1SD5A

Crystal structure of rv1626
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
PRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords putative antiterminator
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd5A01
4UV8A 5HLIA 3NNNA 4PZ0A 5ICCA 1ZAOA 3R0JA 1BC8C 2V1DA 4FT8A 5LGNA 4K2EA 1LBIA 1LJUA 1Z18A 3CUQB 4OINF 1P8AA 3TDZC 4IMJB 3DZDA 2FMLA 2IVMA 1J2XA 6PAXA 5IBQA 3QEMA 2M87A 2FMIA 1ULYA 4G9YA 3H5LA 5BS6A 3CU5A 4KUMA 1MZBA 3KLNA 1XGSA 3D0SA 2GX6A 4I0BA 4P1ZA 3TX6A 3Q9SA 2NT4A 3J7AO 4Z99A 1K68A 2WWVD 1PNTA 3TGNA 2P5KA 1R1UA 1Z05A 2CHFA 2LUOA 5JNTA 2EB7A 1T38A 5D5XB 2K86A 3GFJA 5DKFA 4U88A 1FFSA 2XDYA 1SD5A 1U0SY 4Q7EA 4KIBA 2HTJA 5E18F 4BHPA 2FMKA 4B09A 2F5DA 3G73A 4Z9AA 2WC2A 3QPHA 4ETNA 1W7PB 4EM2A 1BIBA 1WKMA 4L5JA 2JPBA 3KCCA 4HW0A 1NATA 1JWLA 5A2QK 5D5WB 3T8RA 1A2OA 3CS3A 2XASA 1U3EM 5DYMA 2DI3A 1XMKA 4KA4A 3ABTA 2QQAA 4S04A 1EH8A 4HX4A 4PGGA 3QLUA 4JAVC 1L3LA 3OMWA 5BQ3A 2FQWA 3G3ZA 2CYYA 3F8MA 2IA0A 3JTHA 1R8JA 1XHEA 1Z26A 4F8JA 3CHYA 2XAJA 4QICA 1BDJA 2ZO4A 3M9XA 2O0YA 2ISYA 4D6XA 4I0AA 3O1HB 3RPQA 2OU2A 5H6QA 4UHJA 5HLHA 2P4WA 3CJNA 1L5ZA 1CF7B 3LUGA 1RUNA 3RPUA 4XSZF 5KQLA 3V4GA 1O7LA 3ECHA 2GKGA 3LFTA 1ZH2A 3WODF 2IPLA 1GUBA 2RGYA 3Q7SA 1PDNC 5TRDA 1YW7A 2IRFG 1UCRA 1ZARA 4E70A 3IPCA 4EYKA 5DCFA 4JA2A 3KE2A 3HRSA 3TOAA 2FBHA 3DXJF 2M5WA 2WB4A 2DFIA 2Z3YA 4XARA 2E4VA 3EQLF 4WCGA 1DPRA 1F5TA 5FLXZ 4XFKA 4G6QA 1PEYA 2RJOA 5HS7A 1FYMA 4JB2A 2VN2A 4AIHA 3KYIB 4MR8B 3FZVA 2GZWA 4FE7A 5D2CA 2VOPA 3I4PA 3RVLA 1KU2A 5L3EA 3SM9A 3HDGA 1MJBA 2RDMA 4G0XA 3MMNA 4CO8A 1BJAA 4PGHA 1BC7C 1I3CA 3LUJA 2E4YA 2P5LC 5DDGA 4Q48A 2NNNA 4RZSA 3O74A 3T8TA 1K6OA 3KEQA 3RJPA 5DGCA 2QBYA 1LEAA 3WTYC 1EH6A 2ETHA 3H6HA 1XSDA 4M74A 1KQ8A 2LP4Y 2NZUG 4RXUA 1D4ZA 1AWCA 4LLNA 2JT1A 1FYLA 4HDUA 1YW8A 4A2UA 5DTEA 1ZHHA 2XAGA 4Z4CA 1FFGA 3REOA 3A10A 1NXOA 1R22A 2ZNYA 3DLBA 4Z4EA 5E1XA 2HOEA 2OQGA 2FOKA 1PUXA 5D8KB 1H0MA 3P9IA 3I45A 5IUNC 3V8KA 2H09A 3Q7RA 1QQAA 2MYNA 2JBAB 1ZLJA 3UKJA 2HYGD 3OQMA 4TLLB 4G0QA 1HKQA 1GCGA 4JP1A 1R00A 2P7VB 3BZ6A 3QP5A 3IP9A 2PUGA 5JNRA 2QQ9A 2K02A 3R60A 2JB9A 2WTEA 4I02A 3RYPA 3F22A 3WTTC 4QYWA 5FGMA 2YX4A 4H0EA 2YU3A 3OLYA 5JNSA 4RXTA 5A2QZ 4GYGA 2WWYA 1O7FA 5ILVA 3K9CA 1WQ2A 1FQWA 1ZGJA 2AS5F 2H6BA 3OQOA 2P4UA 5FB2A 1R7JA 3K1NA 1IN6A 4HAMA 1RUOA 1TLHB 1FFWA 1RZ4A 5TQ0A 1APBA 5CVIA 2E4ZA 1BVHA 1SMTA 5TQ2A 4MLDA 3BREA 1JYEA 2IA1A 5BPDA 3E6BA 5TQJA 2X4HA 4M9XA 5K1YA 4IRIA 3P9KA 4MQFA 2XKPA 1QKKA 4YGXB 1EWVA 2PUAA 1LBHA 3GBVA 1XGOA 5EWMA 1USGA 2LSOA 2WRZA 4PICA 1TQMA 2GI4A 1QMPA 3CG4A 3D02A 2QQBA 3E5XA 1JL3A 3CFYA 3K2ZA 5L3DA 3O75A 3K1MA 1HXDA 4ESBA 1BM9A 3OLZA 3CDHA 2YPRA 4KNYA 1KU7A 2QR3A 1P92A 2F8TA 4IRGA 1IXCA 2YHBA 3M1EA 1J5YA 1BI3A 2NUBA 3E61A 4Z4GA 2XRNA 1UHMA 3LQQA 2V79A 3QU6A 2L3DA 2FMHA 1OYWA 1P6QA 4HBLA 3HS3A 3NEUA 2KIUA 4MTEA 3SXYA 4EM1A 4N0QA 5CVJA 1JFVA 1YS7A 3HTUA 1JHZA 3D8UA 1T98A 2A61A 3OV8A 4YIFA 1JYFA 2L18A 4B8XA 2JSCA 3RI4A 1MJ9A 4P9FA 3DGEC 3H1EA 2MSLA 4HX7A 2W84A 3RDIA 1WWXA 1A04A 3FFTA 1E17A 4LLGF 4AWXB 4MGRA 3H92A 2E4XA 1R5HA 4MQEA 3KHTA 1F4VA 3BRQA 2HS5A 5KQGA 4HNSA 1TLFA 4G97A 1UHWA 2FQXA 1XSVA 4EYQA 1H9CA 1O3RA 3OLVA 4L9JA 4WWHA 4D6YA 1XB4A 3A0UA 2IA2A 3GZ5A 3KYJB 3M9WA 1LDKB 2MD5A 2DPUA 1TM2A 3LUCA 2JZYA 1W7PA 1NXPA 3OQNA 1Z2EA 2Z5UA 1SD7A 1DBQA 3K1PA 3P9CA 1OPCA 4MR8A 1QP7A 3HDVA 5EEHA 4JQFA 5FO5A 2R25B 5JS2A 3HYIA 3GW2A 1D1PA 3ELKA 2IPMA 1WSUA 2HKXA 1ZH5A 4M6YA 4MR9A 1TMYA 1M2EA 5IT9Z 4IGAA 2ID9A 3MAJA 4MS1A 1PUEE 3F21A 2L17A 3LWFA 1YQAA 3DKWA 1DC8A 3C97A 2E7WA 5HQJA 4M71A 4W5QA 4EM0B 2AXLA 3E5QA 1REPC 4KZKA 1BOAA 1P6UA 3GEZA 2Y75A 5GQSA 1J75A 4MNUA 1Z9CA 1QZZA 2STTA 2A07F 3BBLA 4DN6A 2FEZA 1MJAA 2EA4A 4IMIB 3ZMUA 1O3QA 3ZMTA 3F6OA 2H94A 1FBQA 3WG9A 2BE5F 1NXVA 3C6QA 4R1HA 1BI2A 3KZYA 3MEXA 4PZJA 1CHNA 3ISPA 5DEQA 2RC4A 2GQQA 1LEBA 3IWFA 1E6KA 1IRGA 1S6LA 2PLNA 1P6RA 4N0PA 5DLEA 4XLTA 1R58A 2MBFA 3SHFA 1QO0A 2Q2EA 2KYRA 2A5YB 4WWCA 3I71A 3QU3A 3H3UA 4UHTA 4EJTA 2IW5A 3JPYA 3ZMVA 4EMSA 1FT9A 4G0PA 2STWA 4MRMA 5E20A 2NNYA 4M9SA 2OZUA 4LE1A 2Y48A 3KETA 3A0RB 2ZJ2A 3N53A 3JSOA 1VLZA 4GCVA 4A0YA 3RVRA 2VBZA 4G8XA 2UWMA 3WE2A 4ZYDA 3H75A 1R1TA 4GXOA 5BOXA 1TQIA 1QPZA 2ZBKA 3K9TA 2FTKE 2H6CA 2BBYA 2RVCA 2AYXA 3CG0A 4CBVA 4IXAA 1FOKA 1IUYA 3OM1A 3FXUA 4YRZA 2XAQA 5CVRA 3LTEA 1IXRC 3IL2A 2CGPA 1JF8A 3TD9A 4IRHA 4RS8A 2HEOA 2LBPA 5ICGA 4KN4X 3LUHA 1IZ1A 2M45A 5IUJC 1F9NA 3RKWA 4MYRA 4HA8A 1ZGZA 4G0MA 4RK7A 4F3TA 2V0NA 2CHEA 4KPYA 1MB0A 3F8FA 3F8BA 2O61A 2RGVA 1K79A 1K66A 3MCZA 4AD9A 1T34A 2OBPA 3IKTA 4G7ZF 1YVUA 3S99A 5LRSA 1TVMA 2CQKA 3HIFA 2DQLA 3QLUC 4YWHA 3T5XA 3GT7A 2HJ9A 5TPWB 2PL1A 1FWZA 3MZYA 5D8LB 2IT0A 1E6LA 4ENJA 3L09A 5IEJA 3AAFA 3LKVA 4CZZA 4RWEA 4NICA 1SFEA 2F5CA 3RQIA 3CZCA 4CGZA 2WY2D 1Z17A 3GLXA 1QQIA 4F12A 2EFOA 5L3CA 2RKHA 1Z15A 4IJAA 2G7HA 5FLXK 2M98A 1QZYA 3DGFC 5HKOA 5KVRA 1M2FA 1ZG1A 4LFUA 3RYRA 1IF1A 4KQ9A 1DBPA 1IN5A 4YO7A 1IN7A 1OYYA 2NT3A 3EETA 2QU7A 4IHSA 3UUGA 4N9IA 4H3HB 1XCVA 2KJCA 2R3SA 2LF7A 4ETSA 1YYVA 2DLLA 4I2OA 2G9WA 4L18B 2A9RA 1ZREA 3F8NA 4WXCA 1LJLA 1SD4A 1DCMA 3CZ5A 1EV7A 2Q5CA 5E17F 1XGNA 1EWTA 4AIKA 1DDNA 1J9IA 1JHFA 5ERIA 2J5OA 1U5TA 2HPHA 3HEBA 1WETA 3EAFA 1A0OA 3FMQA 3OLWA 1T2KA 1W4MA 3HHGA 2BGGA 2XGXA 2V9VA 2KRFA 2W42A 3ERED 3ROUA 1MKMA 3BPVA 3WTUC 4M9ZA 3TQNA 1I1GA 3MF4A 3VEPA 2DT5A 4XXHA 3HK2A 3BRSA 3QX8A 3EODA 1D8KA 3VFZA 1YTYA 4UUVA 2EV0A 1E2BA 4NQWA 3RTRA 3FM5A 4IRXA 1KU3A 1HKSA 3BY6A 1RXIA 1TW2A 2F5FA 3QK7A 3RVJA 5ABPA 3O6BB 1SRRA 4RKQA 3NQOA 5K5OA 5EWMB 3BJ6A 1U5TB 1J56A 1SMYF 2QENA 1DG9A 2DK8A 4MQFB 4RY9A 2QUFA 2DAOA 4YIIA 4ENKA 5C5CA 3GFLA 4ZYLA 1E6MA 3B73A 3H5OA 3MQ0A 4LK1F 1LDJA 1B59A 4U7DA 4RXMA 1FPQA 2JRLA 2JVJA 1TQPA 3F3XA 3DLHA 2JK1A 3HV2A 4ZMSA 3EYYA 3BP8A 1HW5A 3P7NA 4OIQF 3TMYA 2IYNA 3PQJA 3U1DA 3BPXA 2BV6A 2FBKA 4OLBA 4HLXA 2ZWMA 4WXDA 4L9VA 5CYVA 1DUXC 4D0PA 1TTYA 2O3FA 4G94A 1ZRFA 3URMA 3FFWA 3H5IA 3ZP5A 3LUKA 2FLKA 3FXQA 1ABEA 4DQ2A 2FQYA 2Z99A 3N75A 1XDSA 1EAYA 2MLGA 2M30A 5F1RA 3E3VA 1R1VA 2UXXA 4KVFA 3F23A 2EJRA 1Y1LA 2YR2A 4ZYHA 4Y9TA 4W5TA 3L49A 1FSEA 1J0RA 3SZPA 2O20A 1KYZA 4LB6B 2FXIA 1Z25A 4OG2A 3RVPA 3HJFA 5E1WA 2NRAC 1P4WA 2A9PA 5K5RA 4NQRA 5HM6A 4CDGA 4L9NA 2OA4A 3RKYA 3IWZA 1LJ9A 4ETMA 3H1FA 4F06A 4BAYA 3ZMDA 4QPJC 2CSOA 3BJAA 2IJLA 1TNTA 4KQCA 3L2CA 4XSXF 5H20A 3RVOA 5J8FA 1NXWA 3RVQA 3V8JA 3ZN0A 1ON1A 5IEBA 4YFNF 1G4DA 2X7XA 1MDMA 5IX8A 2E4WA 4WK8F 1FZPB 3KSMA 4G7HF 4EVSA 1LNWA 3HRUA 4O3MA 5J6XA 3LSTA 4RK5A 1Y0UA 4UNOA 1S29A 3C18A 1G6NA 1ZLKA 1CEYA 1EWKA 1W5TA 3KFWX 1U2QA 1AB6A 3L00A 1XD7A 3K4HA 1ZRCA 3PFIA 4Z0NA 4LDAA 4MS1B 3QLVA 4MS3B 2L19A 3OMXA 5E8IA 4KMRA 2CD7A 3IC7A 2H0AA 3PQKA 3I5UA 4WF2A 3HCWA 4JK1X 2MH9A 1URPA 2JRTA 5FWYB 5CJ9A 1JE8A 3NRVA 5KC8A 3K0LA 4ZJPA 3HRTA 3O2PE 1LQ1A 1D1QA 3SFZA 1QP4A 4TN5A 3B02A 3OO0A 3HZHA 4W5NA 2BYVE 3RVSA 3DP7A 1DP7P 4LD5A 4Z4FA 1Z1DA 1ZY2A 1B6AA 3MFKA 3O1JC 3H3ZA 3GZ6A 3KJXA 3FXRA 2QVCA 3QOPA 2FEKA 1BA2A 4MLCA 3LKBA 1VRVA 5ILSA 3DEUA 1RI7A 4U0VA 2QXYA 5JFRA 4LMYA 2A6EF 1KRWA 4NHJA 4TV7A 3W6JB 3L6UA 3HSRA 3LOPA 3T38A 2MH2A 1ZRDA 4IPAA 5F6FA 1XN7A 2QM3A 5TQ0B 3LAJA 2OZ6A 1HW2A 1KQ9A 3WTZA 4Q47A 3TO6A 2B4AA 2H3HA 2BEOA 1USIA 2N9UA 3MYYA 1WRJA 1USTA 5L3GA 4Q6BA 2DO7A 1FY7A 3TDUC 1OMIA 2DBBA 4F11A 3H5WA 1S7OA 3F8CA 2HTSA 4O6JA 4KT5C 3E3MA 2PE5A 2DW4A 2VC0A 3GRCA 3WTWC 1KYWA 1EH7A 3BJOA 4L0YB 3JAMK 1YFHA 4O5AA 3HOTA 4N9HA 4HF1A 3GWZA 1K7AA 2HSGA 2COMA 1BAPA 2VUHB 2XAFA 5ICEA 2W25A 1P2FA 3GF2A 4RB3C 5T3YA 1J7KA 5CNMA 4EV0A 2O03A 4XLPF 2ZAYA 3C1DA 1L5YA 2D1HA 3CO6C 3CUQC 5IULC 4ML3A 1YK1A 3HHHA 2D2WA 4ASNA 2RJNA 3SZTA 5IT3A 1KMIY 2L4MA 4FX4A 3M9AA 5D5UB 4XAQA 4N41A 5TPWA 2QBYB 1NXSA 5D6EA 1Z6TA 4HNRA 4O5VA 2FN8A 2HWVA 3JPWA 2XROA 2WJAA 3GYBA 3U2RA 1SFXA 1OR7A 3QAHA 5CNKA 4RKRA 1HEYA 4WZZA 4YLEA 2DQRA 4Q6WA 3F72A 3L7WA 4FE4A 4XBFA 1NHAA 4DNCA 2XUBA 3OOPA 4QLCU 3I53A 3O21A 1YG2A 3HSYA 3O2JA 3O2QB 4EJUA 4LK0F 4KRFA 1Z7UA 4NCAA 4RV5A 1ISSA 5ED4A 1M5UA 1IW7F 3QELB 2PAFA 2ZMEB 4W5OA 3C7JA 3IDOA 3FFXA 2QVGA 3RVNA 5KI6A 1UFMA 1KA8A 4BHCA 1PP7U 3HSEA 4GNRA 2GAUA 3V7CA 1TW3A 3I64A 2CFXA 1RPJA 2MSWA 1FX7A 3E5UA 1B4AA 4PCQA 1ZN2A 1DBWA 4PYRA 4GO1A 4BHBA 4YG2F 5ICFA 3ULQB 1VKRA 2MYUA 1U8RA 1GXPA 5AONA 4YFKF 1GUDA 5HS9A 2QZ8A 4JBAA 3P9YA 3RVMA 5CVVA 4EJWA 4L5IA 2R7FA 3VOEA 2QLZA 4LJZF 1G3WA 2MYPA 3E6CC 2OENG 4MRMB 4LGWA 4OOIA 2K4JA 1F51E 5DD4A 4I09A 1U8TA 1FBUA 5L3BA 3LUAA 2P9HA 3CO7C 5DV5A 4E7OA 1JXSA 4EGSA 2L54A 4I98B 5HSGA 2CWEA 3C3KA 2AYZA 1FLIA 3ROFA 4KDPA 5FFXA 2PJUA 3N4MA 4A6EA 3ZQ7A 2EV6A 3SAJA 3Q41A 5LHIA 2LIVA 1OXBB 2EFQA 4YR7A 1VPWA 3LA3A 1B1BA 1XGMA 4UV9A 2PI0A 2ZFWA 2IPQX 2EK5A 1GXQA 2R47A 3GFIA 4EGZA 3NHMA 4HNQA 1D2AA 4RK0A 2F2EA 1V4RA 3TKYA 3EQZA 3WTSC 3WE3A 3HOSA 3CLKA 2HQBA 1YO5C 1ZGAA 4OIOF 4HDVA 3C3MA 4HF2A 4KK3A 1BBYA 3F6VA 1USSA 4NCBA 4LE0A 5KC9A 4UHKA 4O1IA 3Q15C 2G7UA 1S3JA 2IPNA 1RIOH 3BILA 1BN5A 5F64A 5DD8A 5JR3A 4O1HA 3VNAA 2XV4S 4KICA 1Z16A 4ZYEA 2FW0A 3FX3A 3NNSA 4WX9A 3IP6A 2JPCA 2GA1A 5TPZA 1FSHA 4Y13A 2ISZA 2IOYA 4CYDA 2J5PA 4HQMA 1XHFA 4IHTA 4M88A 2M8EA 2MA3A 1EHCA 4EGYA 2ID7A 4H3KB 5LBQA 3QLTA 4P9UA 2CWDA 4CXFA 2FMFA 2P5VA 4YP9A 4MAAA 3SY8A 1S8NA 1TBXA 1ZVVA 3FGZA 4Y15A 2EWNA 4OATA 3T95A 2K7LA 4RGRA 3EJWA 4G0ZA 2HQOA 1GCAA 1BDHA 5L3FA 2IDMA 2VODA 1ZGGA 4N0BA 2R4QA 1HKTA 1I27A 2IKSA 3QEMB 4OLAA 5HDNA 2GA2A 4N03A 4MS4A 1U6GA 3HUGA 3CTAA 4RAYA 2W24A 4L9TA 2ZXJA 4IF4A 3SG0A 3NNDA 3HTSB 3N97A 4UVAA 1U78A 4AIJA 1KU9A 4M72A 2RV8A 2E7XA 4LB5A 3QRFF 4UVBA 2FNPA 3ZMZA 1I5ZA 1JDNA 2L02A 4U7BA 3ECOA 3GFMA 5DUKA 3E97A 3FM3A 3I0TA 3N0XA 4Q4ZF 4S05A 2FLWA 3C3WA 4KREA 4FB4A 1QPMA 3KG2A 1BI0A 3JVDA 5JNUA 2OD5A 2FVYA 3EDCA 2A68F 1LVAA 2PUCA 4GYIA 3IKVA 2PUDA 1NXXA 5E3JA 4KIFA 3ZMSA 3R4KA 3FMRA 3EQ2A 2VONA 4FHTA 2HZTA 1LB2A 2PMCA 4MTDA 2R48A 4YS6A 2IPAB 1Q1HA 2HQNA 4LG0A 4RK1A 2XVCA 1AOYA 2P7CB 3B2NA 1NY5A 4OTZA 5T7BA 2FA5A 4N76A 5DCMB 3TO7A 2NAZA 4WXHA 2B1JA 3SNKA 4N47A 5TPZD 3QP6A 3DV8A 3RH0A 2MYTA 4L4UA 1JX6A 1JGSA 3JW4A 1F4KA 2HYFA 1ABFA 3LA2A 5HDKA 4OIPF 3HSFA 4KFCA 1G3YA 4W5RA 2NS0A 4WUTA 2XAHA 3T1BA 5LLQA 1IRFA 3GXOA 4M6XA 9ABPA 2PBIA 1DCFA 3WTXC 4Z2YA 4ZPJA 3DF8A 2M1ZA 5LHHA 3R61A 4LLLA 3GL9A 5BPIA 4MQEB 3LFKA 3VB2A 5E8GA 2FQ3A 5TE9A 2KJBA 5HVQC 1R36A 4UXNA 3KP6A 4WT7A 4ZYGA 4UVCA 3ILYA 3LUDA 2F8SA 5LGUA 1ZG5A 3QELA 3F73A 5EWLB 2FEPA 3E6MA 3J81Z 5DCLA 2R7DA 4HV5A 4Q5SF 4HV6A 5JNWA 5EEGA 5LGTA 4P55A 4G7OF 2VYCA 4ENMA 3H5TA 1C0WA 2HKOA 3WU0A 4MGEA 1M5TA 3DBIA 4EY3A 3WU1B 2FRHA 1O57A 1RZRD 2LDUA 2P6SA 4XASA 5LEJA 1MDMB 2W57A 1QO0D 1ZYRF 1ZESA 1Z91A 3J80Z 1ZG3A 2VXZA 2ADUA 5CVUA 1YMVA 4Z4HA 1ISRA 5D4SA 3COAC 4KK4A 4G6DA 2HQRA 4U0WA 2PMUA 4YV7A 1QGPA 3U9GA 4RK6A 1V3FA 2KIMA 4ZZLA 3MM4A 2P6TA 3WGGA 2FEWB 2QW1A 1RZRA 4GGGA 3EULA 4ZZDA 2EA2A 1K78A 2VK2A 2JVKA 3TOBA 1O3SA 2VE8A 4EYGA 4MQ9F 3J80K 2FN9A 2EFNA 3JS5A 4Z4IA 3KS9A 4RDCA 3QPTA 1QNLA 1R5GA 2TDXA 2VE9A 1R23A 1YLFA 1O3TA 4EJOA 2V1UA 4EVRA 1IIBA 3HRMA 8ABPA 5IT9K 2ZMEA 5BRAA 4ON0A 5JNVA 1ZDMA 4MHGA 3OO1A 3LA7A 4HOBA 5HLGA 1W7PD 2DU9A 1JBEA 5BRJA 3G85A 4DQDA 2L01A 2E1NA 4HYEA 5D6FA 3KKEA 1T6SA 5JHUA 5FD6A 2VT3A 4MR7B 1PP8F 1RNLA 2PL9A 4MS4B 1ZH4A 2ESNA 3BWGA 1YTUA 2VBYA 5BQTA 2FNAA 2KKOA 5AIQA 2FMYA 1Z13A 3WGHA 4HF0A 1YIOA 5JI6A 2O6GE 4TLMB 2PMHA 4F7ZA 2H27A 4ENNA 1B9NA 3GWGA 3ZN1A 3ROTA 4LX8A 5J8CA 4KN7X 3I59A 5E1ZB 3FWEA 2ESHA 5HOOA 1JFTA 3FMVA 1ONVA 3FF5A 2OAZA 4ESFA 1MVOA 4LRQA 1HSJA 5AIPA 2XKOA 3JSPA 5LHGA 5JS1A 4PE5B 3M8EA 1HBXG 3K69A 1KQ0A 1SAXA 1JFSA 1D5VA 1USKA 3GYHX 3GV0A 2VBWA 5FWYA 3BOQA 1MD0A 3DPLC 5B3JA 2LPMA 1IN4A 2PG4A 2LKPA 1LK0A 2GWRA 2FXAA 4H60A 3IP5A 3TB6A 5FBHA 2BGCA 1J59A 3HUUA 1JH9A 3ABUA 1ODDA 2Z9OA 3EUHA 2CW0F 3HUTA 2D1VA 4KMUX 5DUIA 2QV0A 5PNTA 3I09A 2VOOA 5BR1A 1ZITA 1SFUA 4E7PA 4AVPA 3CLOA 5FFZA 4QWQA 2PUEA 4GPAA 1JLKA 2K27A 3OM0A 5K5QA 1FYKA 3IPAA 4I7HA 1LDDA 3H1GA 2DRIA 1TNSA 3R6SA 2B0LA 1I1SA 2A69F 5HDGA 4P98A 2PUBA 2MSKA 4HX8A 4WXMA 1XDUA 3O1IC 1MB3A 1FBSA 4PDKA 5LEKA 4A5NA 3QX9A 3JAMZ 2JTVA 4CHUA 4KV7A 1G3TA 2W85A 1TJYA 2PEXA 4IILA 4EVQA 3KEOA 5H6RA 2Q8KA 1U5TC 1HQCA 4QYMA 4RGUA 3A3KA 4G0OA 2JVIA 4HZFA 3TO5A 3CUQA 3HXMA 1GVJA 4ZH4F 7ABPA 1PNRA 3WTVC 2JBAA 4OMYA 2GXGA 1D3YA 1FP1D 3VNBA 4RSMA 2RNJA 5EWLA 3KP7A 2FKAA 1IAWA 1F1ZA 3O2SB 3FHZA 1GHCA 2F5EA 3I58A 3LMKA 5IC5A 3QEKA 3JY6A 3N0RA 1XWWA 5FWXB 3MQ4A 4MR9B 1X3UA 4XLNF 5CHYA 2XHKA 1H9GA 2CG4A 3D5LA 3I42A 4R79A 4R8HA 2WJWA 5KQPA 3KP5A 3E6DA 3T6KA 4P96A 2IP2A 2PJPA 5FD5A 4BXUA 2E1CA 4KMFA 1S7AA 2A6HF 2FSWA 3MWMA 4OMZA 1DPUA 3KLOA 2ACJA 2V1XA 2PKXA 4G86A 1B00A 2ELHA 1L0OC 4RY0A 2P8TA 4BNCA 4RGXA 2FU4A 2FSPA 1B9MA 2DTRA 3L9FA 6CHYA 4RGSA 3NHZA 3H5VA 4Y17A 1HW1A 3GX4X 2QYOA 2MC3A 3N0WA 5FWXA 1U2PA 3R0AA 1KGSA 1DZ3A 1NXTA 2HDCA 3H6GA 3I59B 2EFPA 4PEVA 4OU0A 4RB1A 2J48A 4MS3A 4D74A 3BROA 5TQ2B 1Z6RA 3W6KB 3JTEA 3KP3A 3MA0A 1FC3A 2UZKA 2QVOA 1FNNA 2VBXA 5FBKA 4A0XA 3O3KA 2L4AA 2RDPA 1CGPA 1BDIA 2D45A 3F6PA 1OYIA 1CF7A 3MZHA 4LE2A 2LNBA 4OBBA 6ABPA 4A6DA 3ZPLA 3HO1A 5C5EA 4M73A 4IVNA 4TMYA 1XMAA 1STZA 2ZCWA 1XSXA 1JDPA 4RAZA 2YHAA 2VT2A 2QWWA 2PFBA 4MQVA 1PEAA 5IUKC 4EUKA 5JVTA 3QLVC 4DADA 3GVAA 1C4WA 3KTOA 3OLXA 3V7RA 2NYXA 1DCKA 3GBPA 3ML6A 5BMZA 2I6FA 2A9QA 2QZJA 1BI1A 2GXBA 2LF8A 4WXEA 1RXEA 2WMYA 2HGCA 5HS8A 2FBIA 4EVIA 2EFWA 3KP4A 1K78B 4A5MA 1SXHA 1SXIA 4RS3A 4ZMRA 3EDPA 1QNTA 1W5SA 1FSPA 3JTGA 1JHHA 4RU1A 1OKRA 2KIFA 3CKMA 1XCBA 4ESJA 3J81K 4BQAA 2L2QA 4CICA 1HSTA 3M8FA 5KWSA 5TJJA 1AB5A 4NV3A 1T39A 1PHRA 1U04A 4YCSA 3IRRA 1G3SA 1T0FA 4ETIA 1GLGA 2YX7A 3WGIA 2A9OA 1P4XA 1D5WA 1P4AA 4MEXF 1E2XA 3EYIA 2C6YA 1MIHA 1QP0A 5CLSA 3GA5A 2O8XA 4G0YA 2CO5A 2FF4A 3DFGA 3JVIA 4RB0A 4Z9BA 2JCGA 2K4BA 1DC7A 3MIZA 3V8LA 1C0EA 1SD6A 1BIAA 2HR3A 3T0YA 4I01A 5D4RA 3LAPA 3CTPA 4JASB 4A12A 2Z33A 3HVRA 3LQRA 2PUFA 2HFHA 4OIRF 1KRXA 2GBPA 4EYOA 5I4CA 4XRFA 2Q0OA 1DP4A 1Z12A 3F7NA 4MR7A 2WV0A 2Y0MA 5KQMA 2PQ8A 3HM9A 4YFXF 1DRKA 4HLYA 1YS6A 2V6CA 5LRRA 3RIRA 3SQNA 2YSRA 1U2WA 1DRJA 2OQRA 3DQVC 3N8IA 1YMUA 2RN7A 4FX0A 1QBJA 3TO9A 1FP2A 4EQQA 2TMYA 3M6MD 3IP7A 1I6XA 3GO5A 1UB9A 1ZHFA 1YW9A 4L85A 1H9TA 3NBMA 1UDRA 3ILHA 3CRNA 3IHUA 2VUIB 3I5AA 3V7SA 5GOTA 4RK4A 5EWJA 5ILUA 3KZZA 3VODA 2ZKZA 4MPTA 2ZNZA 2XIGA 2PLYA 1MGTA 3IRQA 3Q7TA 5EWJB 1VTNC 3KP2A 2DK5A 3F6CA 3S2WA 4LDZA 1W25A 1ZAYA 4L0ZB 3EGCA 2EV5A 3FMSA 2A3SA 5B3JC 1MAVA 3M7GA 1EFAA 1DJMA 3Q9VA 2M1BA 1WI9A 1OXKB 3GUDA 1ON2A 4RB2C 1IN8A 1YK0A 4P5OA 3T8YA 1IXSB 4LG0B 1W9HA 5CNJA 2DPDA 5KK1A 3DPTA 3KCNA 4MEYF 5DCMA 5D5VB 3LUFA 1CYEA 4U0YA 2MLKA 1SXGA 4LZLA 2E4UA 1NTRA 2X0LA 3Q5FA 5CNIA 2VC1A 2UXNA 3FDFA 4RY8A 3CNBA 3RKXA 4HQEA 4A0ZA 2NZVG 2RQPA 4BYYA 3CUOA 2GIVA 2FE3A 3I54A 3G1WA 1QQBA 3RVKA 2PN6A 4EJVA 3BDDA 4KIGA 2QSJA 4JOQA 4BH9A 1D8JA 3N6VA 3W9SA 4NB5A 4KYWA 1Z2DA 4JB0A 3UK0A
chains in the Genus database with same CATH superfamily
4UV8A 4G1FA 5ICCA 1Z2PX 2V1DA 1X1QA 4FT8A 3UR3C 3HU5A 4U7TB 4WJZA 5GGYA 1CWUA 1KSJA 5DRYA 1LJUA 2CFIA 2QRVA 3FTPA 3IH4A 4OINF 2O2DA 3HP4A 3QKTA 5DYYA 4TTTS 4IZHA 2ZJ4A 2RGRA 3DZDA 2A58A 2OAGA 3S8YA 3H04A 2WZBA 1Z0JA 3H11B 2VS1A 3NTOA 3TTUA 5IH7A 2XT6A 4NEHB 1MVLA 5IBQA 4IEEA 1HOXA 1O94C 2C96A 3H5LA 3EFHA 2POQX 3UAXA 2D3WA 4DNPA 1E3QA 4OMCA 1MZBA 2ASVA 4UUSA 2WKWA 3NOXA 1UM9B 4Q02A 4P1ZA 4ZP1A 3DTNA 3TX6A 2GETA 3PITA 4B84A 2VI6A 3Q9SA 2PRYA 2O1XA 2VDPB 3J7AO 4HDRA 5BQ5A 2VXYA 4XRSA 2IVFA 3GEBA 1ZUWA 3PTLA 4YJFA 3SJAA 2ZTUA 4UBNA 3PHBE 4Y2UA 5HOEA 3DDUA 3LYUA 4KV9A 2VJJA 4YQZA 3GAMA 2DA7A 3S7ZA 5ER6A 1QOQB 5ENZA 3T41A 2AX3A 2YX1A 3BE4A 5TNXA 2CHFA 4DKJA 4JI1B 3HBAA 4F55A 4R05A 4GPZA 3K2BA 1PLJA 1NLUA 2XF7A 5D5XB 5IYDJ 5FO1A 5SYAA 4M7WA 4CFYA 5DKFA 4DMRA 1FFSA 1UXJA 2XDYA 2QL5A 4TWIA 3RHFA 4KE9A 3PI6A 2EINH 1T4CB 2XMCA 4OMFG 3WBKA 1ZCJA 3FBGA 4MYDA 5CW2A 1E3OC 4KDFA 1TWFJ 4INOA 1EDBA 2FMKA 2ZBDA 4ENWA 1FX0A 1PG2A 4NU8X 4S3MA 5DGTA 3TP0A 3G73A 2G1JA 4UBLA 4QG3A 5KTOA 5KPDA 1AO0A 3QPHA 1KQOA 1ODJA 2VHCA 1DS6A 2HQ5A 4BMPB 1DKMA 4ETNA 3RSGA 4EM2A 2BFFA 4BEHA 3FDIA 1U6IA 4LYHA 4B75A 2JFFA 4XX1A 3OOUA 2HF7A 1WKMA 1Y9ZA 4ZMBA 3RG8A 3KCCA 1NATA 1WEKA 4JJ7A 4QOFA 4DA9A 2AQFA 3WO1A 1XTVA 3CCJI 1DKPA 2HLNA 4IDAA 5U4XA 1A9SA 2WVJA 3DUFB 3ZE8A 3T8RA 4C0KA 1CUJA 3LT2A 5BSMA 4QPOA 2DI3A 4KISA 4YREA 4E33A 5C7OO 4U02A 1QAQA 4G5HA 5TGZA 2LVSA 1XVUA 5F7OA 5F7JA 2OFFA 4KR7A 1T2VA 1J2JA 5D84A 1L4FA 3T5TA 1P29A 1V39A 1L3LA 2WG1A 4JAVC 5ALOA 3U1VA 4M36A 5K0GA 1YF3A 3DE1X 1R4AA 2JIQA 2DT7B 1RCFA 1PFYA 3F8MA 1X14A 2Z8YA 4ZVOA 3EPHA 1ITYA 3DOFA 4HQOA 4BRUA 2Q6VA 2R11A 4JDPA 1QR6A 3HFSA 1QRSA 1P8JA 3CC4I 1NQAO 3OA0A 4IUDS 4F8JA 2OE2A 2XAJA 1P1CA 3C1TA 2LR0A 4I1YA 3PP8A 5DWDA 3W78A 1X1BA 1XEAA 2G07A 4AXBA 5AW5A 4Y2TA 2R8EA 3CP8A 3OQHA 2VJPA 4BZPA 4PNEA 3M9XA 1VIYA 2Z5LA 3ONNA 2H9AA 3CNEA 3O9VA 3QLVC 4N7MA 3I62A 1C14A 2O3JA 2XUZA 4FC6A 3O1HB 2VPRA 1YJCA 3ASUA 5IK2D 1FMJA 2J32A 4TS9A 3EQ6A 4WJLA 3VSKA 1W36D 4B82A 3VZQA 5HLHA 2P4WA 3GEMA 1TJ4A 5L3QB 1KK1A 3M81A 3PNOA 4ZAGA 2A5JA 2QJWA 2VXCA 4KHZA 4XFJA 2VKDA 3RPUA 1D9XA 1B1CA 1CY6A 1N5LA 4JLOA 1WHUA 1E0SA 2GCPA 3BWXA 4IJUA 4PZUA 2PH7A 2NVWA 5HF6A 1O95A 3ETLA 4PLGA 2FX5A 3WODF 5J47A 3ZEIA 2AT1A 3R8CA 2IRWA 2Z3VA 4KI7A 1XDDA 5DXFA 3WRVA 1OB2A 1V35A 2CJYA 2XD4A 2YY5A 4GE3A 1NVUQ 1GSOA 4I19A 1K1EA 5BWBA 1X7WA 2AOUA 1BH2A 3I3OA 3VU1A 1ZARA 1CS0A 1UINA 4WNCA 3QKIA 5C35A 4MFEA 1NE7A 5DCFA 1WNTA 4QUBA 2K40A 3HRSA 1GAJA 1Q21A 2BR3A 3E1KA 3BA6A 1P7YA 3CMAI 3DXJF 2OD9A 2B99A 2OUIA 2DFIA 2D8AA 2Z3YA 2WB4A 3A8TA 3VPRA 3BA1A 3CBQA 3DO8A 3GJZA 4UASA 4XARA 3WLKX 2CNWA 3LPAA 4DNXA 2PUJA 2CFCA 3LW7A 3RUCA 4BMXA 1N8KA 5TGDA 3D5SC 5FLXZ 1ST2A 2NTJA 4XFKA 1E79D 1Y8QB 5FKLA 1ZN8A 2HWYA 2XYQA 3ADOA 2H57A 3AR9A 4AIDA 4L2IA 4YAUA 5I3ZA 2VJ5A 4NESA 1M2WA 2GBGA 3EVBA 1FYMA 1G21A 3EOAI 5KJCA 2HSWA 4EL5A 2PLWA 2QMHA 3CM0A 3OTQA 1M1YB 3KBOA 4L16A 4KPFC 4PU0A 3SN6A 2BPOA 3FZVA 2WIGA 4JHLA 2XWJI 3BERA 4W99A 1HV8A 4GKAA 5D2CA 5EJ4A 2E5LB 3QNUA 5KAIC 4B48A 1DDOA 2V7WA 1CDDA 4A26A 1KU2A 5L3EA 3N2GB 3SM9A 4NI5A 1QIEA 2FZVA 3AOEC 3HDGA 4LIPD 4UW9A 2RDMA 4P3KA 2GK4A 4RVFA 1WA5A 4QPPA 2QAGB 4MP6A 4C0HA 2P2CA 3QNWA 3GVIA 3AW9A 3D6AA 3SXPA 3K0CA 1VNDA 4P80A 4QATA 4GBJA 3UN1A 3F7TA 1EWRA 1NV8A 1OZ0A 3MMNA 4ENUA 4WLFA 1JG7A 4ITUA 2OCEA 5U4QA 3QITA 2IW1A 4S24A 3FNGA 2BMAA 3NH6A 1Z63A 3S1AA 3FHTA 1WDKA 5F4BA 5TLSA 2O9LA 1N0HA 1WNFA 2YW2A 1WD7A 4I2VA 3D1JA 1J06A 4RZSA 5LZ5A 3RYFB 4A3EJ 3FUCA 3PX3A 1JG6A 1L5WA 3FK7A 1R49A 2CV1A 1GXSB 5DGCA 2FEAA 2ONZA 3G23A 4I50A 2FZGA 4DEVA 1OROA 3AV0B 1NNSA 2XECA 5CEJA 4BGIA 3TSOA 3FOEC 4RXUA 3D31A 3I1YA 1P9OA 2FUG1 3E70C 3ESDA 3GDFA 3VPGA 5EXXA 1BD4A 1NHGA 3L5KA 4MYHA 4PWYA 4OK3A 3WWZA 4EYSA 5DTEA 5BVGA 3GF4A 3Q3HA 3HPQA 3WL3A 5BNTA 4KQ1A 1NMXA 4XVCA 1R22A 1EZZA 2REXB 1E2FA 2WHPA 3ABQB 3IEIA 3DLBA 4XLCA 2NXWA 2PL5A 2X8BA 1R4MA 5E1XA 1AUPA 2ZI3A 4Q03A 4D2IA 1OSNA 5BUQA 5C8YB 4HQFA 4G4GA 4L4RA 4YRAA 3HXKA 3MLEA 1I3AA 5K6RA 3UPTA 4KIJA 5G0VA 3HG9A 3K0HA 4H15A 2HHAA 1FFEA 5B1SA 2JI8A 3P0FA 2OXEA 4M1ZA 1YI2I 2R93J 2Y69H 2FFAA 1ZLJA 2W2PA 3SDSA 3PUIA 3J80A 1R8YA 1PR5A 1IUFA 4A3BJ 2LRDA 1H2HA 1MMDA 2DA3A 1S3FA 1GCGA 2PSEA 3T34A 1R00A 3V5NA 3HN7A 2Z57A 1E69A 5C5DA 2Z08A 2NVTJ 3O8QB 5JNRA 2WOJA 3R60A 3AHCA 4GR9A 2JB9A 4JS0A 1UBTS 2Y1GA 1MTOA 1PJBA 3DMNA 1I32A 3JQAB 3WTTC 1WJEA 1JG3A 4QYWA 3IKMB 4EO9A 4LJ8A 4WRRA 3ZV5A 3JW8A 2Q0SA 5KZMB 2JD2A 3TZHA 2YU3A 1Y5IA 3HDQA 5J1RA 3OLYA 1DB3A 3QPCA 4E12A 3SQWA 4F96A 2JWTA 2OFXA 2Y1FA 4C06A 5A2QZ 3FY4A 3IB6A 3IAS1 3GZNA 3EXIB 2N42A 4EARA 5IT0A 1OW3B 1E0KA 1YMQA 4GYGA 2R86A 4GM4A 3T54A 2YXEA 4WA7A 3K0EA 4A0HA 2GJSA 3ESBA 1O7FA 3JSXA 5JRDS 1IWBB 5IZCA 2ZI7A 1RZUA 3KWFA 3K4JA 3DCIA 1M7BA 2OUKA 4WI1A 1HNZB 1FQWA 2PRSA 5EI5A 5D3QA 3F6BX 3PD7A 2AJCA 4QQ8A 3INRA 3OQOA 3S16J 5FB2A 3LX5A 5SY4A 1LWNA 2FPGB 4LF4B 1GZ3A 1R7JA 2C1EA 4JX5A 4IQ4A 4HAMA 1RUOA 2IGBA 2P9EA 1XX5A 1JEAA 3AHHA 3KT0A 4HWTA 4K7JA 1A88A 2NUTB 5D8DA 1KDRA 5KVSA 3GDWA 2J0UB 1CNFA 4ZTBA 5B64A 2DUWA 1S2LA 3OU7A 5AIBA 1ZJYA 3X2EA 4TGLA 2JIZD 1TXGA 4MLDA 3BREA 1ZONA 2X5KO 4MYTA 2COKA 4MV5A 3ONWA 3MERA 3PZRA 2ZREA 2I4OA 4Q4DA 5G4KA 2PT6A 4M9XA 1QVWA 1A9YA 1ZMRA 1GNRA 5TT1A 1U2EA 1R2QA 1L1FA 1ADJA 3P7MA 3HKEA 1Q6ZA 1JI0A 3PC6A 5E7MA 3ULKA 2VDOB 2XB5A 4YRNA 3RADC 2PUAA 4PSVA 5AXDA 1NULA 1I01A 4MVXA 2X0FA 4KQHA 3AU8A 4E5VA 1S4QA 4GR4A 4Q3EA 1TQMA 2F3PA 4MX8A 2GI4A 5HP4A 5H83A 5E95A 2O5CA 2AFIE 3AR4A 4JD5A 3TUIC 4E1VA 5KSOA 1I7QB 2QQBA 4MULA 3E5XA 1T5LA 3ERMA 1R5BA 3K2ZA 1T2NA 3WRXA 4L8GA 4XGQA 1GAQA 3K1MA 2WF6A 2RGNC 4FC7A 3QSGA 5JIBA 2X2OA 2I99A 1Z7GA 1HC8A 1YHZA 3OLZA 1N7IA 3CDHA 4A5SA 2YPRA 5EJ5A 1KU7A 3UKGA 3GTKJ 1XZIA 2YC2C 2LK2A 1IXCA 5DI3A 5AHOA 3M1EA 5INTA 3CCCA 2NUBA 1NL3A 3VBCA 5KDOA 2BEUA 3ASZA 2Z09A 2JGRA 4M3GA 3BSFA 3E7DA 3LXMA 2R5YB 4HO1X 1EFLA 3S2ZA 3ZW7A 3IHKA 5DM6F 1G6OA 2I6XA 1XL1A 3C0KA 1A5AB 3ND9A 4HBLA 1EG2A 2R96A 3I9LA 1XG1A 1NNI1 2ECFA 4LC9A 2QQ8A 4D8WA 2O48X 4EM1A 2Z04A 5E8JA 2NSHA 3HL0A 2VCEA 4N0QA 4AY5A 4LNAA 3UC9A 1U28C 3W4IA 3ZE9A 2JLVA 2UVDA 2IHUA 4UDYX 1YS7A 2IGOA 3HTUA 1NJ2A 2VL7A 4BPRA 4EI2A 1JUPA 1T98A 3OV8A 1VJ5A 3AWDA 3MB8A 3NDRA 4H1HA 4WY2A 1WAMA 3EH1A 5L3VA 1KJNA 4TKMA 1KOGA 1LSSA 4REMA 5JCOC 4QM7A 4G5RA 4B3JA 3G1TA 4PFPA 1OXXK 1MJ9A 4P9FA 1EDOA 2Y1DA 3DGEC 1AIPA 2VJ4A 2O8VA 2E2IJ 2R1TB 4FX5A 2COUA 3H8VA 4RVSA 5HK8A 4ALJA 6ADHA 2NUAA 2F8MA 4MO9A 3AX6A 4D7AA 5I5GA 2XX3A 4AWXB 4OU5A 3G9QA 4M83A 1KDVA 4EP1A 2TECE 5KINB 2XUGA 4FUTA 3RYFA 4EIWA 3GCWA 2ZYVX 4Z4EA 3TZQA 1K75A 5K0SA 2P81A 5JADA 1CUFA 4C76A 5JAUA 3RQSA 4XQEA 5GV7A 2JFWA 2JK0A 2BFDA 2GERA 3BRQA 3ITKA 2HS5A 4G5OA 3FFAA 2NV0A 4G97A 3ZR4B 5KQGA 5AVKA 1POXA 1HE5A 2P5SA 1JFLA 3G0HA 1G7CA 4L6CA 4EYQA 1H9CA 5K7ZA 4BQNA 1O3RA 1ZOPA 5B30A 5I48A 5I7HA 1KJZA 3S2IA 1YXMA 2YC4C 3A0UA 1QZTA 2ID3A 3KYJB 2XZTA 3ML1A 3DA8A 2P2GA 3MCAA 1VA4A 2BGRA 3RJMA 2P9QA 3DMTA 5CJ2A 3GFFA 3LUCA 1QZEA 1W7PA 1NXPA 4U00A 3AERA 2EBFX 2QQ5A 4ZYUA 3PFWO 3CN7A 2Z5UA 1DFGA 4RH3A 4CKEB 4F3YA 3K1PA 3P9CA 3UAGA 2EYQA 1RCUA 3HDVA 4KSCA 4BJHB 3M4NA 1VFNA 4HVTA 3OQIA 5F77A 4A0QA 2FZWA 2XCTB 5FO5A 3U16A 3EUEA 4KLNA 5JS2A 3ITDA 1YR9A 2IDKA 1UJBA 5CFQA 4EFLA 2IIBA 4JBYA 4AQDA 2QXUA 5AKHA 1LZLA 2RONA 3F6YA 3AF6A 3ND6A 2D2XA 1D8TA 2J1LA 1QFXA 3N2ZB 1U8AA 2I80A 3MMYB 2W4IA 5KVVA 4N5LA 4Y18A 4M6YA 5BNZA 5KTSA 1G2QA 1X87A 3RTCA 2ZBVA 1LPBB 2A84A 3JALA 5CH5A 5JH7B 2GJAA 4O2LA 5EKXA 2SKEA 5ICSA 4E7SA 3VYUB 5I9NA 5EHQA 2CNLA 4TKUB 3MAJA 1E3WA 2VPIA 3LRXA 2OZLB 2FG7C 3DHWC 3TSWA 2QMQA 2WA0A 3F21A 3RRJA 4BKPA 4F45A 4IM7A 3F49S 3LWFA 3DKWA 1AK2A 2ZU6A 3MINB 4FZ5A 2QD4A 4F4FA 4Z3OA 2E7WA 3VH4A 4HSEA 3WWYA 2PLAA 2WYHA 4B6JA 1ESMA 2AXLA 2OHIA 3KJQA 4MRVA 1BG6A 1SVWA 3F1KA 1R6RA 1E66A 4FYIA 4BQFA 2DEUA 1CG6A 1ZO8A 1J75A 2J45A 2PFKA 2ZIXA 3TTYA 3MPOA 3RBAA 4HQKA 1WKVA 1DLJA 1FDIA 2GLXA 1HKHA 1QQ7A 2YV4A 4WOPA 1RC8A 1LFPA 2STTA 1KP3A 3AW8A 3KUCA 1GNPA 2A07F 2GPJA 3VYVA 1QRUA 2IV3A 5EHXA 1EUCA 1VMKA 4C3UA 3L1HA 5DEOA 3ZMUA 1I7NA 1KSHA 2AR7A 1O3QA 4IZOA 3F74A 5B1IA 2RD2A 1MX9A 2OWDA 2M6LA 4G12A 4QTXA 1MBZA 1LSOA 4XKJA 1KY2A 2HJRA 1JTYA 4H7JA 1FBQA 3P8ZA 3PJGA 2KRHA 1ACMA 5ALPA 4UOEA 1SWWA 2KI5A 3KE9A 3C6QA 4KLAA 2XB6A 3COPA 4PQGA 5M3BA 3RIGA 2WM8A 1V96A 1IDOA 1QJCA 2B4TO 4QFDA 3CUYA 1BI2A 1PRYA 3OX3A 3MEXA 3D4LA 3NATA 3ISPA 1SFOJ 5E7QA 4NECA 1NM5C 3REQA 4GI2A 3RROA 1XAGA 2ZLBA 3ZGXA 4ATNA 3COJA 1R9MA 3DHYA 2O4UX 1E6KA 3MWDB 3U5ZB 2ATIA 1Y8RA 2JHAA 2UVQA 4N0PA 4OH7A 1NE2A 4BFXA 3VU0A 3CC7I 4R9SA 3O4FA 1R58A 2KHMA 3PR3A 1TZMA 1QO0A 5FLMJ 2Q2EA 2P6NA 3G0GA 2N0SA 3QWIA 3G13A 4J7UA 3IR6A 5BT9A 1KH3A 3RS3A 1U5AA 3L8CA 2A5YB 1EUZA 3BXEA 1ZUNA 4J94A 2XGMA 4BV9A 3I71A 2AOVA 2V3VA 3BF7A 4EJTA 5K0NA 4RD4A 3JPYA 1YBMA 4XJVA 3MKYB 1P1IA 4G0PA 5K1ZA 2HH9A 3ZWPA 2UZ4A 4OJNA 5FHRA 4ZTZB 5E20A 3BG6A 2NNYA 3LYHA 1KI4A 4LE1A 1N9ZA 2LY2A 2Y48A 1I5RA 1A69A 1SUFA 4L8YA 5DYGA 1RPAA 2YW9A 3FHJA 4WCDA 4QYXA 4JEIA 4EJMA 5A3RA 2GD6A 1KH2A 1NW5A 3GEIA 2FLVA 4ZYDA 1IFXA 1Q84A 2EDAA 1R1TA 4MO7A 1QC5A 2EFDB 3HO8A 4WN9A 4XTRA 3VRHA 4ONEA 3HJFA 4I9HA 3C2QA 1FTZA 3I55I 3LIIA 1QPZA 4ZD6A 4CXMA 4NJOA 2IY7A 2NAPA 2OC6A 3O90A 1D6NA 4YJ3A 5J1SB 2X0KA 3KQQA 3RW9A 1FDWA 4CQJA 1U0NA 3CG0A 4CBVA 3ESAA 1WW8A 1FOKA 4JJ8A 4UHHA 2V3WA 4TL6A 1IUYA 1UUFA 3FA2A 1F6BA 2E35A 1EVZA 4U6SA 3V7NA 5FAXA 1G8SA 1L4NA 1LFAA 2ZKLA 2BM1A 1STOA 1BMDA 2Y71A 3L7CA 1ZX1A 2ZRFA 1L3IA 5CLQA 4DJ5X 4IRMA 3OE1A 1T91A 1IXRC 3EN0A 3TRKA 3IL2A 1B1AA 1LRLA 1TT7A 5I7SA 4QBGB 3L4BA 4BRSA 4DR7B 5HNHA 1KYTA 5ICGA 4KN4X 3IKJA 3ABRB 1ADGA 2B6HA 3GQBB 3QYBA 3MMPA 5JHGB 1IZ1A 4PPFA 4XLZA 3RV4A 3U39A 4EQ6A 2M45A 1KZ6A 5IARA 3ZWXA 2Q3LA 2XUIA 3K8YA 4ZCIA 5IUJC 3OC6A 3N5CA 3LT5A 4HDMA 4XYMA 5CBPB 4WV3A 1WQ3A 4RJIA 3R5JA 5FV4A 2HK8A 1TE2A 2B0JA 5AVWA 1L7AA 3DTTA 3M6AA 1F1BA 4RK7A 5G1NA 2AWNA 4ARSA 2FJ1A 2O8EA 2DOEA 1E1QD 4F3TA 1XMQB 3IFSA 4AMYA 3WR5A 3KEGA 1NP7A 1YRQA 4DZZA 3RKQA 4QPCA 4KPYA 3F8FA 4CMBA 2VIIA 5AKXA 3CN9A 4KO8A 5IJZA 3RE1A 3BK2A 2WYVA 3W9BA 5D3ZA 2O61A 4CKEA 1I4EB 3OZIA 1SK9A 5CAEA 1Z33A 1PG5A 1WLSA 1WSDA 3EWIA 1OZFA 1K66A 3HL4A 3K4QA 4B87A 5A0TA 1FB5A 2OXTA 3KAKA 4B74A 3IKTA 1IAVA 4DRYA 4FB5A 4JYCA 2OAEA 3S99A 3FBTA 5LRSA 3EUWA 3FXOA 2PZFA 1TVMA 1A8IA 2XQGA 2DQLA 3KR1A 2DLCX 1TOAA 3T5XA 4CR6A 5KNCA 3KZKA 3ROGA 3KQHA 4EABA 1N8SA 3BXGA 3D3EA 3GT7A 2HJ9A 2NVOA 5SYNA 2PL1A 1R4MB 1KSFX 2Q29A 3K94A 2PCLA 1E64A 3MZYA 4KXQA 4BO2A 2AZ4A 7REQA 3PSAA 3PQCA 3S70A 1YQDA 2CXTA 4KMSA 4NABA 4QWMA 3L09A 2I9PA 2VNIA 4J4BA 4X61A 2FF7A 4A36A 4M1OA 4MUFA 4RMIA 4QC2A 4NICA 1W59A 2UZ1B 3DPIA 4JA0A 3CZCA 3INYA 3UAVA 2BFNA 1YX3A 3HN2A 1U5BA 2V74B 3LBIA 1OCOH 3NARA 3FVTA 3ZBTA 5B66C 1Y8ZA 2W6QA 3OKPA 2FX0A 3QW4B 1B6SA 3GLXA 4JLBA 1QQIA 1P44A 4F12A 2EFOA 3TL4X 1WPQA 5BWNA 4ZV9A 1YGPA 2GDZA 1E1CA 4JYAB 1RESA 5F2EA 5DM4A 4M89A 1RBYA 3V34A 4KQFA 4IJAA 2PR7A 1RYHA 5D1NA 4C7JA 2CZGA 4ZKEA 3IMGA 1MO3A 1TZLA 1QZYA 4HDNA 3MVPA 1OA0A 1ZIXA 3M4YA 4QXQA 1JW9B 5HKOA 3FGPA 5MGNA 4BQRA 3HC7A 2ZROA 3ISTA 4TRMA 3DL7A 3FLBA 1QLWA 3WYEA 1UDBA 4O33A 3RYRA 3SZMA 5AKLA 3E1GA 2LMDA 1IF1A 3L0ZA 3R3VA 2ERXA 4KQ9A 3C5EA 3EGWA 4DCCA 1OR7C 1I3MA 1W88B 1HL3A 3I2GA 4FDTA 3K3PA 3JAWB 2D6FA 3B1XA 3T5GA 5FJJA 2UUCB 4DOMA 4IHSA 1RWPA 4N9IA 2QN7A 1R37A 2EBWA 3I6MA 3FSGA 2W4SA 3A3OA 1A7AA 4LSWA 3IX7A 1GR0A 1RWWA 2VYQA 2YXBA 1RJDA 1PNOA 1BHSA 2DLLA 3P20A 4CHTA 2G9WA 1A1VA 5GVRA 4N7JA 2HQAA 2HRZA 3F8NA 5IDXA 2J0UA 2OXFA 4ND5A 4Q4HB 5JECA 2MOKA 3ZHBA 3IALA 3W6VA 1W4ZA 3DHVA 4E2YA 5C53B 3PLAE 3CQZJ 2IZ6A 3IO5A 3KPUA 3VFDA 5E17F 1XGNA 3INTA 4Q1AA 3ZWNA 3MFQA 3S7TA 1NC3A 3TL6A 2SHKA 3E0QA 4FZJA 4V0ME 1SFKA 2G82A 3AEKB 4DQUA 5LP1A 3RANA 1XZPA 1GM5A 4D3XA 3BDAA 3VNSA 2HPHA 2ZJBA 2OD2A 2ECCA 1KAOA 3VSLA 2F17A 3EAFA 4YACA 4YI3A 3H9QA 1AN9A 3WE7A 1HH4A 4ZYZA 3H2BA 4FOLA 4D8YA 1F17A 4Z0HO 1ZQ9A 3HHGA 2VDWB 3DWIA 3CZQA 4BL5A 1C0LA 5A3QA 3FNHA 3HP7A 3ZJUA 4U7FA 2P5YA 2WV1A 3GLLA 3OJLA 5FOUA 1GNQA 1VG1A 1YQGA 3U7GA 4RAOA 1Z28A 1JUSA 5M3MJ 2FJ0A 3I2HA 3NEYA 1XZJA 4AJIA 3L2RA 1CZRA 2G6BA 2MINB 3EPJA 1YC2A 2AOXA 4XXHA 3BRSA 3FVWA 4C4PA 3VPHA 2FXVA 1FTSA 1E7MA 1PS0A 1X38A 3EQ9A 4J0CA 4YVFA 1IO2A 1IM2A 2WOOA 3I4MJ 1E2KA 1BDBA 4FYXA 4EHKA 4UTNA 1S02A 3OJ0A 1XU9A 4ZVLA 4F2PA 4N4OB 1NF3A 4RPIA 4WFKA 1OU4A 3R3YA 5DEIA 3MSXA 2NU9A 1CERA 1ZXLA 4AUMA 3KQYA 5C52B 2QMOA 3W1VA 3RVBA 4OCZA 2B35A 5KWEA 4C07A 4YPFA 1Z5WA 5BYKA 1JEEA 3RVJA 2KQRA 3CB2A 1E2HA 4Q3CA 4Q4LA 2G83A 5A05A 1C9DB 3V55A 5ALEA 2AZDA 2PRKA 3C1OA 4RKQA 3ERCA 3HCFA 4DMMA 1JV2B 3A9UA 4MHSA 2CHVA 4E94A 5K5OA 2R6JA 2RGEA 4QREA 4DV7B 3HRIA 5EWMB 5KNCD 1Z5ZA 2Z4TA 3IQZA 1DG9A 2X6WA 4XM3A 1PZNA 3B6JA 5EMHA 3UV6A 3DCNA 2W8ZA 4GZMA 2YZKA 5L95A 3GCGA 3HUEA 4Q3DA 1XTJA 2DAOA 4ENKA 5HFJA 1VSVA 2NU8B 4YCNA 1PQ4A 2RE8A 1B7GO 4CMIA 1EJ6A 3BRCA 1ULAA 3EVFA 3K73O 5DF1A 3WYFA 3ZQIA 3AL3A 3C8HA 4DRZA 5KYYB 4DR4B 5FJ8J 4ACAA 4IHYA 1XEWX 3MK31 4F5DA 3RI3A 3A31A 5JXWA 2BGIA 1RWOA 4TXJA 2JRLA 2VDLB 4HQ0A 1TQPA 4RE5A 2N75A 2B21A 2JL1A 1ZYUA 2DLNA 3KJIA 5JDCA 1EH5A 3KT3A 3N2NA 2UV1A 2JMWA 1L7BA 4GMDA 1SB8A 2HU7A 1QZUA 2JK1A 4IUBS 3EYYA 1H9AA 1HW5A 1L8XA 4OIQF 4EAAA 1SU8A 3LP6A 4JXXA 3GLHB 3VJRA 3F4BA 3HACA 3WIUA 1YR6A 3SFTA 1NBMD 3JYOA 3M49A 1VJ0A 4YJHB 1WZUA 4D0GA 4TV8B 2W6JD 4I9NA 2PS0A 3EBPA 3I9V2 4C2AA 4V02A 4HLXA 2ZWMA 1PVVA 4BVEA 4QYSA 3PJRA 3ED1A 3OE4A 2XKBA 3QF7A 1U3GA 4X1EA 4D0PA 2GSDA 2HXSA 2I4NA 2WTMA 2ZAOA 3PFBA 3RS2A 5JCJD 3AEQA 1TTYA 4TRJA 1EESA 1ARZA 4QYIB 1IPEA 4DDKA 1LF0A 2AMYA 2F9FA 1HE2A 3FFWA 4WZ6A 2WP8J 1E2JA 2H5IA 3L8GA 4PTZA 1AF4A 2J0SA 2FP4A 4ZZ1A 3H11A 2XXAB 4F5ZA 2ZUBA 4BEBA 1XDSA 2EFYA 4FFBA 1O9HA 4I08A 2XDVA 4C6SA 2NAFA 1BJZA 1NQ5A 2OV8A 2X77A 5DHRA 2VYVD 4PBSA 1OI7A 3GRRA 2JD1A 1EXNA 3PPWA 1J0AA 3ZXSA 1YRNB 3N0TA 2I78A 2WQ6A 1C7ZA 3NCTA 4BBPA 2YR2A 2PANA 1RTKA 5J4YA 2WYUA 3OD1A 1KF0A 1BA5A 3OZGA 4IW3B 3M83A 1E0EA 2OTJI 4JL5A 4E31A 2AFIB 4LB6B 2I4IA 2WICA 1ZLXA 1Z25A 2QTRA 2GHTA 1Z5GA 4OG2A 1DBIA 1UAGA 2A0UA 1J8VA 3EZYA 2H1CA 2BRUC 2ZAIA 3O2NA 2NRAC 4S35A 3RVPA 1OBHA 2ECOA 3E0XA 3H2YA 3IXMA 4LRWA 4D99A 3CYFA 4EMTA 4JLVA 1AXRA 1GAWA 5HM6A 4CDGA 1I9CA 3JAMA 2OA4A 1FFBA 2Z58A 4FT4A 5DV9A 3BG5A 4EMUA 3ANTA 2FRVA 4RTPA 1I94B 3JWHA 1DG3A 3IWZA 2W2NA 4PHFA 4B45A 4BO0A 1OH5A 1LJ9A 3E0JB 2QYHA 3D4BA 4BP3A 2MSYA 3CCEI 4WLOA 3FWNA 3PEEA 2L42A 4XEHA 2YHSA 4BLTA 2FEOA 4OYRA 1J8DA 1O96B 1P80A 4BO8A 4F6RA 4JNCA 1OLUA 3IMKA 1SJ9A 1WCYA 3PQDA 3WVNA 3LPNA 5A7FA 5IN4A 4CKXA 1HORA 1J4AA 4KQCA 1UKBA 5LL6P 2HW8A 2WWIA 4PG4A 4DQDA 5HKAA 4LDJA 1JBQA 3R40A 4TXMA 1NXWA 1SB9A 1GRNA 1MIOB 1SANA 3L7DA 3ZN0A 4L72A 5SYMA 2XCRB 1N9GB 2HZ7A 3RASA 2DYKA 1G4DA 1FVFA 1I3LA 1V3UA 4M3DA 3DOOA 3FVRA 3ZX4A 3PT9A 5C1PA 3U4GA 1TO6A 4ARBA 2VSXA 1KZ7B 5I7EA 4WK8F 3KSMA 4PLTA 4G7HF 3TBIA 2Y0CA 3CV3A 3NGLA 3V4OA 2WAYA 5EVJA 4J1SA 3J7AY 1MIOA 1UMDA 2NM0A 3QUBA 4HGQA 4DC1A 1NONA 3RIMA 1ORWA 4W4TA 2O5EA 3LSTA 1M2VB 5F0CA 2ZQYA 5LWHA 5AJVB 1Z67A 3CGWA 2ZIGA 1Y3IA 2Q2QA 4CIVA 2VHYA 1QRYA 4JB8A 5E1BA 5K0JA 3LL4A 1PR9A 4I6GA 3T6KA 1M66A 4ZOLF 5K9ZA 1BX0A 1JEYB 1C3VA 2D2FA 1ZLKA 1H2FA 4Z5XA 3HNRA 3UMRA 1EWKA 1II0A 1EZ1A 1GPJA 1V8BA 3BFKA 3I4LA 3I8XA 1U2QA 4L8FA 1C7RA 1AB6A 1YS1X 5J9FA 5EE1A 4URXR 1P91A 2P3SA 1SCNE 3PFIA 3EFOB 1T1SA 2HLDD 4LDAA 1R4NB 1TECE 2FWRA 1FUIA 1YITI 2ZT7A 4X45A 2BW3A 3F3YA 2CD7A 3NZEA 3EW7A 3B9PA 4R5MA 2PRZA 1E9DA 1D0IA 2H0AA 2PRIA 2Q46A 4G1CA 2JJ8A 3BCHA 2AJBA 3QUCA 4E09A 1KMHB 3KBBA 1N32B 2CDCA 2XR1A 3HCWA 1K3UB 2H9YA 4RF3A 5FTJA 1P2BA 4JWKA 1NA5A 2ZB9A 3TSZA 1DI0A 1EUDA 3DW3X 3VC7A 1A9TA 3WRYC 4FN5A 4BAZA 4A0GA 4G8JA 2HOTA 3H97A 3H1CA 1K6MA 2WVGA 1UJMA 2ZJ3A 3I76A 3OZSA 3NRVA 1Z21A 3PDIB 4UHEA 1I7DA 4ZJPA 1ZNQO 4HB0A 2J0QA 1O4XA 1LQ1A 1QKIA 3FOBA 1QNFA 1BFUA 1ZELA 2AI3A 3V4LA 5EESA 4AG5A 1QP4A 4CZ2A 2FFQA 1U3UA 3KZCA 4TKZA 4TOIA 2OKCA 3R9IA 2XWSA 4QG7A 4Y2HA 4A8JA 1AUQA 1S3GA 2BYVE 4OWRB 2DFTA 2XDQB 3GN1A 4MB0A 3RVSA 1OXSC 4A8JC 4AJ4A 1BXZA 5DXJA 2IHNA 3SJUA 1WB4A 4Z4FA 1VZ3A 1S89A 2HOAA 3DP9A 5FPHA 4W97A 5ALDA 2FW9A 4RF4A 3RBVA 4YMLA 1B73A 1AT1A 3GJQA 3HR4A 3KJXA 4WUVA 2A2ZA 5G0UA 2HO4A 2H31A 1PLKA 1Z8NA 1U98A 2RCYA 3FWKA 3OBIA 1PQYA 4BJ6C 5ILSA 4X6UA 4EGQA 4D7NA 4GHWA 2CE7A 2IEYA 1UHSA 4TKLA 5AK5A 4RIEA 2GOYA 2II6A 3TEMA 4LMYA 3V8PA 5E0KB 3AR8A 3BWBA 4LPKA 3LOUA 1N6KA 3W6JB 3OEEA 3PNMA 3R3JA 5DASA 2XF8A 3K4NA 3DMPA 3TWOA 3TVDA 4HDMB 1A35A 4OA8A 2XE4A 2V55B 4WNIA 1M1EB 2MH2A 1FDTA 2WMNB 5GJWC 3PJEA 3D7LA 1ZRDA 3SX4A 3WK9A 4BMVA 3IHTA 1NUHA 1XN7A 4N5DA 3S81A 5JTUA 3UA4A 2H1VA 3KZ1E 3SM3A 1E9CA 3A2LA 1QO9A 3NVDA 4HGZA 3OM8A 4UCFA 1HW2A 3PGMA 4N54A 1E1MA 4Q4CA 4CIWA 1A2QA 2CUTA 4MKGA 4MVJF 4DXHA 3CX8A 4LTDA 1L7EA 1MU0A 1USIA 2N9UA 2WVHA 4JYBA 3MYYA 5IAEA 1EE1A 3KQWA 4CV0A 3NMUF 4CCJA 4BBRJ 2CF6A 2QTAA 4FKZA 3A6DA 2Q8QA 1OBVA 5ALGA 2OHOA 1Z29A 4XYBA 4RENA 3AFMA 3QA9A 1VL6A 1YJBA 3UVEA 4EDHA 4E1AA 1FY7A 4UM9D 1KZYC 2DBBA 3C15C 5JD5A 1QGZA 3I23A 3RYTC 3ELBA 5T3UA 5EYPA 2ZPTX 1DU4A 4O08A 3EXG1 2F2TA 4LXIA 3F8CA 2JA5J 3EIXA 4H4KC 1BFKA 3ROZA 1SUIA 4PIVA 4WFJA 4AZ0B 2HIAA 2WJGA 2DW4A 3VZCA 2RAVA 3VDNB 2GESA 3I9FA 3U4HA 2VNHA 1Z6GA 4R2HA 4TS3A 4E5PA 3CQ9A 3T1TA 1B72A 3LF2A 3OIYA 1W7AA 4DA4A 2WHYA 3IP4B 2C7VA 2QLFA 4WDQA 1DQRA 1DO8A 5L3RA 1YU9A 1O9GA 3EWSA 1WU8A 1JVNA 4N7RA 2HLPA 1IE3A 3PFYA 2OHGA 5CDGA 3DSRA 5I9LA 1RRMA 5ICMA 2VUHB 3T7AA 3D2AA 4LHXA 2W83A 1WTAA 5AFSA 5FLEX 5KNDD 2CLSA 1J7KA 1T9GS 1K08A 2VLBA 4II7A 3LCRA 1OXVA 5ES4B 2O03A 1QH1B 2PZ8A 1AKMA 2AKYA 2DVMA 1M8JA 3C1DA 4CYCB 2IXDA 1ESCA 3NU1A 1OWLA 2I6UA 3FRJA 4J1QA 5JATA 4AS1A 1R0ZA 2QUZA 3AXTA 2RK3A 3QLEA 4MPRA 4Y6LA 1DTSA 3CVXA 1QU2A 3PQ7A 3E5RA 2N1BA 1YK1A 3PPVA 3EVZA 2D2WA 5K03A 5DDIP 4I55F 5BSUA 4X1KA 3NP9A 1R6TA 3R7AA 3ZLVA 4D4KA 4ZYXA 1U2SA 2Q3FA 3MMSA 3F96A 3SZTA 1SOVA 4GOLD 4FX4A 4N41A 2R9VA 2X9GA 4BEJA 2QBYB 5SICE 4A3MJ 1U3DA 1V5EA 1JDVA 3B85A 3TQOA 3SQDA 2UUAB 3RUPA 2FN8A 4MVCA 4KQ6A 1M74A 2O2EA 4LHEA 2XQIA 1QA6A 1XTKA 1HYHA 4FFWA 4LHYA 3VQTA 2B6NA 1L7PA 5KDDA 2F64A 3INNA 4LCJA 1TP4A 2FDRA 2POCA 2QHXA 4I8IA 5B7NA 4B2LA 2G28A 3MKWB 2EG9A 1L7NA 4QNMA 4B47A 5KYXA 1P19A 1YA4A 1GPAA 3R9XA 3K2QA 2B9EA 3BCUA 5ALJA 1PGQA 4P22A 3W6NA 1N3LA 4D45A 5LQRA 3M3HA 4Y7NJ 3ICEA 4XBFA 1PV4A 1SBYA 5BYBA 1J9EA 2F3TA 4MVYA 4XSGA 5CXXA 4M60A 3S2GA 3OOPA 4H3VA 1F2VA 4K8OA 1TC2A 1IBLB 2HSDA 3IR7A 4DR3B 4C2TA 3O2JA 3OCJA 3H36A 1C3XA 3B6ZA 4LK0F 1CFJA 2HWXA 1VQ6I 1Z7UA 3BTVA 1WCV1 4RV5A 1M5UA 4ZO4A 3PXEA 1RM0A 1LTQA 4BKRA 4R2XA 3K7AJ 2ZMEB 4W5OA 1E5VA 1P17A 1RLTA 1BCSA 1N2SA 1VCMA 2PSSA 3IP8A 3C7JA 1H2BA 3E8XA 3K70C 2MTBA 3ECAA 2ONJA 3MT8A 1H4TA 1WEHA 4LITA 4KL8S 1UFMA 1KA8A 3HCCA 4BHCA 1PP7U 2A78A 5GINE 1RAGA 5JMPA 4EB6B 4L3WA 3I2IA 3MCVA 5FA5A 4ZI7A 3L1UA 3ZBQA 4DJTA 1OB5A 5FTNA 1RPJA 4LOCA 4QLBA 1UBGA 1FX7A 3ZHUA 2O19A 4IPTA 1NJ1A 2WD8A 1KVSA 4R2IA 1RC9A 2A8YA 4IV5A 1MGOA 2G4CA 2GXAA 3FIJA 1B8OA 1B2RA 4OAYA 1SC9A 2O23A 4GO1A 5KOJB 3PXDA 1B8IB 4X20A 2A5DA 4IIYA 3R74A 1C9YA 1WZCA 5EPUA 4K1LA 1G6HA 1XNHA 3CUWA 4YC7A 2SECE 3IAEA 4ES6A 1PR0A 2QZ8A 4JJ6A 4JBAA 4N4NB 1MO4A 2X9NA 3E6AA 4KVGA 4MP3A 4L51A 4PZEA 4RVGA 1D0ZA 4NONA 1RE1A 4MSUA 1CRWG 1Y3DE 3LD9A 4OX9Y 3GH1A 4GC9A 1G3WA 1I0ZA 1MC4A 1P0QA 4U3JB 1AKTA 2OENG 3L7NA 3GRYA 3LKZA 2X51A 4LGWA 2VZ8A 4MRMB 3NWSA 4U7GA 1NRJB 3OE7D 5LBIA 2G0AA 2Y1EA 4MUKA 3SIRA 3VI4B 4F6LA 5AH0A 2Q5HA 4IIJB 3ZQJA 1AGNA 1UQTA 3JYNA 5HKKA 3W8NA 2Y0SN 3GNLA 5LQKA 1KEEB 1SBHA 4MNTA 1YH3A 3LSGA 2O8NA 2C58A 2P9HA 3CO7C 4DIQA 3CEJA 4PSUA 1Z0SA 2PMDA 1ID1A 3HCDA 3HLKA 5HEKA 5B37A 2WMDA 4D9HA 5IAOA 4PN7A 4AYBA 1AKHB 4V0OA 3OCYA 3IHLA 2WJZB 4NDAA 5LMUB 2AYZA 3IVMA 3UUFA 3ANSA 2H85A 4MI1A 1FLIA 5CG2A 1SC3A 2H17A 2WD7A 4WFQA 4BTVA 5ESRA 5CBPA 2RIPA 5DNYB 4RMHA 4F71A 1VJ1A 5FFXA 1WXWA 2JH9A 2QLLA 3UF0A 10MHA 3B3QA 2QTWB 4UMVA 3VI3B 2XW6A 4UE2A 3CMEI 5ALVA 3H83A 1MA3A 2W2VA 2EV6A 3O8HA 2E36A 3GAFA 3W06A 4I6ZA 3IIEA 3RYIB 4C4OA 3KU1A 5I9BA 1GSIA 5EJ9A 3OOWA 1YWGO 3R6GA 3BAFA 1MH4A 1OXBB 4BMYA 3GEPA 3TECE 4B3AA 3K9NA 3QX3A 1P72A 4UV9A 5DM1A 2ZBRA 2QVZX 3NKVA 3W2TA 3C5VA 2Z95A 4R0VA 4R7GA 1GV0A 2WSSA 1CQJA 2RAPA 4ZHQF 5KOHB 2EK5A 2R47A 5FUMA 4MPDA 4DM7A 3HCPA 2OJED 1BHJA 1Y48E 3H3FA 2A88A 5BSWA 1AD2A 1X9GA 2MG4A 4RZXA 4OI1A 4FQ5A 4AURA 3K2AA 4L22A 3R7FA 3UXHA 1IM8A 1N57A 2GCGA 4QYIA 3AUFA 3WE3A 2DCEA 2I7DA 3DE6X 3RT9A 1BXRA 2WSBA 4IGFA 1Y56A 4HDVA 4OIOF 5AI9A 4HF2A 3AB8A 3QIAA 1KAGA 4YP5A 4MKZA 4ZCSA 2WJYA 2BY1A 2HDHA 4DY4A 1N2BA 3PHJA 4NCBA 1FP4A 1YBVA 4E7ZA 2G88A 2V6JA 4HTAA 1ZM2A 3ICVA 4UHKA 4XB1A 3WV5A 1I24A 5KC9A 1PVOA 2HYIC 4B7XA 3IQDB 4NMWA 4CF3A 3FX2A 2G0NA 3QHPA 3SF8A 2DDBA 4NARA 4ETWA 4ZC1A 3E5NA 1TAGA 3WIBA 3FZYA 1Q50A 2D1QA 3EZNA 2IIQA 4G1MB 3HKDA 1MIJA 1Z16A 5K6TA 4U9HS 3VH2A 1GZVA 3OZVA 1IRIA 4XM0A 2ORWA 2QMYA 3CPEA 1UBMS 3NNSA 4RE6A 3Q0WA 4WX9A 3AFGA 2Q7DA 1CZLA 1E6UA 5LQDA 2CXHA 2IOYA 4CYDA 1TEVA 4HQMA 1ULSA 3ETGA 1UKZA 4JVNA 4LV6A 1GN9A 2C4TA 2IWRA 4HEHA 2ZS9A 2KSQA 3BHNA 2XE6A 3GJRA 3TLXA 4BX9A 4EGYA 4C3JJ 4UY8I 1TKRA 3K1ZA 3D1NI 4V0KA 5LBQA 1MA0A 3D6FA 2IGNA 5LUBA 5A5FA 3DUFA 2DGDA 1ECPA 3HKCB 4XICA 4RADA 4XPZA 2NVUB 1JKRC 1CF2O 3GLKA 5DCUA 2HIMA 3ET4A 4DIKA 4DMHA 4KXXA 1J0DA 4OJQA 4YP9A 4MAAA 3VC3A 1YL6A 1HURA 1WO8A 1EFVA 4EJ2A 1TBXA 5JVDF 1QP7A 1YKGA 2X9DA 1ZVVA 1ZRNA 4URFA 4OSEA 1I3QJ 1CC1S 3S0JA 2YIVX 3V9PA 3KSRA 4MXDA 5CB4A 1CJSA 2IS4A 4FILA 4D1YA 4UBOA 2J08A 4AJPA 1H42A 3JYLA 5D3MB 4Y2PA 1WXHA 1UMDB 1I2BA 3EJWA 1VMDA 2XGGA 3C7CB 1Z6YA 1GUAA 3D7RA 3KJEA 4JKYA 1KEPA 2IDMA 5FROA 1BX1A 1MJNA 2H11A 4KACA 4MITA 4MICA 2WTXA 3EXHA 5HCUA 1T4CA 2R4QA 4IF6A 4C6RA 4I1OA 3HWSA 4MHTA 1QBGA 3QEMB 3M6XA 1SCAA 4J3FA 4EEZA 1Z7YA 4K2HA 4B1FA 4NBWA 4V03A 1U2GA 3LLSA 5CIWA 4XKWA 2NXNA 4M0PA 3ZI7A 2WT8A 4DCMA 4QU0A 2CDBA 1XJCA 3H8WA 1TUGA 2PXCA 2QPLA 2UZIR 3RYHA 2LRHA 4MS4A 3JX9A 4DBZA 1NI3A 2W24A 1MVNA 2WABA 1N8TA 3DT6A 2D00A 4NF2A 4A1FA 4CSWA 4PLPA 3CRQA 5EUBA 3HTSB 5C8YA 2KWIA 4B7UA 4CQLA 2SKCA 1KI9A 5FNVF 3QPSA 3AH8A 3K10A 2V7VA 2YIDA 1GO2A 2QZ4A 4YAGA 4BJ1A 4NUBA 1Y82A 1JTEA 3QRFF 2ETXA 2J9FB 1E3LA 1IHXA 1PG0A 3EIFA 3NC0C 4MDEA 1I5ZA 3U62A 3NV7A 3WYAA 1NG9A 3ECOA 4BJ5A 1WH5A 1TDJA 3BS4A 3RFVA 5JASA 3CE9A 1X2EA 2YIMA 2O7SA 3I0TA 1HE8B 2RG1A 1PYVA 4WKOA 4GL2A 5C44J 1G7SA 4BGVA 2RGGA 3IJPA 4BY9E 1OI2A 4DMFA 1U7HA 2DSNA 4M1TA 1EP1B 1T3LA 2IV2X 1TVKA 1BI0A 3JVDA 4TPKA 2FVYA 3M1AA 5GTDA 2WUGA 1Z4IA 2XMPA 2PUCA 5J43A 4V0MA 4E51A 1AOXA 3TEDA 1VB3A 3BMCA 3DLCA 4PQFA 2VH2A 5E6UA 1JUDA 3DCYA 3JWJA 3RJTA 5LYJA 2I1QA 5ISMA 1LVKA 1ST3A 2FUCA 1C5KA 1P2TA 3FB1A 3KLBA 4AMBA 2E5FA 2RKBA 1ZVKA 3D6VA 5DLDA 3DEZA 2B7BA 4OP2A 4AM8A 3H4IA 1ZIOA 4I36A 1OCTC 1ZN9A 4XD7A 4I6EA 2FSHA 4B6OA 1P18A 4OKNA 3L2QA 3AR3A 3C7DB 4H9GA 2XDWA 2FB9A 2R8YA 2VJQA 1GKUB 3JQAD 4EYEA 2W82A 1JQEA 4MTDA 2WKPA 4MV8A 2ZZMA 3AEXA 1IG7A 5I4IA 3AVPA 2EZTA 1NLZA 2IPAB 3AR7A 1VQ5I 2C99A 5LZ7A 3SJCA 2QSUA 5DTRA 3TLEA 2XVCA 1XCJA 4QDUA 3WB0A 1L1RA 2R68A 4HBZA 3SZOA 4AMVA 1M2OB 1SQ0A 1OGIA 1ND5A 1NY5A 4FHGA 5E7JA 2YHIB 5H9WA 3G5AA 3STHA 3SNKA 3EIHA 5CT4A 3TBFA 4Q7QA 5JSFA 2ZT8A 5AYVA 4CF5A 1X3WB 2QSZA 3DV8A 1GT91 3MTQA 4W7SA 5E9QA 3IV5A 5C4XJ 1WJ5A 4YMWA 4B6EA 4G84A 5ADWA 2F4NA 1H3NA 4G2TA 1OASA 4FNMA 3B6CA 5BSGA 1Z0AA 3WJ2A 2J67A 5TR9A 1N6RA 3DD1A 3H3JA 3K0FB 3K32A 1N75A 2FZCA 4ZEOA 3T0FA 2X4IA 2GJKA 4J90A 4RFVA 2HWUA 1XTZA 2OO5C 3W4JA 1U3CA 4F60A 1QB8A 5FLXA 3NKLA 1JGGA 2BELA 3KXDA 2E7ZA 2H4WA 4CQMD 4V1CB 3HSFA 4MVJG 5JBIA 1G3YA 2BISA 1YU6A 2W6NA 3P0IA 2W7NA 4RCVA 2DSTA 4IOAF 3A1FA 2VXDA 5BSVA 1FRFS 1Y7PA 4BL0B 1VHQA 4OK6A 4AWXA 1KC3A 1Q1BA 3L9WA 1NUTA 4F1JA 5FR1A 2GJ9A 2IYOA 3IAS6 1DCFA 2H51A 3WTXC 4GEKA 4AN0A 8LDHA 4DDVA 1R12A 4NYJQ 4ZPJA 4ABYA 2ORED 3ZCVA 1XBTA 5BURA 4QGBA 4ERNA 3GO4A 4C4RA 1P7JA 3SIPA 1JSXA 4YUYA 3RUHA 4LWOA 1PJ3A 5DRTA 3G5TA 2IDJA 3HPRA 4LLLA 2NUPB 4PX5A 1K4MA 2HB6A 1NVMB 2V6MA 4RS4A 3EYAA 2BDTA 1T10A 2VP5A 1DAOA 1KYYA 4ZTJA 2D13A 1BMTA 4MQEB 4DSNA 3HGMA 2OV1A 3OM9A 1GL9B 1UFVA 2YWHA 3ZCPA 3I9OA 1KJWA 5L7TA 1DQSA 3P0HA 1MRNA 4TT3D 4ZYGA 1KL7A 5CP8A 1VIVA 1XP5A 3ILYA 5CXSA 3K05A 3WL5A 5BQXA 3UB3A 1FOWA 2JNWA 5BMVA 1YULA 3ECCA 2BHRA 4OIFA 5LWQA 3F73A 5F9FA 1X7DA 3BMOB 3J81Z 1Y4ZA 5IP7J 4B3DA 5CCBA 2R7DA 4HV5A 1ONOA 4Q5SF 2N3ZA 3OTGA 1TEZA 1T0UA 5EEGA 2NZYA 4NCNA 2CYBA 4W5WA 3MB5A 4M9QA 1PIWA 3DQZA 3REGA 4XWKA 1A4RA 2XSZA 4HLUA 4P55A 1FVHA 4ENMA 3A04A 1HYQA 3K9QO 3QV2A 2WHQA 1V48A 4MGEA 5HS6A 1M5TA 3WQSB 1A72A 3DBIA 3JWEA 3WU1B 2FRHA 4NV1A 3ROEA 2LDUA 5CW1A 3FYUC 3DFUA 5A4FS 5AUQA 1YQWA 1MDMB 2R1UA 3EHEA 9GPBA 5F1YA 5MHTA 1ZP6A 5H68A 1DC3A 4UEQA 3SYTA 2PBLA 3J80Z 1CUXA 5WRFA 5BT8A 5AM3A 2LKSA 2ZRIA 3HCAA 2WILA 4D4IA 2QYTA 1NVKA 3GLVA 4MWBA 2CE2X 3OURA 2BD0A 2P30A 2G5TA 1H94A 2FPSA 3NYRA 1ISRA 4NNJA 3UK7A 2VDWA 4G6DA 2FZKA 5JD4A 2VBCA 3R7BA 2YV1A 3AJEA 3AM1A 1DUVG 4LXXA 1MH9A 2CYAA 4CEHB 3KM0A 3DZJA 4OQYA 2FEWB 1R6VA 1QDEA 5BW8A 1U9OA 1VE5A 5TT0A 3COWA 3P2MA 3THYA 1R5OA 2EA2A 3OIUA 2XGOA 2JVKA 1W34A 3DDNA 3TOBA 1K3FA 3EG5A 4G1UC 3O0TA 4QIWN 1O3SA 1TT5A 3FH0A 4J43A 3AVUA 3FR7A 3HBNA 1H4QA 3TFWA 4H1WA 3HLYA 1T2EA 4YT4A 3NEPX 1XTBA 4NOKA 4LFAB 3KS9A 4RDCA 2XMGA 2EDCA 1DEOA 3CF4A 3DW1X 4C3HJ 3MGCA 1RYYA 4Y9RA 1WSWA 2KDZA 3Q2IA 2VE9A 1N4AA 3PTZA 5AJTA 5CA0F 1Z34A 2WE8A 3LUBA 1KOFA 1AZTA 2ZB8A 7AT1A 3U19A 4RW0A 4F0JA 3QODA 1FLNA 2RCNA 5DS9A 2GXUA 3UMFA 5C9ZA 4UNPA 4JUBA 3ADBA 3BGSA 4QDZA 1IIBA 3VDRA 4ICIA 2W2QA 2ZT5A 5JWHA 4Z49A 4ON0A 3HA2A 2NOGA 2EQBA 4AJEA 2J3EA 4RKWA 5K51A 2IUUA 3LA7A 4HV4A 3CCVI 1H93A 1SR8A 1V3VA 1VQ1A 1VKNA 2CU7A 3HB9A 3BJMA 1W7PD 2DU9A 2A0YA 5KWJA 1G17A 2A0XA 4S0XA 3IEMA 4HH1A 4WZAA 4BMSA 3HBMA 1R15A 2E1NA 2QTZA 5D6FA 4CNQA 3KKEA 1NF9A 5JHUA 1KVRA 5FD6A 3HKZN 1U1FA 3E84A 3GDGA 4PAWA 3DAHA