1SD5A

Crystal structure of rv1626
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
b'PRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
molecule keywords putative antiterminator
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd5A01
2JPBA 2VK2A 4MS4B 2DFIA 2IPQX 1LB2A 1CGPA 4UXNA 3RVJA 3CUQC 5LRRA 3M9XA 5DLEA 1W5SA 2CG4A 2CFXA 2O8XA 1EHCA 4DN6A 1OXKB 3C3KA 1FYKA 1APBA 1TJYA 3DP7A 4ESJA 2QBYA 1H9CA 5D6EA 1JHZA 1EAYA 2FTKE 3QOPA 1BI0A 2IVMA 5E3JA 1GLGA 1R23A 6PAXA 2QQAA 1BOAA 4YCSA 2OAZA 2KJBA 1SFUA 4JA2A 5TPZA 3N75A 4WWHA 4N03A 5K5QA 4JQFA 2DK5A 2CWDA 2PLNA 4W5RA 3FF5A 4N0BA 5BR1A 4HF1A 1XGSA 4OIQF 2FMIA 2UXXA 4PEVA 2MBFA 3A0UA 2BGCA 2LF7A 2VBXA 4HDUA 5K5RA 5TQ2A 2DQLA 3F23A 4K2EA 2YR2A 3COAC 3GXOA 5KQPA 2PG4A 4Q48A 3CJNA 5HVQC 4UV9A 4HNQA 5CNKA 1LQ1A 2VODA 2HQNA 1R00A 1HBXG 2JVKA 2Q0OA 3H5WA 5CJ9A 2QWWA 2LKPA 4TLMB 4WZZA 2P5VA 1I1GA 4AD9A 4WXMA 5FLXK 2FQXA 5DEQA 2TDXA 5BS6A 3ZP5A 2FN9A 3K9CA 3AAFA 4MS1A 1FFSA 1BM9A 2F2EA 4RWEA 2XAFA 3Q7TA 4ETMA 2Y0MA 4HLXA 4P96A 3TKYA 4OIOF 3HHGA 4ZYHA 2STWA 2DT5A 3NNDA 4RDCA 3K9TA 3KLOA 5KQMA 1KYWA 1O7FA 3FMSA 2NZVG 3QEMA 3N0RA 2Y75A 2E4YA 2B0LA 1Y1LA 1R8JA 4KREA 1XDUA 1HKSA 2GQQA 1Z6RA 4U0VA 2OQGA 5LGTA 3URMA 2ETHA 5FWYB 2ZO4A 4W5QA 3TDZC 3K1NA 4GYGA 1R1VA 1HQCA 4D74A 4MR7B 4KK3A 1Z16A 1UB9A 3HRUA 5ICGA 3P9KA 1BIBA 2A9PA 3TGNA 4M9XA 4EVSA 4EJOA 5TE9A 4RK6A 2FEPA 3BY6A 2HEOA 3I58A 1R1TA 4LK1F 3FWEA 4HZFA 5JNWA 2JTVA 4LE2A 4UVAA 1ZH4A 1W4MA 1JDNA 1SFXA 4HQMA 2IP2A 1VRVA 4KYWA 3E97A 4PCQA 4ML3A 3I5UA 1U0SY 2FN8A 1LK0A 2BGGA 1RXIA 5TRDA 5LHIA 3ROTA 1K79A 4ZYGA 2H6CA 4RKRA 3Q9VA 4CBVA 5TPWA 1SXGA 3RTRA 1XSDA 3J81K 1OYYA 1WRJA 1W9HA 2WJAA 3RI4A 3JPWA 4G97A 4P98A 3ZN0A 4RZSA 3LUFA 3HYIA 4IHSA 3RVMA 3LKVA 1ISSA 1QQBA 1R36A 4HBLA 2CHFA 1J0RA 3O3KA 4G86A 4MLCA 4OLAA 3EDPA 3BJ6A 3KHTA 3DFGA 4HX7A 2FU4A 5IUJC 3A3KA 1Z26A 4RGXA 4F06A 1JFTA 3EYIA 2LSOA 1BIAA 3GEZA 5HS9A 1FP2A 1TQMA 3BRQA 4OU0A 2M5WA 3BRSA 4RGSA 3IRQA 2K27A 2JK1A 2RKHA 2X0LA 3GBVA 1USIA 2NRAC 3ILYA 4LRQA 1F4VA 4IRHA 2GA2A 3NEUA 5TJJA 1KQ9A 1DJMA 3HSRA 2HR3A 2D1HA 1QP7A 2NT4A 3FHZA 3IWFA 4HLYA 4YR7A 3KP2A 5IULC 2ELHA 3H5IA 3IPAA 2M87A 1R5HA 5AIPA 3WTUC 4ETIA 1U5TC 4FX0A 4KUMA 1XMAA 1A2OA 2HZTA 1J9IA 1T38A 5HQJA 3O2SB 1ABEA 3WU0A 3V4GA 1KRXA 2G9WA 1YW8A 2P7VB 1KQ0A 5C5CA 3SHFA 1YK1A 5FFXA 2LDUA 2QXYA 2QYOA 2JVIA 4I02A 1T34A 3ZPLA 3GF2A 3RKYA 2V1UA 2PFBA 1ON2A 1ZDMA 1TQPA 1YVUA 1W7PD 5ICCA 4YG2F 4HA8A 3QPTA 3GFIA 2XVCA 2HKOA 4QYMA 3N0XA 3LUDA 3MMNA 3R61A 3BOQA 6CHYA 1MB3A 3FMVA 3GT7A 5E17F 5DKFA 3WTSC 4KPYA 4M71A 2TMYA 2ESHA 3OV8A 1IIBA 1W25A 3TOBA 2PBIA 4I2OA 2UXNA 3J80Z 3HIFA 4L4UA 3LTEA 2V79A 3HOTA 2I6FA 5JNVA 1S7OA 4XRFA 5JNTA 4EUKA 3HCWA 3CG0A 1ABFA 3QELB 3EQZA 2VC0A 3RQIA 3GX4X 5K1YA 3Q5FA 3HUGA 4G0YA 1HSTA 4CGZA 4NQWA 2F5EA 4M73A 1DG9A 1D2AA 4E7OA 2XAGA 4MR8A 4AVPA 2DQRA 3LQRA 4RV5A 1KU9A 5A2QK 2FQ3A 2PUBA 3WODF 3QPHA 1DCFA 4U7DA 1QBJA 2QENA 4MTDA 1Z18A 1ZAYA 3B73A 2L4AA 1D3YA 4A0YA 2FLKA 2O61A 1QO0A 1EH6A 1SFEA 5T7BA 3QX9A 2EB7A 1QP0A 4KNYA 3T38A 3QP6A 2IDMA 5JS2A 4IRIA 1XMKA 1Z05A 3O75A 1SD4A 2NNYA 1GCGA 2IA1A 1LDJA 4KT5C 5DTEA 2H94A 1IN6A 2OU2A 4F8JA 5E1XA 4ZJPA 1IAWA 1ZLKA 1Z7UA 3E5UA 4MRMB 4F11A 3R4KA 2IPAB 1FPQA 4GGGA 4OINF 3HDGA 4R79A 2AYZA 3HTSB 3RH0A 1OPCA 2Z33A 1KU7A 3KCNA 4ZMRA 1EFAA 1CF7A 5FBKA 2OD5A 1TTYA 2O03A 1SXHA 4JB0A 2FEKA 4IMIB 5BQ3A 4AIHA 2PMCA 2XDYA 1ULYA 3P7NA 1TW3A 3KSMA 2DTRA 1J7KA 3K0LA 4EYQA 1IRGA 3U1DA 3TQNA 4IPAA 3E61A 1FYLA 4RXMA 2MSWA 4KMUX 4O1HA 4YIFA 1C0EA 5KC9A 4RK4A 1SXIA 3DQVC 2PL9A 2R47A 2J5OA 1FSEA 3LA7A 1A04A 2EV6A 3F8FA 1YMUA 3EJWA 4U0WA 2VOPA 5H6QA 3WGHA 1I3CA 1XWWA 4XSXF 2E4WA 4ZMSA 5J8CA 2PUAA 3E5QA 5HLGA 2KIFA 4LLLA 2G7HA 2IPNA 5B3JC 3KEQA 2GBPA 2AS5F 2YU3A 3O21A 2NAZA 3CO6C 1Z12A 4XXHA 1PHRA 3KTOA 3MFKA 4ENNA 2PUCA 2FA5A 1WKMA 3ZMZA 3TO9A 4ZPJA 4OG2A 3LQQA 3JY6A 4G0PA 5C5EA 3MM4A 3MAJA 2XAJA 3I4PA 3F22A 3RVQA 3T8YA 3KP6A 1XDSA 5LGUA 4LE1A 5FWXA 1Z17A 3I59B 1YK0A 5L3BA 1BVHA 1RXEA 2RJNA 3OLXA 3CLOA 4BQAA 3WTWC 1EWVA 4LB6B 1TNTA 3HSFA 4KQ9A 1DPUA 3F8MA 2A6EF 5TPZD 4OMYA 1FT9A 1YYVA 4JK1X 1JHFA 4G0MA 3RVLA 3RPQA 4KV7A 4EY3A 5EWMA 1RNLA 3GWGA 3HK2A 3RKXA 3E6CC 1SMYF 4BHCA 3BWGA 2W84A 4M6XA 5DCMA 1GXPA 1RPJA 2K7LA 4WF2A 2OA4A 2ESNA 1I5ZA 3LUKA 2MYUA 4H3HB 3KCCA 1F1ZA 1REPC 4RK5A 4RS8A 4ESFA 5D5UB 4WUTA 1AWCA 4NICA 4IXAA 4G7HF 1QQIA 4WWCA 1K78A 3IHUA 3GWZA 4Q5SF 2EFWA 5BRAA 3DPTA 1BA2A 4MHGA 2WV0A 3GYBA 1MVOA 2WY2D 3DLBA 5F6FA 2L19A 3FFXA 3OM0A 4M88A 3Q9SA 1BJAA 4WXCA 2N9UA 4MGRA 5HOOA 2RVCA 3CUOA 7ABPA 3P9CA 3HO1A 3IC7A 3KJXA 2A9OA 1DBWA 3KYJB 5L3GA 3FGZA 2FQWA 4HNRA 2YHBA 4IRXA 3KFWX 3WE3A 3CKMA 1MIHA 3MZHA 4F7ZA 2HQRA 1Z9CA 1JH9A 5T3YA 1R58A 1D5VA 5IC5A 1EH8A 2FLWA 2VUHB 1MD0A 2MH2A 3RIRA 3GA5A 3H3UA 3EETA 3G1WA 3CUQA 3JPYA 3ZMUA 4UUVA 1YO5C 4IHTA 5FD6A 1QNLA 1G3SA 2F5DA 5EWLA 4RKQA 1IN8A 3ZMSA 1JYEA 3F6OA 4QWQA 4DADA 5JI6A 3HVRA 2VN2A 1H9TA 3GV0A 5CVUA 3ERED 3RVPA 1NHAA 2ZKZA 2ZNYA 4EJWA 3LAJA 1B9MA 2H09A 3TMYA 4HAMA 3J80K 3MQ0A 2IPLA 4EMSA 1FSPA 2OZ6A 2QLZA 4EVIA 3DZDA 1KRWA 3KP4A 3WU1B 3NHMA 4HW0A 2L54A 4LLNA 2JBAA 3C3MA 3O1HB 1WETA 4Z2YA 3HEBA 1EWTA 5E8GA 4I98B 3MCZA 5HDNA 1VTNC 2GX6A 4LDAA 1KGSA 4GCVA 1ZLJA 3SAJA 3K1PA 1S3JA 4KFCA 3LKBA 2J5PA 1BDJA 2FMYA 3H5TA 3WE2A 4LD5A 4D6YA 4G6QA 4DQ2A 3E3VA 2QZJA 4MR9A 1ZHFA 1ZY2A 3UKJA 2KKOA 1SD5A 1USGA 4Y17A 4L5IA 3I0TA 5JVTA 3QEMB 1HSJA 1UCRA 3H5VA 3U9GA 2EJRA 1NXXA 3H5OA 3D0SA 1BC7C 5D6FA 2LNBA 3OO0A 1HW2A 4RU1A 5J6XA 1DC8A 1USTA 4RSMA 4EVRA 4QLCU 4Q6BA 4WT7A 1P92A 2VBYA 2OZUA 4KN7X 4ZH4F 1TNSA 1XSXA 2JCGA 2W24A 1RUNA 5BMZA 2O20A 2R48A 3JS5A 2Y48A 2HKXA 4ENMA 4YWHA 2K4JA 3SY8A 4MS4A 3L09A 5HS8A 2CO5A 2XKOA 3GBPA 2E7WA 1PP8F 5ICEA 2D1VA 2CW0F 2FEZA 3KP7A 1KU3A 2CYYA 3R0AA 2DPUA 3PFIA 3CNBA 1Z6TA 1FOKA 4G0QA 1NATA 1L3LA 1ZGAA 1G3TA 5CYVA 1O3TA 4HV6A 3DGFC 1IXCA 2VBZA 3JTGA 4Q47A 3RVRA 3L2CA 4LLGF 5D4RA 1ZARA 3RJPA 4S04A 5TPWB 1YIOA 2VUIB 5JNSA 2VT3A 1FYMA 2ZXJA 2KIMA 2IPMA 3MF4A 5ILUA 4ZZDA 4MNUA 2A07F 4CYDA 3H3ZA 1S29A 1LJUA 3B2NA 1IN5A 3NQOA 3C97A 2EFNA 4Y15A 2HPHA 4GPAA 2DLLA 4RK1A 3V7RA 2CD7A 2QVOA 2IA2A 1MDMB 1NXSA 3NNSA 4KIFA 5CLSA 5TQ0A 1YTUA 1D8JA 3QEKA 4MQFB 1IXRC 1CEYA 2Q2EA 4OOIA 3H92A 2GXGA 1FBQA 2PAFA 4PZ0A 5I4CA 2PMHA 5GQSA 1Z91A 2D45A 3L7WA 1R22A 5IEJA 2RGVA 4LFUA 4TLLB 1BI1A 4CDGA 1XGOA 5ERIA 1S8NA 1H0MA 3NBMA 2RC4A 2D2WA 4EJUA 2BE5F 2V0NA 4UVCA 1P6UA 2P4UA 1GCAA 3I42A 4A5MA 3WGIA 4OATA 1QMPA 4G7ZF 3GRCA 1L5YA 5D5WB 8ABPA 3KZZA 2HJ9A 3IRRA 4KIBA 4RB2C 1XCBA 2PMUA 1ZITA 4U0YA 3IP7A 3G3ZA 1JFVA 3G85A 2QSJA 1LEBA 4RB1A 5F64A 1QO0D 3JSOA 3CRNA 1DCMA 4A2UA 2ZMEB 1X3UA 2ZWMA 2ZBKA 4HV5A 1QKKA 4MEYF 1LVAA 2LPMA 2PL1A 1LJLA 1D5WA 1KU2A 4MR7A 4N76A 3EODA 1U5TA 2HS5A 5PNTA 3ABTA 1OKRA 3C3WA 4U7BA 4AIJA 2EA2A 2W57A 4EM2A 4A0XA 3O1JC 1XB4A 1BI2A 3W9SA 2ID9A 5D8LB 3EQLF 3DLHA 1Q1HA 2FNPA 2EFOA 1ZN2A 1XHEA 4ENKA 1HKTA 1TLFA 2NUBA 1VPWA 5HLIA 2HYGD 4ZYEA 3SFZA 4N9IA 3ZMDA 4UVBA 4AIKA 4JAVC 2DRIA 2QW1A 4MS3A 2EV5A 3O1IC 3QLVA 4NQRA 3MIZA 5BRJA 5L3CA 2FBHA 4LB5A 2CWEA 4IJAA 1YMVA 2UZKA 4OTZA 2L3DA 3LA3A 2RGYA 2FOKA 2LIVA 3CG4A 3F8CA 5D5XB 2YX4A 4N0PA 3TO7A 3ECHA 1O3RA 1B1BA 1MAVA 2QUFA 1K68A 3F21A 1G3WA 4NHJA 1U78A 2JVJA 2Q8KA 4RK0A 3HRMA 4WXDA 3DXJF 3T0YA 3L9FA 3ABUA 4A12A 3QLUC 3R0JA 1Z1DA 3QLVC 2V6CA 2WJWA 4I7HA 2ID7A 4Z99A 3TX6A 3GL9A 2WMYA 3DEUA 1IN7A 3IKTA 1ON1A 1P2FA 4YO7A 1FC3A 2DW4A 2FNAA 4A6DA 1XN7A 4NCBA 4A6EA 2V9VA 3HJFA 2RJOA 2R4QA 3V8JA 4TN5A 1E6KA 1WQ2A 1ZVVA 4O5VA 2XIGA 2CHEA 3O2QB 3F8BA 3LUCA 4I0AA 4M74A 4EJVA 3R60A 1IF1A 4FT8A 1SD7A 3ECOA 4RB3C 1DCKA 1RI7A 2VBWA 2E4VA 1OYIA 3HSEA 3ELKA 1V4RA 1JHHA 4ASNA 4MQEB 5LHGA 2FXAA 4A5NA 5IT9Z 3FDFA 5DCLA 3Q7SA 3N97A 3IKVA 2FSWA 4WX9A 5IT3A 3V7CA 2E1CA 3OOPA 4YFKF 2STTA 3M8FA 3SNKA 5E8IA 1PEYA 5LEJA 2QU7A 2FBIA 3DKWA 1PNTA 4E70A 4MTEA 1GHCA 3MA0A 2QQ9A 2PEXA 4YIIA 3DGEC 1T0FA 4L0YB 4BHPA 1JL3A 5KI6A 3K1MA 1XD7A 2V1DA 3N6VA 1MJAA 3GZ6A 2MYTA 4HX4A 1W7PB 2QR3A 4E7PA 1USSA 3ZN1A 2P6TA 1PP7U 3FZVA 3JW4A 3C6QA 6ABPA 3FMQA 1K66A 4Q7EA 4KMRA 1MB0A 2L4MA 2R7DA 3GO5A 3KP3A 5J8FA 4R1HA 1NY5A 3L49A 1Z25A 4Y13A 4EYGA 1OMIA 4XSZF 2RV8A 4GXOA 2QVGA 4Z4GA 3I54A 2L2QA 3GLXA 2MYNA 4P9UA 2DU9A 4JBAA 5FWXB 3LAPA 1BC8C 5B3JA 2MYPA 4LG0A 2E4UA 3WGGA 3UUGA 2DPDA 2XUBA 3L00A 4CO8A 3EYYA 3DV8A 2R3SA 1O7LA 4OIPF 2RDMA 1NXTA 1FSHA 2H3HA 3TB6A 3E6BA 1FQWA 2P4WA 3NHZA 1P4XA 4YGXB 4YRZA 1L0OC 2M1BA 4L9JA 1O3QA 5CNJA 2Q5CA 4RXUA 2W25A 5ED4A 4KN4X 2PJPA 4LX8A 3H1FA 3M9WA 3EAFA 1ZG3A 2XAHA 5DCMB 3NRVA 4P1ZA 2X7XA 2E1NA 4Z9BA 1IRFA 3QK7A 2A6HF 4L85A 3EGCA 2WC2A 5ILSA 5BPDA 5DUIA 1M2EA 1DUXC 5EWJB 4BYYA 4S05A 5IEBA 2EFQA 1XSVA 5F1RA 3ISPA 3VEPA 3ZQ7A 1K78B 4PYRA 4FB4A 4Q4ZF 1OR7A 3GYHX 2P5KA 3CZ5A 3ILHA 3N4MA 4EVQA 2EFPA 1UDRA 3OLWA 2ZCWA 4QPJC 5DYMA 2VE8A 4LE0A 3H6GA 3LA2A 3H6HA 2YHAA 1JBEA 1M5UA 1OYWA 2L02A 1USKA 3F6VA 2FF4A 1LBHA 4N41A 4L9NA 3ZMTA 2VOOA 4LMYA 2GIVA 2PN6A 4HX8A 3DF8A 3GUDA 1QZZA 1HW1A 2GI4A 3F6PA 4XLTA 3F73A 4YFNF 4BXUA 3LFTA 2Z5UA 1L5ZA 3QRFF 1JX6A 5H20A 3IP5A 3DBIA 2QV0A 2FW0A 1KYZA 3H75A 2LBPA 1NXWA 1E17A 1P6RA 2WWVD 1DBQA 4WK8F 5BOXA 3WTXC 1YQAA 3T5XA 1NXPA 2KYRA 4KA4A 1BBYA 3R6SA 4D6XA 3GVAA 2XAQA 3GFLA 3CO7C 5HM6A 4NB5A 4YV7A 3BDDA 1DP4A 3CUQB 4O6JA 3KKEA 3KE2A 3RPUA 2PI0A 2JB9A 2H6BA 5CVVA 4KICA 3I64A 5EWLB 1RZRA 4H0EA 1D1QA 2VYCA 3W6JB 4CZZA 3V7SA 4RGRA 4YLEA 4LJZF 5FGMA 1LDKB 3O2PE 1JLKA 1URPA 1ZRFA 1BAPA 4Z9AA 2A69F 2GKGA 3MQ4A 2PUGA 4PDKA 1PNRA 1M2FA 1K6OA 2DI3A 4L18B 3CTPA 3N0WA 4ESBA 2JSCA 5HKOA 4UHKA 5LBQA 5HS7A 2RDPA 1WSUA 3VNBA 4XLNF 4DQDA 2M1ZA 2FMLA 2QBYB 1C4WA 5FB2A 1C0WA 1KMIY 2YSRA 1ZESA 5E20A 3HDVA 3OMXA 3HV2A 5IUKC 2OQRA 2G7UA 5KK1A 4XARA 3VOEA 2HTJA 5HDGA 3K69A 2COMA 3F8NA 3CZCA 1FZPB 2AYXA 3S99A 4KQCA 1TMYA 1IUYA 4GNRA 4G6DA 1U2PA 5H6RA 3F72A 1TW2A 3OLYA 3WTVC 4G0XA 4HOBA 5TQ2B 3T95A 3HOSA 5DV5A 2ISZA 1J5YA 3KEOA 3QU3A 1ZREA 2EK5A 3P9YA 3QLTA 2R25B 2ADUA 2BYVE 1FLIA 3QU6A 1T2KA 2K86A 1ZH2A 4Q6WA 3C7JA 4RAZA 4KZKA 2IA0A 2QZ8A 1K7AA 1U8TA 2L18A 4ETSA 1F9NA 1U3EM 3JSPA 1I6XA 1HXDA 4MAAA 2WRZA 4FHTA 4QICA 3ULQB 5IT9K 1ZGZA 1QNTA 4MS1B 3IPCA 4G0OA 1P4AA 2FKAA 5ICFA 1NXVA 1YTYA 1MJBA 4PGGA 1RUOA 1PUEE 1U2WA 2O6GE 2OBPA 2A68F 3FFWA 2KRFA 3BPVA 3JTEA 4DNCA 2X4HA 1Z2EA 3RVOA 5FD5A 3CHYA 3H1EA 5LLQA 1R5GA 2RQPA 3REOA 3G73A 2H0AA 5DDGA 3V8KA 2A9RA 1Y0UA 3FXRA 4W5OA 1JGSA 2F5CA 2XROA 3BREA 4HF2A 4G7OF 1B59A 1R1UA 2FBKA 3TO6A 2M8EA 4P5OA 4Z4EA 5A2QZ 2LF8A 4IRGA 3K4HA 2MSLA 3H1GA 2NYXA 4D0PA 4RK7A 1DRKA 1JE8A 1J75A 1XCVA 3IL2A 1STZA 2H27A 1YLFA 2ZNZA 2HSGA 2GZWA 4EV0A 4FE4A 5CHYA 5TQ0B 4EGZA 5HSGA 4IILA 2B1JA 3QAHA 3A0RB 3UK0A 3O2JA 5ABPA 2HTSA 4JASB 1W5TA 4XASA 4XFKA 4Y9TA 1FBSA 3D8UA 1Z2DA 1HW5A 2DAOA 1JYFA 5L3FA 2KJCA 1E6MA 4Z0NA 1SMTA 4G94A 1XGNA 3RKWA 2RNJA 3WG9A 1XGMA 1ZYRF 4XLPF 2MC3A 4L9TA 1TVMA 4YS6A 5JS1A 5L3EA 1ZRCA 3E6MA 2C6YA 1HEYA 1GUDA 2ZAYA 3OLVA 3S2WA 1JDPA 3GFJA 2MD5A 2PUFA 2E4ZA 4KIGA 4XAQA 2XKPA 1TLHB 4P55A 2YPRA 3LUJA 2PJUA 1Z15A 5EEHA 1EWKA 2PUEA 4RGUA 2R7FA 3EQ2A 3BILA 3RYPA 4RY0A 1DPRA 1KQ8A 1OXBB 4O1IA 1YS6A 3IDOA 1JF8A 1IXSB 2HQBA 3KETA 1ZG5A 1U5TB 2PLYA 5FO5A 3Q7RA 1D1PA 4HDVA 5E18F 4MYRA 3JVIA 2EWNA 3EULA 1O57A 1DRJA 2FSPA 4QYWA 4HF0A 4KVFA 1ISRA 1MJ9A 3JAMZ 1BDHA 1MKMA 2HQOA 3ZMVA 2L17A 1GVJA 4MS3B 3FM3A 1U6GA 4CXFA 4EJTA 5EEGA 1O3SA 3C18A 4LGWA 4UV8A 3KZYA 5BPIA 3LWFA 1HKQA 2A61A 3CTAA 3WTYC 4ETNA 1IZ1A 2JRTA 2P5LC 4JB2A 2Z99A 3O6BB 2OENG 1F4KA 4NCAA 4B8XA 3F7NA 2QQBA 2IYNA 2NS0A 4M9SA 2A9QA 1R7JA 1EH7A 1H9GA 2MLGA 2F5FA 1BN5A 1T6SA 3LFKA 5KC8A 2FVYA 3M7GA 5FWYA 3E5XA 3LSTA 1FFWA 3D02A 3OQNA 1LEAA 1S6LA 3QX8A 4PE5B 4O3MA 3FMRA 5AIQA 1M5TA 4MLDA 4L5JA 4UNOA 4OIRF 5CNIA 1XHFA 1SD6A 1MDMA 3T6KA 3ROUA 1YW9A 4MQFA 2DO7A 3T1BA 5D2CA 3BBLA 5GOTA 3PQKA 3B02A 4N9HA 1S7AA 3K2ZA 4EQQA 5CVIA 3QLUA 4IF4A 2FE3A 3HS3A 4N0QA 3DPLC 4EGSA 2W85A 2JT1A 2QVCA 1FFGA 1PUXA 1FY7A 3HHHA 1P6QA 2FMFA 2A5YB 2K4BA 1UFMA 2K02A 4I0BA 4Z4FA 3GW2A 5JHUA 3E6DA 2F8SA 5K5OA 3OO1A 3OQOA 4HNSA 3Q15C 1DDNA 2YX7A 4MR8B 4EGYA 4KRFA 3L6UA 3T8RA 2FQYA 1LDDA 2BBYA 3MZYA 4L9VA 1YFHA 2VE9A 2A3SA 5LEKA 1FBUA 1PDNC 1ZGJA 4MGEA 3M9AA 2VONA 5DD4A 2NZUG 4ZYLA 2BEOA 5D4SA 1B00A 2Z9OA 2IOYA 4PICA 2ZMEA 3GFMA 4OMZA 1P8AA 1JXSA 4RXTA 4IMJB 4HYEA 1RIOH 3F6CA 4RAYA 1J59A 3TO5A 2FXIA 4MQVA 4AWXB 2W42A 2ISYA 1CHNA 4EM0B 1D4ZA 3IP6A 2JRLA 1RZ4A 4XBFA 4WCGA 1FNNA 2HFHA 5DD8A 1DZ3A 2UWMA 2IT0A 3NNNA 1QPMA 3I09A 3TOAA 1CF7B 2IJLA 1LJ9A 5KWSA 1JFSA 1QGPA 4UHJA 4KMFA 4MQ9F 2WB4A 2IRFG 1D8KA 2HWVA 3MYYA 4R8HA 3CLKA 2PUDA 3WTTC 2P6SA 2CGPA 4CICA 9ABPA 5CVRA 1ZG1A 3HTUA 2F8TA 3VODA 1ZRDA 1FWZA 3PQJA 3W6KB 4LG0B 4G0ZA 4JP1A 4YP9A 3RVSA 2NT3A 4TMYA 2NNNA 4CHUA 4WXHA 1CYEA 4U88A 3HRTA 2M30A 3IP9A 3QP5A 3ML6A 1QQAA 5IX8A 1DC7A 3OM1A 2V1XA 3D5LA 1ZHHA 1GUBA 3LUAA 5AONA 1TM2A 2GA1A 4WXEA 1QP4A 3SZPA 2FMHA 3P9IA 4F12A 4JOQA 1TQIA 5LGNA 4N47A 1RZRD 4H60A 4YFXF 2ZJ2A 4Z4CA 3FM5A 2FRHA 5L3DA 4IGAA 5DUKA 3OQMA 2DK8A 1SAXA 1E2BA 2E7XA 1UHMA 3J7AO 3CS3A 2GAUA 4LDZA 1VKRA 3HUUA 1VLZA 1I27A 4B09A 1LBIA 4M9ZA 1J56A 5DGCA 1UHWA 2HDCA 4KDPA 2B4AA 1GXQA 4MEXF 1SRRA 4M72A 3ROFA 4G9YA 3WTZA 2FMKA 2VT2A 5E1ZB 3SQNA 1P4WA 2GXBA 3U2RA 3KYIB 1J2XA 5KVRA 3QELA 1NTRA 3EUHA 3N8IA 2PE5A 2P7CB 1T39A 4H3KB 5FLXZ 1BI3A 4EYOA 3BROA 1ONVA 4GYIA 3HSYA 4MQEA 1ZGGA 3HXMA 1IN4A 1F5TA 2CQKA 2EA4A 4FX4A 1QZYA 2WWYA 2ACJA 2VC1A 3CDHA 1E6LA 2RN7A 2P8TA 5HLHA 1E2XA 5EWMB 3SG0A 1IW7F 1Z13A 2O0YA 4FE7A 4RS3A 2Z3YA 4BAYA 2PQ8A 3OLZA 3BJOA 1KA8A 4W5TA 2XV4S 2M98A 2DBBA 1V3FA 3OMWA 4P9FA 4TV7A 4RY8A 3HZHA 1AB5A 4A0ZA 2O3FA 4PGHA 4MRMA 1BDIA 2M45A 1F51E 1W7PA 2XRNA 2PKXA 5D5VB 4G8XA 5CNMA 5FBHA 1B9NA 4RY9A 4ZZLA 1G6NA 3M8EA 3BP8A 3IWZA 3JAMK 3TDUC 4F3TA 4ENJA 2FEWB 1MZBA 4I01A 3C1DA 2WTEA 3O74A 1YG2A 5IUNC 1ZAOA 3HRSA 3TD9A 4M6YA 1G4DA 1T98A 5LHHA 1JWLA 3KS9A 3F3XA 3VNAA 4BHBA 3SZTA 1U8RA 4Z4IA 3BZ6A 2XGXA 4GO1A 3FXQA 2GWRA 5TQJA 3FXUA 2LP4Y 2L01A 4BH9A 4HQEA 2XHKA 2XASA 3JVDA 5ILVA 1YW7A 3JTHA 2HYFA 5JNUA 3KG2A 3FX3A 1B4AA 4W5NA 3BPXA 5FFZA 3KP5A 2BV6A 4NV3A 2HOEA 3BJAA 3RYRA 3H5LA 2QM3A 4IVNA 1AB6A 1FX7A 3J81Z 2ZFWA 3LOPA 4BNCA 1NXOA 5E1WA 3N53A 3RVKA 2EV0A 2J48A 5BQTA 3CFYA 1TBXA 1PEAA 5JFRA 3RDIA 3LUHA 4ON0A 5EWJA 1QPZA 1A0OA 1ZH5A 4ZYDA 1I1SA 1YS7A 4Z4HA 3MWMA 5IBQA 5KQGA 3RVNA 3VFZA 2JBAB 3VB2A 5D8KB 5DCFA 3I59A 2IKSA 2KIUA 3A10A 3FFTA 3M1EA 4L0ZB 4OLBA 1DP7P 1LNWA 2MA3A 3E3MA 1EV7A 5LRSA 2MLKA 5JNRA 3I5AA 3Q41A 2CSOA 1AOYA 2VXZA 3T8TA 2IW5A 4LZLA 3KLNA 3SM9A 4PZJA 2JZYA 1G3YA 4LK0F 4O5AA 4MR9B 5JR3A 2MSKA 2JPCA 4MPTA 3MEXA 4EM1A 4KK4A 3HM9A 2P9HA 2LUOA 5HDKA 1MGTA 3HUTA 5KQLA 3GZ5A 1U2QA 2HGCA 3CU5A 3V8LA 4OBBA 4I09A 1FP1D 1ODDA 5CVJA 2AXLA 4UHTA 3I45A 3I71A 1B6AA 2MH9A 4RB0A 1DBPA 3LUGA 2E4XA 4EYKA 1WWXA 1WI9A 1U04A 3SXYA 3I53A 3M6MD 3LMKA 3EDCA
chains in the Genus database with same CATH superfamily
4HGQA 3NHPA 2O7SA 3PG5A 2XNDD 3R0IA 1EGVB 4FYVA 2L0KA 5LXTB 4ZALA 1NVKA 2F4VB 2ZBRA 4BZWA 2NQTA 4DLBA 3KBBA 4I19A 2J33A 5EGOB 1CY4A 3LXMA 3DEAA 2RH5A 2BELA 3DP9A 3BCUA 3CC2I 3LDGA 4BRSA 3MWDB 3GEEA 5P21A 3SN6A 3K0SA 1XDGA 2XLCA 4N0BA 4MGHA 5BR1A 1XGKA 2GEFA 3ND8A 3PLRA 3V1MA 4ZZ2A 1A8HA 3YASA 2YXLA 1RCFA 5JHGB 1HA3A 2R8ZA 1GPMA 4RQAA 3GXOA 2Z09A 3CLSC 3D3JA 3OCJA 3A7EA 2QRHA 2XKKA 4F96A 1R5BA 4F52A 2DH6A 4J0CA 5M04A 2W4MA 5KNCH 1E0SA 4GBGA 1UM9B 2IEBA 4L8VA 1I1GA 4M37A 4Y30A 3FTDA 1I2MA 1IM2A 2FP3A 2GCGA 1J9EA 2TRTA 4WLOA 1XCPA 4HLXA 3IFSA 2A5GA 2STWA 2DT5A 3NNDA 3PHJA 1UBOS 4BV3A 3K9TA 2WF5A 4XK4A 2NGRA 4WOPA 2GQQA 3NWPA 3RIXA 3PNMA 5LGTA 5F4ZA 1GPNA 2JRCA 5A3RA 4LXIA 4FFSA 3M89A 4EK9A 1UXIA 5IDXA 5LQRA 3KZVA 2DUUA 1OX4B 2QR2A 4UAGA 1ZUWA 4RK6A 3FZEA 1I2DA 3CPEA 4HQFA 4P2GA 4GUAA 1SOUA 3GLRA 1W4MA 5GP9A 4E0BA 3IXLA 4ZCTA 2AJDA 4P0QB 5TRDA 1XJ5A 2Q9UA 2PD6A 4A0SA 4MW9A 4P98A 1JKQC 3ZN0A 3SXPA 4QEZA 1XP8A 3L1KA 4WNIA 5EESA 1RZ3A 1J0RA 3EBLA 4UUOA 3ZXUB 1ID8A 4IX1A 4J1TC 1XG5A 5THQA 1UP7A 3X1XA 1DI0A 3GBVA 3U44A 2UZAA 1CR1A 3S3OA 1FFHA 4HYQA 3PV0A 4K6FA 1M6WA 4HLYA 1Y8QB 4XB6B 3AV0B 1R10A 2CNWA 1E92A 3OFVA 4EB0A 4X63A 2YFHA 5AOBA 4CCOA 4HV4A 1EGQA 4ME6A 1ESNA 4DE5A 2ZYIA 3V4GA 4B6SA 1SHZA 1OTHA 1ZGWA 3FD8A 3ESCA 2JVIA 2B21A 3TRFA 1E6WA 1T2AA 1GTJ1 3MTBA 2DR2A 4OJTA 1YHYA 5L9AA 3THOA 4DIFA 2XVCA 4DFDA 1INLA 1GNSA 2DR3A 2H51A 2WUGA 4NJMA 1X3WB 4B81A 5L3SA 1J07A 1FVOA 3L8CA 4GM0A 4IGIA 1H23A 4M38A 2OFPA 1CIPA 3GR6A 3HCWA 1UIMA 3S1SA 4XFDA 3QTTA 1G17A 1M2VA 1G8FA 4INPA 1OLSB 1WCYA 3A58B 1QBJA 3N87A 1I6MA 4C03A 4O0LA 4ZAGA 4NOJA 5F2KA 2WZDA 4FBGA 3K8QA 4UCWA 2VQDA 1EH6A 5JO9A 1OJLA 2OAQ1 5IT4A 3LO5A 1JW9B 2VAXA 2NU6B 1GCGA 2IA1A 1ORIA 1NWHA 3BAFA 3ER8A 1R9TJ 1A8IA 1JR3E 4J3FA 4R79A 3IMGA 4W1QA 5AVQA 2PIDA 2OO7A 1OI2A 1ZSVA 2HRZA 3RWOA 4OD0A 4NNPA 2E18A 3ZR8X 2FEKA 5K0JA 3MZ0A 2G7ZA 2R5NA 3T7AA 1VI2A 4AJOA 5AM2A 1WCV1 3TQNA 4B40A 3OSUA 2JFNA 2XB0X 2VNAA 3RTEA 1WXWA 2BGUA 3NETA 2DHDA 2H18A 1C0EA 3DQVC 2PL9A 3EXHC 4R2WA 2SKDA 2NW6A 2VBIA 2XCOA 1UK6A 3TLJA 1AK2A 4CT0A 1BS1A 2C5FA 2NUAB 1G2PA 3GOQA 5EPOA 2NAZA 2HYJA 5DRYA 4HH4A 1VCHA 5T8KA 2CZQA 1KPIA 2NP7A 4P81A 3UMBA 2ODPA 1NG7A 2G80A 4M6WA 2WU0A 1FIAA 4RC9A 3PIOF 3UNXA 2H1KA 4AVYA 4BQAA 5HBGA 3ACDA 4KQ9A 1DPUA 1P3Y1 3PSIA 2JGDA 4JUFA 4D9EA 2X1MA 1B23P 2CXSA 2ZJRF 1OBCA 4UY8I 1HDDC 4XKVA 3V2UA 3LUKA 3IMCA 4IRMA 3NBZC 3RAFC 2O9JA 2GKOA 3DWLE 3ERMA 4WWCA 3ZXSA 4AMBA 3FE2A 3ACCA 1I01A 2PMZA 1RU3A 4Q3NA 5AW8A 3B53X 1TMKA 3J7ZI 5CDGA 3UZUA 2RVCA 3D54D 3LBNA 4WLVA 3H5NA 4AS3A 2ZETA 1A4XA 1M72A 4TTJA 2K2WA 5CFQA 2CV0A 4MWCA 1TA4A 3DU6A 2J6CA 4XNFA 4REQA 1A8SA 4FOSA 3RVBA 3DTVD 1D5VA 2W43A 2VUHB 1FXUA 4M8KA 2O4CA 1CQJB 3H3UA 1KVQA 1LY1A 3OU2A 1SZPA 4Y4RA 1SWVA 2VPTA 1D4AA 3HWRA 4CCSA 3F6OA 3HVRA 1NE2A 2IW1A 1I8TA 5SY6A 4DLPA 2IDJA 2BFWA 3LQ1A 4DYCA 1WETA 2OZKA 4DNXA 1JDBC 1JPVA 1FNDA 4QFDA 3HYRA 2ZREA 3FGOA 1KY4A 4PPFA 3WFZA 4MB2A 4AZSA 1UDBA 3GDWA 3ASYA 1USGA 2EFHB 5JVTA 1AZWA 2XVAA 4O0MA 4LIPD 5KKAA 2JI9A 4MLZA 4MB6A 1O4VA 3B8HA 2YYAA 2EJRA 1ADBA 5FI1B 3ZWXA 2AE2A 1G98A 1L3IA 1G5HA 2B9SA 2A1IA 1XALA 1M2OA 1RP7A 2PXXA 1MB2A 1XSEA 1P92A 3MD0A 3PFBA 2OM2A 1A1SA 3MRTA 1H0RA 4PFOA 3JD0A 5EMLA 1BW9B 3TLGB 3HMQA 1G8YA 2A0XA 3L09A 3WL3A 1K4KA 1JHYA 5HF5A 3B52X 3A01B 5DTMA 1TTHA 5KYGA 4RTRA 1NNLA 3GCZA 1H8ED 1BJTA 2W2OA 3CJQB 5CYVA 3MOIA 4LLGF 3GIDA 2XCTB 4QLBA 4XGIA 2X8WA 4F60A 1FYMA 4L9AA 4XIFA 3FCYA 1C9NA 3GTJJ 3ETJA 3HVHA 3O3NB 3WYEA 2FH5B 2HPHA 3FUCA 1CT9A 1JZQA 1Z83A 1U1EA 4GAEA 4GXNA 5JROA 4JV5B 1C3VA 2W83A 1ZK0A 3OYJA 3GI1A 1XZLA 3C45A 4G0NA 1J23A 1VQOI 2PAFA 3C5WP 1FSSA 2D45A 1R6RA 1W0UA 4KFTA 2ZBGA 3VJKA 1OISA 2K6GA 2GCPA 2ZTHA 3RV3A 3ZWMA 1L5OA 3OX1A 4IL6C 1MW7A 2WZCA 1P44A 3IRRA 2XXAA 5K8LA 4Y52J 2XYQA 2DSTA 1Q3TA 1E9EA 4RB1A 1GGFA 1KO8A 2NADA 3AZQA 5DM0A 1HO3A 3QG5A 2ZMEB 4FJ0A 5L3QB 4XR6A 4MR7A 5CX1B 5BMVF 4X8LA 2YS6A 5G1OA 4U7BA 3HJHA 2EA2A 3CVUA 2PXHA 3UA4A 2FEXA 3GQBA 5D8LB 3D6FA 2OCXA 3U0VA 2A1UA 2DRIA 4MS3A 3D1NI 4FS3A 3M3PA 4YECA 3MJRA 1Q77A 4OTZA 2L3DA 1NK2P 1C2YA 2ZUTA 3ZIAA 1UZCA 2FJUA 1USWA 5IKXA 1LW6E 1AA9A 4CG1A 4YIRX 5F08A 3JQ7A 5ALEA 2HQ5A 4ENQA 2Q3MA 5DMXA 1I36A 5HLTA 3TEDA 4XOIA 4DDWA 1DV2A 2RJOA 1U1IA 4Z0HO 1XI2A 2PX4A 1C4KA 3MMSA 2QTZA 1I39A 5T6BA 2JIPA 1KAQA 3JD1A 5LHGA 3R3HA 5EIWA 4MA5A 4B71A 4CGYA 5ALTA 4CMIB 5AVJA 4IO9F 2STTA 1QV6A 4J7UA 3IIEA 3I5XA 1M2WA 3MA0A 3TLCA 3ZE9A 4JNKA 4KXQA 3AVWA 3BZBA 2CNLA 2ZSIA 1P8JA 3PNKA 2H7YA 5EIOA 1WZEA 1Z56C 3ONNA 2BC9A 3KP3A 1EA5A 1AQUA 5TGDA 3CZ6A 4MP8A 5HEKA 3DE7X 5B3JA 5H5JA 3UUGA 1HFJA 1UEXC 3L00A 2YNMC 4HY3A 2C59A 4NF2A 3DV8A 4BXXJ 2PT7A 1NUHA 3ZVLA 3ZDRA 3UB3A 4P22A 2H3HA 2X4GA 2RKBA 2CUZA 2EVWX 3CCLI 3MN2A 3K9HA 4Q0MA 3NRVA 3HJUA 2R8RA 2Q50A 4N3AA 4PW0A 2VDNB 2JAXA 1J5EB 1YUNA 3JAMA 1XXHA 3SICE 2EFPA 1N6NA 3F3MA 3TW8A 5F1YA 4QWWA 2HNBA 1JBEA 2I66A 2QJWA 3UJPA 1LBHA 3DLTA 4XUDA 1NJ5A 1M1ZA 1R4NA 1KEEB 3K5PA 5H20A 2LBPA 2GD2A 2XRLA 4B84A 1NXPA 1BBYA 1MAUA 5DBOA 2PI0A 1G21B 3KLMX 5CVVA 3SI7A 5JUWA 2D1RA 3LQ2A 5BSHA 2M2IA 2CHVA 1MIJA 1FEZA 2ELKA 5AM1A 1BAPA 1MV5A 2X0FA 4PO1A 4B75A 1P33A 3UK2A 3H9QA 2R96A 4IS3A 4Y6LA 3U6KA 3GG2A 5E8JA 4XJXA 2A8YA 2BI8A 3QYPA 1J0AA 2WYHA 1LWOA 1BHJA 4NEHB 2AYXA 2BFFB 4JROA 4OMFG 3RF6A 3IV6A 2I55A 4EPYA 2ELJA 2R25B 2X1VA 4UEWA 4R68A 3GFQA 3RJMA 3H2BA 1OWNA 4HXGA 5BV2P 5IM4F 4F2GA 5TT0A 1RPWA 1E7RA 3GARA 4X5OA 2MSCB 1EHIA 3GNQA 1UK8A 4B34A 1KMNA 1D8AA 1GZ4A 4CSWA 3OUZA 1ENHA 2O6GE 3LA8A 1OJ7A 1NXQA 2FE1A 1V1RA 4GH5A 1HYGA 1PT9A 1W1UA 1F9EA 1Q19A 1YDFA 3TLBA 3I5YA 3OYIA 2CL5A 3LHFA 4DYQA 4D5GA 5E2IA 2FVXA 2M8EA 5EP2A 4X85A 1EM8B 4IRGA 1NSYA 2AUMA 3M6UA 2MSNA 2COKA 3NO4A 2Q5IA 1TVKA 2ZNZA 4HGNA 1SHJA 4KODA 2DY0A 2QMQA 2D5BA 4AX4A 2GH1A 5A4IS 5KNDD 2POCA 3CCFA 4E2WA 2BLNA 2VLAA 1U02A 4FGUA 2CCGA 3B6AA 2R5WA 3VR6A 1BE6A 1FDTA 3ABKH 4F0JA 5ITWA 4K9PA 4Q16A 1GG5A 2MC3A 1IG7A 1TVMA 3HL0A 3S7TA 5JS1A 1GUDA 3KEMA 3NYWA 4B7XA 1V8BA 3S2WA 1ZJ6A 4LF5B 2HIHA 5TS3A 4UNNA 1RR6A 3OT5A 1TZJA 1OREA 2ZI4A 1CUZA 3FYCA 3G8YA 5EEHA 4MO9A 3RYPA 4HRXA 1CD5A 3WLIA 4WJKB 4DM3A 3VR3A 3GA7A 4WDQA 1L4HA 3IDOA 1JF8A 3KKOA 5CUQA 1CK4A 2DXIA 5DM1A 2ZAGA 2HK6A 4NC8A 4FSHA 4MYRA 5KDLA 2EWNA 3EULA 5ISMA 4R7GA 1E18A 4PCVA 4OHRA 2QI9F 3PSHA 2OHXA 4TV8B 1Q0HA 5EMHA 3RZOJ 2W2KB 1RBYA 1RYHA 1RMQA 2VTEA 1PZNA 1EVQA 3DZKA 4N7JA 2P5LC 3DOFA 2CFCA 1SXPA 1SBNE 3IAFA 3VKUA 2QQBA 2OM6A 2NS0A 1WPKA 3B9RA 4L5AA 1GQOA 3ST7A 3LQYA 3F4KA 4EA8A 3ZKWA 3T9CA 2VP6A 4HBZA 1GGEA 5BPFA 4JXZA 3T5GA 3V34A 2WHPB 1M5TA 3KE9A 5ECWA 1EUDA 3NVAA 2NV2B 2AV6A 4BQEA 2EATA 3ROUA 4MQFA 2J4FA 1P1RA 4PC2A 3PXXA 1S7AA 3QLUA 2W0MA 1XTRA 1L4BA 2H59A 1T4CB 2FUKA 3V1UA 1U0FA 4GI5A 2W82A 4GPZA 1P0CA 1SCKA 2PMZN 3B2QA 5K5OA 4QHTA 4KN5A 4HSEA 2YX7A 4IKFA 5G0WA 2NAFA 5J2TF 5JLJA 3IVRA 5LEKA 5E3MA 2CS3A 1K61A 2VWGA 4ZYLA 5D5HA 1Q22A 2IOYA 2WTMA 1P8AA 1Z3CA 3TL3A 4IIDA 3LLSA 5FT9A 4WL0A 3L6DA 4IDQA 2NXEA 4AX8A 2R8OA 4MO7A 1ZH8A 5ILQA 5CFOA 1G8GA 4XCXA 4IJQA 5EZ6B 1I30A 4LVNA 1S3GA 3BTSA 4BFTA 2PPLA 1WH7A 4F5ZA 4TGLA 5ENDA 3PL1A 4Y1GA 2ETVA 1XJ0A 2CDCA 2AD1A 1FVXA 3VODA 1BE0A 1N2SA 5L3ZA 1SD1A 4NENA 4TMYA 5JDIC 2XT9A 3G82C 3MERA 5IHPA 1S5LC 1E8MA 4X84A 2G4VA 2OUMA 4RENA 2C4VA 1FE8A 1KERA 3NT4A 3O5AA 4X0EA 2ODBA 1C14A 3OCUA 3QTBA 3UMGA 3UENA 3G68A 3T5CA 2VUUA 3BK1A 1E2BA 5EIEA 4MUFA 2L42A 3HZJA 2OV1A 2FSHA 3LUPA 3S4YA 4N5LA 5HF8A 2RHTA 3KSZO 1KC1A 2DWOA 4PC3A 3QELA 4ZZ3A 3QY0A 1BI3A 3IRVA 3EDQA 5CYOA 1NJSA 3B1VA 2Q3DA 3K0EA 2HGZA 3QXXA 4E4HA 4EHJA 2IGMA 5E2BA 4RMJA 4PQRA 5J43A 3GRKA 3QWBA 4E2YA 4C7XA 5KYUB 2X9QA 4KQFA 4P9FA 4M99A 1ND6A 2O0KA 1Z0XA 1JHQA 2V7WA 4YELA 1ONOA 4GWGA 2OHOA 1JLLA 1X1DA 4WRRA 1VBKA 3PD1A 4P3KA 4BACA 3H5RA 2P9JA 3DNPA 5HKKA 1XCJA 3D8BA 5J1YA 4FHFA 1VCNA 2W48A 1YXMA 4OHZA 1WVIA 3WKEA 1FQJA 4IF6A 3CKYA 4IUBS 3KM0A 5F1PA 1Z34A 2AN9A 1E3WB 5BV8A 1WJ5A 1JI3A 1HE8B 3U7GA 4H59A 3FIJA 1N0VC 4LXGA 4KOAA 3KP5A 2IHBA 3EEYA 4NV3A 3NWBA 1E3EA 3H5LA 4F3CA 4JLAA 4AB1A 4POOA 1DQSA 3Q6NA 2HDWA 3N53A 2EFGA 4MUBA 2XVYA 3HDDA 1UDAA 1HF3A 2D59A 2XBMA 5EWJA 4Y9DA 2JBAB 4LXQA 3RKUA 2XNJA 5D8KB 3A10A 2K4MA 2CE7A 4OGLA 5IVKA 1K2WA 4AWBA 4HNTA 3UKGA 1G3YA 5MN5A 1TM3E 5JR3A 4DBLC 1RXYA 1GT6A 1CNFA 3ORHA 4KP7A 2JIQA 4AUEA 4BP9A 4AKGA 4ZT5A 1U3FA 1Q5PA 1JRLA 1IEXA 3S3MA 3WDMA 4CG0A 5CW2A 2VJQA 5CVJA 4IV8A 2AI1A 5LPNA 5KOJB 2ZWPA 3ML1A 4G9EA 3UOGA 2RGCA 3HKBB 4YRPA 1N3BA 3MJDA 2VYFA 4J0KA 4Z9XA 3M1CA 2ZIGA 2QEXI 1J21A 1Z5GA 4MVJH 2PRIA 3Q2KA 1H6BA 2XEDA 2EG5A 3DWIA 3L2VA 1IFXA 4BTVA 1EHYA 1VOTA 3C3KA 1JHPA 2QBYA 2CHUA 1NY6A 2O59A 1H4VB 1QAQA 3H84A 1SFUA 2JD2A 2DK5A 2PLNA 1Z5NA 1TIPA 4KWIA 4ZT4A 2GVNA 2O2YA 2OZLB 4OIQF 4K3UA 1QGDA 2DA7A 3LRXA 4RBOA 1ZUIA 2C20A 2P5UA 3R7LA 1AQNA 4LGMA 3UVEA 4LRYA 4K2EA 2KDOA 1D7AA 4A0HA 4QU0A 1E6CA 4R1NA 4IVQA 4BNLA 4ZJUA 4Q48A 4UV9A 3R6LA 5T64A 1MC4A 3U5TA 2Q7DA 2WP0A 3EIUA 4X1YA 1Q21A 3OZVA 1PR1A 1KU0A 2AYYA 5DEQA 4OA8A 1COWA 2TDXA 4E7ZA 2FN9A 4R81A 1F2TA 3WICA 4RWEA 2BUAA 4RO0A 5IXJA 2EZLA 4P96A 4BXFA 2VUMJ 4ZYHA 1HFKA 4H7DA 3VR2D 4R3WA 4LF8B 4I9HA 3COVA 3RZDJ 4RTPA 5CAEB 2YCBA 2WNIA 4KFRA 3LJKA 3OD5A 3PC4A 4O8ZA 3URMA 2VO1A 3KFLA 4BMXA 4B80A 2GM3A 2BFCA 1UB9A 2GEVA 2DPLA 4Q39A 5C1PA 4KRXA 4QZVA 4A9AA 5JMOA 1SBTA 3UV6A 4TTQA 3KWFA 4IX9A 2P6NA 3FWEA 4RPJA 3H35A 3E3LA 4DQUA 1YL5A 3L04A 2PBRA 4ZZIA 4YRNA 1PEKE 1C41A 4ARAA 4XZ3A 4UVAA 3OCXA 1BROA 1ORTA 3BZUA 3GLFE 3OPQA 1PWXA 4E08A 2AX3A 1U0SY 1Q2XA 3GLKA 4PS1A 1U0RA 4O4LA 3KT0A 5EGSA 2H6CA 1ENOA 1UJNA 1SXGA 1OYYA 3R3JA 1U0EA 4CMEA 1J0XO 2OSBA 3K1TA 4ZYVA 4OXYA 1YE3A 4RETA 2GFIA 1Q12A 3U4AA 3GZ4A 3ADCA 1Y33E 4E5SA 4RGXA 1XVTA 1JFTA 2J9FA 1VLLA 1W85B 2O2ZA 3TRJA 5GGYA 4LWZA 1IZ8A 1XLTC 1N3YA 3MWYW 2JK1A 1USIA 4B6PA 5JRZA 4JMPA 1XZHA 1T0UA 3D7KA 2F62A 1ETKA 2ZUCA 1Z7EA 2GCOA 4UEKA 1VYTA 1F8UA 3TLYA 5FWNA 1QTNA 3TF5A 5IAJA 1ABEA 1IJBA 1PG0A 1NMEA 4KE6A 3SBEA 1WOYA 2XGCA 5DNYB 4DR3B 4NZPA 4WXRA 1GUUA 5K3OA 1MEJA 4B3DA 1MB9A 2QE6A 4ID3A 2J9GA 5IJ9B 1TQPA 3WQHA 5DW0A 1PGPA 3N0XA 4OB8A 1GUZA 3R61A 1LXCA 2Y0SA 2W6PA 1P5HA 4QU8A 3SD7A 4MWEA 3J80Z 2YJ3A 3GX1A 2DOAA 2DWPA 1GA1A 1FUIA 3RT7A 1WVGA 4AKSA 2F3TA 1I2BA 1JEYA 3RQIA 1CUYA 5EKTA 4RTNA 2XWJI 3CP2A 1D2AA 2Q49A 3GEPA 4BNHA 4RVFA 2Q27A 2Y71A 3ZUGA 1IGNA 2VQFB 1I94B 2WICA 2BR3A 5G1PA 1SVIA 2B3TA 2ZW9A 4U9HS 3FHOA 5JS2A 1T3SA 4HXYA 3TLKA 3W4JA 3QP9A 3SLKA 2UUPA 2I4NA 3GLQA 4EQ6B 2IUSA 1B6GA 5CX4A 4BEWA 2FCAA 4ZU6X 1DTEA 4ZYZA 1BVUA 3AFGA 4IO0A 3GUYA 3RFVA 4DVGA 1G8XA 1JUMA 4A3SA 2EX0A 3UXEA 1NBIA 2XGMA 1CY1A 1NJ2A 1GPUA 5CA1B 2O7QA 3KCQA 1LNSA 4NUBA 3W8DA 1W75A 1SXIA 3GY0A 4Q1CA 2X8JB 3PHBE 1RE0A 1CTQA 2LW7A 2AOTA 3T4XA 4BE4A 1A3CA 3A02A 4Q7JB 5GJBA 4ENNA 2FA5A 3WL7A 3IV5A 5BUSA 4ZTUB 3JY6A 1SU7A 3V46A 1PNQA 3MAJA 2PSDA 3RVQA 1IAQA 3JSAA 1HNNA 2ZE8A 3IUMA 1Z17A 5TMPA 3F8TA 3IMEA 3SFTA 2Z6VA 3STXA 1LLUA 2KZGA 1BA3A 4O5OA 2R84A 3H5AA 1SK8A 4YH1A 1XU7A 4DRXB 4LOKA 3C8DA 2Z4RA 1Q7GA 5C80A 4Q4CA 3GGOA 4ZRMA 2GLUA 2ESNA 3KR0A 1GAEO 2ASEA 1LS1A 1LB1B 3O4HA 4NFLA 4ESFA 3R4VA 2IYFA 3N05A 4YQFA 1RC8A 3AYXB 3I55I 1M2GA 3KAPA 3KDSE 2ZYTX 4DDKA 1LFAA 4D8XA 3FFXA 4I6ZA 2WV7A 3EFOB 1BJAA 3B6ZA 4H7IA 4YRRA 3TAHA 4WDRA 4B7AA 4U7JA 3R0VA 2R7MA 4HEJA 5IKPA 1CVRA 1MIHA 5AVVA 2LKXA 3ZTYA 2PLFA 3ZUPA 1BCSB 2VPWA 3PEVA 2FLWA 2UVDA 4J49A 1OLUA 4V3CA 3CUQA 2ECKA 3ZMUA 3C1TA 2IU3A 4XYLA 4DADA 5FJ8J 2P2LA 3DFUA 1KEPA 4PHGA 4R16A 3KPHA 2H7XA 1KYIA 3G9XA 3KXDA 3DCFA 3EVCA 2HZBA 3LDUA 2AFIB 4JJKA 3ICCA 1UAGA 1PR5A 2AZ4A 3ZQUA 1RKQA 3UJBA 3DVRX 2HL6A 3PNQA 4KR7A 1ULSA 1XMPA 1OCPA 3MYRA 5K0FA 5C4XJ 2RNGA 3F71A 1YE8A 1ZHFA 3KTAB 1DWUA 3H2IA 2DFPA 2DMTA 1LLQA 3ABMH 2GCEA 1RT9A 2Q6OA 4JJGA 2I6TA 1VQ7I 1NW7A 1UJ6A 2QR5A 3D4LA 4OMCA 4CM4B 4EF4A 3WBFA 4ER7A 4EVRA 3THRA 5G41A 1MH3A 1D5YA 2Y1DA 1E4EB 4LEIA 5FNZA 2K40A 2O2GA 3DYBA 2W24A 4RUKA 3RNOA 1QRYA 2O20A 2AI3A 3RIEA 4PQEA 2RHCA 1DAEA 1EU1A 1NMXA 3V8RA 2IITA 1V41E 4I4IA 5CQGA 5ICEA 4J7CA 2FZWA 2H54A 5FTNA 3F2VA 3TVYA 1NATA 2FA9A 2D4AA 4ED9A 1B7GO 2FQ4A 2IYQA 1RZVA 4LWOA 1ZUNA 5MN6A 1A50B 1OCRH 1K8ZB 4G36A 4MIMA 2VT3A 2H5EA 3DV2A 4U0KA 5ILUA 4AF7A 2A07F 2IYZA 4QTUB 4IXMA 4RK1A 4TL7A 4TT8A 1JEQB 1LV8A 4A93J 4F4CA 1JEJA 3TQSA 4X3CA 1U7ZA 1QCYA 2Q2NA 1REQB 3IBCA 2RC4A 5HCIA 1HE4A 4QHSA 4HDCA 3HU3A 1H5QA 2BWJA 4YMHA 4OATA 1QMPA 5TGZA 4LHXA 4FC7A 2ZBVA 3WGQA 4E7JA 1M6VA 2WWRA 1VLQA 3L1PA 3JSOA 5D7NA 4GBMA 1Z3YA 1IPFA 3DEIA 2QP9X 1WMAA 1ACIA 3AEUA 1D5WA 1ZU4A 4HX9A 5ER6A 1S01A 3EODA 1KJYA 4OAOA 3ABTA 1PZGA 3O8QA 4MEBA 5FBWB 5D01A 3W9SA 1QHHD 1L5MA 1QDUA 1L1RA 2QYSA 1JGGA 3PUWA 3BSSA 2G4LA 2PTGA 1CJCA 4JAVC 4A3IJ 3EDMA 2C4NA 3O1IC 4O33A 4OQQA 3TEJA 4JCOA 3LP8A 3JQQA 3I01A 1JG7A 2FOKA 1FYFA 3ZJVA 4YMVA 1IQPA 5EJ7A 1CZUA 5GOZA 3AVQA 2JZOA 5FFFA 1EQAA 2BM8A 4PCLA 2BKXA 1EXMA 3FPHA 1W46A 3DH0A 1IN7A 4CM9D 1XQ9A 1PWZA 1ON1A 2ZYRA 2FNAA 2D7JA 2XB6A 1TRHA 4OOEA 1XN7A 3USZA 3OQPA 2AT1A 3BJIC 2R4GA 2DYSH 3I30X 2O48X 2OCYC 2IXBA 4M74A 1O0SA 3WRYC 1XVLA 2PANA 2GPYA 4FJ2A 1KZHA 2FW7A 5FOWA 3JAWA 4W6QA 4QPQA 2IYUA 4TMVA 3UA3A 3DGEC 2P9ZA 2W6JD 2UUBB 2Q9BA 3BZWA 4FFWA 2W6ZA 4EUSA 1YRBA 4RMNA 1HOXA 1K66A 1Z0FA 2TECE 2JCXA 3L49A 1LPOA 3SU8A 2B8JA 3K8YA 2E1MB 2L2QA 3F9KA 1X1QA 2C7OA 1U8AA 5CIWA 4C0JA 1AU7A 4FKMA 4HD8A 5CDFA 2BGTA 3UMRA 2NAPA 2B99A 1WXDA 2XMDA 4U2EA 4GX0A 2R3SA 2J5BA 1N2IA 3BT7A 2UYOA 1XHLA 3NT2A 4YAIA 1KNQA 1ZIPA 3WYNA 1V9LA 3UIEA 2Y0EA 3M9WA 5ICMA 1Y82A 2Z5FA 4PX3A 2X7XA 4F5DA 2A0KA 4BX9A 3ZQQA 4BYYA 1U2RA 2P1ZA 3H1PA 1LE8B 4GI1A 4MUAA 3ISPA 3EPPA 1RFGE 3TNFA 1Y56A 4IDEA 1HRKA 2WKPA 4HDRA 3VOAA 1DAKA 3LE8A 1Z06A 1PDWA 1UELB 2ON6A 4WCFC 1Y0BA 2QMHA 3U7QA 3BH6A 3ZHXA 4ARUA 5HDBB 2VJKA 4WLNA 4H6XA 1E17A 4ZRNA 5BOXA 3WRXA 3WTXC 1TECE 3BFKA 1P31A 4WJZA 3GLLA 4D9CA 3N7AA 5EC8A 2BTQB 2JB9A 4S3MA 2XZLA 3VX4A 2Y2ZA 3E53A 1RZRA 1G8JA 3VVLA 3KXKA 2F4NA 2AC4A 3ETNA 2C1ZA 2Q45A 3RUEA 4C6TA 1SCIA 2NO7A 4OI1A 4R5MA 1E58A 1M2JA 1XLWA 4DLXA 3V4PB 4CTKA 3EGDA 3LOQA 1WMEA 5KYXB 2HXGA 2FMLA 3QOEA 5DGDA 3THYB 2TCTA 1SOAA 1GPAA 1LVUA 2WTNA 2Z83A 2LCIA 2R11A 1MTOA 1JBQA 4QUGA 5BY2A 2FRDA 2BJHA 4PLPA 1I33A 3AHGA 1ZFNA 3U7FB 2I2DA 1BU5A 3HY6A 4IIJA 1J5YA 4XVRA 4BWFB 2BYVE 4UMEA 2ZZMA 1KXZA 2PS3A 4YN3A 4RACA 5A4AA 4RQTA 2QLTA 3O82A 1IV6A 1WR8A 2BAGA 1HEIA 2Q8NA 1RESA 2Y0SN 4RCVA 1U1CA 3ZCVA 2J0UA 1U2WA 2UUOA 2YZMA 2WQ6A 2X4HA 4MQ5A 4BNJA 1YZ3A 3QOWA 2RQPA 1GLVA 3OJ0A 3OOYA 1RLUA 1K9SA 3RIGA 4C9YA 1AA6A 4P31A 4QBHA 4NZMA 2ZYGA 3WLNA 1ARZA 1V54H 3D8RA 3HDYA 3QE9Y 4QFCA 4UNPA 2HSGA 3U9LA 4EWLA 2EYUA 2B1JA 2PXCA 3UK0A 2VP9A 1KZYC 2P9BA 1QH8A 1HK7A 1QVVA 2Z04A 5F7XA 1LLDA 1KVTA 1JSXA 2EFJA 3HACA 2PKEA 1N1MA 4EECA 4BMDA 4GOMD 2GGSA 1DEXA 2VB6A 2VHTA 4KCGA 1SN7A 4KX3A 2ZDQA 1XXHE 4GM4A 5H81A 1W19A 2MD5A 4Q3BA 2YXNA 4EOGA 1HUQA 3LUJA 2F6RA 4DGQA 2GM4A 4DY4A 5DEOA 4RY0A 1ZX1A 1JR4A 3BL5A 3LO8A 2HW8A 2VHYA 2IU0A 1S6YA 2E2HJ 1ZONA 4I9NA 1PT7A 3IPLA 4BGEA 4HDVA 1HSOA 2CJFA 1LDNA 2QA4I 4BRWA 2X1HA 3DR5A 4DWVA 4TXJA 3CJRB 3DW1X 3HKCB 1JNYA 2DUMA 5IANA 3F74A 2AG8A 2WBMA 2A61A 4WK4B 2M9MA 1Z8HA 2JGJA 1YFLA 2OENG 1ZXLA 3PQ3A 1GPBA 2AD5A 3CX4A 5KC8A 1ZW1A 4JI1B 2E21A 3HCPA 1KC3A 4CU2A 4BU2A 5U4QA 4YP1A 5F0HA 3CRVA 1Z7YA 1J39A 2PFSA 1CIJA 4HK4A 2ATVA 3INRA 1RJDA 1WHTA 4L3OA 4ZDWA 4JGBA 4IF4A 3HS3A 3DPLC 2NUPA 3A2LA 4JZYA 5KVCA 2R7NA 2G40A 4QEKA 4RZIA 2MINB 2FMFA 2J6HA 1DTSA 3VSAA 3FZQA 3A4MA 2JGEA 1XRLA 4NBKA 1W6UA 1W88B 3TMAA 3OG9A 3OQHA 3KNZA 4FP9A 5A6VA 5CBPA 1S96A 3WS7A 2Z8YM 4AYXA 4YCDA 3L6OO 5K0NA 4NHOA 4ZOCA 5CLIA 5D4SA 3B5EA 4KO1S 4UUBA 3E23A 2WMDA 3OD1A 4Q1FA 1JAIA 3CBQA 2Q5EA 3VBCA 2GR9A 1UJ8A 1TUGA 4YJ3F 3HJCA 1M76A 4OQYA 4AL4A 3CIFA 1JFSA 3H6KA 5CB4A 3RR2A 3DAOA 2IRFG 4J4TA 4DIEA 1R0LA 4I4TA 4CICA 3L0SA 1SM4A 3IVMA 1J8DA 2WD8A 1Q1VA 1QNFA 2WAQA 3ZV7A 1SVLA 3M6IA 3D2LA 4UMDA 2OCEA 4JLDA 2M30A 3SC6A 4CYCA 2JLBA 1NZJA 3GGPA 3ZGYA 4CKEA 3EGIA 4FSXA 3IXQA 1ORVA 3D7NA 1H66A 4XWAA 5LGNA 4DAEA 3G5MA 3LC0A 2VZEA 2PSEA 3T5PA 3NRCA 1GZ3A 2FWPA 5HX7A 1ADGA 2GOMA 2UYQA 3MHPA 1NNUA 4M9ZA 1T91A 2P6UA 4BBRJ 2FUEA 4XSGA 1ZPDA 2OTJI 5KVRA 4F2WA 1AQ6A 2P7CB 4EYOA 1OVMA 2Y68A 1DMSA 4UEQA 3UPDA 3HXMA 1P6XA 4L7VA 2ACJA 2VC1A 3OJFA 3UUEA 1Z3IX 5HLHA 1DC6A 3GN2A 4OM7A 1K98A 3ROGA 1BO6A 4LYYA 3NEAA 5F3RA 1KA8A 1X42A 3EUHC 3ENZA 3Q11A 1P9NA 2R62A 1LK5A 2JA5J 3MTIA 1B4DA 4RKYA 4OAZA 4JI8B 4MYCA 4HF7A 5K3SA 4MRMA 1R8SA 2PKXA 3PEYA 1IM8A 1CS0B 3NTXA 3ZHYA 4XW2A 3TW0A 1FTSA 4ENJA 2EERA 5HFJA 1Y3AA 5T3UA 5FA8A 4YCLA 3LFUA 2UU9B 2VPXA 4F9TA 4WK2B 1NKSA 1F8XA 1G4DA 1UT5A 2HJWA 2PFGA 3SK0A 3KS9A 3TL6A 5JO0A 2X0IA 2NPFA 5A02A 4CM5A 5AJHA 2Y76A 5LOVB 4LNUB 4IDDA 2RB5A 3JVDA 4MW4A 4BCBA 3BPXA 5T41A 4P80A 4Y8VA 3U0BA 4C3UA 1AB6A 2ENWA 1QC5B 1L4MA 3LOPA 5DBHX 4ZI2A 2EKZA 2C03A 3I9V2 5DU2A 4IEJA 4Y33A 3LRPA 1TBXA 2XF5A 1KOFA 2JAOA 3E7DA 2ERXA 2Q6LA 4LRXA 1QIFA 2XITA 3L4EA 3UWDA 2BDUA 1UPCA 1KJJA 2V7PA 3CZQA 5DCFA 1OA1A 2V26A 2ODNA 1AGPA 1XRJA 2MLKA 3REFA 3I5AA 3LPCA 2I62A 1KR5A 4E94A 2IW5A 2JWTA 2DPGA 4E07A 1Y4AE 1MAHA 4MPTA 3ORFA 1ORKA 4HOYA 2PU5A 1A9OA 2Z6UA 1VYUA 3LGAA 1ZH6A 4J2TA 4UOZA 1FS4A 1J9GA 4OJNA 2VFAA 1W76A 4UJ3A 4LXYA 1XTSA 2FI1A 2RBEA 2I10A 4FZRA 1X2BA 1M1NB 3IQFA 5E6SB 2B0JA 2D5CA 4MRAA 1NI3A 3KB2A 3EGEA 3QPLA 3TSYA 5SZKB 1CGPA 3G1UA 4BOYA 1XFAA 4NH4A 4F38A 2EYQA 1JQ3A 1PE0A 3ZVRA 5DBGA 3FTEA 3DP7A 1DU6A 2KPMA 1JHZA 1EAYA 1R23A 3JQ9A 4DV7B 2OAZA 2KJBA 1KS9A 4L02A 5EKDA 2OF7A 5LU8A 1I0IA 3IAXA 2GJKA 4DEXA 5EIBD 3DJYA 2ZBPA 5LNK1 1RBQA 4CL3A 4HDSB 2X7JA 4OBWA 1HMYA 2VJLA 1YV9A 1FNSA 1L3BA 3ICEA 3H5WA 3ZZ0A 1QGUB 3KHKA 3F96A 4BEVA 4WXMA 5EP4A 3B3JA 4LYEA 1A8QA 2OV7A 4P35A 1L7VC 1Y1QA 4G09A 2OLJA 4LZPA 1T6YA 3IA7A 1CFJA 4YJ2F 1JDVA 1KYWA 1TIKA 3FMSA 2AMJA 1D07A 4JT4A 2Y9ZA 3RAEC 4G1BA 3H2GA 4MDHA 2W2NA 4F5EA 2OB1A 3L0CA 3ADPA 1FZTA 4POAA 1LTKA 4TV9A 5FQOA 4BNFA 4KK3A 3GRVA 2UKDA 3LDAA 1DAMA 3HRUA 2JHAA 4ID9A 1PQPA 4PV7A 5HIAA 4EJOA 4L0MA 1BWPA 4JYKA 5JNWA 1P75A 3EMVA 1ZJ5A 1EP2B 4JS0A 2H31A 2HF8A 4ZREA 4B3TB 4QGGA 2PVCA 3T1YB 3L4BA 3O0TA 1JG3A 1WI3A 4P84A 3TDNA 4ZYGA 5JXHA 1CR2A 1HZJA 1RI4A 5TPWA 3JPWA 2YN0A 3PD0A 5G0VA 2WSLA 3I6MA 1IUNA 4RGVA 4ARBA 4EL5A 4RTSA 3EDPA 3BJ6A 2QL6A 4H18A 3K0BA 2LDXA 5LJLA 5EP3A 4F06A 1WO8A 2GTIA 3FNHA 1FRQA 2RIPA 1NJ1A 5ITZB 3FVRA 1BKYA 1E64A 2RKHA 4QUIA 2C5BA 3PB3A 5CB8A 4JC0A 2QGUA 5ALYA 4KYVA 3ERCA 1YRLA 3KP2A 4KXNA 5C4IA 4MWOA 4RLHA 1A5AB 3FOWA 1R16A 1S72I 5LB4A 2GASA 1CUBA 3ZW8A 4DJAA 3HCAA 2WVGA 3R6GA 3LIIA 2Y77A 3TQTA 2Z9DA 4CLRB 2QG6A 1HT1E 1R4ZA 3LPMA 4TKVB 4KPGA 1W7PD 3DNFA 1ZLXA 2XXJA 3EUWA 3IH5A 4HEA2 4TUYA 3GDGA 2YYYA 4Q66C 4MFEA 1F43A 1USUA 1WUJS 3NTVA 5JNVA 4M87A 2X5OA 4B5LA 1B0AA 1XDBA 4QOHA 2RKOA 1A6IA 3WODF 3WIUA 5DM6F 2CMDA 4MTDA 3CCCA 1Z18A 4YPFA 1YS1X 3CH6A 10MHA 5EEAA 4D3SA 2Q0SA 4A15A 3G79A 5D00A 4WADA 3A9RA 4HQRA 4FDLA 1LDJA 2DFHA 4V0MA 1IN6A 2OHIA 1MFPA 4PSWA 4GPEA 2R9VA 5M3MJ 5GONA 5FHQA 2O03A 1EGHA 2QLJA 2ZAOA 3CZPA 5AW1A 1OU0A 2QX6A 3AR3A 2B2NA 3BWMA 2EINH 4AJIA 4R9RA 2A9FA 5AIAA 4IPAA 2AC7A 4O2AF 2AWNA 1ZRMA 2ATXA 2MSWA 3TS1A 4TTPA 1AHIA 2Z56A 2WV1A 2QM8A 1QHEA 2ZBFA 3FI0A 7MDHA 3UW3A 5H6QA 1YCFA 1VLJA 3I1JA 4ZMSA 2W93A 3RLIA 2OMKA 2BPOA 4KFUA 3A0BC 1M73E 2DMPA 3TTUA 2OCLA 4JLPA 3P8ZA 1Z12A 2FSUA 3QOXA 1YCDA 3UBMA 4M8SA 1A5JA 2ZYVX 3I4PA 4WN9A 4UVGA 2WHYA 2I4IA 3B6MA 1QYIA 3RSHA 1PRYA 4FYPA 1SULA 2FU5C 3T9AA 3CLSD 1H0HA 4H6PA 3AHIA 1OKKD 1TNTA 3GLSA 3SE7A 2OE2A 4XLCA 2P79A 4LK2A 4PQFA 5L6MB 3RVLA 6LDHA 3RPQA 2GD6A 3A3PA 5BPHA 2QQ0A 2XYHA 2BRUA 4M6XA 4QXAA 3L9WA 3G2JA 2VK8A 3NDIA 1EJBA 4BO1A 3NWSA 3LT2A 5EQJB 1QQIA 5TT1A 3C6BA 4QPCA 5TDHA 2HYDA 4ZK2A 3P0IA 4I6GA 2NSDA 1YQEA 1XK6A 1IVYA 4MUIA 4LMPA 5F9MA 3IC7A 3KJXA 2A9OA 4MDYA 3MVEA 4NP6A 4F7ZA 5BWCA 1G2QA 4JKOA 1R58A 4PLHA 2ACWA 2DWCA 3BKXA 1KSFX 4AKEA 2MH2A 1ISIA 2PUVA 3RHFA 1HV8A 3W5AA 4BE9A 4PGFA 5IOZA 2R1TB 1JIQA 1P74A 2DX7A 4CDRA 2IXEA 4HQLA 3WVNA 1KNXA 3UPTA 4DQXA 4C88A 4KNWA 1E2PA 4QWQA 4IZOA 3ETCA 2VN2A 2W4IA 2TS1A 5AVWA 1I2ZA 3W2EA 3ZBPA 1ISHA 3FPCA 4CMHA 4G12A 1SELA 3HEBA 1EWTA 3MCZA 1RM0A 2EDAA 3C5CA 3I04A 3TZQA 1OPXA 3W4KA 4CIWA 2C2MA 3IC5A 4M1KA 1ECJA 3CCJI 4D9HA 4MR9A 2W6QA 3ZE0B 3Q87B 5AUNB 4XA8A 4PZUA 3UKJA 5EZGA 4L76A 2UVPB 1X0XA 1GPH1 2XUKA 1C4OA 3LT4A 2QVXX 4I55A 2J5RA 1THGA 2PGLA 1BFKA 5J58A 4XVQA 3GFFA 3CINA 2WAQN 1II0A 3PEEA 2Q6IA 5C0OE 4EJ6A 4RSMA 4XDHA 2X6TA 3QVGB 4WT7A 5IG2A 1T6XA 3I61A 4W8GA 3DG9A 3S1AA 3N2LA 2ZAIA 1SOVA 3JS5A 2D5IA 1UM8A 1VQNI 1VL6A 2A9KA 2ZIEA 2XKOA 3HNPA 4EB6A 2RK4A 3W34A 2IZ6A 3FSRA 5HODA 4YCMA 1OLOA 2O7NA 4EW6A 4RLQA 4MXDA 5EG0A 1NVAA 1DC5A 4B3XA 3W0LB 1LJUA 2KHZA 1W5BA 1IN5A 2AF4C 3C97A 3QFRA 1AO0A 2VDLB 3TW6A 4ZTFA 2F4OB 4MWGA 1Q20A 5TQ0A 1WV0A 4BNDB 4PYNA 4AJ9A 2P69A 4QL3A 2JJQA 4BQNA 1M8GA 4HAUA 3F5QA 1MH9A 4TLLB 1STOA 1MIOA 4U1RA 1D0YA 3NBMA 2IYTA 4ZGWA 1WZUA 3FYTA 2P4UA 3VU8A 5KTRA 5HQTA 5CYGA 4YDHB 1YR6A 3K1AB 2XUGA 4OY3A 5IBRA 2Y1XA 5A1JA 1CG6A 2PMUA 4FFDA 4UBIA 5JJKA 3BGSA 5JCOA 2R1UA 1Q3HA 2HUNA 1GQYA 3D7LA 2O8FB 1YHNA 2JIBA 1P9LA 4DMCA 2P75A 1XZEA 4HDMA 1KVUA 3ZQ4A 4GDMA 4UOEA 1GKIA 3MINA 3VX3A 1G0OA 1V16A 2VS1A 1DOHA 1XPRA 3HQ4O 3WQSB 3KQQA 3GGCA 4ENKA 2V7QA 2WFAA 1JFRA 4DNQA 2ZPTX 3MG9A 1XPOA 3K6SB 1C4XA 2EV5A 4NQRA 1NR1A 5BRJA 4C78A 4IZZA 4OVKA 4GLJA 4PYOA 2DC1A 4FYYA 3SIPA 1I6WA 1PL0A 2AL7A 1K68A 2P1RA 4PYKA 1RDFA 1QV7A 3FPSA 2EFYA 3KYLA 3ZDCA 3OIQA 5U1PA 3LP6A 4RIGA 3ANTA 2M7AA 1L9XA 4QOEA 4IIXA 2CHEA 3O2QB 1IF1A 4IKPA 3DMHA 1GTSA 3VU9A 4C5BA 4UCXA 1HDZA 4P92A 4GKJB 4KGDA 3WYGA 2D54A 3C98A 3V7CA 3WBBA 2FW1A 3EPHA 3IJPA 1OHHA 3NV9A 3U1KA 3FNEA 2F1IA 1VTKA 2C54A 3QXGA 4YTEA 3AY7A 4E70A 4YRJA 1VBMA 1GHCA 4IIEA 5K0GA 4DCGA 1T0FA 3CX3A 3IEKA 4I5DA 3AUKA 2C2XA 1E3LA 3EXEA 1GILA 1U8ZA 3IE1A 3OWHA 3V9PA 4IR7A 4Q7EA 1GFWA 4WA7A 5GM1A 4JP5A 3SBOA 3GCDA 1OZFA 1WS6A 1Z25A 4Z6YA 2CKMA 4XSZF 4Z4GA 3M1YA 3F78A 1WP4A 3NB0A 1GTMA 1XEXB 4WASA 4LG0A 2E4UA 1YE9A 3WGGA 4UZFA 4H27A 3P5JA 2HOSA 1T24A 3RYHB 3ZCUA 4GMHA 1XKLA 4YGXB 1W2HA 1SVUA 1LCIA 3PUFA 1Y5NA 4LJLA 2OGZA 4KN4X 4QSHA 3KDAA 4LX8A 3BIFA 2VKHA 4HZIA 3HB5X 3W6UA 1KP2A 4IHWA 1VG0B 4XTCS 2VPRA 2PMWB 4PYRA 5I5GA 1MMDA 2OV4A 3QGMA 1UDRA 1EFKA 5JSKA 1IVNA 1E94E 4NOKA 1NN1A 4ZT7A 4FT2A 4IOKA 5T4EA 4JC5A 2E82A 2DVMA 1P3JA 4KGZA 4DLLA 3KZOA 1ZP6A 4GYKA 3X3HA 1LC3A 1AKQA 4CKCA 1U8XX 5K6AC 1BX1A 4P4SB 2CQXA 1NBOA 1R0RE 2BHYA 3KVYA 1A9XA 3H75A 1EQ2A 1IB0A 5I9MA 3FHTA 1X9IA 5JEEA 2OUKA 5CYPA 4IINA 2FR1A 4R71A 5LIPA 1TT5A 3NI2A 3SYRA 2VJNA 3A6LA 1CIVA 5KU7A 1IRZA 16PKA 2O3UA 1VL0A 1YB5A 5KDOA 5LP6F 4MQLA 4MQ6A 1C0IA 1QVZA 4M9QA 1D2NA 4CZZA 4UBJA 4OQNA 1FP4B 1Y9JA 4UDYX 4HKTA 1PD0A 1PNRA 1QV9A 1TLTA 3OKAA 5BN5B 1BMTA 2WLSA 1FTTA 1BOFA 2H07A 3CW8X 4CV3A 3B60A 4XQFA 2Q0XA 2GZMA 3HDVA 1B1CA 3WNQA 3OEHA 3C3EA 5IN5A 1Z88A 3FCCA 2IRWA 4C89A 1ISMA 4XARA 1Y7PA 1CY6A 2LRHA 4D8VA 3OUTA 3WKBA 1ZK8A 4GNRA 4G6DA 3FUWA 1TQ2A 1YVEI 4DT1B 4LHYA 3ZWBA 3JZMA 2YY5A 2ADUA 1BYIA 3STUA 3W7VA 1T2KA 2I5PO 5FPKA 2ME0A 4ZI7F 4JBIA 3BFXA 2FG7C 3O9MA 1YRHA 2WRZA 2N0SA 4QICA 3K1JA 1V8ZA 5IT9K 3BWBA 2O0HA 3KJFA 4XX0B 4B3FX 5IYDJ 4NEQA 5LSAA 1KI3A 3E15A 1YACA 3ZGKA 3NHLA 3EARA 4OOFA 1ODSA 1V4VA 3RVOA 4I46A 2XSDC 1YA4A 3UTDA 2JLCA 3HCFA 3MBOA 2ZXWH 3TI7A 3DKXA 2D2EA 3WE7A 5CDFE 3ODPA 1YJBA 4DLYA 4BWYA 2OB2A 1XCVA 2H27A 5JPDA 5HSGA 4B44A 2YQ4A 5B53A 2W1OA 1QHYA 1X2MA 2JMWA 3OMLA 4U0JA 1IOLA 5JY6A 3HBAA 3GIWA 1XGNA 2IHTA 1XGMA 2XPVA 2RGXA 3IB3A 721PA 2OXTA 4XVHA 5L3EA 2Y1OA 2HGSA 3ANXA 3PEUA 4UFPA 3UAGA 5IW8A 3BBPA 3VPCA 4MV8A 1J0CA 2JK0A 3ZCRA 1PG2A 3ZQLA 1IBRA 2OAEA 4M3NA 2F00A 5G0SA 3E1GA 2VHWA 3DC2A 3PJDA 5DX8A 1NR7A 1UPXA 3E1SA 3B3GA 2HF9A 3BFPA 4M9CA 1RCUA 1PL6A 4NPAA 4IHJB 4HF0A 1ISRA 3JAMZ 2Z16A 2XNDA 4RMHA 2ISSD 2ZM5A 2VYVD 4CV2A 4X90A 2NZYA 3C6XA 1NQTA 1C9KA 2ZYAA 1IHPA 2ID6A 5FCDA 3QXJA 3ESQA 3OCWA 5JJ5A 3SYLA 6NULA 1NSTA 3A9CA 3TKLA 1EH7A 4GS5A 1W0CA 3DLCA 4U2GA 5I7RA 5EAIA 3JARA 2YNMD 3SC2B 4FNAA 3BR1A 5DWVA 3PUZA 2XVXA 3L5OA 3OUUA 1MDFA 5CVTA 3DBHA 2DO7A 2HIAA 3K35A 5D2CA 3HWWA 5BT9A 2QZPA 3PXDA 5SICE 3KPWA 2HREA 1P6QA 2WV9A 4A3FJ 2PRJA 1UFMA 1EZZA 4GFDA 2YXDA 1T9AA 2AZDA 5LBUA 3SWWA 3HXPA 3AHEA 4MR8B 3CSSA 3L6UA 2FQYA 1K3TA 4RIFA 3RTCA 1FLAA 2IZ5A 1YMQA 3PHIA 4OJKA 1OUMA 1RKXA 2C4KA 4KPUB 2AQ8A 5ERGB 4P54A 2JIDA 4AWXB 3AEYA 2JFVA 4AJKA 4CIXA 2CZGA 2HFHA 2AI2A 3NTLA 4Q24A 3REQB 2XPWA 4UE2A 2PUDA 4EX7A 2ZTLA 4JGIA 4RPHA 3D7MA 1ESDA 2WPDD 1FWZA 2CLIB 3PQJA 1G9TA 4LUCA 3GPCA 4GL2A 2EBFX 1M1XB 4MMZB 4U2FA 2X8BA 1YL7A 4JJ6A 4U5QA 5AONA 1S2IA 1KKUA 4AAYA 5EKXA 1QGAA 3TBKA 3UK7A 3HFRA 1AU9A 3FH0A 3FBWA 4IIUA 4CR6A 3JRGA 1P7JA 3W5UA 4DG5A 1SQSA 2QUAA 2GAUA 1ZIOA 1Y81A 1R0BA 4R0VA 3OCZA 1IIRA 1GG9A 2BFDA 2HVQA 3Q0WA 1SRRA 1T8SA 1LDGA 4DQ0A 3Q9NA 1P4WA 4I7EA 5J4VA 4DSZA 1WX1A 1GL3A 5FLKA 3LG2A 2BF7A 4GYIA 1P4JA 4R05A 3W6VA 5KMGA 2VNKA 1G4HA 5TXGA 4CL8A 3R75A 2H2FA 3N1UA 2LV8A 4HXFB 3MBKA 3KYDA 4R2LA 1DKPA 3BWDD 3AEKB 3PQ6A 2LKSA 1RC9A 1ZC4A 2HU7A 3NHRA 2ECOA 4TV7A 1AHNA 3B5IA 1HDYA 2F3PA 2IYYA 3K4JA 5LMZA 1OFVA 3G2KA 3BP8A 3M6AA 2WKRA 3EIXA 3JRCA 3ZBQA 2QTVB 3RDPA 4A0FA 3OSGA 4OK6A 7ADHA 3P94A 3EF1A 1U8RA 2OFXA 3NDBB 3GT4A 3FXUA 3JREA 4AJ2A 1SR8A 4BH9A 3VXKA 5ENZA 4X60A 4I99C 3CT4A 3LSJA 1SBYA 4U4AA 3OIVA 4EHKA 3FX3A 1EB9A 3KOXA 4MW6A 4BU1A 2X1EA 1XTKA 3AESA 4EJ0A 4Q5IA 3EY4A 2X0JA 4XWKA 1WDWB 4KDCA 5JPCA 4PZEA 3UMYA 1OX5A 1FFCA 3GFPA 1VKNA 3OU6A 1GL9B 1E0AA 1HURA 2OAP1 4QE3A 3L3BA 1PEAA 1UKCA 4ON0A 4OHUA 4X24A 3S2DJ 3BG9A 5HJ5A 4MIEA 1PFYA 4MJLA 2I7CA 1FRVA 3P1JA 2IKSA 1L7EA 3FFTA 1MRSA 3AG2H 3RRFA 5FA6A 4OLBA 1FW6A 4C4SA 2NVOA 5B4VA 4LZOA 5KX5A 4BO9A 4I5IA 5AM5A 4HEQA 4B2PA 3SM9A 1D0VA 4EI2A 2AXTC 5AVZA 3BK7A 3L0OA 2JPCA 4YI3A 4IQGA 2GDZA 4C2MJ