3M1YA 2VAXA 2I67A 3MTIA 5IWAB 4G36A 4NDAA 2G76A 3MJDA 5FO0A 3WLRA 3T4XA 1ZOSA 3KZIC 4KX5A 2Q4EA 5EPEA 2QPOA 3NKFA 3NR2A 4BH9A 2FEPA 3UT5B 1KY5A 1TGYA 3WLFA 1PR1A 3A1DA 5KOHB 4EJ0A 5ERGB 2RH4A 1X7GA 1D2AA 4L50A 3I8XA 4AB1A 1F2VA 2GTHA 1SZDA 2DTXA 3MILA 2HOTA 1WF3A 3JSPA 3OIDA 1FNCA 3RFVA 1RWWA 4EKEA 2AKYA 2Y48A 4MCAA 2YVKA 3RYIB 4ND5A 2E89A 5LZ8A 3QEBZ 1HL7A 5ALRA 2HSDA 4K8RB 4BO4A 2GN1A 3LIIA 1LRKA 2VBZA 2PBZA 2A14A 4LF6B 3JQDA 1R9JA 4O59O 1WKMA 5IH3A 2FWMX 4JYPA 3HFJA 2RG1A 3DKVA 3E5MA 1FS5A 3ZBQA 1LQUA 3CF5F 3G9TA 3H3XA 3NV9A 1UC5B 1EFPA 4LJ7A 2VQHA 5KKAA 2ISYA 4XKBA 1R5NA 2HQ1A 2LR8A 3WIEA 1UFRA 3R1IA 3I09A 4LFAB 4CHGA 2OQVA 8OHMA 2HXOA 1YE9A 2DBQA 5KYTA 1IPHA 1V5FA 3CG0A 3KETA 5SY6A 5KKNB 2MA3A 4RA2A 3GTJJ 1JJ8C 5TY0A 1NYTA 1JYEA 5JNSA 2VK2A 3RUHA 1TLHB 4Z9AA 4KFUA 2AYZA 3MT8A 1NU8A 2Z09A 4Z3OA 2PH5A 4Q1FA 3CNOA 2CVZA 2O06A 4MEBA 4DMLA 2ZWOA 2BM1A 2DF8A 3QKRA 2B4YA 3NP7A 4A6PA 2EHDA 2IKQA 5KNCA 3K35A 2P40A 2VJAA 5DBIA 1I6XA 3A26A 3H17A 3PLAE 5A3VA 3CVUA 3N59A 3BSWA 3JRXA 3GMDA 5AHKA 1EFPB 4QU8A 3WXMA 5F3DA 3W6PA 3OYCA 4S12A 1WDMA 4ER3A 1U3DA 5IXJA 1RU3A 1PQPA 2GD6A 3U7QA 4LK3A 2HMWA 3TSAA 3PDJA 1G5RA 4Y9RA 2J9FB 3OLQA 4ALNA 4EA7A 1G17A 4XGKA 1D0ZA 3GAMA 3ZJVA 4ETMA 4QLBA 2AZXA 1O94A 1KEZA 1J99A 1MZBA 3F7NA 1N4DA 2H1KA 4P9FA 4P5EA 3U62A 5I7UA 4YCJA 3P4XA 3HA7A 4X63A 4EJUA 2YTZA 3IAM6 1R8JA 2P78A 1KU9A 1KI4A 1UXKA 2Q6OA 1TTYA 3GL9A 1JQ5A 4JV5B 1FFSA 3LLSA 4K46A 2CSUA 1QDLB 3ZQ6A 1FTSA 3ZD6A 2WADA 5ELLA 4XIJA 4ZZ2A 2B7LA 2F1JA 3UPDA 4EM2A 2IEAA 1LDMA 3I01M 3RVKA 5BSKA 4LGCA 3JQAB 4LGMA 3NPAA 1OTYA 4KLNA 2W6NA 2OKGA 2OHJA 4GEKA 2TRSB 1OX5A 3P4YA 3PXDA 3WGHA 4BZXA 2KB0A 3OZTA 3VHRA 4DZZA 3HDDA 5CPBA 2WU0A 3CLUD 2GERA 1IAVA 1WXWA 1FL9A 5C1OA 3I6ZA 4N47A 4FJ1A 4CFSA 1TKBA 2VP0A 4UUSB 1I5ZA 2VJOA 1JDNA 1ZL2A 4GOMD 2XNHA 1CY0A 3AR3A 3KXPA 2PANA 5JRDS 3SCZA 5CVVA 4CUJA 3QXJA 1TJPB 2ZJQF 2VHUA 2B6HA 3RARA 1SBZA 4LC1A 4YEJA 1XDWA 4PIVA 4X8HA 2EOAA 5K6AC 4E2WA 2C4KA 4UU0A 1CJBA 1X0VA 4N1AA 1WOMA 3P2MA 1QIJA 2AD5A 1QLHA 4BYYA 3CQZJ 1W48A 1D0XA 2AN5A 2Z58A 3GJ6A 2GOMA 4YFVA 4A0YA 2W57A 1Y5NA 4FEGA 3DTVA 5ICEA 1NVWQ 4FETA 2PY6A 3JD3A 3RKYA 1Z8NA 1CQIA 4NFYA 4CIWA 1V11A 3QWAA 3ETNA 4ABZA 3WYFA 2VJKA 4HXEB 4R1LA 5DYWA 1WR8A 3LHFA 5LQRA 1UPBA 1AUPA 4XIIA 4YASA 2J3MA 1SD5A 3V1NA 4MIKA 4Q3NA 5ITWA 4YRCA 5M5XJ 4YIIA 4PLFA 1IV8A 1JTEA 3QP9A 1UK7A 3LQRA 4QL3A 2Q5FA 4YUAA 4TTJA 3V6MA <