1SD5A

Crystal structure of rv1626
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
PRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords putative antiterminator
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd5A01
1SRRA 5E1WA 4YFXF 2JVJA 1OYIA 2LF8A 1FYLA 2YX4A 1K68A 2CG4A 2K7LA 2ZMEB 2M1BA 2JB9A 5CNJA 2E1NA 2H3HA 3CTAA 3LFTA 2EK5A 2VC0A 3M6MD 3QP6A 4RDCA 4M6XA 4TN5A 3H1GA 3KP5A 1TQMA 3R0AA 3HM9A 4HV5A 4EJTA 2FVYA 3HSFA 3HEBA 4GYGA 2FEKA 3T5XA 2CHEA 1HW5A 4MS1A 3FMSA 3LTEA 1O3TA 2MLKA 2QV0A 4WXEA 4OATA 4P1ZA 1REPC 2ID7A 4G7ZF 1FLIA 2MLGA 1U78A 2QQAA 3S2WA 4CO8A 2QLZA 5TPZD 2HPHA 1JWLA 5FWYA 1YTUA 2ZO4A 2XVCA 3FHZA 3GBPA 2VBXA 2JZYA 1DRJA 1TQPA 1LDKB 1ZGAA 3SXYA 1L5ZA 2IPMA 4KVFA 3WTUC 1VRVA 2XV4S 3WU0A 3QAHA 4CZZA 3ABUA 3FMRA 3V8JA 3E6DA 5BQ3A 1NTRA 4WF2A 3SHFA 1IN5A 4MQ9F 1UFMA 1JYEA 4Z4FA 4IRHA 4ETMA 1MZBA 2ISZA 3RVPA 4L85A 3KP4A 4I01A 2FSPA 3CLKA 4YG2F 1EFAA 3Q9SA 3IC7A 9ABPA 3BBLA 4KIGA 4AD9A 3SNKA 2DQRA 4NB5A 3F21A 3I5UA 3GEZA 2JTVA 2QVGA 1PUEE 2PN6A 1W9HA 4ENMA 2B4AA 1BI0A 2VBYA 5TQ2B 1XGMA 3BPVA 3IWZA 1DDNA 2IVMA 4P5OA 2FLWA 4ML3A 5CYVA 3HRUA 4UV9A 2TDXA 3F8BA 3GFJA 5IEJA 1U8TA 4N9IA 1IZ1A 1ZLKA 1FYMA 2YHBA 1URPA 1R8JA 2QBYA 3I58A 1R1UA 3QOPA 1EH7A 3I54A 5ABPA 2XGXA 3I59A 4JASB 4OIOF 3MIZA 1O57A 1QQBA 3T8RA 3OLXA 1PP8F 4L9VA 3R0JA 1XB4A 4Z0NA 4XARA 1LEAA 2QVCA 1F5TA 2Y75A 2FF4A 4G0QA 3TDUC 2F8SA 3N0RA 4W5QA 3BJ6A 1OXKB 3GWZA 4ETNA 2IP2A 4EM1A 4LE0A 3MWMA 2QZ8A 4LD5A 3JTHA 3C3WA 5CVRA 4ZZDA 5BQTA 3N97A 1U3EM 1DCFA 3GT7A 4JAVC 2JRLA 3H3ZA 1SFXA 3QX9A 5L3DA 5LRSA 2Z5UA 4WXDA 5DCMB 2E4ZA 4LLLA 4WXCA 2ISYA 4PE5B 4E70A 1BI1A 1M5TA 4RV5A 4EM2A 4QYWA 1D4ZA 4H0EA 4G97A 5IT9Z 3FFTA 3RJPA 3VNAA 1Z2DA 3DEUA 4Z4IA 1ODDA 2AXLA 3K4HA 1VLZA 4EM0B 1IUYA 4Y13A 1I1SA 1LJLA 3RVNA 2OBPA 1A2OA 4RK6A 2DU9A 3K9TA 4RK5A 2ETHA 3F6CA 4EV0A 2FLKA 1I1GA 3DV8A 1W4MA 1T6SA 3WGGA 3G1WA 2IA1A 5L3FA 5DYMA 3JPYA 2LSOA 4M74A 4JOQA 1YS7A 3LUGA 2E4YA 2PI0A 2HKOA 1JL3A 3N8IA 3SQNA 3KKEA 3WTWC 3WTXC 2VOPA 2VUIB 4U88A 1RXIA 1J0RA 4D6YA 5FWXB 5IBQA 1T2KA 5D6FA 2D1VA 3HIFA 2Y0MA 1FFGA 4KICA 1DBPA 4PGHA 5JI6A 1JHZA 2BYVE 1P6UA 1BIBA 4IVNA 2VYCA 2G9WA 3FXRA 2FW0A 4RK0A 4CYDA 1YQAA 5A2QZ 1RPJA 2Z9OA 2O61A 3NHZA 5ERIA 2HTSA 5F64A 4NICA 4HQMA 1DCKA 2PL9A 4NQRA 2P5LC 1RZ4A 1SD6A 3GFMA 3KSMA 3QU3A 3HRSA 3JVDA 2JT1A 4YWHA 1RXEA 2FMKA 4WXMA 3KP7A 5K5OA 2L01A 5KC9A 4ESFA 1UHWA 3LKBA 5TE9A 3G3ZA 4KN4X 1J59A 3QK7A 3RVJA 4ZPJA 4HF2A 3LUDA 3ERED 3FWEA 5LGNA 1O7FA 1KQ9A 3OLWA 5FBHA 4OU0A 1NXOA 3UUGA 4WZZA 2EA4A 2YHAA 4XXHA 4OLBA 4N76A 1U2PA 3K0LA 2A9RA 1YO5C 1EV7A 2RV8A 3JAMZ 3D8UA 1USTA 3M9AA 3MQ0A 4A5MA 4KIBA 2FMFA 5D5WB 5E20A 2FBKA 1STZA 1D5VA 5E18F 5CVUA 1ZY2A 1I3CA 4KIFA 2VXZA 5TQ0A 4UNOA 3KE2A 2F5DA 3NNDA 2EV5A 3HK2A 1Z91A 5DLEA 4RWEA 4MR8A 3A0UA 4HAMA 3KCNA 4U0WA 3Q41A 1MD0A 1X3UA 3GUDA 3QLTA 1P2FA 2E1CA 3HRMA 1USGA 3TO5A 1W7PA 1CHNA 2M98A 4P9FA 3KTOA 4G7HF 2FKAA 5TPWB 3E3VA 3IKTA 2FU4A 1FOKA 1IN8A 2QENA 1YW9A 2HYGD 1AWCA 4RGXA 4DN6A 3LA2A 2P9HA 4LJZF 3WTZA 1CEYA 2F8TA 2PMHA 1GXQA 3F8CA 1KU9A 2VT3A 4OIPF 4JB2A 2P5VA 4KN7X 5H6RA 1KU2A 4RXTA 4M88A 2HEOA 3PQJA 4XLNF 2WMYA 2FNAA 2CWEA 2IPQX 1U2QA 3T6KA 2XKOA 5IUNC 1FNNA 3RPQA 3GRCA 1RNLA 2HR3A 3IP7A 4XFKA 1USKA 1DG9A 3FMVA 2ZNYA 4KA4A 1U5TA 1XCVA 4ZYDA 3O2JA 1NXTA 2QQBA 1TLFA 1FZPB 2JBAB 1WRJA 3FX3A 2CGPA 1U0SY 4FE4A 3SZPA 3KZYA 1DBQA 3H5TA 1QPMA 2QYOA 3FF5A 5LHIA 2Z99A 4MQVA 1O3RA 1AB5A 2R3SA 3H75A 4UHJA 1HSTA 3CKMA 3CRNA 4OINF 3MCZA 4ZMRA 3K69A 1Z6TA 4BHCA 2W57A 3CG0A 1R5HA 1D5WA 5TJJA 4L0YB 3H5WA 4BQAA 3RYRA 2VN2A 3TDZC 5D8KB 4MR9B 5JVTA 4BYYA 4F11A 1VPWA 3DFGA 1RZRA 2F2EA 1ONVA 2GXBA 2O3FA 4HLXA 3C18A 2RGYA 4CGZA 4OMYA 3RVOA 2X4HA 4EY3A 2EB7A 4D6XA 2H6CA 5K5QA 2P5KA 5TQJA 2A9QA 1ON2A 2O03A 2GKGA 1YYVA 1BDIA 3AAFA 3Q7RA 3FXQA 2ZCWA 3RH0A 6PAXA 5D6EA 2VBWA 4Q48A 5FD5A 2MC3A 2WRZA 4YIIA 3O1IC 2QSJA 4F8JA 3W6KB 1LB2A 3HTUA 5EWJB 3H92A 3P9KA 2W24A 2VONA 2DT5A 2FXIA 4WWHA 1HW1A 3BRQA 3QLUA 4IHTA 3DGFC 3OQOA 4RY0A 1JBEA 5CVVA 4O3MA 1JDPA 4EYKA 3IL2A 2ESHA 2MSKA 2ESNA 1W5SA 3BZ6A 2QXYA 2R7DA 1HKQA 3LUAA 3OMXA 2A61A 1JX6A 3SFZA 1USIA 3F23A 3ZMDA 1Z7UA 2PG4A 1JLKA 3E61A 3UKJA 3DPTA 4K2EA 1M2FA 3KFWX 4LZLA 1M2EA 5ICGA 2JRTA 3MEXA 3REOA 3T0YA 2H0AA 3CU5A 3E97A 1Z05A 4M9ZA 1QKKA 1K66A 4HNRA 4H60A 2EFQA 4HX4A 5CJ9A 1ZLJA 4A6EA 1T39A 4IILA 4N0PA 4Q5SF 3LA7A 3Q5FA 4KK4A 4MTDA 3IDOA 2UZKA 1R1VA 4EYGA 1XMKA 4M9SA 4R79A 1DPRA 4OOIA 5LRRA 4G0ZA 4XAQA 5LEKA 3GWGA 2PUDA 4Z2YA 2H94A 1NXWA 1DC8A 3P9YA 5ICFA 5LEJA 1SXHA 1ZRCA 1TW3A 2MSWA 3Q15C 5HLHA 1JE8A 5DUIA 2GWRA 4I98B 4F7ZA 4RB1A 1XWWA 4UHKA 4HX8A 3FMQA 3QLUC 1DRKA 3T8YA 4IPAA 1U2WA 1ZH5A 5CVIA 3MAJA 1FX7A 4O5VA 1FP1D 5DGCA 5BRJA 4ZYEA 4G0PA 3I53A 1QP7A 3NNSA 4RGSA 4BHBA 4M71A 1T34A 5EWMB 3J81Z 1J75A 1EWTA 1E2BA 1RUNA 1C4WA 2FA5A 3F3XA 2P8TA 5LGUA 3CUOA 3R6SA 1ULYA 2R4QA 3A3KA 2WWYA 1C0WA 3QELA 3KG2A 3L49A 4MS1B 1WETA 3DP7A 3B2NA 4AVPA 3N4MA 3LUKA 3IRRA 2PLYA 4MAAA 3I71A 3DKWA 4ASNA 1Z13A 5L3EA 4A0XA 4L5JA 2HKXA 2NNYA 1OYYA 2HYFA 2W84A 2R47A 1YW8A 1B6AA 2HSGA 4WUTA 4KK3A 1JHFA 3DF8A 4EVSA 2DFIA 3L9FA 4GGGA 5B3JC 2F5EA 1K6OA 4L9JA 3LMKA 1ZG1A 1OMIA 1FBUA 2GQQA 4Z4GA 4MRMB 2WTEA 4I0BA 2PBIA 1E17A 3CDHA 3DLHA 2OQRA 4ZH4F 3WE2A 1Y1LA 5KQGA 4QPJC 1XN7A 2M1ZA 1KYWA 1ISSA 3BPXA 2MA3A 2CWDA 3JVIA 3F8FA 4BNCA 2DLLA 5DCMA 2KJBA 1WWXA 1JFTA 2KKOA 2IPLA 3A0RB 2EJRA 2RC4A 5TPZA 5FD6A 4O1IA 1OR7A 4RXUA 4ENKA 2R25B 2KIFA 4L0ZB 4RK4A 1QQAA 4BH9A 4L9NA 2V9VA 3PQKA 4MTEA 3JAMK 3R4KA 2O0YA 4XLTA 1PNTA 3KYJB 2M8EA 5H6QA 1BA2A 1W25A 4W5OA 3TGNA 4FHTA 2O8XA 4H3HB 1SD7A 2FE3A 4W5NA 3D0SA 2VUHB 3BILA 2XHKA 3COAC 1HSJA 1E2XA 1T38A 2WWVD 2E7XA 5DEQA 3QP5A 1UHMA 1DPUA 3HSRA 3WTYC 1G4DA 3LUCA 2CFXA 4FT8A 3H5LA 4ON0A 5HSGA 1ZHHA 2K86A 3SG0A 1QP4A 4MS4A 4G94A 1RUOA 1H9GA 5JS2A 2HOEA 3M8FA 1QMPA 2ZFWA 2CSOA 3WODF 2WJWA 2RJNA 2IYNA 3TX6A 1ZN2A 1JGSA 1ABEA 4O1HA 4NHJA 3CTPA 3MZYA 4M72A 5L3CA 4RU1A 2YU3A 3OQNA 1PNRA 2HQNA 3CLOA 1R36A 2PUEA 2F5CA 4PYRA 1AOYA 4MQEB 3RQIA 5LHHA 2L18A 3P9CA 8ABPA 4KMRA 4FB4A 1QZZA 1BC8C 2NNNA 5D4RA 1TQIA 1KQ8A 3O2SB 3GX4X 4U0VA 4G6DA 2CHFA 4PZJA 3LUFA 4LB6B 3JSOA 2ZJ2A 5BPIA 3EAFA 3I5AA 3WGHA 2L4MA 4PICA 3I0TA 4LGWA 1B1BA 4HYEA 1QQIA 4RAYA 3VFZA 1Z16A 3F72A 4M73A 3IWFA 2PKXA 4FX4A 2NUBA 3ZP5A 2Q2EA 2IDMA 3CZCA 5IT9K 3OLVA 2LDUA 1EHCA 2FNPA 2DW4A 2MYUA 2PUCA 2NT4A 1AB6A 3HHHA 1JXSA 4WT7A 4HOBA 4TMYA 5HOOA 4S05A 3MM4A 2FTKE 1HW2A 3ZMUA 5T3YA 3ILHA 1LNWA 1TW2A 3ML6A 1R1TA 2Z33A 3V7CA 2DI3A 3O2QB 2HDCA 4DADA 4PCQA 6ABPA 3TKYA 1NXPA 2VE9A 2L02A 3HSYA 3FM5A 4KRFA 3Q7SA 5HLIA 4LFUA 3T38A 3L09A 5JNTA 1GVJA 3GFLA 1FSHA 4F3TA 4RGUA 4G0OA 4IJAA 1I27A 2NZVG 1F1ZA 2NT3A 1FSEA 3HV2A 1YMVA 3WTVC 4G86A 1EH6A 3QEMA 1G3YA 5E8GA 5AIPA 3ZQ7A 2R48A 2PUGA 2YX7A 3QLVC 3KEQA 3EETA 2HTJA 5IEBA 3H6GA 4H3KB 3CUQB 1J56A 2E4VA 3RVRA 3OMWA 1R7JA 2XUBA 5DV5A 2QZJA 3G73A 3J80K 3RI4A 5C5EA 3FM3A 4MQFA 4EYOA 4P96A 3WG9A 1HBXG 3ILYA 1QP0A 4L18B 4R1HA 2JPCA 3D02A 2W25A 2V6CA 3BP8A 4JA2A 2WB4A 1V3FA 1XSVA 1JDNA 2IA2A 3V8KA 3KEOA 3K9CA 3GW2A 4LK0F 3JTEA 4UVCA 4JBAA 4N9HA 3TQNA 4Q6WA 4A5NA 2E4XA 1IIBA 1S29A 3BRSA 2AYZA 2XKPA 4MHGA 2GA1A 3URMA 2XAGA 2VT2A 3JY6A 2W42A 4Y17A 1R23A 3OLYA 4ENNA 4FE7A 5FGMA 4EJUA 1SAXA 1FSPA 2FOKA 1Z17A 3ZN0A 4CDGA 3H5VA 3LQQA 3PFIA 4A2UA 2A9OA 2PJPA 3EODA 5CNMA 3JW4A 3QELB 2Q8KA 4HLYA 4JK1X 1KGSA 2FEZA 4OIRF 1PP7U 3RDIA 1BI3A 2XAFA 3OO0A 2PUBA 1BIAA 2P4WA 3TOAA 3EULA 4YCSA 2MH9A 3IKVA 3UK0A 2HGCA 2RNJA 5FFXA 4LLGF 3FFXA 2XAQA 5EWLA 1P6RA 3TD9A 5KWSA 3J7AO 1MJBA 2QUFA 2E4WA 4EUKA 3RVKA 3L2CA 4LRQA 2ACJA 1XGSA 2FBIA 4HV6A 4HNSA 3ZMVA 4LMYA 4RZSA 3GLXA 2FSWA 2FBHA 1PHRA 2WY2D 4KQ9A 3N53A 1ZRDA 1TVMA 3LQRA 3Q7TA 1QO0D 3ROUA 3OLZA 2K4JA 2VE8A 1E6MA 4YP9A 5HS8A 5ILUA 4CBVA 1K78B 3CZ5A 3T95A 1LDDA 3KYIB 3KP3A 2V1UA 1P4XA 2GBPA 3HOSA 1F4VA 4UVAA 1DC7A 4KZKA 1FFWA 4YIFA 5D8LB 1QZYA 5I4CA 5FFZA 1RIOH 3DGEC 4MQFB 2JVIA 7ABPA 5KI6A 4RY8A 1ZH4A 3QLVA 4BHPA 3GYBA 1ISRA 3BJOA 3IPCA 4HF1A 1D1QA 4EGZA 2ADUA 4BXUA 3ECHA 3MQ4A 5IUJC 3LFKA 5HVQC 4MPTA 1KU7A 3C6QA 3T8TA 4LG0A 3MMNA 1R22A 2B0LA 1XGOA 4RS8A 1IN4A 2HQRA 5FB2A 3BDDA 1Z1DA 1UB9A 1DP7P 2PLNA 5KQPA 5J6XA 2PJUA 3Q9VA 4EVQA 1R00A 1YIOA 4IF4A 3ZMTA 1TJYA 2GA2A 1JYFA 3IHUA 1GUBA 2D1HA 1MAVA 1ZARA 1T98A 3H3UA 3N6VA 1U6GA 4ESJA 1OYWA 3HVRA 3OO1A 1DUXC 5DCLA 4P9UA 4XASA 4LDZA 5D2CA 2EWNA 4MLDA 4EJWA 1B9NA 1CF7A 5HDGA 3WGIA 2Y48A 2LKPA 1F4KA 2ZXJA 1YK0A 4EGYA 4UHTA 5J8CA 1GCGA 1LBIA 3WE3A 2OU2A 1YVUA 2UXNA 2ZBKA 4ETIA 4I2OA 4KUMA 1K79A 5JNSA 1ZG3A 4RKRA 2R7FA 4Z4HA 2XAJA 3DZDA 1K7AA 1FFSA 1J5YA 4Z9BA 1O7LA 5LHGA 5D5XB 4ZYLA 3M7GA 1IXCA 1SXGA 1DZ3A 1IAWA 4HBLA 3I59B 1O3QA 2OENG 3GF2A 4Q4ZF 1P92A 2RGVA 3GA5A 3P9IA 3QPHA 4A12A 5FWYB 2AS5F 2X7XA 1TLHB 3I45A 4EYQA 2IA0A 4E7OA 3ZN1A 3NNNA 4LG0B 5IX8A 2PE5A 1CGPA 2JK1A 4MS3A 3S99A 3OQMA 1Z26A 2KIMA 1JFSA 3O74A 4MGEA 4NCBA 4ENJA 3HS3A 1MJAA 5CHYA 4G8XA 4G7OF 3NHMA 3EQLF 4OMZA 3MF4A 2OZ6A 1ZYRF 2E4UA 2XAHA 1ZAOA 5KK1A 3LOPA 2K27A 3M9WA 1C0EA 5JR3A 3I42A 4CXFA 4RB3C 4KT5C 5DD8A 5CNIA 2YR2A 2FN9A 4MLCA 1YS6A 3E5UA 1YLFA 2HWVA 2D2WA 2HJ9A 2ELHA 4AIHA 5CLSA 1HKSA 1XSXA 2MYTA 2ID9A 1LJ9A 2KRFA 4KDPA 5TPWA 1S3JA 1FBSA 2F5FA 3F8NA 1MB3A 1BM9A 2PUAA 1NXVA 4HDUA 4FX0A 1YFHA 3HTSB 4HZFA 2BGCA 4LK1F 1D8JA 2FEWB 2FQYA 3GYHX 1SMTA 3O2PE 4GPAA 2O6GE 1G3WA 3E6MA 4Q7EA 2WJAA 3N0WA 2QBYB 1Y0UA 3FDFA 5ILSA 3O1JC 1ZG5A 3BREA 2J5OA 4RK1A 2FQXA 1L5YA 5KVRA 1T0FA 3CO6C 2P7CB 2IKSA 3CHYA 4LE2A 2XIGA 4N41A 3F8MA 1ZRFA 1FPQA 1B9MA 1IXSB 2A6HF 2DBBA 4QLCU 3KHTA 4W5RA 2IRFG 5HM6A 3C97A 5AONA 1MIHA 2H6BA 2GAUA 5DTEA 4KYWA 1HKTA 2JCGA 3F6VA 3TB6A 1MGTA 3FFWA 4OG2A 4MR8B 5L3BA 3U2RA 2WC2A 1EAYA 2DO7A 4L5IA 1E6KA 3BROA 2Q0OA 3M1EA 1GHCA 4ZMSA 1XGNA 3B02A 1B00A 4MS3B 5EEGA 2FMLA 2MH2A 4Q47A 5HKOA 2L19A 3RVMA 1LDJA 1GLGA 3SY8A 3W6JB 5FLXZ 1XHEA 3L00A 2IPNA 3IPAA 1NXSA 3M9XA 1FC3A 2PMUA 3RPUA 2XDYA 5A2QK 4HX7A 5TRDA 5BMZA 5EEHA 2CO5A 1H9TA 4I7HA 3DBIA 2Q5CA 1YMUA 4MEXF 2DTRA 4N0QA 3F22A 1Z25A 3OV8A 3H5OA 4EQQA 3ABTA 2QWWA 3IRQA 2IW5A 4RAZA 4M6YA 1DBWA 2FXAA 1G3TA 1SXIA 4IGAA 4EMSA 5JHUA 3HDGA 3FGZA 1LEBA 5DCFA 1J2XA 3E5XA 2PAFA 3VEPA 4R8HA 1ZGGA 5D4SA 2BGGA 3OOPA 3A10A 4AIJA 1F51E 2D45A 2IT0A 1NHAA 3EDPA 4IRGA 1WQ2A 1CF7B 4L9TA 3F7NA 3CO7C 4IHSA 2HQOA 6CHYA 1UCRA 3HOTA 1V4RA 1Z2EA 1L0OC 1NATA 1LJUA 5FBKA 1QPZA 1J7KA 4OIQF 2QVOA 2W85A 2XROA 4UVBA 2HZTA 3RTRA 2EFWA 1OXBB 3GBVA 4CHUA 2RN7A 4Z4CA 5KC8A 5GOTA 5F6FA 1ZDMA 1FWZA 4HW0A 3HUUA 2OZUA 2ZAYA 5HS7A 3F73A 4G0YA 3QEKA 4Y15A 1TNSA 1IRFA 3HXMA 3GO5A 3CNBA 1XSDA 4QICA 4E7PA 3RKYA 1Z15A 2VODA 2CQKA 2GIVA 4AIKA 3MZHA 4HF0A 4TLMB 4JB0A 3ZPLA 5JNVA 3B73A 5K5RA 3VB2A 2XASA 2A6EF 1BI2A 2FMYA 1GXPA 3IP6A 3C7JA 1MKMA 1PUXA 5AIQA 2IOYA 4QWQA 2RVCA 4RB2C 2OA4A 5TQ0B 4RK7A 2G7HA 3IP5A 1QNLA 2V79A 1H0MA 3O1HB 3R61A 4IMJB 1LK0A 1S6LA 3F6OA 2VOOA 1SD4A 3H1FA 4HNQA 1XD7A 3EDCA 1G3SA 5D5UB 3V7SA 1TTYA 4MR9A 4GO1A 2B1JA 3GL9A 2N9UA 3GVAA 5JNUA 2ZWMA 3ELKA 2A07F 5F1RA 5JS1A 5LBQA 4MR7B 2AYXA 2X0LA 3J81K 5E3JA 2ZMEA 5H20A 2NRAC 4GCVA 4GYIA 1H9CA 2PMCA 3HJFA 5E17F 3QX8A 2CW0F 2H27A 5HDNA 1IXRC 4KQCA 3RKWA 3V8LA 5LGTA 3RVSA 1KA8A 4G0MA 5BPDA 2JSCA 5JNRA 2MSLA 2A9PA 5TQ2A 3SM9A 5FO5A 3O75A 2JPBA 4S04A 4TV7A 2L3DA 1E6LA 2GZWA 5ICEA 3HDVA 2GI4A 3RVQA 1K78A 2L54A 1FP2A 2PEXA 5E1ZB 2QU7A 4UV8A 3C3KA 4WX9A 1ZGZA 1EH8A 4IRIA 1BBYA 2UXXA 3KJXA 1KU3A 2YSRA 1D8KA 2FQ3A 3LUJA 4Z9AA 1Q1HA 1QGPA 1KYZA 2LP4Y 4P98A 4YR7A 1QNTA 3ISPA 1SFUA 1ZH2A 1P8AA 1OPCA 4N0BA 4KFCA 3ROTA 4RB0A 2V0NA 4I09A 5D5VB 2A5YB 1USSA 1HQCA 3E3MA 2V1DA 4ZZLA 5BRAA 2BV6A 2BE5F 3FXUA 4ZYHA 4HDVA 1FT9A 4RSMA 1OKRA 3K1MA 2VC1A 1B59A 4DQDA 4Q6BA 2FEPA 4ESBA 2RDPA 1IF1A 1TBXA 1ZREA 2WV0A 1I6XA 3BY6A 1YTYA 1VTNC 1DCMA 2FQWA 3VODA 4LX8A 3HHGA 1XDUA 4OTZA 4YLEA 1KQ0A 1XHFA 1FY7A 4YFKF 2VK2A 2M45A 2DPDA 3EYIA 4O6JA 3CFYA 2P6TA 3TOBA 5EWJA 3QU6A 5BOXA 3LUHA 5IULC 3V7RA 3M8EA 2PL1A 4YO7A 4XSZF 1PDNC 3E6BA 3LA3A 3J80Z 3O21A 3LKVA 3QEMB 4RXMA 3KP2A 1BVHA 3ZMZA 2TMYA 3K1PA 3TO7A 1NXXA 4I02A 3T1BA 4XRFA 3KZZA 1MDMA 4EVIA 3L7WA 4HQEA 5BS6A 3P7NA 4RKQA 4G6QA 5HQJA 5ED4A 5PNTA 2RJOA 3CUQA 2ZNZA 4MRMA 3K2ZA 3SZTA 4Y9TA 2NZUG 4YV7A 4M9XA 2EFNA 2RQPA 5GQSA 4EJVA 3O3KA 5T7BA 1BOAA 2UWMA 2DAOA 1U5TB 2PFBA 1ON1A 5IT3A 1WI9A 2CYYA 1A04A 1ABFA 4KPYA 3VNBA 4I0AA 3DXJF 2JBAA 3KS9A 3IP9A 1MDMB 2IPAB 1Z18A 2P4UA 3MFKA 3ECOA 3WTSC 3MYYA 4EVRA 2A69F 3MA0A 2L4AA 4MEYF 2M87A 2STWA 1WKMA 1BJAA 1BC7C 1Z12A 1DJMA 4A6DA 2KYRA 1D2AA 2P7VB 1L3LA 4NQWA 1SFEA 3HYIA 4OLAA 1S7OA 4KNYA 1RI7A 2KIUA 4JQFA 5HS9A 2MD5A 4NV3A 2A68F 4EGSA 4XSXF 4BAYA 1R5GA 3RKXA 4WXHA 2P6SA 4OBBA 3QPTA 4PGGA 4DQ2A 3JPWA 2O20A 3W9SA 5DD4A 3RVLA 1IW7F 4NCAA 1SD5A 2QQ9A 1TM2A 3KP6A 4MYRA 1IN7A 4B09A 4AWXB 1RZRD 3CG4A 2OQGA 1M5UA 3G85A 4U7BA 2HQBA 4LB5A 2QR3A 1KRXA 3GZ5A 2FN8A 3C1DA 4YFNF 1D1PA 1QO0A 4YS6A 1LBHA 4UUVA 2FRHA 1BN5A 3EJWA 1JF8A 2I6FA 1XCBA 1MVOA 2FMHA 4LE1A 1I5ZA 3E6CC 4EJOA 4PEVA 1NY5A 1SMYF 2JVKA 4XBFA 3I64A 5B3JA 3NEUA 1U04A 4WWCA 1R58A 1F9NA 4GXOA 4ZYGA 4Z99A 4CICA 3V4GA 3WU1B 2C6YA 2MYNA 2L2QA 3H6HA 3EQZA 1JH9A 4MQEA 1Z6RA 2L17A 2LIVA 3QRFF 1KRWA 3C3MA 1W5TA 5ICCA 3OM1A 1LVAA 4IXAA 2A3SA 4P55A 1EWKA 4A0YA 5CNKA 2IJLA 2DRIA 1S7AA 5DDGA 4IRXA 3H1EA 2NS0A 1UDRA 4D74A 5CVJA 1JFVA 4B8XA 1IRGA 3SAJA 3EQ2A 1MJ9A 3HO1A 1HEYA 3HSEA 3CS3A 5K1YA 4WK8F 4XLPF 1PEAA 4MS4B 3DPLC 3RIRA 1YG2A 3H5IA 2EV0A 5KQMA 3GXOA 3HCWA 5L3GA 4PZ0A 3EGCA 2EFPA 3NRVA 5JNWA 2BBYA 3KLNA 2DQLA 1BAPA 5FLXK 1D3YA 2RKHA 1JHHA 4RY9A 4IMIB 4O5AA 1U8RA 4D0PA 4U7DA 2DPUA 5DKFA 2EV6A 3HRTA 1KMIY 3CJNA 3GZ6A 3BJAA 1GUDA 4YGXB 2XRNA 2LUOA 2GX6A 1W7PD 1ZITA 2GXGA 3JTGA 1YK1A 5FWXA 4MR7A 3ROFA 3KCCA 3N0XA 4KMUX 3U1DA 2V1XA 1P4AA 2HFHA 5DUKA 1P6QA 5C5CA 1O3SA 4MNUA 2LPMA 1W7PB 4MGRA 3O6BB 4KREA 3TO9A 2QW1A 2DK5A 5HLGA 3CUQC 3L6UA 4KMFA 4YRZA 3LSTA 2LNBA 3RYPA 1HXDA 5E8IA 2ZKZA 4N03A 2FMIA 5KQLA 2J5PA 2BEOA 1U5TC 3BOQA 2MYPA 2Z3YA 3HUTA 3OM0A 2VBZA 3U9GA 2EFOA 3GV0A 3KETA 1P4WA 5LLQA 1PEYA 2COMA 3ZMSA 1A0OA 4L4UA 1ZVVA 1LQ1A 1DP4A 2YPRA 2OD5A 2DK8A 1ZAYA 1ZESA 3E5QA 1FYKA 1YW7A 3N75A 1TNTA 3I09A 3NBMA 3TO6A 2STTA 2K02A 1FQWA 1WSUA 3HUGA 4DNCA 4PDKA 1TMYA 1S8NA 1XDSA 1VKRA 2E7WA 2NYXA 3R60A 2MBFA 4F12A 2PQ8A 4RS3A 4A0ZA 4HA8A 3LWFA 4KV7A 1G6NA 5E1XA 1IN6A 2RDMA 3EUHA 4U0YA 2G7UA 5ILVA 5J8FA 4G9YA 4G0XA 3I4PA 4ETSA 5JFRA 2H09A 1APBA 5HDKA 4Z4EA 3ULQB 1BDHA 2HS5A 1J9IA 2J48A 2M30A 4LDAA 3GFIA 1ZGJA 4F06A 4WCGA 4UXNA 3DLBA 2LF7A 3WTTC 1FBQA 1B4AA 3BWGA 4GNRA 4QYMA 3K1NA 2PUFA 4N47A 5IC5A 1CYEA 5IUKC 3EYYA 1QBJA 5EWMA 3FZVA 5EWLB 3VOEA 1Z9CA 4W5TA 2LBPA 3F6PA 4LLNA 2QM3A 3TMYA 1XMAA 3D5LA 3LAPA 3LAJA 1GCAA 4TLLB 4RGRA 2KJCA 3NQOA 2NAZA 2OAZA 3KLOA 3JSPA 1MB0A 5BR1A 3DQVC 4JP1A 1EWVA 4ZJPA 2CD7A 3HZHA 3JS5A 1ZHFA 2M5WA 2K4BA 2EA2A 1BDJA
chains in the Genus database with same CATH superfamily
1LFBA 2G9UA 4NNOA 4U63A 3QV1A 3UYLA 1Y8AA 1MRSA 4DMLA 3ORSA 4ED9A 3VPFA 2EKLA 2CG4A 1PR5A 1PYGA 1JDZA 2GERA 2JKVA 3S14J 3INYA 3MUNA 3NP9A 1B41A 1KHHA 2QRVA 4OQZA 5DYYA 1V9LA 1YCGA 2ZMEB 2GJKA 3KTDA 2H1KA 3K9HA 4RFSA 5CNJA 1HG0A 1U5AA 1VJ5A 2Z43A 2WHPA 3H86A 5H82A 1RBZA 5DBFA 1JU3A 3JQBC 3PGLA 3U9LA 2PK3A 3NRJA 2H3HA 1F8UA 3CTAA 1JG2A 3G8YA 4ZU1X 3QKIA 4JBIA 5BQ5A 2FPMA 1YBHA 1Y8RB 4D5EA 1N5KA 3BS4A 1FDIA 3QE2A 3CCYA 2HDDA 1UDXA 4HAZA 3S5UA 5CCEA 5FKLA 3KKZA 3H1GA 4U7HA 3WB0A 1WBBA 1MH9A 3R0AA 1BMFA 1NFQA 1P44A 1BR1A 3MJFA 1OIWA 3RV4A 4B3JA 1V7ZA 4EJTA 1D0VA 2FVYA 4P7KA 4CI9A 4CL2A 3U7GA 3D8NA 4F1WA 4EBFA 1SPBS 3PRYA 2C3UA 4PYQA 4E5PA 3RU9A 2FEKA 3T5XA 3LLUA 2CHEA 3KE8A 4CA0A 2EDAA 3LV8A 1ORRA 1DOHA 3FXKA 1FPMA 3AIIA 2I3AA 1IZ7A 4FD3A 5K3OA 3TF5A 2LNDA 4A36A 3TTXA 5FKKA 1O3TA 1ODFA 3AJEA 4QDOA 5EPOA 3R7NA 1JEDA 2WD7A 5CA1F 5HK9A 1A9RA 4FKBA 2VHEA 5UKDA 1U0JA 2ZB9A 2W93A 3I2HA 3DDNA 2G5CA 4E09A 3D6JA 3C16C 5TMPA 4G7ZF 3OEHA 1JHRA 2YWFA 3DOUA 2XWPA 1JKRC 4H15A 5IK2D 5K8UA 5KTTA 3WGUA 221PA 4JL6A 4DHWA 1N92A 2HK9A 5I7UA 2QQAA 3S2WA 4CO8A 3SZLA 2HPHA 3UJCA 5FWYA 5LOVB 2CE2X 3WGOA 4D8VA 1BYIA 2BMVA 3KVYA 3FHZA 2DFFA 1KBZA 2E9SA 3FCSB 2ZYUX 4HH3C 4W7SA 3DPSA 4EM6A 1J1UA 1VQ5I 5EJ9A 4YYZA 5TJ9A 3OY2A 5K4HA 3SC2B 1TQPA 1LDKB 1P9RA 3FYUB 1S4MA 4H6PA 4AF8A 1L5ZA 1QS0B 1X2BA 4B3RB 3EOZA 3IJEB 3SHVA 3HLYA 3CNHA 3QKSB 1WH5A 2QVYX 3KQPA 3DOHA 3LG2A 1W0CA 3V8JA 1XKQA 1CK4A 3K0AA 1NTRA 4Y6QA 3IESA 4ZDOA 3L06A 2YYZA 1H0HA 1R0YA 1JYEA 1UZCA 1DLJA 3CUYA 4PSWA 3CXRA 4C0AC 4ETMA 2ZUBA 1OU0A 3KYLA 2ISZA 5BPFA 1QLJA 3A58B 2C9CA 4LX0A 1WB9A 1I6WA 2ZSFA 3EW9A 3QQPA 2E6UX 4IIDA 5E6RA 4Y2UA 3CLKA 3EFOA 4GZ6A 3M89A 3KYDB 2MSYA 4YG2F 1XN1A 3Q5GA 5AKYA 1JH8A 4B7UA 4ZAFA 3HJHA 2VPTA 1PYOA 2H1IA 1KU0A 1E2DA 3NM4A 4JLKA 2HADA 4LNHA 4BUCA 5KVSA 2B5OA 2GJ9A 3IH4A 4UUTA 1RPWA 4JBLA 3AVUA 2DMPA 2DQRA 4NB5A 3F21A 4C05A 5FPKA 3H9BA 4GMKA 1K6MA 3DLAA 1G5TA 2OM2A 2VLBA 3NUGA 4DE5A 4MYHA 3BT7A 1FNDA 1JWBB 4TTSA 4MB0A 3E1SA 4I99A 3OSFA 3G1OA 1Z28A 1PUEE 1MNAA 3C7CB 2DYRH 1N8TA 2P2ZA 1T0UA 4UU7A 3WJAA 3UXEA 1N9GB 1W9HA 1YQGA 1YI1A 2OZLA 4I3FA 1NN3A 2VUMJ 4TXMA 4CQMD 5TQ2B 2VKHA 1XGMA 2Q7OE 2O8CB 1VQKI 4II3A 1XZMA 3LSGA 4P7BA 5D7NA 3V1KA 3FMFA 3BR2A 1E2PA 1P9OA 2ATCA 2RFLA 3AFOA 3O4RA 3I9FA 1SXJB 5G02A 1FU7A 1ZNYA 4KJZA 2XA9A 3CWQA 1U28C 3AB7A 3PG5A 4H7FA 1KDZA 3SZUA 3U0BA 2IVMA 1IVNA 2FLWA 2HJHA 5AW6A 3MKYB 5B4VA 4PBRA 2XF7A 1RTTA 1T8WA 1XFDA 5JZOA 3GEHA 3ZG6A 1MPTA 2PT7A 3KPWA 4ZYAA 2BF7A 3CVOA 4BNMA 1E3LA 4JB3A 3S0JA 3F8BA 1UOEA 3UAYA 4D8WA 2NO9A 3GFJA 2Z5LA 4CN9A 1QAOA 1NQXA 4D82A 3RRXA 3RWOA 1SQSA 1U9NA 2YICA 1IZ1A 3HJAA 4I1PA 1EJ9A 2YHBA 7GPBA 2PGIA 3WK8A 1UAAA 3B7GA 5KNCH 2QBYA 2YHIA 1R1UA 2WD9A 1NZJA 4RYLA 1XAGA 4ZVTA 3TK1A 4DUZB 2PL5A 3I59A 1I2AA 2RI6A 1X8KA 2Y0SA 2I22A 4V0QA 3VC7A 1T25A 4TKVA 1YI8A 3W4JA 4MRNA 5J4HA 3UOWA 1JTXA 3T8RA 4DOZA 3CB4A 1XXLA 3G68A 4HCJA 3BG3A 4IJUA 4Y2GA 1QDEA 2ASVA 2VSXA 2GAFA 4EA6A 2A5WA 1D0SA 1U8CB 3ESZA 5GVRA 3EZ7A 3FJ1A 1H3FA 2WVJA 4G5QA 4BB0A 2P62A 2XUKA 1YS2X 2BXYA 3A1NA 1DIBA 1G60A 4GXRA 4J0EA 4KGXA 4R51A 5LYJF 3Q0VA 1ZL2A 2FF4A 2C4UA 4IMPA 4OH7A 1CVLA 1YVPA 5C1OA 4O2BA 3EXHB 3AW9A 3T35A 1LLCA 5H81A 2N3ZA 5TV2A 3BG6A 4LXTA 4TLBA 3ECCA 3KWJA 2L7KA 3RHTA 1V5IA 1SC9A 3BCBA 3GWZA 3SZMA 2HQAA 3I55I 3SJUA 1DIOB 2I2BA 2YWHA 4ZVVA 1GQ2A 3C3WA 5CVRA 3SJMA 2BGJA 2W6MA 1DCFA 5ES4B 3ZK8A 3KSAC 2BFCB 1ZKMA 5AVWA 1SFXA 1H8ED 1P2UA 3QX9A 4U6NA 4BGVA 4O29A 5ER6A 1QIIA 3O8QA 4L28A 2OCCH 1CCWA 5IJ9A 2IYWA 4QX6A 5LRSA 3BF7A 1H9AA 4IIVA 4KN8A 1DIRA 2Z5UA 2I8AA 4TL7A 2VP2A 2Y31A 5GTIC 5DCMB 1NGSA 5ETJA 1SCNE 1OCPA 2AXPA 3ACBA 4LJSA 4WKOA 3VDQA 4BS9A 4PE5B 1WCYA 4PLGA 1BI1A 1FFBA 2B6NA 2H51A 2I71A 4V0SA 3ST7A 3LWNA 1GPUA 2Q1SA 4EM2A 2WM3A 4PTYA 1RACA 2I4TA 3M5WA 4NBVA 4G97A 4PO3X 2CVHA 3L2RA 5F98A 1A82A 3FF4A 3ED1A 3FFTA 4Q00A 3T5PA 4TVBA 2QDKA 2B69A 1Z2DA 4J6EA 3DEUA 4AICA 2WQ6A 4LFAB 5JVGF 1BEEA 1G8SA 3OZ7A 1XQYA 4BJTA 5HFJA 2TRTA 2Z2SB 2P75A 3OY7A 3QVGA 1BOOA 3EXG2 2JHGA 3NAQA 3RDPA 4XUCA 4F8YA 5C53B 3PHBE 1ODDA 1WNFA 3EFEA 2AV6A 3GGOA 3MLAA 3MS2A 1SXJC 1CS0B 2CXHA 2WZQA 4WA8A 4DJTA 1V71A 4D97A 4RGQA 4H31A 3H0CA 1Y33E 3U4AA 1OVMA 1E7WA 1IUYA 1RRGA 3A9WA 3KV3O 3TJZA 2DA2A 2FPGA 4ZHQA 5AW0A 4LFCB 2Q3MA 1UPXA 3K4MA 4JI6B 4QPDA 2DU9A 3P0JA 3R6GA 4TM7A 2IH4A 1MXFA 2FUCA 4RW0A 3TNFA 4CW7A 2ETHA 7ADHA 4DJEC 2BFWA 3DV8A 1T6SA 3WGGA 1VQNI 1XX6A 2HMSA 2QPAA 3OAAD 4UMFA 2W11A 1AKWA 1BROA 1W0KD 4B3HA 2W8BA 5CFQA 1WO8A 1FIAA 4TZ0A 1YRWA 4M74A 4J9UE 4WIAA 3TXXA 5F7JA 2X3FA 2E4YA 2YY5A 2VNHA 4NE9A 1O9BA 1K2VN 2ZTLA 4CV2A 3N8IA 2UZ1B 1GTZA 2OV2A 2OMKA 3ABQB 3CC7I 1RXYA 3BDIA 3R1IA 3WTWC 3WTXC 1AQUA 1LV8A 5DCWA 2W0SA 3QEAZ 4B48A 1O5TA 1XEXB 3A0HC 3FHNA 1IQPA 5D6FA 4ZTFA 3HIFA 2CNKA 2IQ5A 3JQAD 1E7RA 3RRNA 1Z73A 3RFCA 1MX3A 2BYVE 4DXHA 1NVVR 1GGMA 3PVCA 3PXXA 4QULA 1Q1VA 2FMXA 2FW0A 1JSLA 1Z0XA 3CO0S 4RK0A 5CLLA 4BO5A 5A2QZ 2EF0A 4O0MA 5JI3E 2I2FA 1ZJ5A 2OG1A 1SIWA 3AILA 2C4HA 2R8PA 1GQRA 4FUQA 4RL6A 3VH1A 4I9NA 4BNNA 3DL2A 4CKBB 3CC2I 5KINB 1B0UA 1Z07A 4HQMA 2PL9A 2Y1EA 1G20B 3KYCA 4GMXA 4NQRA 2NUTB 1BSVA 1SD6A 1G9TA 3OUZA 1R10A 4RDUA 4DYRA 1NJFA 4YAFA 1D09A 3I9V6 3HRSA 5LLTA 4CYCA 4TV8F 2C8JA 3DWFA 4NAHA 4IOJA 1UWKA 2JGRA 3ELBA 5EPEA 1QYCA 5JALA 2JT1A 4QGBA 3D8RA 4M3FA 3AHFA 4FGWA 2I3DA 2BI7A 2FMKA 3ETLA 3LGAA 4QXAA 3MCWA 2L01A 2O54A 4ESFA 1HDYA 1VJ1A 2AKAB 1WM1A 1UHWA 3E3OA 4GNKA 4BE2A 2OXFA 3QK7A 1VL6A 4AM8A 3T7TA 3LU1A 5DM60 4HF2A 4HDNB 4HSRA 5LGNA 4IO9F 1S8FA 2DP4E 4G1MB 1KQ9A 2C9ZA 2ENUA 1E9BA 5H2FC 2RHGB 3EDQA 5FBHA 1KI2A 2XBUA 4ABTA 3KCQA 1T5OA 1KY5A 2TSYB 4FZ5A 4OLBA 5JWHA 3GFSA 1EK6A 1WCV1 2IW3A 4N0EA 4A2WA 2IWHA 4UNPA 2EBHX 1TJPB 2A9RA 1U02A 2F6CA 2H52A 2RV8A 3LHKA 1WJCA 2ENWA 3OTHA 2GN9A 2DTXA 1POXA 3HU1A 1WZ2A 3SC4A 3KIOA 3LE8A 1GYQA 4RVUA 4A5MA 2HY7A 2FMFA 1XRRA 1XG1A 2IUFA 1VG8A 5HF9A 4RZUA 2XBMA 4ABZA 4EI8A 1STZA 1MT3A 4DMKA 1D5VA 3ZHCA 1NJ6A 1LE8B 1SBTA 3QYBA 1T6NA 2YW2A 3C3EA 3FBTA 4JENA 3RAEC 4A5OA 3G5AA 2AOVA 2K85A 1ZY2A 3I32A 3L4BC 3Q1KA 1ZJYA 1I3CA 1I3NA 4TKMA 4KCGA 4RH3A 5ENZA 3AJRA 5TQ0A 3QI7A 3UN1A 4TKZA 4BO9A 2EH3A 1I33A 1CY4A 3KE2A 4JYMA 4DCPA 1EUQA 5HG0A 4CIWA 5AW4A 2Y9MB 2IEZA 2JDID 2OBXA 1X8JA 4G9EA 4IL5A 4U7TB 4MR8A 3LP6A 2Q2OA 3KCNA 1MD0A 3C2QA 3UGKA 3PRKE 3G7UA 4NP6A 1IAVA 2C98A 1BJKA 1GD1O 2YWEA 4QHTA 3GUDA 5ALOA 1P2FA 1FC0A 2JLAA 1USGA 2QD2A 1PJCA 2GYUA 3TO5A 1HFEL 1Z3IX 1NT4A 4Y98A 2M98A 4KFSA 2BEJA 3UJ9A 4IFBA 3EZYA 3QBVA 1Q1ZA 1BRMA 5AVYA 5TIIA 2C97A 2EBIA 5A9TA 2D4HA 1Z7EA 3RC1A 2XVZA 1DX9A 2QAGA 4J0IA 2O59A 2IELA 3IQXA 4EAQA 5L4LA 4YMTA 4D45A 4AU7A 4DTCA 5HJ2A 4A26A 4ZDJA 2OZVA 2C0QA 3M6LA 1OQYA 3SEFA 1V39A 2ZSIB 4C6TA 4MUIA 1F60A 2X6QA 2VJQA 2P2YA 2XMDA 2EKDA 5D3MB 2G1AA 2VF8A 4EHNA 4LJZF 1O96B 5AOBA 5K8TA 9ANTA 2PMHA 4QVIA 1ID8A 3RHFA 1ZOPA 4G8JA 3A6ZA 1Q95A 4O2AF 4OIPF 2HWXA 2J3JA 2PKQP 4JB2A 4BFXA 3ELUA 2XF2A 4PFKA 5H6RA 1O5OA 1LPQA 4PAWA 4HJRA 1EFPB 1K6YA 2D5VA 2HEOA 1F0YA 1AN0A 2QYTA 3ABIA 5EEAA 2WMYA 5KAFC 3LQKA 3WJ2A 3VU3A 3FCXA 4KX3A 1HDDC 3LO8A 2XXAA 3PC2A 3PUKA 3QWIA 1ZGCA 2CWEA 1F48A 1T10A 2XKOA 2NS8A 4DIOA 5CPRB 1ATIA 4UHCA 4PPQA 4UPEA 3R9KA 1RNLA 3IP7A 3MOSA 2FQQA 4UTPA 4P7JA 6YASA 5FWDA 3H9UA 1DKPA 2MCFA 2C5SA 1UIRA 3TTYA 5JQGF 3QYEA 1DG9A 2ZNYA 4GMGA 4HUQB 3RRJA 4BUZA 3GCWA 3HEFA 1RM0A 3PDIB 3KLPX 4Q3CA 2BFPA 4XUEA 1JTFA 1KERA 2VDMB 1YA6A 2VG8A 2KHZA 3A05A 4ZYDA 1XJWA 4DAOA 3OQIB 3VO9A 4JVOA 1NXTA 3GTKJ 1QO9A 1TLFA 2Q4BA 1T5IA 3IX7A 5A7GA 5AQ1A 2OWDA 2JW5A 2ZQZA 3O4IA 5LQSA 4Y2SA 1HLPA 2EINH 3OP1A 1OBFO 2Q5EA 1B8VA 1BA3A 4J29A 4CKEB 3R0VA 5AKHA 3FG9A 3E27A 3SSMA 3F3YA 2GM9A 4GZ3A 4NUBA 4ZEVA 5T8KA 1ZMRA 1T5LA 1WPGA 4JI2B 5FI1B 1IOLA 4HBZA 1QPMA 1PD1A 2HNHA 2QYOA 5HXAA 2VAWA 4PSKA 4UVDA 4NU0A 3H4VA 1ISPA 5ALGA 2Z99A 4KAFA 5DTQA 3R7FA 1I0ZA 1TJ4A 1TF5A 2IHBA 1WXGA 4C3JJ 2C7QA 1XZLA 2GLUA 2Q4RA 3RFVA 2P4EA 2O3SA 1CEXA 2MGQA 4OINF 1DBRA 1FMWA 5GZ3A 1XMSA 1OH6A 1U3VA 1K8XB 3ZOBA 3DBVO 3SQMA 2M4GA 3CZQA 4ND8A 4DIMA 3F9KA 5DK4A 5IW8A 3DBHB 5AIAA 4AK9A 1AA9A 3SK0A 3UC5A 3FNGA 3SIWA 4F4FA 2FPIA 1XX5A 4BQAA 3T5BA 1UP4A 1OLSA 3PUXA 3RYRA 1P9WA 3TDZC 2Q21A 3GB9A 3JCZA 1RI4A 3AONB 4U02A 3F7OA 3EUHC 4OJYA 2YXBA 4DJ5X 3NWSA 4E12A 2QEXI 3IH2A 2F2EA 1CNMA 3QQAA 1B72B 2YWJA 3R7AA 2C7RA 3BVPA 3FBWA 3O8LA 2RGYA 1ABBA 2AXTC 3IHKA 3UWKA 4EG5A 5G0VA 4W9NC 1ZM2A 2Q0SA 1TZMA 4ZV9A 3TAUA 1ZR4A 3ORQA 3VYWA 3EW7A 3BFVA 1XZFA 5SY4A 1ZA1A 2IDKA 1IY8A 4XW2A 3ONVA 5KOJB 5TQJA 4CKXA 2A3NA 3OBBA 3FVRA 4FNAA 2HIMA 4N01A 4OXIA 2FWMX 2O03A 5G1NA 4IDCA 2Q2EB 4GX1A 2GBYA 3LSPA 2ZCWA 1ODLA 3V97A 4M0PA 1P31A 3MJEA 2MC3A 1G291 4YIIA 5E9AA 2QSJA 1A9ZA 5FR2A 5JDCA 2OL4A 1XVAA 4PANA 3AR4A 4PFPA 1WXDA 2DQ4A 1R0SA 1Y5NA 3FYSA 5K0GA 1PNOA 2W24A 3CCBA 4MIKA 4QXMA 1B2RA 3H5RA 1OCEA 2QMQA 2DT5A 3B9PA 1VFNA 1HURA 3K9NA 4IH9A 4TQGA 4URXR 2QI9C 3BRQA 2PX2A 2ZAGA 3ZWOA 4B3CA 1QIHA 1RYMA 5H5JA 3UMVA 3OQOA 3HCOA 5D5PA 3U1VA 3QKTA 4ESEA 4GI2A 7REQA 4JU9A 5JCOA 3I2YX 1Y3AA 4CSWA 4ODIA 3TAHA 5A4KA 1ECLA 1THZA 2MSKA 4Y6OA 2ESNA 3TMKA 1W5SA 1TU4A 1MUUA 1D4FA 4DCNA 2R6GA 2QXYA 2R7DA 4RPHA 3LUAA 5DISB 5EJ5A 3THYB 1H6CA 3G6EI 2A61A 1FOYA 1JX6A 3GQVA 4RJ2A 1USIA 2ZRJA 1Z67A 3A2NA 3KZOA 1Z7UA 3ESAA 4JUDX 4BGUA 3VJRA 1OI2A 4V2FA 2VIXA 3SDBA 1S4QA 4MSUA 4DIKA 3IAM6 1EKEA 5AVUA 1NKVA 4OQNA 3JRXA 3X2EA 1O5IA 3KFWX 1MW8X 3SXJA 5ICGA 1C3OB 1Y34E 3OZFA 3K9WA 2JRTA 2X6WA 1TK2A 5DNUA 4L4SA 1Q44A 2CJWA 1OLUA 2SHKA 1Z05A 3G5MA 1O0BA 3ZGYA 1C0IA 4ZYWA 4PXYA 3AI7A 3T0IA 4GKJB 4EKGA 2EFQA 8GPBA 4G37A 5T64A 1IMJA 1PLJA 4XRMA 3PVSA 4WPGA 3DPIA 4PK4A 1VQ1A 4NPAA 5EJ2A 4EH1A 4C3IJ 1R2QA 2HSWA 2E21A 4BO7A 5I51A 4BN0A 4HRIA 1BXGA 1HDGO 1L3BA 3EN0A 3FNIA 3M7IA 1L4NA 3Q9UA 5EL0A 2HCJB 3GLGB 4XX1A 2RAPA 1BMTA 4X6UA 3LA7A 1N6HA 1OFVA 1TKRA 1T24A 1ULUA 3DEFA 3VSLA 3IEKA 1GGKA 1PJTA 1VQ9I 1ZU5A 2AZMA 2QEQA 2ZC2A 1G3QA 2C5FA 3H8WA 3KUXA 3LQ1A 4XPIB 4ANJA 4EJSB 2FSFA 1TYCA 3JD2A 3Q5FA 2WSYB 1NURA 1EE9A 3AKDA 4MTDA 2R6ZA 2VNKA 2LKDA 1HTBA 3IDOA 5TT0A 2QW8A 4EYGA 1XMKA 2BGTA 4R79A 3QMMA 4ZI7B 4RTNA 2PMEA 3FI0A 1T9GS 4GPD1 1AS0A 1EK5A 2XLBA 2FX0A 3FLMA 2EW1A 3GG2A 1TJNA 4ZT4A 4ZC8A 4D56A 2YN0A 3GWGA 2DVMA 3ANLA 2BT4A 4OXYA 4XWOA 3L8EA 4GI5A 1C3EA 1IHUA 4HB4A 3OYFA 5G3YA 2K7FA 2PUDA 1XZJA 4AG6A 3HJUA 1NXWA 3QY0A 1J0BA 1O97D 4JHXA 4KPUB 2G67A 3GLGA 3U7HB 3W8NA 1WB6A 5H7XA 3TZKA 3BERA 2WKRA 2GWRA 5EP1A 3OWHA 4K6MA 2I7XA 1FVHA 3T15A 2A5DA 4RB1A 1XWWA 4JP8A 2C58A 1E1RD 3G0CA 3FMQA 4NK5A 3QKRA 4EQ6B 4OLJA 3CP2A 1F2VA 3OE7D 2DHDA 4S1WA 4AUKA 5HOQA 2ZCUA 4QEKA 5KNBH 1TUBB 1IY2A 4FLEA 4LZAA 1EZ4A 2ZYHA 4CKCA 1Z7BA 4AWAA 1BTOA 1R8QA 2PVPA 2B4RO 2J6IA 3U21A 3F5MA 1FX7A 4DPMA 2P7HA 1CRWG 2JA2A 2XCUA 3DHYA 5KX5B 3FNRA 2DA3A 3I53A 2Z9BA 4GYWA 4J0FA 5AM4A 1U90A 4UFOA 3RTBA 1XXHE 2PT6A 4C43A 4R05A 5IN4A 4DA4A 3B3QA 1XJ5A 3UPUA 2W2KA 1IM5A 3OG9A 4ZA2A 1GUUA 1NIJA 1MP0A 1P8JA 3DF7A 4S0XA 4ZODA 4JUAA 1JA0A 2IPXA 2FF7A 2VTVA 3H6KA 4J7AA 3ADDA 1SCUB 3ZHXA 3JQEA 3DE5X 2XCTB 3HJCA 3O95A 1T2UA 3DTEA 3ZR4B 4PM4A 5LU8A 4AYWA 3EMDA 4X7RA 5C18A 4PAOA 1Y6FA 2W1OA 1C0WA 3DTVD 3QELA 3KG2A 1L5RA 2CT8A 4MS1B 4AY6A 3LQFA 1KQOA 4N54A 1TMOA 4YV0A 5IP6A 1INLA 3OETA 3N4MA 1PVDA 2PWYA 2D5AA 3MERA 4IFTA 1Y3FE 1K7EB 1U7DA 1P0QA 1UPCA 2EC5A 4LI3X 1ZGWA 4ILKA 3P2OA 3MB5A 4MUXA 3PIRA 4OMUA 2LLKA 4K46A 4JC0A 4BLSA 3NWJA 4ASNA 4YJ2B 4YX9A 1J42A 1Z13A 5T4BA 3DZFA 5L3EA 3GW8A 1E61A 3E4DA 2DYSH 1XCJA 4PYNA 1V5GA 2WV1A 1W9MA 1XK6A 4M89A 4XYEA 2VL8A 2NNYA 1OYYA 1XZCA 5EIHA 2HYFA 3UWSA 2W84A 1JZQA 2R47A 3GUVA 3PHCA 3ZN2A 4DBVO 4CG1A 1SM4A 3OT1B 1RYZA 1HETA 4LNUB 4TMXA 4UE2A 2QTGA 1OBCA 1VRCA 4LXGA 4N3GA 5DYIA 3LBYA 4O8CA 4NULA 3P5JA 1RQGA 3SMQA 4DV0B 4J75A 4LOCA 4E7ZA 3KV1A 1DKLA 1T4GA 3LJKA 2DFIA 1QPZA 2G70A 4GGGA 4KO2S 2FF5A 4Z2AA 1WY7A 3H9CA 3H17A 4JOBA 4LA4A 4HB2A 5DP1A 3GBSA 1GVHA 3QX3A 2GN4A 3VPDA 1PR6A 4JOMA 2VTKA 1PN3A 3BR0A 3F8WA 4MNTA 4DC1A 3THWB 4L9JA 2NXEA 2H63A 3GLHE 1ZG1A 1OMIA 3E0QA 3ENNA 4KDRA 1FBUA 2ZDGA 2A84A 2GQQA 1BNCA 1KAMA 4Z4GA 1TQ2A 1GPNA 2CLDX 1L7NA 5EUCA 2EYQA 5BWLA 1Y1QA 5B2ZA 5IARA 4NCIA 2V6BA 1NMYA 4B7CA 4D0NA 4BDYA 1TA4A 3V3TA 3W2GA 3L2WA 2XECA 4JVNA 1D2MA 3BR6A 2QTHA 4JX6A 3GGDA 4DXAA 5JZMA 4UAGA 3F8SA 1HTWA 3MTBA 4DV4B 1U7TA 1U4SA 3JWEA 1GRCA 1JDJA 2JGAA 1ZH0A 2RONA 1VHWA 1KYWA 1TCCA 2JHAA 2HVQA 1JMYA 2QAJA 2IGBA 4E3ZA 4GFBA 1UBOS 3BWEA 4OYHA 3T3PB 4W7HA 1ECCA 1Q22A 3RROA 5AD1A 4DLWA 1R9JA 3QU5A 2DLLA 2O19A 4S24A 4KE9A 2X8AA 2Q1XA 1TZLA 2PBRA 1JFTA 1B23P 1MRZA 5THXA 2FRDA 2IPLA 3HKCA 4NJMA 5JDCC 2EJRA 2OAEA 1K7CA 2GZMA 2Y1LA 3QKRB 3V6MA 1KQGA 3AF5A 3AFIA 2QNIA 2QLLA 4M99A 2EGUA 4RVFA 5TPZA 1T3TA 2WG0A 5FD6A 3F0CA 1K6IA 1QANA 1Z88A 4Q3BA 4R1OA 3C4JA 2ZMEC 3RARA 2VJJA 4KXMA 2Z83A 1NYTA 1V45E 5HIMA 2WT8A 3F5SA 1TL8A 2C7PA 4ENKA 2C9MA 3WRYA 4P53A 1Y6QA 1SBZA 2PEYA 3OE5A 3RVBA 4L0ZB 4LY3A 3BTCA 2AZXA 1QTIA 1UXHA 2D1QA 4MRVA 1WJDA 5TY0A 1S2OA 3A4NA 4PINA 4BH9A 3RS0A 4JI0B 2V9VA 3KZNA 3WYAA 1AK2A 1JVNA 3RPUD 1DKRA 2NX2A 3OZUA 3K70B 4IIBA 4ZYZA 2M8EA 3RZOJ 2PD4A 1BA2A 2X41A 2Z04A 3AH8A 1T1IA 3ESDA 4IIJB 4F38A 4YMVA 5LYYA 3T4PA 3H3VK 1YVRA 2QGUA 3FTCA 1Y63A 4EUFA 4ZJUA 1AZTA 1SCDA 1TECE 1WMEA 1IWPB 3GNQA 3IPLA 3TGNA 4F93B 1FP7A 2O8XA 2CMFA 1J1ZA 2UVQA 3O94A 3PLNA 3TX2A 4H3HB 4CF4A 1N6OA 4D8XA 5ERGB 1ZJZA 1SHZA 3RC8A 2HRCA 1VLJA 2WT4A 1HSJA 3GNTA 4A8JA 3OECA 2F1RA 2V7FA 5DEQA 1U0EA 1VBNA 2HRQA 2V3WA 2WT9A 1S1CA 2X58A 3R5HA 3L1HA 2GRJA 1ZCFA 3UJDA 2IYRA 3A37A 4NNJA 4DMMA 1VG9B 3W2IA 1NU6A 1Y8RA 4G5GA 3WTYC 1G4DA 3LUCA 5KNLA 3BTJA 3EFHA 2GCGA 3E0XA 5EC8A 2IC5A 4FGSA 3H35A 4NARA 4OHKA 3BBPA 1C8BA 1ZMOA 1ZHHA 1YB1A 5D5HA 2K86A 2W4IA 1L4MA 4YROA 4QT0A 5AJXA 3SG0A 2JLQA 4HGPA 5AIBA 3ONEA 2KFDA 1OX4B 4G94A 5H68A 3AWIA 3ZHSA 1H9GA 3M8FA 1QMPA 1FDWA 4PC1A 1UKVY 1QGUA 3H0EA 3THRA 3L41A 2WJWA 2RJNA 2ZE7A 3GPIA 2IGKA 1NYLA 4BCBA 1BGWA 3ETGA 3WP0A 1TVEA 1QHEA 3CTPA 2QLTA 3SNHA 2YU3A 3MQ2A 5M5WJ 4MV3A 3ZDRA 3OQNA 2OE2A 2HQNA 2G4LA 1R36A 4B40A 1LQTA 2B37A 4M8NE 3Q9NA 2PUEA 1XA0A 3T1TA 2I6SA 4X1EA 1V4BA 2BV3A 4PX9A 3JD1A 4DFDA 3A6DA 4BZXA 1OASA 3DM5A 3P9CA 3E9EA 1LJ8A 2ZJ3A 3Q12A 3Q1LA 4FGZA 2ZWOA 1QHGA 3I3OA 2AXQA 4QTRA 2WD8A 1I30A 3X1JA 2XXAB 1KQ8A 3FSEA 4FC6A 4WKBA 5A9RA 4G1BA 5EG5A 1JXQA 3H3XA 2QPOA 3EB9A 3P2YA 4R6WA 5HBGA 3SYNA 4A5SA 4G6DA 3DZIA 4M7RA 2OSBA 3OUUA 4X60A 1MC5A 3FSGD 4D9CA 2IX3A 1B0ZA 4A23A 1H2BA 4AJNA 3BH0A 4BX8A 3ISVA 1X9HA 2O0HA 1YJCA 2H1SA 1BEUB 4M0DA 2XC7A 4LGWA 1B1BA 4H1TA 1P33A 2CCJA 1VLHA 2OO7A 3OHPA 4FXOA 3GJ3A 3UV7A 5J43A 2O3QA 1QQIA 5LJIA 1TIKA 3OKAA 2E19A 4IGKA 4RVGA 1GNSA 1K5HA 4BPRA 4AQ7A 1D03A 2UXBB 2XY4A 3M8JA 4AXBA 4E30A 2DLDA 4IIYA 2DQKA 1OGYA 2QAIA 4M7WA 3W4KA 1QE3A 2IDMA 3CT6A 3OFJA 4IUBS 2Y0CA 2RK4A 3IIIA 5JLWA 1NSYA 2X76A 4TN1A 3SHTA 3T7DA 3G0GA 5IT9K 2KI5A 5CLGA 4R8RA 3VU0A 4LYJA 5CBKA 4YJHB 3U9SA 3O8QB 4KFTA 2DW4A 3ORYA 2MYUA 2JLZA 3QG1A 3IH5A 3A1DA 5B3KA 2PUCA 2XQJA 1AB6A 1JLMA 3TFOA 1QUFA 1JXSA 1MNEA 1NBIA 4WT7A 5CHYA 1TVCA 5L40A 4S05A 3MAAC 2X8LA 2FTKE 3MM4A 2F55A 2AO9A 1US8A 3AG5A 5KTRA 1REQB 5L53A 3U4QA 4UPVA 1VPLA 2PM8A 5KDLA 1HTTA 2CXQA 2Y6UA 3AZOA 2D5IA 1R1TA 1YD7A 1IOVA 1YJ5A 3C14C 3T3DA 2VZ0A 3A1YA 5H3LA 1KFBB 3ITDA 3KHUA 3GDFA 4C03A 4R8VA 3O2QB 1Y1PA 3OFSA 2C9YA 1UZNA 3CEJA 4GMFA 1MBJA 4PCQA 1MV8A 5K0FA 3M6FA 6ABPA 4A8HA 4DIEA 2VE9A 2NUAA 2YY6A 1QH1B 3F9RA 3P27A 4X63A 1P1CA 1G8MA 2EJVA 3Q8MA 2IH5A 4QTXA 2AJTA 4RA9B 2UDPA 1A77A 4LRYA 1EDZA 3A1EA 1YOVB 2IGOA 3L09A 2HN9A 3PA8A 2GASA 4ZARA 3GFLA 5C35A 4KHPB 4H3VA 1F3LA 2KLOA 4RGUA 3K0FA 2C0CA 5ELLA 4ZK2A 1TJ5A 1F1ZA 4ZVKA 4MVWA 3K32A 1P5FA 1PO7A 1TRHA 3MJHA 2JJ2D 4DGQA 4ANFA 1JMKC 1NJSA 4HAVA 4UBIA 4C4ZA 3NORA 3HJBA 4UHDA 2W8BB 1YMVA 4LXQA 4M83A 4AZ3B 2DLNA 3L18A 1AK1A 1RLJA 2ERCA 4X8MA 3P9RA 3STXA 3KU4A 3W8DA 1EH6A 4Q05A 1DG3A 2DDAA 3RFUA 3B85A 5DLPA 4A3EJ 4AJLA 3ZQ7A 3V00A 5BV0A 4M76B 4L95C 1JKMA 1SGWA 2D0OB 2W6ZA 3ZKWA 1YH3A 5IH3A 2HTJA 1ZM7A 2HU5A 3R23A 4BMCA 1SXPA 4P0PB 1HNXB 2H1FA 4HLUA 2VKVA 5ALKA 3AEQB 1AV7A 4A8JC 3OMWA 3DE3X 4TYWA 4ZO4A 5FRNA 4BDSA 2HH9A 1RWBA 3R6WA 3WMEA 1ZJWA 1ICIA 2GN2A 2QZJA 3D8TA 3GJ0A 4Z0PA 2VF4X 3RI4A 5C5EA 2PBZA 1WEHA 3WICA 4CR8A 2AN3A 4UCXA 3FM3A 3IUJA 2FRDC 1QE0A 1QIGA 2ZSDA 3Q4GA 3U7IA 5EHIA 4EYOA 5I7VA 3KYCB 3H1AA 5I5GA 2GF0A 3OIFA 2J3MA 3M6WA 3E9DA 5EYPB 4L18B 3BM5A 2JPCA 1POGA 4EYSA 2YNMD 1EP9A 2ACKA 3G0HA 1K4MA 1CB7A 2P1DA 3Q87B 1P0MA 4JBNA 4XCVA 4Y6GB 3WK9A 2LC2A 4AJ2A 2WB4A 4PXSA 1GA6A 1V3FA 3EIEA 4RGYA 1GGHA 4P31A 2DXIA 5J1TB 2FETA 4S1VA 4YRPA 2V4UA 3M8KA 3V8KA 4U7GA 4ER0A 3KEOA 1HDOA 1XWIA 3BSYA 2QE7D 1WPKA 4XLHA 1IHPA 4HRXA 1SA0A 3VV3A 1G38A 4EMTA 2JK0A 3ZY6A 2B3TA 3PFKA 3OD1A 4YXWA 4N9HA 4Q6WA 3WIBA 1BXRB 1SQ0A 2QVZX 3F49S 4KMOA 4A5NA 4OHXA 3GBGA 3ZGVA 2GLTA 2OZKA 3SYLA 2VP0A 3MXTA 5EJ7A 3MMPA 3MTJA 2F9FA 2OG2A 1PQWA 2HPAA 1GG8A 3NTQA 3ZCVA 2GA1A 1SG6A 1BCRB 4TV9F 3URMA 2VT2A 4M6WB 3K1JA 4Y17A 1EKXA 2IF0A 2IDZA 4FE7A 1OXUA 5JY1A 4EJUA 1JAZA 3CCFA 1H5NA 4FZRA 3ZIAD 5E95A 5JD5A 3S44A 1G4UR 3LW8A 3DLLF 4AXXA 3JAWA 4ZCIA 1ZNZA 3UHPA 1W29A 2BR4A 2OV8A 5EE1A 3PFIA 1FA9A 4ITUA 1KEUA 2QWXA 2XB9A 2MMCA 2D8MA 3ETHA 2OBNA 3ZQGA 2WK1A 1OISA 3L8GA 2F67A 1PR9A 1JB9A 2L2OA 3NBUA 3RSHA 4BMSA 4DQXA 1PQUA 4HLYA 3CZRA 1IB6A 1XDBA 2Z98A 3HVJA 1KGSA 2GCIA 4XIGS 5JAIA 1WXXA 3L7JA 3HDDA 1B6GA 3R09A 2PUBA 2HNAA 1BIAA 2Q2NA 3TOAA 1NW7A 2A1UA 2A3RA 3EULA 3GRYA 3INRA 2VXBA 4Q9NA 4X1OA 1Y1KE 3AR3A 3O9ZA 2MH9A 4EP1A 1ADYA 2CLHB 5BPHA 5FFXA 4IXWA 1Q19A 3BTIA 3AUTA 4XD7A 1R8YA 4DV2B 1FVFA 1H5UA 1BDIA 3AM1A 2XAQA 2AVNA 2R1TA 5BWOA 5IM4F 5C34B 4MGYR 3G9UA 2BXZA 1NFRA 5KWSA 4L8WB 4IX1A 4MW7A 3FVVA 4HDMA 5JDIC 5FB3A 4YMSA 2JI6A 1MJFA 2ID4A 4CLHA 2E4WA 1J9ZA 1T8RA 2AL7A 5CR9A 1R6DA 4DY4A 1QQTA 4F7WA 1K88A 1V37A 3L2CA 1MNMC 5IFLA 3RU7A 1IATA 3T9EA 1EVEA 5B7PA 1QRRA 4C2UA 1T26A 3PCRB 2YBDA 4GC5A 4URYR 3FXOA 3GTMJ 1AU9A 3NUZA 4HNSA 4Y67A 4IG4A 4RULA 5J3LA 4WOJA 3LSMA 1QCCA 4ER3A 4B6EA 4KQFA 5BOSB 1JSXA 2D3WA 3AGQA 1QGOA 4HS4A 1ZICA 3WTCA 1DARA 4PGMA 4DDKA 2WY2D 4FMDF 1XOIA 3FZEA 3LSHA 1ZRDA 5AFSA 3A6FA 3PDJA 4OQDA 4RVOA 1O3YA 3L1PA 1N6KA 2Z8XA 4HLDA 4WE3A 1WW8A 2QQFA 4PG6A 2K4JA 4M8LA 1E6MA 2G25A 3W2AA 3CIOA 3O6VA 4YP9A 4CBVA 4TMKA 4ZO6A 3LT0A 1UHSA 4W9MC 1CW2B 1IUPA 1K86A 1P75A 621PA 5HKKA 3NRCA 4LRXA 5EMJA 3W5IA 3QHQA 2Y67A 5ARBA 1ZGBA 1FJ2A 3HOSA 3A9RA 1RM5A 2BFDA 5JBIA 3K7AJ 1KZ9A 1TWFJ 1J2EA 1VMIA 1AC5A 2RHBA 4FSDA 4KZKA 4L4XA 1P7YA 3MTGA 1MAUA 5D8LB 1QZUA 2ZEJA 1U2SA 3L6EA 2PBFA 2M8GX 4MQFB 4S1OA 4LRSB 5AXCA 3WDMA 3TKAA 2PS0A 3UCFA 4B3MB 2EQBA 5KI6A 3M6UA 4IEFB 4RY8A 4ZCLA 2XYVA 2A59A 4JX8A 4OXQA 3MJ4A 4LHSA 1J8FA 1ZH4A 3QLVA 1ML4A 2LP0A 1LPMA 1LDEA 1ZK0A 2UVPA 1Z74A 3K20A 1BFKA 1II8B 1OROA 4BHPA 5C4XJ 5ERXA 3SQDA 1Z6AA 4BTVA 3BJOA 4RUKA 4QJ5A 2F3QA 1A3CA 1E4EA 2FPSA 1D1QA 2FN3A 4LQLA 1LZKA 4EGZA 2WAEA 1GSOA 1HSOA 4BXUA 2BFDB 1OUMA 1Q1BA 4B4CA 2N46A 1F9AA 2R2GA 1MAHA 4D3FA 1XPXA 4MPTA 2GF2A 1Z6GA 4JBXA 1WA5A 1RYDA 1BWQA 1NG1A 3GEIA 4RVSA 4RZQA 3G2OA 4KWEA 2FUG6 1OAAA 3MMNA 4CV3A 4F9EA 3TR6A 4K9MA 3NBXX 3ZDDA 2ZRCA 1MMAA 3QOXA 3R44A 1BQEA 1HDZA 2GETA 2DA1A 4HT3B 3QVGB 3QGMA 4WZ6A 2QJOA 3AZPA 3ZNNA 2ZK7A 1P72A 2QN3A 3OQPA 5FB2A 4L75A 3JQ7A 3QW4B 3WWZA 1ODTC 1DJQA 1UB9A 1IHOA 1HI9A 4TTAA 4AZTA 5TGZA 2GHTA 1GTSA 2NO5A 1RW4A 3TIVA 4JJ4A 2XDAA 5AW9A 4DCCA 3QUCA 1EFLA 4OMFG 4OV6B 2JAQA 1EE2A 4Q1DA 4EVQA 3GPBA 3SQLA 1SCAA 4NAUA 4IF4A 4LAFA 4UTRA 2FRXA 3FVQA 3ZMTA 4FQ7A 4KSYA 1WUJS 4YLGA 3U3JA 3VOAA 2D1RA 2EJBA 2R66A 5EXXA 8OHMA 2R8OA 4A0FA 3GAZA 1JYFA 5MDHA 1Y3DE 3C3BA 3WK6A 2J59A 2EDCA 1C4XA 5I7AA 2CW7A 1WDLA 1QHSA 3KHSA 3NWTA 3OF3A 3SHQA 2H1LA 2V45A 5K0CA 3P9PA 4E03A 3DUFB 2CVOA 3TBHA 2A9FA 2DHQA 2B1GA 1YJ9I 1ZARA 2O8VA 2AMVA 3A4MA 1LVGA 2PLRA 3PGKA 4CQJA 3JQAA 3UMGA 4EAAA 3H2ZA 4ESJA 2YOFA 1OYWA 1IK6A 3HVRA 1CUZA 1YJQA 3OO1A 3BMQB 2PT9A 4PTLA 4P9UA 4OA8A 2PJZA 2W2QA 1QM5A 4M53A 1XDDA 4NC7A 5REQA 4NMHA 3V33A 4PC2A 3EXHA 4HAOA 1EVIA 1JNYA 3RHSA 3D7RA 3WLJA 4IKFA 2YIMA 1ENYA 1PSWA 2OV6A 3EUEA 2LKPA 3S1AA 4ND1A 1T56A 1GVNB 2AN9A 2ZXJA 1YK0A 1FX0A 1J2UA 4DILA 1EVLA 2R11A 4I19A 1C1HA 4LXUA 4MUEA 1DTEA 2QTMA 1MH4A 1T9CA 3S3MA 3PIDA 2OU2A 1YVUA 4HEJA 2UXNA 2ZBKA 3OEYA 4ETIA 3EPKA 1GNLA 1XYYA 1TC2A 2HIHA 3FCEA 4KQIA 3WGVA 2WZDA 1PKEA 1QFXA 4NEHB 4DTIA 2RHOA 2WU0A 4PR0A 5ALFA 3TLAA 1GTL1 3ZW8A 1CZHA 4BV8A 5ISMA 2XAJA 1YKFA 1M6VB 2F62A 3KVRA 1MG5A 2Q3DA 5E3NA 5LHGA 1CY8A 4Z9BA 5BNIA 2OXTA 2C5EA 4YV2A 1W36B 2BE7A 4HDRB 1P5JA 3CRVA 2AE2A 4AN1A 2D06A 1IXCA 3S2EA 2X6XA 2XCQA 2ZYRA 3B3GA 5M3BA 5KWVA 4EO4A 3M6VA 3JWHA 3NVAA 3IERA 3AEKB 2OENG 1T9AA 2CLLB 4M1MA 5C4JJ 4Q4ZF 2IODA 2JG3A 2FE4A 3DDOA 4V2IA 3SZGA 1YIJI 3RFTA 1IBCA 3TSAA 3ILXA 3GA5A 3FLBA 1RWXA 3R8FA 1NBME 3OU6A 4A12A 4UCFA 1TAUA 3D2BA 2AS5F 3QEJA 3ACDA 5FWYB 5LOVA 1YRAA 2ZYSA 3DYBA 3I45A 2VHQA 4UNIA 4XIIA 4EYQA 3QFHA 4HDRA 4UUSB 4E7OA 2WQZA 2BVMA 3EVCA 4LMRA 1M6NA 1YR7A 2I8CA 4R2HA 2ZIAA 3DFKA 3D5TA 3JQFA 1V5WA 2O5VA 4JEUA 1VLVA 4N8EA 4BHTA 4ZQBA 2PE5A 2GPWA 3AV0B 4TMFA 1YB5A 5EKXA 2YIJA 4RPGA 4B7XA 1LEHA 1NZFA 3OQMA 2AYYA 1VQ6I 2PRSA 3NWPA 4G8DA 4D1QA 4NCBA 2PCLA 1IHYA 1MJAA 1EXNA 4G8XA 1JR3D 1Z2CA 4G7OF 1HFWA 2MW8A 2GBLC 4ND2A 5HRAA 2J4DA 2GJ8A 4I5FA 4Q4JA 4REMA 2M9MA 3BFXA 3O7MA 5KAIC 1IZYA 3M07A 4IXMA 1ZYRF 1XCMA 4XVQA 2I29A 2HPMA 5KK1A 2XQVA 3LOPA 4XEUA 2K27A 5ESXA 1A5BB 4ZIRA 4CXFA 1MBZA 3KYDA 4FJ0A 5DD8A 5CNIA 3SC6A 1J49A 2ZREA 5CK5A 3S2SA 5A3JA 1CUFA 1WP9A 1GKIA 1VMKA 4OXKA 5FKMA 3HOYJ 3EYWA 1YS6A 2FUG2 3E5UA 4HX5A 1YLFA 2HWVA 2D2WA 1P4SA 2HJ9A 2ZJ0A 4RAQA 3BK1A 3SIPA 1JJ7A 4K9PA 4DQLA 3C3YA 4KWIA 4AIHA 5KNCD 5IT9A 2CBZA 1XHLA 5CLSA 1GTVA 2QT0A 4HSGA 2O05A 4TXJA 4Q9HA 2YZ2A 2AMJA 2BBSA 2DBQA 3FWKA 4C7MA 2Z1DA 3B20A 3HU5A 1W73A 3KSZO 3DJYA 5FNVB 4K1LA 3RBAA 1WXQA 1SK8A 5EXDA 4EMUA 4U0JA 1DIAA 3EX7C 3T7RA 3PI6A 2F5FA 2B7CA 5AM2A 1V3UA 1VI0A 2I1QA 1T0HB 3MRVA 5H02A 3U3DA 3HA3A 1UJCA 1RI5A 4WUVA 3W6OA 4PLFA 4LC1A 3ZBQA 1XCOA 1MABA 3DR3A 3PL5A 2QZ9A 5SZIA 5JSKA 2NUTA 1E96A 5DBHX 1VBMA 1NXVA 3EF0A 5DTMA 1YHZA 2QMOA 4KGZA 4DEYA 2PUAA 4HZFA 4HWTA 4XH9B 4YBRA 3FTEA 2FEWB 3ZHTA 3H19A 3LGXA 3GYHX 2KE5A 4GPAA 121PA 3AOGA 3MWDB 4WECA 4DA8A 6REQA 3EZ6A 1I36A 3E6MA 1LFDB 1CF9A 2B3DA 1XZIA 4OD0A 1RP7A 4H17A 4RORA 4ZCRA 1SXJD 4CCKA 4JN6B 3LSIA 3VV2A 1KJIA 4K9SA 5ILSA 2FZVA 4MIYA 2VQEB 2WYHA 2Q1TA 3R4VA 3FLEA 4Z0HO 3LC0A 1DTWB 2J5OA 1O8BA 5E9QA 2J9ZB 2Z8YA 5A6SB 3UMFA 1T0FA 3CO6C 3N6XA 1V4NA 4KG7A 3UH1A 2XIGA 3IXQA 3DS8A 2CKMA 1FPQA 1B9MA 1S2LA 1SR8A 2FPUA 1MVLA 4PC6A 5AMXA 2PX4A 4PYKA 3OKFA 5ADUS 2XUDA 1MIOA 1LK7A 2P30A 3KHTA 3OE1A 3QXHA 4W63A 2K3FA 1KPHA 1EM8B 1OXXK 1UJ6A 1YS4A 5COQA 2C20A 5TVKA 3KQNA 3FHCB 1D7OA 3T1VA 2Q0XA 2VSNA 4WFIA 2HT1A 1V7CA 3IRUA 5AONA 1QWOA 2DOFA 3OYGA 2ZRFA 2BW3B 2JGIA 2C84A 3EWIA 1V11A 1RM3A 3HDHA 3HU3A 3IAUA 3PXEA 5KSOA 2VJLA 3JRHA 2QMZA 1HE1C 1ONNA 4KYWA 2WMDA 3EZGA 3LFHA 1YQDA 4HDKB 4OHFA 2R2AA 5FXMA 1L5QA 5A6SA 3F6VA 3OQ1A 2VJCA 1HDEA 1MGTA 2F3RA 2WE7A 5JHHB 1H1LB 4OG2A 3K0CA 4BMNA 1ZUNA 5ITZB 2FU5C 1J0XO 2FN4A 1XT6A 2BFFB 4PYOA 1O95D 2WIGA 4QIWN 1Q3TA 4B6OA 2MR5A 2OTLI 1KQNA 1NUTA 4MVJF 1ZCBA 2ESRA 2PMWB 3ITEA 3L0OA 4JLUA 4XB1A 1LLUA 3WNVA 3CR8A 2WJVA 2A6TA 5J40A 1V48A 3RJ9A 4EKYA 2ON6A 3GARA 3T06B 4UJ5A 2QD5A 3DBRB 2DWPA 3L2VA 3RUAA 2XF6A 5A03A 3HY3A 3UMRA 3LDAA 3UJ7A 1LVKA 2P5UA 4L8FA 3WOVA 4MJLA 2FPIB 1OKKD 1RLMA 4IJ5A 4F3QA 4DLXA 4CQNA 5HCUA 1I5OA 2Y1GA 1Z4IA 4C5BA 2ICWG 2L19A 2Y8EA 4TS9A 4LG3A 2BRUA 2G63A 5SYMA 2XQFA 1G17A 4BJ6C 3I9KA 4D9BA 3ZHYA 5HKAA 3EAGA 3W5SA 2ZBGA 1PFUA 3L00A 1B43A 1NBAA 2JGFA 3KU1A 1AGYA 4MV9A 4P6VF 3PFHA 3VPCA 4QOSA 2R60A 4ER6A 4YUAA 2YMLA 3UB3A 2MSCB 4ER7A 4H7KA 1WW2A 4OAYA 3KHKA 2YN2A 1U9IA 2X2FA 4MEAA 2XDYA 1NP3A 5A2QK 2J7KA 2IOQA 2ORIA 2EJTA 5TMEA 4K0KB 3HG7A 3F6BX 1A5AB 1QYWA 5BMZA 2QVLA 1H9TA 2N42A 3RASA 1XIVA 3IBSA 4LF9B 2PS3A 4KXNA 3RKUA 4Z7QB 2K87A 1S2DA 4IP0A 5FV7A 4AS2A 4MEXF 2DTRA 1JU4A 1VJRA 1EB9A 4IDFA 1L3IA 3QKUA 3GNSA 1P4GA 3M4ZA 1HYBA 4D7AA 5C8YF 2XWQA 3MRTA 4MKZA 5AJWA 2OCDA 4AP5A 2FP3A 3JVVA 3W5UA 2EZ8A 2QZPA 4Y6LA 1HE4A 3UT5B 5DASA 2AWNA 3ESCA 3GAMA 2B30A 3AFGA 3AP3A 2PJRB 2QWWA 1W0UA 2F2TA 1GR0A 2IW5A 1CDEA 4M6YA 3IB3A 1YR9A 2REBA 1VQ8I 4CMGA 2B8EA 2FXAA 1SUSA 2DTEA 1SXIA 1G2QA 1T9KA 1U2TA 2LWIA 3DUWA 1UZLA 3FPKA 4D9IA 1LEBA 1AGNA 2QRPA 3NKVA 4RIFA 1NLYA 1U65A 3E5XA 2BEUB 3I83A 3U19A 1V5FA 2PAFA 3RSZA 4BDTA 4R8HA 4BL0B 3EIXA 2JARA 1UM9B 4PLTA 3A14A 3OOPA 1Q0QA 1RC8A 3HCNA 4H7JA 3MJDA 5CDYA 4BKXA 4RNDB 1NHAA 3SDGA 1O6BA 3I9MA 2YWBA 2XWJI 3HPQA 4PYIA 3EDPA 4G4IA 4WKGA 4YRJA 1BW5A 1O1YA 3A01A 1DKUA 4M9UA 3L92A 4AURA 2VP6A 4TX1A 1IY0A 2WWXA 4YXFA 4L9TA 2PGAA 4EECA 3TPZA 4J19A 3EMKA 4GL4A 3CW9A 4U5XA 1MH1A 1QYVA 4MITA 3WRWA 4JKOA 4IHSA 1L1RA 1FFHA 1FQJA 3WHIA 3LYAA 1V16A 2GM5A 1L0OC 1CUSA 2RHHA 1GG9A 2ZSIA 2IXSA 1G55A 2P9YA 3BULA 4IHJB 3D3NA 2QVOA 4L8GA 2VQLA 2W85A 2P4HX 3R7WB 2XRZA 2XROA 2O2XA 3OYJA 2PSJA 3RTRA 2DC1A 3F7MA 4J7XA 4WINA 6PFKA 1OXBB 3EZ9A 4QARA 5F5LA 3WIVA 4CHUA 1CZNA 1RHRA 3BX1A 3R3YA 5F6FA 2VJAA 3LC7O 4IKOA 1JALA 1IL0A 1ZDMA 2XUAA 2LDBA 3IAM1 4OREX 5B66C 4QU9A 4HW0A 3IEUA 5G4KA 3RS5A 4C30A 2CRGA 3Q8LA 1Z6QA 4BYMA 1K83J 1C8VB 1TM4E 2BPOA 1NV8A 2C8LA 1QHHD 3A9TA 1A8PA 4D9MA 4EJSA 4G0YA 2ZRPA 1DAFA 3QEKA 5HTOA 1SVLA 3CVYA 3K4JA 3QA9A 3TSYA 1LDMA 4Y15A 3BWDD 3GZTB 4FLMA 2FR1A 3BZUA 1XCLA 1YA4A 3L7KA 3MGCA 3IAAA 4P34A 4PBSA 3RKYA 1LFUP 2JIDA 3H11A 4QTZA 2VWGA 5T6BA 1CZRA 1GDTA 1JA9A 5KSYA 3DLPX 2OCXA 1LW6E 1D2CA 1EDDA 4RAFA 3DE0X 3BCHA 3QTTA 1E4YA 2FUEA 3KJGA 4BFCA 4TLMB 1F12A 3IQWA 8ATCA 2IPOA 2O2EA 1WF6A 3FOWA 3VH4A 2A6EF 1BI2A 2G08A 5DYWA 2ERXA 2K9NA 4LC0A 4QWQA 4CZCA 3M6IA 4GRAA 1A5SB 5ALHA 3JD0A 4NFHA 3CRMA