1SD5A

Crystal structure of rv1626
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
PRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative antiterminator
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd5A01
4CGZA 5FWYB 1UDRA 2BYVE 3J7AO 4ESJA 1O3SA 3GBVA 1BI1A 4ETIA 1SXIA 2O03A 4D0PA 2MBFA 4EJWA 2KIUA 3CFYA 2AYZA 3HV2A 3KTOA 5FFZA 1NTRA 3FHZA 2IA1A 5CNMA 5T3YA 3GYHX 2R47A 2FXAA 4OIQF 1D1PA 5JNUA 4IMJB 2HGCA 1IN4A 1JHFA 1IRFA 3C3MA 2QZJA 1JHZA 2UWMA 2ZFWA 4AIJA 3HHHA 2GXBA 1YYVA 2FXIA 2M1ZA 2FE3A 5KQPA 5TPZA 3FZVA 2DK5A 4XXHA 3HXMA 3RVSA 3RVJA 1Z6RA 4IMIB 2WB4A 2M30A 3I45A 3HSEA 1O7LA 2PUCA 1D5VA 3O21A 3QK7A 4JASB 1LB2A 3OLVA 1R1UA 1WKMA 1ON1A 1R7JA 4W5QA 3UUGA 4G6QA 1Z17A 3I0TA 3MZHA 2IJLA 2IA0A 1P92A 1E6KA 4U88A 1GCAA 1AB6A 4XSXF 1YIOA 5IBQA 3LUFA 1J7KA 1PDNC 3ILHA 4ZZLA 1Z6TA 1BC7C 1W25A 4XAQA 1YS7A 4KICA 1F1ZA 1OXBB 4JP1A 3M7GA 1ZRDA 3E6DA 2WV0A 2AXLA 4BAYA 1AB5A 3HZHA 2RVCA 2COMA 5BRJA 4H3KB 4LRQA 2YPRA 1W7PB 4I98B 2DLLA 4RKRA 3SG0A 4IGAA 1RZ4A 4KK4A 2FLKA 2D2WA 3GYBA 2KJCA 1DPUA 3QLVC 5FLXZ 2QQ9A 5BS6A 4G0XA 1BIAA 3CUQA 2XKPA 1DC8A 4EY3A 1HW5A 1TNSA 1RUNA 4YGXB 4OG2A 1PUEE 1LJUA 4ZYLA 3M9AA 5FWXA 4YRZA 4Z0NA 3LSTA 1J9IA 1ZRCA 1U8TA 4CBVA 3HOTA 1D1QA 3TKYA 2ZMEA 3IKTA 1U2PA 5C5CA 2ISYA 3PQJA 2DRIA 1WRJA 1USSA 2QENA 3HK2A 8ABPA 3CG4A 1D2AA 1K79A 3I71A 2H3HA 1APBA 1OYYA 5DGCA 3ROUA 4EJVA 2OBPA 4LZLA 2HPHA 2LBPA 1WWXA 3QX8A 3H3UA 4K2EA 3MWMA 5DCLA 2Q8KA 1KMIY 4G97A 1LEAA 2W25A 3QPTA 2LKPA 4MQVA 4RK6A 5FO5A 4CICA 5LGUA 5FGMA 2PUGA 2W24A 1FSHA 4IXAA 1R8JA 1USTA 4AWXB 2VBWA 2PUDA 1U6GA 3H3ZA 3FFXA 1MB0A 3GFIA 4UXNA 2VE8A 4OIPF 1B59A 4ETMA 4ZYHA 4MTDA 3HM9A 4S04A 5JFRA 1QQAA 4MR8A 3FMRA 4AIKA 3F8CA 3BJAA 4MYRA 1XN7A 3EYYA 4LDZA 3HUUA 3V7CA 1FBQA 2GXGA 3SM9A 2MC3A 3KHTA 2FBKA 2HWVA 3ABUA 2GWRA 4WT7A 1FC3A 2WWYA 3N0WA 3RIRA 4TLLB 2PUAA 3TDUC 1HXDA 4CHUA 1NY5A 4ETSA 1Y1LA 2FTKE 2V0NA 3NNDA 4RS3A 2PUEA 5E17F 3I42A 2NAZA 2Y0MA 4JA2A 1STZA 4UV8A 4N0BA 4YV7A 3LA7A 5IULC 5E1XA 3A0RB 5T7BA 4M73A 3EETA 4LLGF 4UUVA 4U0WA 3DKWA 2FOKA 2QUFA 4MGRA 3KS9A 4BHBA 2K7LA 4OLBA 2VYCA 3HSYA 2HDCA 3MFKA 2STTA 2M98A 2C6YA 1LDJA 2IPQX 2Z9OA 1DRKA 4NQRA 3J80Z 1I1SA 1IW7F 3FM3A 1M2FA 2QBYA 3NBMA 1A0OA 1FWZA 1BOAA 3F6PA 4A5NA 4MEXF 2ZWMA 2F8TA 5L3FA 2LDUA 4OTZA 3N97A 2GA1A 4A6EA 2CGPA 5FD5A 4MR7A 1VRVA 3COAC 5HQJA 1NXSA 3M9WA 3LAJA 5HDGA 1EWVA 5D4RA 2A07F 1GLGA 4Q6BA 2ELHA 5TJJA 1FLIA 2QVOA 3RVPA 2PUBA 1S7AA 3D8UA 5TPWA 2A6HF 5KQGA 4KPYA 2QU7A 3BY6A 2HOEA 3DXJF 1XHFA 4RWEA 3GT7A 2QVGA 4UVBA 3LUGA 5HSGA 3GV0A 1R00A 1KU3A 1IN7A 3KE2A 5IUJC 1UCRA 1B1BA 3CLOA 3R4KA 2G9WA 3OV8A 1SD7A 3SY8A 1GXPA 4NB5A 3MQ0A 3W6KB 1A2OA 2VUHB 3GXOA 5ICCA 1ZDMA 2NUBA 3TD9A 1IXSB 3MZYA 2O61A 4JB0A 1U0SY 4HLYA 2VUIB 1SMYF 7ABPA 3KP2A 1D8JA 1MJBA 3G1WA 4L18B 1TQIA 2E4UA 2EA2A 1E6LA 3LWFA 3QLTA 2HQBA 3OLYA 2L17A 3WTVC 2IPNA 2D45A 3T38A 3EODA 5CLSA 1DRJA 2BGGA 2GI4A 4B09A 1QQBA 4TN5A 1Z25A 4RK0A 1QQIA 4MS3A 1CF7A 3QEKA 3UK0A 2FEPA 4XFKA 5ERIA 5HS8A 3CZCA 4RB0A 5JR3A 1O57A 3ULQB 5ICGA 4F12A 3HJFA 5EEGA 3FGZA 1KA8A 1ZY2A 4N0QA 3LMKA 1MJAA 2W85A 1PNTA 4RSMA 2P5KA 3E97A 2E1NA 4G6DA 1B9NA 4RK7A 3U9GA 1GVJA 3QELA 1C0EA 3F8BA 2Q0OA 1CGPA 1ZHHA 1KQ0A 4WWHA 1O3RA 3B73A 3OMXA 2VT2A 2V1DA 4KIGA 3KETA 3L9FA 2ADUA 2FU4A 1E6MA 3RVRA 4AVPA 2FLWA 4W5NA 3AAFA 2BGCA 2UXXA 3DGEC 2PEXA 5EWJB 3C1DA 2NT3A 3C3WA 5LBQA 1MDMB 2I6FA 4O6JA 3R0JA 3QAHA 5HM6A 5TPZD 1G6NA 1HW2A 1ZYRF 2L4MA 4EV0A 1EWTA 1PNRA 3N0RA 1J59A 3CDHA 3KEOA 4L4UA 4YO7A 1E2BA 3L49A 4EYKA 1QPMA 1TLHB 4ENNA 4FX0A 2VBXA 3WTZA 1XGMA 3R61A 1LEBA 3BRSA 4I7HA 3PQKA 3FX3A 1A04A 1JDPA 3T5XA 3L09A 4WXDA 3E6CC 4B8XA 4KN7X 4MLDA 4MTEA 1BIBA 4RAYA 4EGYA 4EVSA 4IRIA 3SFZA 2P6SA 2NZUG 2HYGD 1M5TA 3EQZA 4L9JA 2MYNA 3C18A 1JFVA 3D02A 2H6BA 4MRMB 3OMWA 1JE8A 2DPDA 3J80K 3WE3A 2Q2EA 2E4XA 3Q7RA 5DCMB 5BPDA 4L85A 4BXUA 2RGVA 2HQOA 1AOYA 2E4YA 4YWHA 3FM5A 4YS6A 1JL3A 2JBAA 3K1MA 4W5RA 3R60A 4G0PA 1Z16A 4IVNA 4PEVA 2QZ8A 2RN7A 1TLFA 3VFZA 4GCVA 5C5EA 4UHTA 5CVIA 5F64A 3A0UA 4ETNA 4W5TA 2DU9A 3ISPA 3N0XA 1YW7A 4A5MA 1Z13A 4KQCA 2IPMA 3FFTA 3I58A 1XGNA 4HOBA 1DDNA 2IPAB 3QEMA 3FDFA 2K27A 4EJTA 3IP9A 1BDJA 2PAFA 3G85A 5IEBA 5FB2A 3QP5A 1B6AA 2DAOA 2F5DA 2OU2A 4E7OA 2RDPA 1L5YA 2PI0A 4U0YA 1YVUA 4EMSA 4WUTA 1KU9A 4MR9B 3ROFA 3D5LA 5DDGA 1MJ9A 2JRLA 4KMUX 3OM0A 4FHTA 4ZPJA 5EWLA 1EAYA 5L3BA 3TGNA 3KYIB 1KGSA 4LE1A 2H09A 5K1YA 4HV6A 4ASNA 4LK1F 1TNTA 5TQ2A 1H9GA 1Z12A 4WZZA 1R1VA 4L5IA 1ZARA 2A9OA 1U04A 5L3DA 4G8XA 3WE2A 1MB3A 2FKAA 3TB6A 2FSPA 1RZRA 3BDDA 3K2ZA 1K68A 2STWA 4L9TA 4I01A 2FEKA 1YTUA 2KRFA 2DBBA 4ON0A 3RVMA 3QU6A 2E4VA 4H60A 2F8SA 3N53A 4N0PA 1L3LA 3HRMA 3KP7A 4U7BA 3RPUA 1PEYA 4QYMA 3T95A 4GYGA 3WGHA 3N4MA 3HIFA 2RGYA 1VLZA 1T6SA 5F1RA 4NV3A 1JDNA 2PLYA 1SMTA 2ZO4A 4YFKF 1JYEA 5DYMA 1Z2DA 3F6CA 1QNTA 2D1HA 5D5WB 3KZZA 5IX8A 1SFUA 4RXUA 5TQ0A 1G3SA 1ZVVA 3WU1B 2YHAA 2VK2A 3K69A 3HTUA 3IP5A 2Y48A 5D4SA 5JNVA 3B2NA 3GLXA 2ZNYA 1V4RA 3T1BA 1R1TA 3DPLC 4LLLA 3GX4X 5JVTA 5JI6A 4U7DA 4O1IA 3EUHA 2MYTA 4I02A 4OINF 1TTYA 2Z99A 3SXYA 2N9UA 1U2QA 4S05A 4PGHA 4RGUA 1XSDA 2KIMA 4HX7A 2ACJA 3BJ6A 5L3EA 3HCWA 2PQ8A 3QLVA 2P4WA 4MAAA 4RK1A 4A0ZA 4MS1B 1KYZA 3JVDA 2FA5A 4EJOA 6ABPA 1YK1A 5KC9A 4W5OA 4F3TA 3WTWC 2CQKA 5PNTA 1QZYA 2YX7A 2FQWA 4E70A 3ROTA 1IUYA 1USIA 3GF2A 5LEJA 4ZH4F 3ECOA 3I59B 4IJAA 1I27A 1D8KA 2FVYA 3QOPA 1Z18A 2E7XA 2G7UA 2IVMA 2JPCA 3R6SA 3E5XA 1V3FA 5JS1A 2PUFA 3ZMSA 1SFXA 3F23A 1FBSA 3BPXA 4LD5A 2GBPA 3K0LA 2HSGA 1UHWA 3IP6A 1TQMA 3GW2A 3LKBA 2R7FA 5DCFA 1LDKB 2GA2A 2AS5F 2P4UA 3FXQA 2E1CA 2IKSA 4FB4A 3OQOA 1ZGZA 4P96A 4D6YA 3HYIA 5TQ0B 4HX8A 3H5TA 1ZLJA 2FSWA 2HS5A 1XSVA 4D74A 3GUDA 2WRZA 1FNNA 1KQ9A 4P55A 1K66A 5BQ3A 2K4BA 4JB2A 2P9HA 3K9CA 3P9KA 1VTNC 1YMUA 1GXQA 3FWEA 3MA0A 4XASA 4G0OA 1JBEA 2L54A 1IRGA 2L01A 1ZH2A 5E1WA 3F21A 1LNWA 4CZZA 2ZCWA 5E8IA 2FW0A 2XAGA 3J81K 2WMYA 4Z99A 5DD4A 5HOOA 3KP4A 1JX6A 5CVJA 2ETHA 1CYEA 3KSMA 4EM2A 4L9NA 3IRQA 4A0YA 2FQXA 3P9YA 5ED4A 2GIVA 3L2CA 4RY0A 3LA2A 1SD6A 4A0XA 4N47A 2H94A 4WK8F 1HEYA 2TMYA 1MVOA 5DEQA 1E17A 1E2XA 4D6XA 4JQFA 1S8NA 3PFIA 3RQIA 1P8AA 3H5IA 1P6UA 3O2PE 1BDIA 2B4AA 1OR7A 1ABFA 2XVCA 1TBXA 1G3WA 1XDUA 2GQQA 1S6LA 1DP7P 3IKVA 1ZG1A 1Z1DA 3F6VA 1FY7A 2J5OA 5E20A 4L5JA 2Z5UA 3Q9VA 3RDIA 3ZP5A 2P5VA 3A10A 4UHKA 4H3HB 2EV0A 1XSXA 2UXNA 3GZ6A 3CUQB 3LUDA 5HLHA 3BPVA 3FXUA 4IRGA 5AIPA 2IDMA 4G0ZA 4MQEA 4N9IA 1BBYA 1JHHA 4CYDA 1NXOA 3ELKA 4Q5SF 1BDHA 1PHRA 2CHEA 5FWXB 4ZJPA 3ERED 3CU5A 3DP7A 5D8LB 3KCCA 4HNRA 3TOBA 3LAPA 2ZMEB 1GUBA 1W9HA 2PL1A 3O2JA 3LUJA 1JGSA 1OYIA 3BILA 2R4QA 4R1HA 4LK0F 1YO5C 5D5XB 4ZMSA 5DUIA 3Q7TA 3OQMA 3M8FA 1EHCA 5KVRA 2IRFG 3E5QA 4CDGA 1DJMA 1G3TA 4FT8A 3RVNA 3EQLF 1F4VA 2X7XA 1T2KA 2P7VB 1F51E 3T6KA 1ZRFA 3BP8A 1P2FA 4N9HA 3MQ4A 4RB2C 1D5WA 4M74A 2L19A 4MLCA 4Y13A 4PICA 2ISZA 3LFKA 3BRQA 3DLBA 2E7WA 1ZG3A 1MAVA 1VKRA 5CYVA 4OMZA 2VOPA 4F06A 4EM1A 2OAZA 5E3JA 1UB9A 5JNTA 3G73A 4WWCA 3BROA 3HS3A 1KU7A 4EYQA 5E1ZB 4MR8B 2VODA 4IPAA 3CTPA 2CD7A 4ESFA 5K5OA 1USKA 4KRFA 4OLAA 3V7SA 1T38A 2JZYA 2QSJA 4KZKA 4HBLA 1HSTA 1BA2A 2FBIA 4OU0A 2ID9A 5ILUA 2R3SA 3QLUA 1RZRD 2O8XA 2EK5A 2BV6A 1ZGAA 3Q7SA 4Y15A 3HSRA 3EYIA 2B1JA 2MSWA 3KEQA 5EWMA 2LF7A 4DADA 3JPYA 2W57A 5FFXA 5GQSA 2ZJ2A 1I6XA 2LSOA 3CO6C 4EVRA 2BBYA 2FMLA 3MF4A 3UKJA 2YHBA 3MAJA 1H9CA 5ABPA 2GAUA 4H0EA 2ZXJA 3TX6A 5KI6A 2A6EF 3H1FA 2VBYA 2R48A 3QLUC 1Y0UA 3RVLA 4Q7EA 2JB9A 5HKOA 2QBYB 3O2SB 4TMYA 5BR1A 1T39A 1FSPA 1HQCA 2BEOA 1K6OA 4RV5A 2FQYA 4EUKA 1ABEA 2EV5A 3IP7A 4KV7A 3P9IA 4MQFA 3ZMZA 5IT9K 2ZKZA 4EM0B 3EAFA 3NQOA 4MR7B 5D6FA 5JNSA 2JK1A 1RNLA 2CYYA 2MLGA 2HQNA 1ZLKA 3GFLA 3ILYA 1P6QA 3H5LA 4NCBA 3L00A 4HA8A 1JXSA 4DN6A 4I2OA 5TPWB 1QMPA 5CNIA 4TV7A 5D6EA 2DK8A 4XLPF 4IILA 3JSPA 3QX9A 3KLNA 4AIHA 5HDKA 4N41A 3GL9A 1USGA 5LGNA 3K1NA 5ICFA 4YFXF 4MS4A 1X3UA 2QW1A 1DZ3A 1S3JA 1FBUA 3GO5A 5CVRA 1ZREA 1XGSA 2XAQA 3I54A 1PEAA 1RIOH 4OMYA 2L2QA 3DZDA 3CG0A 3KP6A 4Z4GA 3DQVC 3WTUC 1TMYA 2NYXA 4I0BA 4DNCA 2OZ6A 1RXIA 2A69F 3DV8A 3CHYA 2M1BA 2LP4Y 1FPQA 4Z4CA 1MZBA 3ZN0A 1R22A 2HEOA 2WWVD 2VC1A 4M9ZA 3SZPA 4EYGA 2FNPA 2VT3A 2A3SA 5BQTA 4ENJA 4G7HF 2KJBA 3VB2A 2PKXA 4JK1X 2PMCA 4UV9A 3OO0A 1ZHFA 3LQQA 3KLOA 4Z4EA 2YSRA 4MS3B 2HR3A 2OENG 1YW9A 3TQNA 4WCGA 1CF7B 2NNYA 1M5UA 1FZPB 2XGXA 5A2QK 5J8FA 3ZPLA 1Z9CA 4EGSA 3WG9A 4Z4FA 4YP9A 2KKOA 3CKMA 4ESBA 1K78A 4A6DA 2FRHA 2F5CA 3FXRA 3GZ5A 3QPHA 3WTTC 4XARA 4O5VA 2PJPA 2H0AA 2CG4A 1TJYA 2NZVG 3A3KA 3OLXA 1LBIA 1P4WA 4RY8A 1B9MA 3QELB 5JHUA 4Q4ZF 2QQAA 3CO7C 1O3QA 3F8NA 1FYLA 3MM4A 3S99A 1BI0A 3SHFA 5ILVA 2V79A 4YIIA 1PUXA 2IP2A 1R36A 3EJWA 1FT9A 3DPTA 2FEZA 2VN2A 3Q41A 5D2CA 1IN5A 3DGFC 1FFSA 1U5TA 4Y17A 1IN8A 2J48A 3BBLA 4KIBA 1FX7A 5D5VB 4EVIA 2JTVA 3H92A 1NATA 2DI3A 3V8JA 3FFWA 1XGOA 1T98A 2MYPA 3JS5A 5FWYA 5LLQA 1QP0A 1XB4A 1Q1HA 2HYFA 3GA5A 1DCKA 4LE2A 3HVRA 4OOIA 3CS3A 3KJXA 1QO0A 3SAJA 2MLKA 4HW0A 1KU2A 4N76A 3SZTA 2V9VA 2V1UA 3HEBA 5CNJA 2M45A 5CJ9A 1QGPA 4YR7A 3OOPA 3REOA 1YTYA 1DUXC 3HO1A 2F5EA 5H6QA 3WGIA 4Z2YA 1ZITA 2XAJA 2QWWA 1QP4A 3J81Z 3EQ2A 1YFHA 5K5RA 1U5TC 1U3EM 3QP6A 4Z9AA 4UVCA 1F9NA 1FP1D 3RKWA 3F22A 1ODDA 5BOXA 4N03A 2LPMA 3G3ZA 1TW2A 1ZGGA 4UVAA 4LDAA 1BM9A 2JPBA 3BOQA 3I64A 4LB6B 3LUAA 2YX4A 2PN6A 2FMFA 2MH2A 4WF2A 1EFAA 3T8YA 2K86A 1MD0A 2XAHA 4Q47A 1WETA 3F8FA 2B0LA 4Z4HA 5H6RA 2IYNA 2JBAB 2TDXA 2QM3A 4XLNF 2YU3A 2CHFA 2HFHA 5CVUA 2JCGA 4IRHA 3O1IC 3EDCA 3SQNA 4WXEA 1DPRA 3H5VA 5DLEA 3LOPA 1W7PA 5B3JC 4L0ZB 1QKKA 3JTGA 2FMIA 4IHTA 3F6OA 3CJNA 1LJLA 2QLZA 1T34A 3QEMB 4QPJC 1QPZA 1FFWA 3BJOA 3VOEA 3Q5FA 3O74A 3I09A 2LIVA 3IPAA 2NT4A 4Q48A 2PLNA 1P4AA 3HRSA 4XSZF 3Q9SA 3P7NA 2VONA 1PP8F 5TE9A 3FF5A 3V8LA 4G9YA 1WQ2A 1RUOA 4PYRA 2WTEA 2OD5A 4PCQA 3LQRA 5HLGA 3RVQA 1DBQA 2JT1A 2DW4A 5AIQA 1WI9A 3FMQA 2WJWA 2RNJA 5H20A 4Z9BA 3L7WA 1H0MA 4KREA 4MPTA 3H1GA 4LFUA 5EWLB 1S7OA 2F5FA 1BI2A 1GHCA 4KK3A 1U78A 3KP3A 1TVMA 2OZUA 3O75A 1G3YA 3M1EA 2MSLA 1D4ZA 4LE0A 3NNSA 2CSOA 5DKFA 2GX6A 2P8TA 4IF4A 4BNCA 3V8KA 4OIOF 6PAXA 5TQ2B 5IC5A 1EV7A 5CVVA 3LFTA 1UFMA 3KFWX 2CWDA 1BC8C 1QNLA 4JBAA 4PGGA 2NS0A 2NRAC 4P1ZA 3GVAA 2BE5F 2V1XA 4HLXA 3JVIA 3F72A 1LK0A 2ESHA 1NXVA 4GXOA 3JSOA 2ZNZA 2CW0F 1LJ9A 1SFEA 2CFXA 2JVIA 3TO6A 2QVCA 1FSEA 1VPWA 3EGCA 2KYRA 2DQLA 3JPWA 4MQ9F 1QZZA 5E8GA 3ZMUA 2DFIA 2E4WA 1QBJA 1OKRA 1J2XA 5HDNA 4MEYF 1EWKA 4WX9A 3K9TA 2XASA 3DFGA 5HLIA 2VOOA 4ML3A 3GWZA 2O3FA 2XRNA 3CUOA 3E5UA 5DTEA 2L02A 2DT5A 5JNRA 1DCFA 4KNYA 1J0RA 4ZYDA 1I5ZA 1OYWA 2XKOA 1Z26A 4BHCA 3DF8A 1Z05A 5KQMA 3ECHA 4RB1A 2VBZA 4G7OF 4IRXA 3NHZA 3LKVA 3R0AA 3MYYA 1F5TA 1SD4A 3H6GA 3C3KA 3N75A 1MIHA 3GBPA 5JS2A 1OMIA 3B02A 1FFGA 3OM1A 2RC4A 5HVQC 3M6MD 2XUBA 2VC0A 1NXWA 3VNAA 1LBHA 1FYKA 2XDYA 4LB5A 4PZ0A 2IW5A 1HKSA 5DV5A 1ON2A 1ZG5A 2FQ3A 2Z3YA 5LEKA 4O1HA 5IUNC 4F11A 6CHYA 2HZTA 3V4GA 4RY9A 4M9XA 4M88A 1W5TA 1FQWA 3LUKA 4KMRA 2H27A 2IA2A 2PBIA 2DPUA 2XROA 4MGEA 4BQAA 4RGRA 3CUQC 1YK0A 3LA3A 2RKHA 5IT9Z 2VXZA 4GPAA 1UHMA 1K7AA 3O1JC 3DLHA 2HJ9A 3S2WA 5L3CA 1YW8A 1G4DA 2XIGA 1B4AA 1U2WA 2NNNA 2A9PA 2QR3A 5D5UB 3IL2A 3CZ5A 3F7NA 5CNKA 3N8IA 3CLKA 5J8CA 2MYUA 2CO5A 1KYWA 4KT5C 3TO5A 3T0YA 4P9UA 4KDPA 4BHPA 1GCGA 1ZAYA 1H9TA 3KG2A 3RI4A 1T0FA 2W42A 1SD5A 3FMSA 3TO7A 2O0YA 4KQ9A 4LMYA 2JRTA 4R8HA 2DTRA 4RK4A 3K4HA 1BAPA 3E6BA 4M9SA 4YFNF 3URMA 4DQDA 4XBFA 1GUDA 4Q6WA 1IXCA 4G86A 3QRFF 3F73A 3OO1A 1YLFA 2EFQA 1TM2A 4L9VA 4RU1A 1R58A 2W84A 1IF1A 3F8MA 5DD8A 1BVHA 2M87A 4HYEA 3O2QB 2PMHA 4HZFA 1XD7A 3W9SA 4I09A 2K02A 4KIFA 4UHJA 1ZAOA 4O5AA 1IZ1A 3KKEA 4RK5A 1KRWA 3I5UA 5LRRA 3KZYA 4M6XA 2PE5A 4GO1A 1OXKB 3IPCA 3ZN1A 4EGZA 1Z91A 2O6GE 2R25B 4M71A 5K5QA 1CHNA 1DG9A 2QXYA 2HTSA 1SXGA 4R79A 1ISSA 3TMYA 3E3VA 2X0LA 5A2QZ 1JYFA 2EFNA 2K4JA 2DO7A 2EFOA 3HOSA 5IUKC 1FOKA 5JNWA 4YIFA 3SNKA 2RV8A 4RDCA 4O3MA 2LNBA 4OBBA 3ZMDA 1XCBA 3OQNA 2FEWB 4YLEA 2X4HA 5KK1A 5GOTA 2QQBA 2PFBA 3JTHA 3ZQ7A 4HDVA 2L18A 3JY6A 5KQLA 1PP7U 4LX8A 2A9QA 1Z7UA 1P6RA 5ICEA 2OQGA 2V6CA 1QO0D 4KFCA 1HBXG 5KWSA 1L0OC 4PDKA 1CEYA 1NHAA 1LDDA 4RKQA 1Z15A 4PE5B 1R5HA 2EB7A 3HHGA 1ZESA 4RB3C 3O1HB 4EYOA 4KN4X 1O3TA 5EWJA 3WODF 2GKGA 1MKMA 4G7ZF 1HW1A 3IWFA 4KYWA 1MDMA 1ISRA 1NXPA 2R7DA 1NXXA 2FN9A 2Q5CA 1EH7A 2QYOA 2JVJA 4EJUA 4HF0A 2Z33A 3ZMTA 1P4XA 3H75A 1RPJA 4EQQA 5FLXK 1ZGJA 4MQEB 4CXFA 5TQJA 2FMYA 3WTXC 1FP2A 2O20A 4UNOA 5FD6A 2H6CA 1XMAA 4FE7A 4LLNA 4RXMA 4HQEA 1J75A 3E6MA 3HTSB 3DBIA 4KA4A 2MSKA 2PMUA 5LRSA 2IPLA 2EFPA 4P9FA 4GYIA 3CNBA 4DQ2A 4LGWA 1BI3A 1W7PD 2MD5A 4GNRA 2UZKA 5DUKA 2RDMA 1IAWA 3HDVA 3KYJB 1J5YA 5ILSA 4MRMA 5F6FA 3MMNA 3FMVA 2EJRA 4IHSA 3GWGA 1EH6A 3IWZA 1F4KA 5DCMA 4Z4IA 4TLMB 3CTAA 3V7RA 4OIRF 1W4MA 5D8KB 2FNAA 3HSFA 2QV0A 3NEUA 4F8JA 3H1EA 5IEJA 3ABTA 2FF4A 4NHJA 4KVFA 1IN6A 2EA4A 5HS7A 2CWEA 2HTJA 4FX4A 3GRCA 4QICA 3HRUA 3RVOA 5FBHA 4E7PA 4WXCA 2EV6A 4LG0A 3HUTA 3BREA 1FYMA 4YCSA 3H5OA 1C4WA 3W6JB 3RKXA 2P7CB 1XWWA 3WTYC 3HUGA 2LF8A 4BYYA 3GFMA 3U1DA 3JAMZ 2ZAYA 1URPA 2OQRA 3RPQA 5FBKA 2P5LC 3D0SA 4PZJA 2G7HA 1ZH5A 3MEXA 3VEPA 2L4AA 4YG2F 4RGXA 1RXEA 3QU3A 3HDGA 3NHMA 4HDUA 2XHKA 4MR9A 2VE9A 5BPIA 2PJUA 3E3MA 2JVKA 3GEZA 3N6VA 3C97A 5EWMB 4ENMA 1TW3A 1OPCA 4P98A 3DEUA 1JLKA 4I0AA 3EDPA 4ZYGA 1KRXA 4JOQA 4QWQA 4AD9A 1DCMA 3JW4A 1SXHA 2J5PA 3VNBA 2A9RA 1BN5A 2A61A 3IRRA 2FN8A 2HQRA 2XAFA 1KQ8A 2KIFA 2MA3A 1MGTA 3MCZA 1I3CA 3H6HA 3LUHA 1XDSA 3ML6A 3O3KA 4HF2A 1LQ1A 4MNUA 1QP7A 4OATA 4HV5A 3Q15C 4G0QA 4M6YA 3LUCA 1R23A 4L0YB 4NICA 1BJAA 1JWLA 4HAMA 2FMKA 5L3GA 1XHEA 4ZMRA 1TQPA 4NQWA 5BRAA 4MQFB 3VODA 3BWGA 2A68F 5I4CA 5LGTA 3RH0A 5HS9A 2IT0A 2PG4A 2ZBKA 4WXHA 4ZZDA 1L5ZA 2P6TA 1JH9A 4KUMA 3KP5A 2GZWA 3H5WA 4U0VA 3ZMVA 1JF8A 1HKQA 1U8RA 3P9CA 2WJAA 3WU0A 4ENKA 4LJZF 3C7JA 4HQMA 5TRDA 4LG0B 3OLWA 1JFSA 1NXTA 3CRNA 1YMVA 1B00A 5AONA 3OLZA 1LVAA 2WY2D 1D3YA 4ZYEA 4XLTA 2ID7A 5CHYA 4MS4B 3RYRA 5LHIA 2YR2A 3T8TA 4RZSA 4HNSA 4EVQA 1EH8A 4FE4A 4G0YA 4GGGA 5EEHA 3RKYA 4RAZA 1J56A 9ABPA 2AYXA 1I1GA 1DC7A 1YG2A 3IDOA 1REPC 3IC7A 2D1VA 3RVKA 4JAVC 4QYWA 3K1PA 3BZ6A 3F3XA 1YS6A 2FBHA 3T8RA 3RYPA 5B3JA 2JSCA 1R5GA 5IT3A 2HKXA 1Z2EA 3HRTA 3NRVA 4F7ZA 2LUOA 4XRFA 1IIBA 4G94A 3TDZC 2PL9A 2M8EA 4KMFA 1C0WA 1IXRC 4HNQA 3RTRA 3U2RA 4QLCU 3EULA 3MIZA 3TO9A 3L6UA 4MS1A 1JFTA 2L3DA 3NNNA 1W5SA 4M72A 3RJPA 2OA4A 4HF1A 2XV4S 1S29A 1M2EA 4RS8A 1K78B 1DP4A 2Y75A 3I5AA 4BH9A 3I59A 4MHGA 5E18F 2WC2A 4RGSA 2IOYA 3M9XA 1XMKA 5LHGA 2EFWA 5LHHA 1XCVA 3IHUA 5KC8A 5J6XA 1HSJA 3E61A 2DQRA 3WGGA 1ZN2A 3O6BB 4P5OA 2FMHA 2M5WA 1HKTA 1O7FA 1RI7A 4RXTA 3TOAA 2A5YB 4NCAA 1ZH4A 2MH9A 3C6QA 4A12A 1WSUA 1DBPA 3KCNA 3GFJA 4WXMA 2EWNA 3JTEA 5BMZA 3I53A 2F2EA 1DBWA 1SRRA 3I4PA 4Y9TA 4G0MA 1U5TB 1AWCA 3LTEA 2RQPA 3M8EA 4A2UA 3JAMK 1SAXA 2RJNA 2RJOA 1ULYA 4CO8A 4HX4A 2HKOA 3WTSC 2E4ZA 1ONVA 1YQAA 2ESNA
chains in the Genus database with same CATH superfamily
3ICPA 2QMHA 4EG7A 2IBMA 1ZJZA 3J7AO 5K3EA 3EXG2 4I66A 4XKJA 1QYCA 4HYTA 4D0PA 2X1DA 3E1SA 4QDUA 2AG1A 2Q5LA 5D3MB 1WSAA 3HXKA 3U0BA 4C2TA 4NBKA 1KL7A 1ESMA 2SKCA 3W8DA 1ZXLA 2GASA 4HDKA 2VQ3A 3WXMA 5KQPA 4RULA 2DK5A 1FSGA 2Z2JA 4DCPA 1VI0A 1X94A 1BS2A 3NX4A 1WKMA 3A31A 1KMNA 1VZ2A 3MZHA 1CRWG 2QZ4A 5I7WA 3WK7A 4ZO6A 4U9IS 1YIOA 1QNFA 2WIBA 4ZZLA 3WFIA 4A16A 3SGLA 2OC6A 5LFAA 3GEPA 1ZRDA 2EBUA 1J22A 3HZHA 3FOCA 2IHUA 3W8EA 4C9BA 3L0CA 2X86A 4OJTA 4LJKA 5INTA 3OCJA 3K9WA 1DPGA 3SMQA 3Q1LA 4OGFA 5BS6A 3VYWA 3V32A 3AM5A 2WD7B 4ZVLA 4GWLA 4IJUA 4IQ8A 3A06A 4ZYLA 1T0IA 4EJSC 4YRZA 5EP2A 5JJ5A 1KDVA 4JLVA 3TL6A 3RAGA 2ISYA 1QVAA 1G55A 4QJ5A 2BZSA 4DA7A 3R6DA 8ABPA 3CG4A 3I71A 4CQNA 4RTPA 1V4NA 4ERXA 2OBPA 4UNRA 1GQ2A 4R7TA 3PUHA 4J3NA 3V8VA 1RLJA 1Q0TA 1O6CA 3MEQA 3PDCA 1FX1A 2W24A 3GIDA 4QM7A 3PSAA 2JBHA 3JAWB 3D3KA 2P0EA 4ZI2A 2VP3A 4S04A 3QFFA 3P96A 4L02A 1FJLA 5CPFA 1XN7A 4BQIA 5FPKA 3V7CA 1JJ8C 1KPHA 1RM5A 4HQKA 3ERMA 2R7SA 4N7BA 1X3WB 2BTOA 2PUEA 3HJHA 4E22A 2OCDA 3ZY2A 5B6JA 4ADSG 1DG3A 4YQYA 1Z29A 4TTRA 2XDWA 2RD2A 1TT7A 1IMJA 2W6IA 4MW6A 3T3MB 5DBGA 4FN4A 1WO8A 2AUNA 3AI2A 3E9EA 1J97A 4RQUA 4B7UA 2Z9OA 3L8CA 2P9ZA 1H2ZA 2QBYA 1A0OA 4HNTA 4EF4A 1BW9A 2DECA 3SIXA 4LRWA 3HBNA 4NWIA 4FSXA 3OICA 3N97A 3LHDA 3TXAA 2Q1ZB 4ZHSA 3BPSA 1B41A 1RWPA 4X00A 1Q22A 5KQGA 4KODA 2V7VA 3OQHA 3BY6A 2V9CA 2Q3FA 4J1NA 5CJPA 3QTBA 3GT7A 4N5DA 5HBGA 1GYPA 5EE9A 2JHAA 2QORA 3LWZA 5IUJC 2NUPB 3LT5A 4C20A 3QP9A 3K0FB 1BCRA 3BIWA 3GUZA 4KE9A 4B0OA 1CVRA 2RHWA 1VQ6I 1TT5A 2HQBA 5AM4A 2IPNA 3T38A 1DKMA 5KSYA 4FVTA 2O8CB 4QFCA 1JSCA 3IAFA 3MJHA 1V4BA 2BKUA 4B3MB 4V0KA 4YJ3B 1EDDA 3N87A 3HUFA 4EHNA 1W49A 4L08A 5F0HA 1WPRA 4EW2A 5HS8A 3RUDA 5IASA 3I01A 1UM9B 3BG6A 3AO0B 2HZ7A 3ZZUA 1E7MA 1T2DA 1U0HC 4HCJA 1E6MA 4MKGA 4PSXA 2BGCA 5NULA 5KNBH 3DGEC 4N1AA 1BOBA 2Y92A 3O9MA 4HN2A 4II3A 5EIEA 1G20A 4QUGA 3MUNA 1W0JA 4WMLA 1LX7A 2DWQA 5I5GA 1Q7CA 3D6HA 4YH1A 3KXKA 3GLUA 4CL8A 1D0VA 5BSEA 3Q0IA 3MUOA 3WGZA 4C0BA 2HTFA 5EMMA 5KTOA 2JATA 5KZMB 2GVNA 4JVNA 2W2LA 1DC6A 3VTKA 2HYGD 2V9KA 4A03A 4MFDA 4IV0A 2WLSA 2QRLA 5PGMA 5I51A 1WQ1R 3M4ZA 4ZYWA 1QIJA 3ELUA 3WVNA 3FM5A 4J4HA 2QUZA 4D44A 5JS6A 1NKVA 3VQTA 1JIVA 4U7FA 4TYYA 3IP1A 5LQCA 4OHKA 3CMEI 1Z6GA 2MDTA 1KH2A 1Z13A 4IGKA 5EZQA 4YAFA 2W6CX 3HXLA 4RPLA 4JXZA 2WFZA 5MDHA 3IUJA 5AIBA 4UVHA 1J1UA 3PEEA 2XR1A 2ORIA 3HKZN 3M3YJ 1RR6A 2EIKH 2HJRA 3QE3A 4U3JA 1JTEA 3CONA 5A9TA 1A7UA 2NTNA 1T9GR 1NMYA 1G18A 1IK6A 3TGNA 1P0PA 3CYFA 5KBYA 1YITI 3NTRA 1H9GA 1E2LA 4P81A 2QP9X 4HTFA 1IAVA 1R0RE 4G8XA 1OZ0A 3QBEA 3ODPA 3BDDA 4ER3A 2DSNA 2OY0A 3OU7A 1X86B 3WQQA 4GWGA 1NJFA 3P2MA 1SXPA 1Y6FA 3JQDA 1NBMA 2W9XA 4NH0A 5AK4A 2H7VA 5BWOA 3WO0A 3R24A 2HRZA 5SZJA 5ALNA 3KSRA 1SMTA 4P4TA 1L5HB 4YFKF 2HWKA 5DYMA 2WJGA 1NQXA 2OG2A 3OLCX 3UBMA 3VH4A 2D2IA 3HP4A 1SCQA 1ZSNA 3BHMA 2BBSA 4GX1A 4ZEMA 4FFMA 4V3BA 3IP5A 4EB6A 2FLVA 5HJEA 3UJHA 3PD1A 4RSRA 2I3ZA 2VP5A 5IFLA 1W8IA 4U7DA 1QANA 4W1SA 1AHNA 2D8AA 3DLLF 1RJ9A 4PGHA 3Q7PA 1DQSA 1FBTA 5L3EA 2X1MA 3IE1A 4G0NA 2QE7A 2GEJA 3AOGA 1HDPA 1I9GA 2NUTB 2CQKA 3TNJA 1JQJC 1RKQA 4KQIA 1YRAA 3GRYA 4EJFA 3EUHC 2QDKA 4LXGA 3BR1A 2A4MA 1UKAA 3DVQX 4NIMA 4X6XA 4HAIA 3SFTA 5LIRA 4NBNA 2GPTA 1QHEA 4CHGA 5DCFA 4ZALA 1LDKB 3T5MA 3C3XA 5C0OE 3BCHA 2E1PA 1AN9A 2FXVA 4WIAA 1ULSA 4YK7A 3GELA 3FCOA 1ZLJA 1BEEA 2G0TA 4RCVA 3VMMA 2ZPUA 4F0JA 3NEYA 2O3TA 1ZXXA 2EBIA 4BKUA 2JCBA 5KTSA 1W4AA 1OAAA 3W78A 4HDMB 3L1HA 3TBKA 5F2KA 2PT5A 3PL8A 5AKZA 3IEUA 1UDAA 1GSHA 2ZTMA 4ZVUA 2XF5A 1G6KA 4GH5A 2F6RA 5HZHA 4L51A 4HZGA 4TGLA 4A0XA 3NEJA 1B73A 2D06A 4HO1X 2MINB 1D8TA 3E2PA 5T67A 1UMKA 4IIXA 3HUEA 2H8GA 1XZBA 3ZD8A 1IV6A 5IK2D 4ZT4A 5TNXA 5JZSA 2R4TA 2VXCA 2YIDA 5KTKA 4XRSG 2C82A 4HSRA 2ZTVA 3FTEA 4F2PA 2P5VA 4BLUA 2XMCA 4V1CB 3LT0A 4BQOA 4QEKA 5IOYA 2IGOA 4U87A 4EI9A 3ELKA 1E1MA 2J3DA 1SCNE 4GVLA 1MENA 5TVGA 4MO2A 2VYFA 3D4OA 1M1ZA 1OZFA 4XKWA 2RIPA 1YO5C 1EHCA 1LDNA 4ALKA 5DM2A 1V11B 1MMNA 2DC1A 3DOJA 2RGWA 1K3UB 5F35A 3E22B 1NBEA 3LBIA 1T36A 3JQ8B 1P5FA 1DBIA 3DDNA 4GL4A 3GTJJ 2I7CA 2VP4A 3T7JA 1CZKA 2JWTA 3LFKA 4AXBA 4Q7LA 5HFNA 5COBA 3TL3A 4CKCB 4UUAA 1GPYA 4WOPA 1MB4A 4FWTA 4MULA 4MARA 2OAZA 5E3JA 3VTAA 2E18A 4GL2A 2W4MA 4HRAA 1XAHA 5J1SB 5ALJA 4BFXA 4XUCA 4QHSA 5FAXA 1I01A 4K9SA 2LH9A 3V7SA 2ACVA 1I6LA 2ZQYA 1WZEA 1AUPA 5ILUA 2P2NA 3BFVA 3ZK7A 5DVZA 3UXYA 2P11A 4P5DA 3W2GA 5CX1A 2FUNB 2GNOA 4Y2RA 4BXOA 3M4JA 1N2XA 1TIBA 1DQYA 2JANA 3HY3A 3U4IA 2BBYA 2VHTA 2NPFA 4TVBA 4N39A 1E0AA 1D2NA 2ZWVA 2P41A 2W2XA 3F6BX 3AKEA 2Z6UA 2DDBA 4TKVB 1DGWY 1K8YB 2RB5A 5L8VA 1DVRA 4KQEA 3T5CA 4N8EA 1T39A 1H23A 1MIJA 1K75A 2D0PB 1ZK2A 2RGRA 3H19A 4MFEA 1TF5A 3R7WB 4A5SA 5IT9K 1H2RS 3IUPA 1KKMA 1P4GA 4FWBA 2VP6A 4R7GA 3RR2A 4IUBS 2CLKB 2LFBA 1JG3A 3BMOB 1FTZA 5DK6A 3ELDA 5HDKA 2XGCA 3VR5H 3DJFA 2YYAA 4OHMA 4ZTZB 3EW9A 1GTJ1 4DTIA 3SXUB 4Z4GA 2JI7A 2FQ1A 2O6HA 2WFAA 1EP1B 1G5RA 2WWVD 1R22A 3SZPA 5D7BA 2IOFK 3ITEA 2NYAA 1W19A 2EQ5A 1JZSA 2ONKA 1OX4B 2ORYA 2IAIA 2O7VA 2Z1DA 3ZPLA 2UUPA 4ESBA 3U80A 4XARA 5DLYA 4B3XA 1SKAA 3OLXA 3QELB 1CUJA 3K1AA 4L3OA 4YJGA 2IVFA 3LX6A 3GQBB 2OBMA 4J0HA 4RF2A 2WF7A 4UHFA 5D2CA 4BO0A 1FFSA 1U5TA 1F8GA 3IH5A 4EHAA 4RCZA 3UYLA 4FR5A 1NATA 1EE1A 2GN0A 4DLZA 4B4VA 5C5DA 2EZ8A 5CDYA 4PFPA 1RABA 2H4ZA 4X6YA 3PDIB 5D3MA 1I4OA 2ZRCA 4Z2AA 5D1NA 2XAJA 4K5QA 4QAJA 5LD2C 2PDAA 1PUJA 3IERA 4XYBA 1FP1D 1YL7A 4ASUD 4DLSA 2JLZA 3G3ZA 3G0DA 3C45A 1H2WA 4ANFA 1MF7A 3KO8A 1GR1A 1I9CA 1T24A 1WJBA 4ZCSA 1GADO 2Q2EB 4FYMA 1BHJA 1U2DC 2WG2A 1FYFA 3CRVA 1J5XA 2QL7A 2EZKA 2P9CA 3GAFA 3O0DA 4J7XA 3ZR8X 4EQZA 3WKCA 4OGLA 2CXQA 1DU6A 2DTXA 1XD8A 3JTGA 4B45A 1A97A 1XZHA 5C7LO 1R88A 1VLLA 1Z68A 4GKKB 3S8EA 3BTLA 5KHLB 3CPSA 1CUWA 4KGZA 5HQ3B 2WD7A 5T5QA 3OYJA 3L7KA 2QM8A 2CCJA 2VLAA 1BA3A 3FMQA 2DA5A 2AE1A 2FGKA 1C3XA 4Z9BA 1N4DA 2PR7A 4MPTA 5EWLB 4GI3A 4RVUA 4P4SB 4AZ0B 1GPAA 3O75A 2CSOA 2GAJA 3VTFA 2OC4A 4QUIA 2QEXI 4PLGA 4REQB 4KXLA 3F72A 5E2AA 1NXVA 3JSOA 1JG1A 1Z5WA 3GDWA 2CFXA 2JVIA 3R5HA 1MMFB 1FFDA 1YBMA 4FUQA 1BCSB 3EPPA 3RTCA 3JAWA 3K9TA 2G1UA 2B1RA 1A9XB 1E5LA 4G81A 2Z9BA 1SXJE 5IH7A 3KE9A 2P0AA 4EI2A 3JSXA 1WUHS 1EUQA 1DQZA 3AUXA 2DT5A 4XE5A 2BISA 1NW7A 2ZRNA 3OOSA 1OGYA 3QM1A 2ET6A 3NI2A 2I29A 4G89A 3A28A 2I65A 1SU8A 1QCZA 4AZ3B 3S1MJ 4ND2A 3GNSA 2FWNA 3OM1A 4E1VA 3DPIA 2XGJA 3GH3A 1I3MA 3RWOA 2JA7J 1W0CA 2NO1A 2OQIA 2YV2A 4ZYTA 4TT8A 2H1IA 2ZIGA 2Z3YA 3SOZA 2WIFA 5IUNC 4Q19A 1W5TA 1TKBA 1XQVA 1H6AA 4S0HB 3UJ7A 4CDNA 4RGRA 2ISQA 1LKZA 2ZYDA 3MWFA 1EB8A 3V8QA 2P1DA 1ZINA 1HA8A 1RC1A 1YOBA 4DIDA 4C05A 1PUFB 4HH0A 4WVFA 5AW4A 2BKVA 1F14A 1LXCA 1I4TD 3CF4G 2VBGA 1MQ8B 2E1RA 1E9BA 2ZB8A 4L9RA 3H1AA 1LK5A 2IH5A 3NFYA 4UEWA 2YJ4A 4M1WA 2AMLA 3BORA 1R10A 5EIWA 4Q82A 1YLFA 2NUPA 3UMYA 1T2NA 3MOIA 3K0FA 4ZEXA 2X2OA 4RK5A 1I4EB 2RJ3A 1S4MA 4KO4S 5L95A 1U7DA 5BW4A 1BTOA 4B3CA 1X7GA 2B6NA 5AOBA 2I62A 1GCOA 2O8CA 3AIMA 3PDJA 3CR3C 2FZCA 1DG9A 3WMRA 1XFDA 3MMZA 4YJ3A 3WS7A 3SS7X 1YC5A 4F6LA 1XA3A 3ZQUA 2WSBA 2X4HA 4BVLA 1UM9A 4NDZA 1C7RA 1J09A 4DNQA 3S2SA 3U6KA 4F5DA 3FUCA 2IZOA 4P82A 4TMTA 4E2FA 1LE8B 5C1DA 2XV1A 3IQGX 1W4BA 1DBRA 2LKCA 2ZJ7A 1NC1A 2VUSA 3R5SA 1EA3A 4G7ZF 2G0NA 4KYWA 2NLOA 4HOYA 3T7KA 2C8LA 1XMVA 1OF1A 3F8WA 1SBCA 4H4DA 2BVMA 3FFBA 1UBTS 2FP4B 3K15A 4LRXA 3WRYA 3BMNB 1ZQ1A 3DYIA 2O20A 5KTTA 4N18A 2HCJB 2UV1A 5I4IA 2IPXA 1D04A 4EMBA 4Z7NB 4D9MA 3Q0VA 4F4DA 4O4LA 2EZUA 5JASA 5CXSA 2X0IA 1NAHA 1NBHA 1YUMA 1X9IA 2F48A 2YV3A 3ESRA 1PNOA 5I9BA 2J87A 3MMNA 3E53A 4D57A 2TMKA 3PWZA 2FNAA 1P7CA 1ODSA 3QQ5A 3OY9A 3TM4A 4ZI7B 3TZCA 5HK8A 2XKKA 3GPIA 1F2DA 1N75A 5SYMA 3ROZA 5HW0A 1PAUA 5IU6A 4C2MJ 2Y1XA 1MG5A 2BM9A 3W6JB 2K7FA 4ZCPA 2ZAYA 1EDBA 1P4JA 3VEPA 4MQ6A 3VU8A 4KR2A 4ZGBA 1WCIB 4G2NA 1EFHA 2A9JA 4YRNA 3QPLA 4IIDA 1UOQA 2IX9A 3DWIA 2C2KA 3E3MA 3DULA 2YY5A 2CLCX 4XVQA 1PNVA 5DHAA 3I1JA 2P79A 3FI9A 4DDWA 5AM3A 4CQMD 3H9JA 5J2UB 5JZVA 1VSTA 3PZBA 1J5EB 1POWA 5SYNA 1ML3A 3PFBA 5I9SA 4LC1A 3WGOA 2QTBA 4JYBA 3IJ5A 4F1WA 3NEPX 5DTDA 1G8YA 3HTXA 5H4GA 5AW0A 1XQYA 3PIDA 2DY1A 2QTMA 3GP5A 4YAUA 1L5HA 3QU5A 2HR1A 4R05A 4LG0B 1OX5A 3GDFA 4RA6B 3OOEA 3GB9A 4K6OA 5DN9A 4ZYEA 2Z2ZA 3D3JA 3WOVA 4DJFC 3UCFA 1NQOA 4RZSA 3TQTA 1H0HA 1ONSA 4RHXA 3X1ZA 4IJMA 2L7ZA 2YDXA 5DCYA 2ICAA 1JDBB 2HU2A 2ADOA 1V8DA 2Z56A 3KUCA 3PUIA 2GN2A 1A27A 4IUYA 3JZDA 5B3SH 1CEEA 2QRHA 1Z2EA 4IL6C 4JJ8A 2PL9A 2GEDA 4DSTA 5EHXA 1UOEA 2Y1WA 1TIKA 2Z0MA 1G1AA 2XV4S 4I5EA 2VSYA 1TX4B 2E49A 3EMDA 2NUTA 3ZI7A 1JZQA 2PPLA 4OJKA 1K6MA 2XRYA 1ODTC 1VG8A 4J6EA 5HE8A 2G9QA 4D8UA 3BQNB 1XMKA 2BT4A 3H2SA 1HSJA 4U7JA 3SOPA 1A1VA 1K27A 5KNCA 4YDHB 4Z8YA 4LC9A 3JYOA 1NOKA 4GYJA 1XZNA 1IG0A 3JTEA 2HVRA 5AI9A 4UBLA 4X1EA 2OV2A 2FF7A 3I4PA 2J0QA 3V7UA 4J0IA 3B9PA 4FEGA 1BG6A 5IBRA 5LNK6 2CLEB 3R76A 2HKOA 4PG5A 2E2WA 3PQ2A 4KIWA 4ESJA 4AKGA 4GBED 1KYYA 4E5DA 3KKKA 1FB5A 4ER6A 1NTRA 1U1CA 4Q37A 3C2GA 4B34A 4Y67A 4IMJB 4CIAA 5JZOA 3NC0C 4B3FX 1N3BA 3Q3CA 1IRFA 4GIBA 1MHPA 1AO3A 4PS0A 3BTIA 1NULA 4ZDPA 1VMDA 4I6GA 2QKMB 5DM1A 4K87A 3T5PA 5TPZA 4LMRA 3HXMA 3PPWA 5E2BA 1R9GA 2I99A 4UAGA 2FSHA 1O7LA 1FRZA 2IYLD 1N2BA 3UUGA 3RK4A 1PT8A 4NDAA 4I1YA 4N48A 4R0VA 1J7KA 2MINA 4EECA 2NO6A 4J2OA 4XAQA 3LP8A 5LP1A 2D74A 2UZAA 3OA2A 5J4LA 4Q15A 1Y8ZA 3RAJA 3K9QO 1U7UA 4MDHA 2DLLA 1WVGA 1UMDB 1G98A 2D2WA 3TLEA 1HYGA 4V1CA 4Z8XA 5LUBA 2GFQA 3PTLA 3OEHA 4Q12A 1HLPA 2J3MA 2DHRA 1J33A 2HIAA 1SVNA 2B61A 2ODQA 4TM7A 1FC0A 3HYSA 2OORA 5JI2E 4Q9AA 5C5CA 3CLUC 4AN0A 1WV0A 2RI0A 2HK7A 3B6JA 1U0EA 3T1QA 3DFMA 1V11A 3B3JA 3H9QA 3EWIA 1IM8A 4IG9A 2C84A 3E22A 4OXYA 3GCDA 3C8DA 2PT9A 4LX0A 2BI8A 1BQ4A 3A9RA 3JQ8A 3MW8A 4LZLA 2O9LA 4ALMA 2VNSA 4JGBA 3WLKX 1I24A 2WM2A 2W25A 3DQQA 4G09A 3I2FA 4J8PA 4CKCA 3OOUA 1ZUIA 3ECAA 1CULC 4P3PA 5AK0A 3IBYA 5IM5A 4BCCA 1J2EA 1WSDA 1T95A 3L8GA 1ETWA 4J9VA 1DARA 2ZS7A 2FPUA 3F8CA 1V55H 4B6PA 2GDJA 1GL9B 2R6FA 5J1UA 3ECCA 3IQXA 3R3SA 4E32A 5DV9A 5BORA 2VAVA 4DMCA 2RB4A 5AKIA 2D1SA 3OC0A 1LBSA 1MP0A 4W1QA 4AULA 4FOLA 1CZRA 3B1WA 5IULC 5K6AC 4UARA 2N0SA 4NYIR 5T7BA 1F5SA 5BSRA 1NX6A 4OLBA 3ENVA 4TKVA 3HSYA 3OCZA 3I9OA 1ADFA 3HMKA 1I1SA 2HCBA 1FQKA 3GJ4A 2P6MA 1K1EA 3WYAA 3ASNH 3JTMA 3R7WA 4PSAA 4GECA 3D0QA 4HK4A 2EATA 3D0RA 3COAC 1NXQA 2YYZA 5HQJA 4RM2A 2OQ2A 3GLTA 4MLOA 3CUSA 1FJXA 4XIIA 2VK4A 3BMOA 3ET5A 1TPYA 4QIHA 1G42A 3ROQA 2AR7A 1S5LC 2X0DA 3CNOA 2VTEA 4UVBA 5AI6A 1R00A 1QVTA 2VUTA 4MV0A 3PQ4A 4AO8A 4XX0B 4TTPA 1MTOA 2GLTA 5IZCC 3SXUA 3LQ1A 1FBNA 3N8NA 1G3UA 4X0EA 3AHCA 1JJBA 2R4GA 3UB2A 2NP7A 4X0GA 4X1YB 3QY0A 1RIIA 1XPUA 1OX4A 4ZYAA 1W36C 3TF5A 2VTVA 3GEDA 3M8JA 2XADA 1N2SA 2VDJA 3OYLA 2HA6A 3WWEA 3M49A 1LQUA 4K9QA 1F0PA 1Q0ZA 4HZIA 1SRQA 1TL7C 2XCRB 1JUDA 3QELA 5KSWB 4LGYA 3GQBA 1O3RA 2O2HA 1C2TA 3ZK8A 1K5HA 3EBLA 4HWSA 3ZY4A 2B98A 3K0CA 3EC2A 5CDFA 3H7IA 2C9DA 1WD5A 1GKYA 4N3GA 2XTMA 3WP0A 4D5CA 3GMSA 5DSXA 1VKZA 4I1PA 1V6AA 1RI4A 3SJ7A 2AFHB 2VF2A 1KI8A 4A27A 4EGJA 3PDIA 2JI8A 5JH7B 2QMQA 4MQUA 1C7QA 4RVOA 1A04A 1EXDA 2BZTA 2FPXA 2NQ2C 4BAUA 1KNQA 4HPQA 2XNDA 1EQAA 3F98A 1LF0A 1F6WA 3D1NI 2P6SA 4B80A 1WMSA 2V6EA 4L9JA 2X3YA 3G2OA 2G8NA 5KYXB 1GA4A 2Q2EA 2AQEA 2QYSA 3WYBA 3HRHA 2UUBB 2Z8ZA 4LI3X 3I0NA 2ZRMA 5REQA 3R3ZA 2FFBA 1ECBA 5B36A 3E1KA 3T4PA 1CJSA 1F48A 1BVRA 4ZYUA 1XGNA 4HOBA 2IPAB 2VPPA 4MGIR 2GHQA 4YONB 2ZAMA 2X6XA 3B13B 3NMUF 3VO8A 4WNCA 2W2QA 5CYGA 3UMGA 3KD2A 4LV6A 5JOQA 4NMWA 4E15A 3EEIA 4K81B 5HQ3A 5L45A 4F1JA 3ZWCA 1Q3HA 2CFOA 1KU9A 3D5LA 1WBBA 5GV8A 2OXCA 5BXYA 2Q3EA 3ZEAA 1ZXBA 2A0YA 5EWLA 1SHUX 2AK2A 4DVJA 2IEDA 4P4SA 4AZ0A 1EAYA 1LPPA 5L3BA 2I0FA 3C2BA 2D1FA 4LK1F 1TNTA 1M1EB 5JSHA 1Q1BA 2FSPA 4M9UA 3DLIA 4REQA 1KQ3A 1K68A 4FOTA 3G9QA 2C98A 2PIAA 4BO1A 1YWGO 2DBBA 2E4VA 4XQFA 3AMVA 2IQIA 2GLXA 2WYIA 4DJEC 2NTEA 2HRCA 1BCSA 2R7RA 4XSVA 2B99A 2NU6B 1A9XA 2AEEA 2VHCA 4DEXA 4BE2A 1P1IA 2XPVA 1UKZA 1XE3A 3EZXA 3NHKA 3PQFA 3P97A 4RXUA 4ZC8A 3H0GJ 1AQLA 1EXNA 2P0WA 1ULAA 4R3NA 1G3SA 3QOXA 3F6SA 1P7YA 2M3AA 3DB1A 1N6HA 5A5GA 3K69A 4DBLC 2Y48A 4Q9NA 4F46A 3IIJA 4AZ3A 2JGEA 3DE0X 5EIXA 1DG1G 2XVYA 2A9FA 2QLJA 3ELBA 4O1IA 3BB4A 3ISVA 3AW9A 1N5IA 4F8YA 2D5IA 4AKIA 3OPXA 1M76A 4UCWA 1HNWB 1A96A 3QVVA 3ZNNA 1QIKA 4PCVA 2YNMC 2AQIA 4BMPB 2WVAA 3Q3EA 3O38A 2EEZA 1JR3E 3SC4A 2EERA 1F0NA 3UAWA 5C1PA 1PUFA 3U7FB 2WZDA 4JEHA 2XA1A 1V9LA 1USUA 2YV1A 2JJYA 2G7UA 2V7WA 1YIJI 4QOFA 3IIKA 4MRRA 3ZQLA 4UBOA 3K53A 4J2TA 1XTVA 3Q7QA 3SDZA 1XTSA 1H9BA 1OAOC 4IDGA 3QKRB 5HILA 4XKVA 2KQUA 4ZCLA 4UCXA 5T8KA 3TBFA 4KPEC 2N46A 3AY3A 2DX7A 3UFXB 1Y56A 4DQXA 3U3MA 3VPCA 3HHPA 3U9TA 4C4OA 3F67A 2Z5VA 1KJJA 3ZW8A 5JXHA 4KXNA 3E3AA 4IIVA 1QQTA 3HNPA 3VWBA 1TCAA 4KU4A 4JB2A 1VTNC 4HNHA 4MVJD 5CJJA 3WWCA 1YQTA 1DEAA 2C5GA 4LSMA 2DMRA 4DJAA 1DKPA 4XWAA 3O4VA 2XWBF 4EO7A 2XSZD 4E2ZA 4DB2A 1IPHA 4CIYA 3ABSB 3FLEA 4PSWA 3F47A 4GHWA 5DHSA 4MW4A 1M72A 4ALIA 1ADCA 4BVHA 1AZLA 1Z7GA 5JC8A 4NJEB 3TLMA 1LE8A 3DS8A 3MJSA 1GRQA 4V24A 2QAIA 4PAWA 1B14A 2OSBA 4YEJA 2FE1A 2RMKA 3HY6A 4JX9A 3SN6A 5L9AA 1NW4A 1L9KA 4O6VA 3CUQB 4BMSA 1YONA 5DYGA 3ZVNA 1KJZA 3Q2IA 2Z8YM 2FP4A 1BBYA 4QEZA 4OQXA 3BMNA 3AFMA 3QOYA 3AU8A 2E35A 1IBKB 4DIEA 3E5QA 2OGTA 3RT7A 3RVNA 1HQYE 3KUDA 4G4SP 1TVCA 2L19A 1AURA 4F56A 1LDBA 2JSPA 2W6NA 3N6XA 4ZI7A 5NLLA 2RBEA 2JA5J 1SC7A 4M36A 1U3UA 2Q9CA 1UB9A 2B7EA 1PD0A 4NNOA 4JROA 2KMLA 3E0XA 2IUEA 2FPSA 4GZ6A 1H0RA 1XB2A 1T29A 2Z5FA 1WCIA 2OAEA 4YHHB 1H2AS 1OOEA 4A1FA 1JXOA 1MOSA 2DBYA 4W8GA 3E0QA 2HBQA 2ILTA 2ZSFA 3ER6A 1CRQA 5FUYA 4X85A 3NYRA 1WB5A 3O4FA 3QYAA 2VAMA 3ZU5A 5KI6A 2IYTA 4KISA 2IA5A 3HDTA 3RYTC 5J2UA 1GEGA 3JRIA 2R48A 4DOMA 4P53A 3QVKA 3U3DA 3I76A 1HQCA 3JWJA 1NI4B 4RV5A 1RXSA 4QNMA 3L1UA 1XLWA 3ES9A 5D6FA 4UMDA 2G82A 4JEMA 1XG5A 2Q3LA 3R41A 3GTPJ 1G9XA 2B8NA 1CU1A 4UOQA 1QAOA 3G0HA 1WRBA 3V4ZA 2W6JA 8ADHA 1ZRHA 3GL9A 4RA6A 1T5IA 1GTG1 4PR0A 1H1LB 2M2IA 4K9PA 2XAQA 3DZDA 3A9VA 2WU4A 4NEHB 2ZRJA 5IY5H 1M8JA 2DFNA 4I0BA 4ENJA 1AGRA 2OILA 3L92A 4TLDA 5DM4A 3RTEA 5EJ4A 1E9FA 4HQ0A 1XMOB 2OENG 1C50A 1E2KA 3JR7A 2NNYA 3H5AA 1VLMA 4BACA 1W6RA 3GLFB 4Z4FA 4ZZIA 2DETA 2VJMB 3FXRA 2PFGA 1RU3A 3MWDB 4HGPA 5SYAA 1OWPA 4ZAXA 4QYSA 2QTZA 3V2UA 5DM0A 2F3QA 3PXGA 4OFZA 5GJBA 2O7SA 3S99A 4FQ8A 4FU0A 2OZKA 1R36A 1UAAA 1XTIA 3Q41A 3ZDQA 5JBNA 3RHZA 5DLPA 1T9AA 3V8JA 2MYPA 5K3AA 3OEYA 3U9LA 2E19A 3QHQA 4IMPA 1W1UA 2YZGA 3OM9A 5DNAA 3CURA 3PGA1 2OGUA 1GV1A 3D8RA 3LZCA 4Q1EA 4OH1A 4Q3BA 3J81Z 1YFHA 3P4YA 2R87A 4Z9AA 3RKWA 4RVNA 3PDHA 1L6RA 4QT0A 3U48A 4ENVA 4ARIA 1ZU4A 1ZRNA 3H2KA 5KX5B 2XVZA 2MH2A 1Q2UA 1OJLA 4Y9SA 3F8FA 3RYHB 3P9QA 4Z4HA 3BFKA 2BGLA 1GZ3A 2JBAB 2TDXA 2QLFA 3JWEA 4XLNF 1IXZA 4AZSA 4OI1A 4A1OA 1GL6A 1L5MA 1EGHA 2IS6A 1F5NA 3F6OA 2HLDA 1UMDA 3D7NA 3PK0A 3Q5FA 1K0UA 4NU5A 4AZTA 5JV5A 4D8XA 4PJMA 5TE9A 5BT8A 2GTPA 4G8CA 5F1PA 2QVXX 4L73A 3CE9A 2HRQA 1GHCA 3PDUA 1TVMA 5EKDA 3PUZA 2M4GA 4HVLA 1W5AA 4PLHA 1QNLA 4JBAA 4JBGA 4D80A 2ZJAA 1VJ0A 2VF8A 4QGFA 4D4LA 2CW0F 1NV9A 1NQAO 5EJ9A 1FSEA 3R8XA 1R66A 4RFSB 5E8GA 1QXSA 3K4LA 4QOEA 1ENPA 1YRWA 3K4QA 2I2CA 2YW9A 1LVUA 3DFGA 4GICA 4GP9A 2GBYA 2XB9A 1WR8A 4JYPA 5H80A 4OQDA 2XKOA 3MERA 3RC9A 3KWJA 1IBLB 5KQMA 5CU7A 4K0KB 2EW8A 1RI3A 2GESA 4YBZA 1WDKA 2JPDA 4CEJB 4F4IA 4B47A 2VTDA 2XF2A 4E09A 2BVNA 5E8JA 5BNFA 5BQ5A 4PYKA 2EHJA 1CEQA 3QI7A 3J7ZI 1D9ZA 2XYHA 4UTOA 1HDRA 2CXOA 5TF0A 3UGKA 1ZBQA 2BAGA 4RY9A 1V8ZA 3CPJB 3OUUA 2NYRA 4IDHA 5JMTA 3BCBA 2NV6A 1HNZB 3BICA 3K0HA 4Z1MD 3DLHA 3ZBQA 2ZUDA 4AROA 2V5VA 1J70A 3FTNA 1DKUA 3ZDRA 3NS7A 1RTKA 1P1JA 3M1LA 3EEBA 1GUYA 1Z2AA 3SQMA 3LO8A 3RT1A 4M9SA 3BTOA 4XX0A 4NVRA 3FCUB 3OIYA 1JBKA 3OFVA 4LIUA 4HZFA 1NW6A 3GR6A 2K02A 5TLSA 4AX8A 2GAFA 4M6XA 3W5HA 5L51A 3WL6A 3OE1A 4EGZA 4X1YA 1EYZA 2ANBA 1ZJ5A 1TJ4A 1HFJA 2EFOA 3ZVRA 1TQ2A 4FS3A 1PR4A 2M1XA 4LYAA 3V1YA 3DBRB 3TQRA 3PHHA 1RWOA 2Q5OA 5ALPA 2I33A 3SEFA 4YRGA 4P3YA 4H0NA 4G5RA 3AL0B 2UKDA 1LPBB 4OKSA 4KSBA 4GS5A 3L8HA 4JGGA 3DAPA 1WZNA 1J5PA 1B6GA 2F64A 2H0RA 1WMDA 1E62A 5IYZF 2W6ZA 4BNZA 3EG5A 3CSUA 3LBHA 1ETYA 2AFHA 5J2TF 1OTHA 3BXPA 1Z45A 1ZA1A 4ZAWA 2OK7A 4BB6A 5JH7A 4OU4A 1XMAA 4Z51A 1NDUA 2Q0QA 1QIDA 3EXFB 4G12A 1ZN7A 4KO3S 4DMRA 2CUFA 4YR9A 2ZJ6A 3FHCB 5ALSA 2JG3A 1X1EA 1ECJA 5KYXA 1U5AA 721PA 1A8IA 5HMLA 2ZR0A 4OX9Y 3BWEA 3KBOA 5IKMA 3NGLA 2CNBA 1IN6A 2OWEA 2WABA 4CMKA 2OCYC 4NYMR 2B1GA 3SU8A 2XW6A 4CR8A 3F7TA 1Z5NA 3Q11A 1B8NA 1BKSB 3RPQA 4NXNB 1E4OA 4RIFA 1VBKA 2VATA 1YE3A 4GXQA 3LT2A 2Q0SA 1BGVA 3HVJA 3BB1A 5FQNA 1HBJA 2Q45A 3RODA 3ETHA 8MHTA 3DG9A 5FJ8J 1KC1A 4WI1A 4CMIB 2R6HA 1PTJA 3CF5F 3ESWB 4JT4A 4MQ4A 5JDIA 4MEJA 1I3OA 4O4LB 1WUJS 4MV5A 4TTAA 2WWRA 3TGLA 3SYNA 1KO5A 2D7JA 4KPGA 1AQ6A 1MKYA 5JXJA 4UBMA 3SDBA 3BR6A 3NOVA 1VF9A 4MQFB 1ODLA 3S28A 5CFMA 3DSRA 1EQUA 2NU6A 3BUSA 1JE0A 4BKRA 1QFSA 2LCFA 1U7TA 3I6ZA 4AYXA 4H1TA 4YPVA 3MFQA 3OLZA 3MOGA 4U1RA 2V7GA 4WLOA 2ZXIA 5ETJA 3RQSA 4II2A 1H4SA 1CJBA 3D1JA 4RAZA 2Q9BA 1E6WA 5GP9A 4R0MA 1YFZA 4B84A 2QSUA 3LZDA 4QYWA 1TEHA 3RSSA 1BXKA 1YS6A 2FBHA 3IGFA 2Q7OE 5CH3A 3D7LA 4RORA 1HNXB 4ZO9A 4E7KA 1X7WB 2POQX 4PYMA 3CX7A 3PCTA 1QFXA 3L6UA 5IJXA 3F5SA 3V1NA 2YMQA 5C1OA 1KSGA 2VIIA 4MRNA 3CZPA 3L79A 3UOWA 1QF7A 1ORDA 1E9RA 4MVJM 5AKYA 3FHLA 5AMXA 1PZMA 3LXMA 1M6HA 2MH9A 4OQYA 2WB1A 1R6DA 3G1TA 4WN3A 4WXMA 2YOGA 2Q27A 5M3FJ 3QKRA 3M8EA 1I2BA 2C58A 3ONVA 3F3YA 3UFXA 2XPWA 1IOZA 4BNMA 3U1TA 2F3TA 4GLOA 1CQJB 4MTCA 3ZCQA 3VPAA 3ZXIA 5C1IA 4DC0A 1QWSA 5A2QA 1C1DB 2BLLA 3BG9A 3IV5A 4MEBA 3IBTA 3O82A 1Z6RA 2WB4A 2ZTLA 5B3LA 2O59A 3MS7A 1UBEA 4JASB 1LB2A 1R6UA 2QLBA 3U1KA 2W93A 4OHYA 3UUFA 3DTYA 1AB6A 5EKUA 2QTAA 5CCBA 5JRDS 1LSSA 3HQ4O 4R9SA 1OXBB 4NJEA 4BTLA 1X8LA 3S29A 2XXBA 1WDWB 4L5BA 1Z4OA 1W7PB 4GNKA 2YWGA 3CX3A 4N7RA 3RV3A 2HRDA 3ADPA 3CUQA 3W04A 4MUBA 3SBDA 3AYZB 2VSXA 3V4LA 5DT2A 4BFCA 1M6WA 1LVKA 4NJOA 3HRIA 1CUCA 2ZRFA 4FZRA 1RRVA 4E6PA 1C3VA 2X5OA 3UCEA 2GERA 1R7RA 3RSNA 1X13A 1EFLA 5LNK1 5CFPA 4OV6B 1R4ZA 4EJVA 3DUWA 2Q3BA 1WWXA 3BWBA 4AUNA 4GRAA 2I7VA 4H77A 2C7QA 3QYFA 1J49A 3GMTA 2VZEA 4RK6A 1ST3A 3VZQA 3H3ZA 3FK6A 2O54A 2WAFA 3FXOA 3UWKA 1QIIA 3JZFA 4PG4A 3JATB 4YBRA 3QPUA 2I1QA 3NP7A 4CG3A 4TLLB 1RADA 3TDUC 3OU2A 3JREA 3NTQA 4S1TA 2N42A 2V0NA 3KOMA 5E17F 3USZA 2NAZA 3OY7A 2AJTA 1U1EA 2ERYA 3IXQA 3KEGA 1RDFA 4OIMA 3A2NA 5LMCA 1Q7BA 3JASB 2B5OA 3FM9A 5KQRA 2QUFA 3EIFA 3JR3A 2X19A 1YA4A 4F3RA 1EUCB 2XWQA 1TCUA 5CDTA 1G21A 4WL0A 5KTRA 4KFRA 2PR2A 4BN4A 4CV3A 1NI4A 1RZ3A 2ZRDA 4M1KA 1FNCA 4HAVA 4L1KA 3QENA 4Y4RA 3C87A 1IZZA 3FCAA 1R18A 1YR3A 1OBFO 3RF7A 3TW0A 5LM3A 1MEEA 1VRVA 2PKRA 2EBFX 1PLLA 4UFNA 1WB4A 2I2XB 2DA2A 1KVTA 4TL7A 2PL5A 3TQHA 2QU7A 1PQ4A 2DERA 3GRAA 5CB6A 1DAIA 1G8JA 2MABA 1G0OA 2H5JA 4F4FA 4KQFA 1JQAA 1YT5A 1H1LA 1SQSA 4LISA 3J81A 4EKIA 1VQNI 4NB5A 1CZLA 1S3IA 1ZDMA 1P7JA 1A5BB 1DV2A 2CC2A 1SMYF 3NT2A 2XWSA 3WKAA 3KP2A 4ZCMA 4CMCA 1K9VF 3GGOA 3LWFA 4H1HA 1Y81A 1YQ9A 1ECLA 2ZBRA 2DA4A 5IJAA 5B2EA 4GOKA 4CT4B 4PPYA 1UFQA 2IEIA 4BMNA 1Z25A 3QX3A 1NNLA 4QGHA 1DWPA 3KE8A 3OKCA 4FDTA 1O57A 3GLFA 4DMLA 5IJZA 2VJMA 2AOVA 2AJBA 3JD0A 3MWDA 5FULA 4B3DA 1ULZA 1X92A 5HF9A 4E1BA 3ZNQA 3HRKA 3FUXA 3HBFA 4BRSA 2IBSA 3S2GA 5FFMA 2X41A 1DEHA 1ZHHA 1F8UA 1Y42X 1J9ZA 4YJHB 1LUAA 3B73A 3K1TA 2V1DA 4S1VA 2FU4A 2FLWA 1JKRC 3BXEA 2O8VA 2Q4DA 3LY7A 2V6BA 1F60A 3PRKE 4RIGA 4RBOA 1NL3A 5F51A 1JAYA 2OXRA 1WV1A 2RC5A 4KJXA 4GRDA 3B7PA 1P2TA 3KSDO 1OFUX 5TIIA 4EYKA 3J7YJ 2V6JA 1TB4A 2FFRA 1AO0A 1EZ4A 3L09A 3TRDA 1I2CA 3WP1B 3GTKJ 1G66A 4UHEA 4KN7X 4ZVRA 1FFEA 1JALA 3AETB 4P38A 4HDCA 1FZQA 1FDTA 1ZEMA 1P2SA 1Z3CA 1TWFJ 5C4XJ 3RYCB 5KX5A 5IKXA 4YALA 3ZHBA 3DOFA 3G2JA 4KACA 2D54A 3RYHA 4PU0A 4YUYA 1QOQB 2JBAA 5LU8A 1W48A 3EWNA 1YZNA 2RGNA 4PEVA 2AI2A 2I9PA 5C5EA 2E37A 2SECE 1ACMA 3ISPA 2PVCA 4N65A 2UZ1B 1X4PA 3Q8LA 2AQFA 1QJ4A 4U8GA 4W9MC 1Z4LA 4DRYA 1R2QA 3F5QA 2F7SA 1YDGA 1UEXC 5IEBA 3WGNA 3UHAA 3IMKA 4K0RA 3TEDA 3R5XA 1M2GA 2HHCA 3LCCA 1Q1QA 4WUTA 4RMNA 3L1PA 5DDGA 4KE6A 3PFFA 5B1BH 2P3QA 4E21A 3V7YA 3EVTA 1XPOA 4YCJA 1AV6A 3ZGLA 2I22A 2OAGA 1W46A 2QMOA 2CVZA 4KKVA 2O0KA 4LE1A 4A8HA 5THQA 4G01B 1PFVA 2VF5X 3FOZA 1U04A 5C7YA 2JIQA 3NRCA 3PQCA 1X7DA 4ON0A 2GAAA 3S1RJ 1NVKA 3CRMA 2GJ4A 2BBTA 3BXOA 4RFSA 4S0XA 3UO8B 2R6R1 2NP6A 4XR6A 3I23A 2IP1A 2RGYA 5C46F 5REQB 3STVA 5F1RA 1JDNA 1I0ZA 4B2IA 5JBQA 3UV7A 1U99A 4KP7A 1JYEA 1Z2DA 2R62A 1QNTA 2WOOA 3KM0A 1B26A 2O06A 3JAKB 2P1RA 2VPQA 3EUAA 2VK2A 1GGJA 3I4FA 3I39X 4CEJA 1E9CA 4Q16A 2ZJZA 3HEFA 3IKJA 1YUNA 1LEHA 2FPOA 5F7ZA 2RH9B 3KC2A 2FFQA 3AT1A 5A6VA 4I99C 1ZIDA 2H7YA 4OHUA 5DNVA 3H0EA 3WNBA 1FFAA 4XVUA 1AF4A 4LZOA 1SOMA 4ZZ2A 4URVR 3SCZA 1YVRA 3JR9A 1YSCA 1HTBA 4PGMA 5JS1A 5A7HA 3F23A 1I7SB 3ABLH 2HSGA 1L7XA 1TQMA 3GW2A 3FUWA 3AUFA 4M0PA 5E9JA 3RSGA 3EW7A 1A9OA 1D4FA 1EBFA 3K0KA 4X8LA 3PI7A 3FKJA 2GEKA 1ZUNB 2Q1WA 1O4VA 2OMEA 4AG5A 4N9WA 5ES4B 1B93A 3P9KA 2FW7A 1ZNQO 2P6RA 3DHYA 3C4QA 3VZBA 5E1WA 5F7XA 4MWDA 1WP9A 1DWQA 1MT3A 2XOKA 3R9WA 2EGUA 4P2BA 5CB4B 1K88A 5JU6A 1QV9A 4HPJB 5CVJA 3L18A 1MZPA 3DBRA 1L5RA 4KBGA 4A0YA 2FQXA 3ROEA 3WZLA 1ZK4A 3L3BA 4NCNA 4X6LA 5K8UA 2WAEA 1ZMTA 1Z4QA 1KZ6A 4MHOA 3Q9NA 4CCJA 4DCOA 3DCFA 4RDXA 3KKNA 1DP7P 4JIMA 4M21A 3RUIA 4YXWA 1SKMA 2WFLB 3NATA 1ZUD1 3VUEA 2IODA 1DXHA 1ENYA 4A0HA 3QFSA 3EHEA 3IH4A 1PJRA 1N0IA 2C31A 4EG6A 5D3ZA 4DFDA 2YASA 3PFGA 5M5XJ 3Q2OA 1AMOA 1SAUA 3ERED 1E1YA 1Q83A 1OR7C 3OHMA 4EGFA 3EXFA 1U2SA 3IR5A 5ULLA 3I5XA 2P2LA 4MVCA 1N9KA 2CK3D 1QRRA 4OD0A 4LJ7A 1V3TA 4S3MA 4O1MA 1YKSA 2P27A 4A93J 1ZRFA 3KDAA 1GZ6A 3VDNB 5HKBA 3ZOBA 4QXOA 3ZDEA 4IQ0A 1FW6A 3R75A 2PRJA 4JCOA 1IY8A 3DLBA 2O5EA 2WQ6A 2QQGA 1Y1SA 3AERB 4KDEA 4MYDA 5JDCC 5EZ6B 4ALJA 4X71A 2YKGA 1VSVA 2QMUA 1G5IA 3PXDA 3RVBA 3QEBZ 1KSHA 1O94A 4JL5A 2RKBA 4KZKA 1M5RA 5M5WJ 1RZRD 2H85A 2EK5A 5MGBA 2UXCB 4G8BA 2VUMJ 3TAUA 2Z5LA 1T3SA 4CMIA 2W57A 4BBAA 2PO7A 1W8DA 4K40A 1WA5A 2YHBA 1A35A 1H9CA 5JTUA 3T3DA 2P3OA 1QIGA 1L3BA 3R2JA 3FAKA 5ARCA 1XDZA 4LHWA 1D2HA 3D2CA 1K98A 4J0EA 3FLBA 2IOQA 5EJ2A 1IONA 1X15A 2W0SA 4MQFA 4IEJA 3VO1A 3EAFA 4G1FA 3KAKA 5AI5A 2JK1A 5CYPA 2B2NA 5BOSB 2BEJA 1GUFA 3NXKA 1ZM9A 4KX5A 2EV9A 5D6EA 4HX9A 3ZBPA 3QX9A 3KLNA 4FMBB 1IY0A 5EC8A 4CR7A 3ORFA 5JJIA 1E1RD 2BBOA 2HQSA 1R0ZA 2L2QA 1R6TA 2P7IA 3DMFA 1RM4A 2IEAA 4MWEA 1IM5A 2Z2KA 3SVZA 3PC2A 1UAYA 3A6FA 3DL7A 5BQTA 3MJ4A 4PQEA 3E1GA 4WDRA 3IA7A 4UV9A 3IHKA 1X7WA 5KNCH 2YBDA 2YSRA 5CLLA 3LF2A 2LD4A 4GOXA 4LDQA 2XGXA 4DV0B 1QMGA 4AICA 1O03A 4TUYF 3EVBA 2WNHA 1N2EA 2WWWA 4NDLA 3FPKA 2QQAA 2AOXA 2HMTA 1RVDA 1BI0A 1O5IA 2V79A 3QODA 3UT5B 5KVCA 2R79A 2VN2A 2C3YA 1I5OA 5HBRA 1S3GA 3VYTB 1JT9A 4UFPA 1YKGA 1CQJA 1NI3A 3HVRA 1QO0A 4I3GA 5IM4F 4GGOA 1BVUA 1C1DA 2L7MP 2LKSA 1FMVA 3K73O 2FRXA 3BRWA 4JQZA 2X8LA 1IEWA 3EQ2A 4QQKA 5E6UB 3AWDA 1IHUA 4W1UA 2W7TA 2OMKA 3OSGA 1ZGGA 2Z2SB 1K7CA 1HZJA 3BOQA 4MW7A 2YX4A 1JR4A 4NQZA 1XAJA 4US0R 2IEGA 1VQLI 5EA2A 1MBHA 3LBAA 4H35A 1WETA 1PWZA 3QXSA 4EHDA 3GLHE 2C2HA 2YXDA 5TISC 2J3IA 4HY3A 1CUBA 2XJ9A 3EQ8A 2EZTA 4LQDA 2BEVB 1BJKA 5DLEA 1MNMC 1W7PA 5B3JC 2FE4A 5FQOA 1NYRA 2QLZA 3BJOA 3HPRA 4ZDLA 4Q03A 1ISGA 2PLNA 5AVRA 4ZEVA 5LB4A 2QYHA 1YV9A 4V2IA 2Y1FA 1XTJA 3D6AA 3R74A 3X44A 1Z4KA 1DBQA 1OH5A 1Q0RA 1UZMA 1UJBA 4EB3A 3T4XA 1VJCA 3GROA 3EEOA 5E2IA 5BWLA 3X2SA 2BONA 1G3YA 5IDXA 4LOLA 3LFTA 1YCFA 2IXBA 1SM4A 2PKQP 3HU1A 3OI7A 4ZD6A 2FHPA 2KYRA 4JX8A 5C7IO 1DRUA 3PRYA 3LIPA 2QR2A 4FCYA 1WDTA 4L9SA 2C78A 2JH3A 3UT6A 3DHVA 3ZE6A 3MMSA 2HF9A 3LCVB 4X1OA 4WK4B 4DUGA 4RTKA 1I7QB 4BYGA 1O7JA 3JATA 3PENA 4DCJA 1M1YE 4NHEA 1Q0SA 1T8SA 2DH5A 1N2GA 2H7XA 3ZVKA 3LHFA 3MYYA 4AB1A 1ENOA 2OUMA 2O2GA 2QX8A 1PJAA 4BUJA 2VC0A 3ITKA 3KR2A 1L4HA 2IE0A 3T5DA 2M2EA 4GI1A 4JP8A 5DV5A 2JLBA 3JASA 1ON2A 1K5PA 3MG9A 3A6HA 3CZ6A 4RD1A 2GBGA 4IZIA 2XKJE 2PH7A 4O8ZA 1EUCA 5ERXA 2G76A 1KOFA 1PR1A 4LOIA 2YXPX 4A2WA 2IU3A 2ABWA 1R9TJ 3NWTA 2R9VA 1TADA 2ZJ3A 3EN0A 1X7HA 3ACDA 3RI4A 5HRUA 3S0JA 3AIOA 4ROSA 5CYOA 3G89A 1TXGA 4UQOA 4ATNA 2AOUB 3R5JA 1I1NA 4F3YA 3KP1A 5AXCA 2HA4A 3W4IA 4C08A 2EFQA 5BMVF 4RU1A 2EHDA 2WJYA 1BH2A 2PX0A 1TTTA 1XNHA 1IF1A 2M87A 1DQUA 4PZPA 4GWKA 3K9HA 1RIFA 4PHFA 3SZLA 2EGHA 3DFZA 7MHTA 1YA8A 5K5QA 2HTSA 4QDKA 3P0FA 2EKDA 1ZKMA 2YQZA 4RH0A 3E3VA 3HYTA 3SQXA 1JWBB 1P62B 1T8RA 1FOKA 4YIFA 2QN8A 2WV7A 4B7XA 2FEWB 4HZUA 2BKLA 4BX8A 3EOBI 3UKOA 2VZ0A 4JQCA 2W22A 3H97A 1R16A 1P6RA 4R8MA 1TF7A 1O54A 4DANA 3JALB 4YJHA 2R7KA 3FPAA 4N82A 3OWOA 3R5TA 1SG9A 4A3IJ 2JCYA 4PE5B 4CL3A 3F7OA 3WGVA 3JQBA 4BKOA 3KJGA 5HTOA 1X7YB 3K09A 2GM9A 1R5NA 1QIMA 2C00A 1TM5E 2B0CA 4Q1FA 1SBTA 3AJ9A 3JRWA 3QIAA 1LPOA 3GCMA 2H6CA 1ZGHA 3WZ2A 4R0NA 4A0RA 2WJ6A 3C5HA 3AETA 2LD5A 1PGQA 2IPLA 3J7AC 4O4IF 2W11A 1L1QA 5A5VA 3PWSA 3IDZA 2ZRGA 3GUYA 1ONBA 3UMVA 3RYCA 2E1MB 1K4TA 2XUZA 3CRW1 5J58A 1QHXA 4F8JA 4OXXA 2DEUA 1JI8A 2P5SA 4IUCS 3OQ6A 1B2RA 1Y6JA 4D96A 5IC6A 1YB6A 2IHBA 5FUVA 4V19K 2UZ1A 4CSWA 2X6QA 4A8JC 1PFKA 3M6VA 3NP9A 4IKOA 3DOCA 1MD9A 1GRNA 3RKXA 2EKQA 3SZGA 1QUEA 3NTOA 4JP2A 4TL8A 3FCXA 4G41A 1K89A 1W96A 3FJ1A 4HDUA 4QVGA 2EZ4A 5KJ6A 2XGDA 1BZYA 2MSCB 3NJ4A 4WFQA 4M37A 4WZBB 4QTRA 4ZYGA 4JUAA 4P83A 1VQ9I 3B9QA 3S15J 3IVRA 1KQ8A 3HACA 1SCUB 3TS1A 5F21A 3I55I 2WE7A 2UYOA 1LB1B 3NTUA 3ECSA 3FXJA 4J03A 2W4SA 3H5RA 2A68F 1KBZA 1ZSYA 1Q92A 1RXYA 4JDUA 4TYQA 3FR8A 4UULA 3FKIJ 5DH9A 4IPTA 4U0VA 1JF8A 1FNBA 3DLTA 3BOSA 3S2UA 4XB6B 4ENKA 4QBKA 3C7JA 2XTNA 2DP4E 4K26A 3WHCA 2ATCA 5DI3B 2QQ8A 3JAKA 4BPRA 1A50B 2KFDA 2OLEA 4HNSA 4QOGA 2A0FA 3ZI0A 5EEHA 2CBZA 4M1MA 2PJRB 3T5TA 3SWWA 3C24A 4MINA 4JAVC 1WOMA 4AECA 1GOTA 4IHJF 3H5NA 5AVJA 2WD8A 1P5RA 2VPIA 4KAJA 1AA7A 1GPWB 4C2AA 4ZP1A 1IHXA 4N4OB 3TP0A 3ABRB 3OX3A 1NDHA 1RRMA 1YB4A 3ZRGA 4XYLA 4BH9A 5E18F 4YFYA 3K0EA 4B44A 4BNYA 2VPYA 2YY7A 5TXGA 1NA5A 1XCVA 3IHUA