1SD5A

Crystal structure of rv1626
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
PRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords putative antiterminator
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd5A01
2HGCA 1L3LA 1D8JA 1DRJA 1P6RA 2YR2A 2FNPA 2K86A 1ZRDA 5EWLA 1BIAA 4KIGA 4EGYA 4DN6A 2JCGA 3C7JA 4GYGA 3V7SA 2NAZA 2F5EA 1YTYA 4N0QA 1XN7A 1DBWA 4RXTA 3LUKA 5HS7A 3MQ0A 3QP5A 5BOXA 4WX9A 5E8IA 2XKOA 1ZGZA 5E18F 5LGTA 3HUUA 2FVYA 1LDDA 3I0TA 3ROTA 4BH9A 2RDPA 3A10A 3TDUC 1PHRA 2P4UA 4P5OA 1WETA 5CNIA 2LKPA 4G7HF 1FWZA 3H5LA 2P7CB 3RVPA 2JSCA 3O1IC 5ICEA 1ZESA 4LG0A 1IXCA 2MH2A 3M9AA 1JWLA 4LB6B 4XSXF 4PCQA 1SD4A 4MNUA 2PUDA 2P5LC 2STWA 2L17A 1R36A 3GFLA 1UCRA 2QBYB 2BEOA 1KQ8A 3I71A 2PUCA 1YMVA 3IDOA 4KYWA 2DAOA 2Q5CA 5JNRA 1GVJA 2FBKA 3D8UA 3D5LA 2ZWMA 4OMZA 3TGNA 2E1CA 5C5EA 3DXJF 5L3CA 2JTVA 3MEXA 3QELB 2W42A 1HKSA 4PE5B 3B2NA 1JL3A 4Z4FA 5IT3A 1DPRA 4RK6A 5ERIA 2JVJA 2EB7A 1FLIA 5CNMA 3O75A 4MTDA 4Y9TA 3A0RB 1ZGJA 2VC1A 4OLAA 1LJUA 3I64A 4F12A 3FFWA 2P6SA 7ABPA 1WQ2A 1HEYA 3HV2A 4CO8A 5CVVA 3V8LA 3QU3A 4E7OA 4L5JA 4LD5A 1MVOA 5DKFA 2YX7A 3C6QA 2I6FA 4MQEB 3RJPA 3E3VA 4LK0F 2J5OA 2GXBA 4H60A 4DADA 3BPXA 3CO6C 3T6KA 2WJWA 1SFUA 1UHMA 5TPWA 2PMCA 3GRCA 2HS5A 2DRIA 4IHTA 5CLSA 1FBUA 1QZZA 3C1DA 1ZREA 5LRRA 3FMSA 4FX4A 3GUDA 4O3MA 5CVIA 2A9QA 5ICFA 4RDCA 4RB0A 4EJVA 4ETMA 1FOKA 1P6UA 2H0AA 3TX6A 3DF8A 2HOEA 2QLZA 4A6EA 3P9KA 3MA0A 1Z1DA 4OINF 4EJUA 2BGCA 2JBAB 4YO7A 3H5OA 4KIFA 2R4QA 1OYWA 2EJRA 1HXDA 4M9XA 2C6YA 2FEPA 4ENKA 3IRRA 5TPZD 3ELKA 5ED4A 4MAAA 1QP4A 5FLXK 1FFGA 3C18A 2PKXA 2HKOA 2VYCA 1ZARA 2P4WA 3KCNA 5FBKA 1XGOA 3ZMVA 4YP9A 4EUKA 1QO0D 4MR7A 2FXAA 3KE2A 3HDVA 5FBHA 3T5XA 2K27A 3A0UA 3B02A 3G85A 4MQFA 2FMLA 5EWMA 1FP1D 3WTUC 4EM1A 1YW7A 1DBPA 4GNRA 2VT3A 5ILVA 3R4KA 3ZMUA 1ZH4A 1BI0A 4EVQA 3LUHA 2W85A 1JYFA 1Z17A 2UZKA 2FOKA 4KN7X 2W24A 3LUCA 5K5RA 5DEQA 1T98A 4XARA 1NTRA 1RXEA 3HM9A 4WXEA 4G0XA 3NHZA 4LE2A 2IOYA 3FM5A 3OQMA 3KEQA 5HLIA 2OD5A 4F11A 2P5VA 4G8XA 4HNSA 4HX4A 3EDPA 2IDMA 3KP7A 2XAFA 1NXXA 2IT0A 1FPQA 1SD5A 3L6UA 4MR7B 4KV7A 2HQRA 1GUDA 2K02A 4KQCA 2COMA 3QLVC 3I4PA 1J7KA 5FWYA 1R23A 2FU4A 3N8IA 3RDIA 2EFQA 4HOBA 2RKHA 4KK3A 2A9RA 1TLHB 5D5WB 2PUGA 4RY8A 3OM1A 4XBFA 1KU3A 1IAWA 1MKMA 2M5WA 4U0VA 2FMKA 1XD7A 2PUEA 5I4CA 4F06A 4N9IA 4R8HA 5K1YA 1E6LA 2IPNA 2DFIA 3RKXA 4I0BA 2XKPA 1EWVA 4XXHA 1R8JA 2JVKA 5KQPA 4CYDA 2XAJA 3F72A 1BOAA 4A2UA 5IEJA 2OQGA 1WWXA 5BRAA 4XLNF 3C3MA 4N0BA 4KICA 2E4UA 3CJNA 4OATA 4H3KB 4U88A 2QVGA 3ERED 4L9VA 2M30A 4FE4A 3GL9A 4NV3A 1IXRC 5D6EA 2E4ZA 2WB4A 4UV9A 1LJLA 3JS5A 1QPMA 3DGFC 3E3MA 1JDPA 1Z6TA 5D4SA 3LUJA 3FMVA 4LZLA 1USTA 1HBXG 4M88A 1ONVA 3Q9SA 3ZP5A 3CHYA 1DC8A 5IUKC 3CTPA 3GYBA 4WXCA 1NXTA 2E4WA 4WXDA 3Q7TA 4M9ZA 5DD8A 1L5ZA 4G0YA 5IBQA 1KU9A 1LK0A 4ZJPA 1QQAA 2J5PA 2KJCA 3HK2A 2OQRA 4KMUX 1BAPA 3RQIA 5FD6A 4ETNA 3BZ6A 2L18A 2FSWA 2M98A 2DQRA 3QLUC 4EY3A 1DPUA 1VPWA 1LB2A 2CG4A 2MYNA 4IRHA 5E1ZB 1O7FA 2VBZA 2Q2EA 2H94A 2QZJA 4UVBA 1ISSA 3K1NA 5D5XB 1TQPA 1YIOA 3V4GA 3F3XA 1JX6A 3Q9VA 2FEWB 5CNJA 2IKSA 2J48A 3H6GA 3IPCA 4KK4A 2MSLA 3K69A 2QENA 1O57A 4CZZA 1TM2A 4AIJA 5IC5A 4ZYLA 3QX9A 2WWVD 4U0WA 3KP4A 4IVNA 4ZH4F 1KYWA 2VONA 3WTZA 3N0RA 4JK1X 2CGPA 5DTEA 4HW0A 1LJ9A 1IIBA 3LUGA 5FD5A 1FBQA 3KLNA 1FSEA 3T0YA 5KC8A 1R1TA 2Q0OA 1ZY2A 2FEKA 3J80K 1QQBA 1MDMA 3RVJA 4D0PA 1U2WA 4CXFA 3F6PA 2OAZA 2HJ9A 1BVHA 3NBMA 2JZYA 3L00A 4Z4HA 2FQXA 4XLTA 3RVMA 2VK2A 1KA8A 1TNSA 4ZYDA 3N97A 2V6CA 4A0ZA 3JY6A 4O5AA 3BRSA 2ADUA 2ZJ2A 3QAHA 5LHHA 1QP7A 5TQJA 1SXGA 1ON1A 1XSXA 3WODF 5GOTA 3H1GA 4MS1A 5A2QK 4ZZDA 1GLGA 1Y0UA 1KMIY 3VEPA 4B09A 4G97A 3SNKA 3H75A 1JFSA 3DZDA 3O2QB 5DDGA 3FFXA 3GEZA 1FC3A 3BROA 2AXLA 3FM3A 3IP6A 3HS3A 3M7GA 2UXXA 3L2CA 3K2ZA 2STTA 2X0LA 2H6CA 2LDUA 4G0OA 2OBPA 2VXZA 5CHYA 5BPIA 2HWVA 2P9HA 1G3YA 2KIUA 3WE2A 1G3WA 3I59A 3Q41A 4QYMA 2PEXA 4XRFA 5TPWB 3KJXA 1D4ZA 1MZBA 2LNBA 4YG2F 1RPJA 5TQ0B 2EA2A 2A07F 3U9GA 2JRTA 2PI0A 2DT5A 5L3GA 5LEKA 4LMYA 1URPA 5KQGA 2TMYA 3MYYA 2HEOA 3IKTA 1XGMA 2BE5F 3WE3A 3MFKA 3IRQA 2QYOA 2V1UA 1Z15A 3GLXA 1SMTA 4AWXB 3ZQ7A 3V7RA 4W5TA 1T2KA 3PFIA 4L18B 2HKXA 4K2EA 3URMA 3BWGA 5A2QZ 5KWSA 3LUFA 3F6OA 2F8TA 2L02A 5L3FA 2V79A 4RB2C 1ZHHA 3LSTA 3O2PE 3NNDA 4GPAA 1DP4A 4KUMA 4XSZF 4IRGA 3FWEA 2L19A 1FBSA 3HOSA 2FBHA 3J7AO 3ROUA 2K7LA 2MSWA 2UXNA 3GXOA 1Z9CA 1C0WA 1DP7P 3CKMA 2F5FA 2QQAA 2FA5A 4G9YA 4PDKA 1IN7A 3H5VA 2G7UA 1W9HA 2MA3A 4TLLB 3ULQB 3I5AA 4NICA 4G6QA 2PUBA 1T39A 1MJAA 2LSOA 3DPLC 4FE7A 2G7HA 3LA2A 3JTHA 5HDKA 5EWMB 2MC3A 2FRHA 1ABFA 3HTSB 3ISPA 1W7PD 4FB4A 3VB2A 3TB6A 5H6RA 3FHZA 1M2EA 3LKBA 1O3RA 2ID9A 1DDNA 4L0YB 3NNSA 2P8TA 3C3WA 1BI2A 2LPMA 4ESFA 4PZ0A 2H6BA 4AIKA 2HPHA 1K78A 3O1HB 5JR3A 2XAHA 1XCVA 1E6KA 3EQZA 1MGTA 4HLYA 1T6SA 1V4RA 3CUQA 2A5YB 4YIFA 4RS8A 2DLLA 4LG0B 5K5OA 1EWTA 4PGGA 1JBEA 3S2WA 1XGSA 2ACJA 4N03A 4NCAA 2DU9A 1JFVA 1REPC 1HW1A 2NUBA 2JK1A 4PZJA 2YHAA 5LEJA 1DCMA 2R47A 3BRQA 3KHTA 2EV0A 1AB5A 1ZRFA 2AS5F 1XHEA 5CJ9A 2FMIA 1EH7A 2L01A 2RGYA 2FQWA 5KI6A 1USGA 1UFMA 3CZCA 4JQFA 3G73A 1P92A 2DK5A 2OZUA 3O74A 4KA4A 3ML6A 1A0OA 1VRVA 3E6BA 1R5HA 1ZG3A 2CO5A 3ZN0A 1JHZA 4TLMB 3LQQA 2PQ8A 2PUAA 5DD4A 3F7NA 4RXMA 2XGXA 4BYYA 1B59A 2LUOA 2OZ6A 2PE5A 3MM4A 5BQ3A 3DFGA 5IULC 2XRNA 1XMKA 3EQLF 2YHBA 1R00A 5KQMA 4EJTA 5ABPA 2IA2A 1Z25A 3N75A 1TQIA 3JAMZ 1HW2A 1KU2A 1SXIA 2X4HA 1JFTA 4HF2A 4OLBA 2QM3A 3FXUA 1FYKA 2VBXA 2V1XA 4Y15A 1MJBA 3JSPA 3UUGA 3ZMDA 2P5KA 3HXMA 1NXPA 4P1ZA 1XSDA 2KRFA 4N76A 3T1BA 2EFWA 2KJBA 3GX4X 3V8KA 4PEVA 3GFMA 1M5UA 1K66A 2PLNA 1JE8A 3FFTA 1TBXA 4BNCA 1V3FA 1QNTA 1R22A 1D5VA 4OMYA 2XAGA 4HX8A 1J75A 2IPQX 1YFHA 2F5CA 3HRMA 4Q6WA 4W5QA 1NATA 3JPWA 3RYRA 4YWHA 3L7WA 1XHFA 3JTEA 4MLCA 1E17A 2WRZA 4FX0A 4MTEA 4ON0A 4BAYA 1D2AA 3O3KA 5D4RA 2O0YA 4A12A 4HLXA 2Y48A 1Z2DA 1C0EA 4L9TA 1RZRD 5LGNA 2R48A 4QWQA 2PMUA 4EYKA 1HQCA 5JNTA 4AD9A 3L9FA 1QBJA 2XVCA 4OG2A 2KIMA 4O6JA 2A9OA 1PNRA 5L3DA 5DLEA 4Z9AA 2MLGA 1AB6A 1ISRA 4LLGF 4Q47A 5IT9K 3O6BB 3HYIA 4RAYA 2QV0A 3RIRA 1JYEA 3CNBA 4LLLA 2GWRA 1B9NA 2VE8A 4DQ2A 4KRFA 1U6GA 4WWCA 4RSMA 2LF7A 4D6YA 4JB0A 1F51E 1S3JA 2ISYA 3F8FA 2D1VA 3KFWX 2QQ9A 3PQKA 5BMZA 3PQJA 3WTXC 2VUHB 4XAQA 3M8FA 3RYPA 4UXNA 1IN5A 3EULA 3L49A 3D02A 2RVCA 1APBA 4HF1A 2ZXJA 2LP4Y 2HTSA 2L2QA 3OQOA 1U78A 4EGZA 2PL1A 4GYIA 1XDSA 3EGCA 3Q5FA 2RQPA 5DCLA 4LGWA 2XDYA 2GIVA 1IRGA 3TO5A 5EWLB 1STZA 4MS4A 3KCCA 1YW8A 1PDNC 2FNAA 1HKQA 5FGMA 4WZZA 3CUQB 3HEBA 3HCWA 3JVIA 2K4BA 1PNTA 2EV6A 2PUFA 4ENMA 5D8KB 2WV0A 4Z2YA 3CDHA 4ESBA 2O61A 1K78B 1DCFA 3F73A 1YG2A 1BDJA 3VFZA 2EFPA 3TQNA 3KLOA 2JT1A 2W57A 4OBBA 5D6FA 3O1JC 5F1RA 4A5MA 5KQLA 3WGGA 2CD7A 2FTKE 3HSFA 3SXYA 3GYHX 3G1WA 3TOAA 2RC4A 4D6XA 1P2FA 3HRSA 5AONA 1U2PA 5T3YA 2WJAA 3ECHA 2H3HA 1W25A 1FFSA 4Z4CA 4JASB 2QBYA 1ZLKA 3EQ2A 4ZYEA 3K9TA 3RKYA 3LUAA 1VTNC 2B1JA 3KEOA 3R61A 1IW7F 4P96A 3LA3A 4EM2A 1UB9A 2P6TA 5JNWA 3WTSC 4MRMA 1YS7A 4HYEA 3KZZA 1VLZA 5DYMA 2FEZA 1L5YA 1QZYA 5IEBA 2JBAA 2PJUA 3RI4A 1QNLA 3R6SA 3T8TA 2RV8A 2XAQA 1MJ9A 3IPAA 3R0JA 1FP2A 4I01A 3QEMA 5HSGA 2LIVA 3F21A 6CHYA 2CSOA 4CGZA 2NT4A 5FWXA 2R7FA 3U1DA 3TDZC 1OXBB 4F8JA 1T34A 1W7PA 2RNJA 4MS3B 1WRJA 1ZGAA 5E3JA 1J2XA 4CBVA 3LA7A 3GBVA 3E61A 4P9UA 4KQ9A 4W5NA 5FFZA 3SG0A 4ZMSA 1R7JA 2Y0MA 5HS8A 2Z5UA 3QEMB 2PMHA 5D2CA 1ZITA 2ZMEA 1HSTA 5D5UB 3QLUA 3QP6A 4MGRA 2ETHA 3I5UA 1OMIA 4OTZA 5DGCA 1YK1A 4CDGA 5EWJB 4MS3A 2IVMA 2Z3YA 2MH9A 4I7HA 5IT9Z 3UKJA 5JHUA 2GX6A 3JW4A 3RPUA 1USIA 1Z12A 4OIPF 2IA0A 1LQ1A 1IZ1A 2P7VB 4NQWA 2LF8A 1ZYRF 2CYYA 2JPBA 5FWYB 5KK1A 1OR7A 1AWCA 5TJJA 1BA2A 3GVAA 4RGXA 3JTGA 3BJ6A 1FQWA 4YV7A 1SMYF 3OLXA 3I58A 1NHAA 1DCKA 4RK7A 2KYRA 2IA1A 4RK5A 1ZLJA 3WTWC 4G7OF 1NXOA 2EFOA 5E1WA 3VNAA 2KKOA 3HHGA 4F3TA 1U04A 2D1HA 2BYVE 3FDFA 3SY8A 1EAYA 3WGIA 1W5TA 2DBBA 3RVQA 4MQ9F 1BJAA 1XGNA 5ICCA 2DO7A 3QPTA 3BBLA 3OM0A 4WWHA 3H92A 2GBPA 4KMRA 2Q8KA 4N9HA 2M1BA 1G3TA 3I59B 2A69F 2GKGA 1B6AA 3H1FA 2CHEA 3EDCA 3FXQA 1SFXA 1YK0A 5TQ2B 5EEGA 3K1PA 1QPZA 4ZYGA 2OA4A 1P8AA 1FSPA 1B9MA 3I42A 4MS4B 2ISZA 4IPAA 5IX8A 4Z4IA 3BP8A 1BBYA 5AIQA 3E97A 4WCGA 1JGSA 3H5IA 3K0LA 1W4MA 3IKVA 5HS9A 1TLFA 4HV6A 4HQMA 3CFYA 3GZ6A 2VUIB 2VOOA 1TMYA 2ZBKA 3BREA 1R1UA 3I09A 4QLCU 2IJLA 4QICA 3B73A 4BHCA 1FX7A 3JPYA 1P4WA 1MAVA 4LDAA 4RK4A 4YFNF 1FFWA 2FMYA 4KREA 4HNRA 1S7AA 3WTYC 4HDVA 2Z9OA 3Q7RA 3RVSA 1ZRCA 3S99A 4GO1A 3M9XA 5BQTA 4N41A 5JNSA 3ECOA 3KSMA 3M1EA 1I5ZA 2PFBA 2KIFA 2L3DA 4GGGA 2MYTA 4XFKA 3WTTC 2O3FA 3CUOA 4JAVC 4KVFA 1XWWA 2JB9A 3KTOA 3IL2A 3IP7A 1LEBA 2A6HF 5BPDA 3CU5A 3LQRA 3T38A 4KFCA 1WSUA 3GW2A 1Z6RA 3G3ZA 1DC7A 1A04A 1VKRA 1Y1LA 3BY6A 4NHJA 1M2FA 1EH6A 3UK0A 2FKAA 4WXMA 3JSOA 1H9CA 4WK8F 4RS3A 1LEAA 2OU2A 1PUEE 5CYVA 3LUDA 1FSHA 4G0PA 4PGHA 2IPLA 3T8YA 3N4MA 2ELHA 1S8NA 1U8TA 1BI1A 3DP7A 2DI3A 3NRVA 5DCFA 1U5TA 2D45A 1SAXA 3P7NA 5FWXB 3HHHA 2YPRA 3IWZA 4RB3C 1I1GA 1Z13A 3ABUA 1HKTA 1B00A 1YTUA 2QXYA 1DJMA 3OQNA 1F5TA 2DK8A 2QUFA 4MR9B 4L9JA 3P9CA 1D5WA 2YU3A 3I45A 4S04A 1QKKA 1G3SA 3NEUA 4MGEA 3K1MA 2BV6A 1U0SY 4DNCA 3RH0A 1JHFA 3KP5A 1IRFA 1PUXA 3LAPA 3CO7C 4XLPF 4JBAA 1OYYA 3QLTA 4W5OA 5ICGA 2ESNA 2F5DA 4N47A 3BOQA 1IF1A 3IP9A 1CYEA 3VNBA 4Q7EA 5H6QA 5JS2A 4BXUA 3QPHA 3BPVA 8ABPA 2ID7A 1OYIA 4YFKF 3N53A 4H3HB 4JB2A 2ZNZA 3FX3A 1D3YA 3RPQA 3ZN1A 3E5UA 1TW3A 2R25B 3TO7A 3CG0A 1RNLA 4RK1A 4IILA 4A0XA 2O20A 5DCMB 3JVDA 4HNQA 2RDMA 1KGSA 4QPJC 3V7CA 4EQQA 2E4XA 1LDJA 4WXHA 2IW5A 4HQEA 3H1EA 4ENNA 1K6OA 3EYYA 4L85A 1MB3A 5AIPA 4O5VA 4LFUA 4IJAA 1PP8F 5J8FA 3QU6A 3LMKA 1IN4A 2FQ3A 1PP7U 3O2JA 2E7WA 3E6CC 4L0ZB 4Z4GA 4LX8A 1C4WA 1IN8A 3DGEC 4MR8A 1ODDA 1F9NA 2LBPA 3RTRA 2HSGA 2IPMA 5E20A 4TV7A 4HX7A 3J81K 1P4AA 2GXGA 3RVKA 4M74A 4DQDA 4JA2A 2PAFA 1DG9A 2MBFA 3FXRA 5TQ2A 2NNYA 4LB5A 3E6MA 2CHFA 4EVIA 3DLBA 1U3EM 4ETSA 4R79A 1S6LA 2TDXA 3W6JB 4F7ZA 4EVSA 1FYMA 3ZMTA 4JOQA 5JNUA 2N9UA 3COAC 1ZAYA 2MD5A 2VE9A 2QVCA 3HRTA 4YR7A 5LGUA 3QOPA 2V9VA 1GXQA 4M73A 1LVAA 1FY7A 2NZVG 4GXOA 4YGXB 1H9TA 3SZTA 5DUIA 3HOTA 1BDHA 1XB4A 4EJOA 4Z0NA 2NYXA 3LAJA 4ASNA 2GI4A 4G0QA 2BGGA 3E5QA 4UV8A 5HLGA 5D8LB 1F4KA 4E7PA 3GZ5A 5PNTA 2X7XA 1TJYA 3I54A 2E7XA 1YLFA 5F64A 3SZPA 3WGHA 2FLKA 1IXSB 3D0SA 2RJNA 4ZPJA 4L4UA 3DPTA 1B1BA 3FMRA 4UVCA 2Z99A 4G7ZF 4UVAA 3SFZA 1BM9A 4MQVA 4UNOA 3F8BA 1MIHA 1USSA 1F1ZA 1YYVA 1ZDMA 4EYQA 4NCBA 2DQLA 3QLVA 4LE1A 1P6QA 4G86A 4RV5A 3FMQA 2IP2A 1CF7B 1BN5A 3JAMK 4G94A 4XASA 5C5CA 3GA5A 1RUOA 3MWMA 2H09A 2B4AA 4L9NA 4M71A 1O3SA 3SHFA 3TD9A 3NNNA 3QELA 3EUHA 5J8CA 2WC2A 2FLWA 1UHWA 1M5TA 4O1IA 4WUTA 2O8XA 2VC0A 5LBQA 2ZFWA 3LFKA 1H0MA 1KRXA 3GV0A 5BRJA 5TPZA 1AOYA 1GCAA 2M45A 4Y13A 3DLHA 4EVRA 4IHSA 4G0MA 1GHCA 2L4MA 1LBIA 4LE0A 4LDZA 3J81Z 2F8SA 2HR3A 4IF4A 4MHGA 2QR3A 3LOPA 3MF4A 3AAFA 3F23A 2EA4A 1EWKA 2FF4A 1DUXC 1Z91A 5CNKA 4H0EA 1J59A 3OMWA 2WY2D 2FN9A 2HFHA 3HSYA 3OLZA 3KG2A 1ZN2A 1CEYA 1WKMA 2GA1A 4MS1B 1GCGA 1Z18A 1SXHA 2M1ZA 5KC9A 2RGVA 2FE3A 4HV5A 1BC8C 4OIQF 1SFEA 2YSRA 4AVPA 3LFTA 3SAJA 1F4VA 2HYFA 3FF5A 5LLQA 4KT5C 5IUNC 1YVUA 1RZRA 1A2OA 3TKYA 1W7PB 2QWWA 1J56A 3OO0A 1TVMA 2VBYA 1BC7C 1ZG5A 1BDIA 2WTEA 2H27A 3KP3A 4ZMRA 2ZMEB 3ILHA 3HIFA 5H20A 3SQNA 4YCSA 1D1PA 1KQ0A 1DZ3A 4M72A 3TMYA 2XIGA 3H6HA 1K79A 3CTAA 1KU7A 3H3UA 1K68A 4A5NA 3TOBA 4OU0A 4N0PA 1I1SA 3REOA 4EM0B 2GAUA 4MR8B 1KRWA 4U7BA 1JXSA 1KQ9A 4OIRF 5HLHA 4WF2A 4MLDA 3LWFA 3DV8A 3MIZA 1ULYA 4I0AA 2VODA 4ETIA 4U0YA 1I6XA 9ABPA 5L3BA 4TMYA 2L54A 2DPUA 1FT9A 1UDRA 1TTYA 2YX4A 4RZSA 4RKRA 2QVOA 1NXWA 1J9IA 1D1QA 2XHKA 1YQAA 3M9WA 4PYRA 1RZ4A 4ZZLA 1T38A 3MCZA 1G6NA 2ZNYA 1OKRA 3IWFA 4I2OA 4RK0A 3LKVA 4Q5SF 3T95A 2QQBA 2D2WA 4D74A 4KDPA 1MB0A 3T8RA 1J0RA 5LHIA 1OPCA 1DBQA 5K5QA 4CHUA 4P98A 3CG4A 5FO5A 3FZVA 1E2XA 2IPAB 2HQNA 2ESHA 2FSPA 4QYWA 4RAZA 1NY5A 2W84A 3Q7SA 1JLKA 2G9WA 4MEYF 3ZMZA 3EYIA 3O21A 5DCMA 4IXAA 3GWZA 1JHHA 1XMAA 3M6MD 1QP0A 1BI3A 4Z4EA 5TE9A 4Z9BA 2IRFG 1LDKB 5D5VB 4RGRA 3BJOA 3HUGA 4KN4X 1B4AA 4YLEA 4HF0A 3ILYA 1O7LA 3QX8A 3KETA 1D8KA 4MQEA 4TN5A 1ZGGA 3LTEA 1E2BA 4EV0A 2MSKA 4KZKA 2VN2A 3BJAA 1HW5A 5HVQC 3K9CA 3HSEA 3FGZA 1CGPA 1MD0A 2QU7A 3KYIB 3BDDA 3OLVA 1P4XA 1EHCA 5CVJA 2M8EA 1S7OA 2AYZA 2M87A 3C97A 2HQOA 1ON2A 1SD6A 3OOPA 3EAFA 4U7DA 3O2SB 3OO1A 1H9GA 4BHBA 3EETA 3H3ZA 3HZHA 1JH9A 4RGSA 3F8NA 2WWYA 2O03A 4A6DA 3N0XA 3TO9A 2RN7A 4EMSA 4BHPA 3MZHA 3NHMA 3J80Z 3CS3A 3GT7A 3QK7A 4MPTA 3GO5A 4LK1F 1TQMA 4AIHA 2VT2A 4EYGA 2HZTA 1O3QA 3F8MA 1U5TB 3OLYA 2W25A 3DKWA 1SRRA 2O6GE 2MYPA 4KNYA 2E1NA 3GF2A 1ZAOA 3MMNA 4Y17A 5HDGA 2GQQA 3DQVC 3WTVC 2BBYA 1Z26A 2CWEA 5HDNA 3SM9A 4EGSA 3A3KA 4MR9A 3P9YA 4FHTA 3CUQC 4FT8A 3E6DA 2PBIA 2JRLA 1RIOH 5IUJC 4MYRA 5ILUA 4HAMA 4MEXF 1TW2A 4RWEA 4WT7A 4KPYA 2FN8A 2OENG 5FB2A 2IYNA 1YMUA 2XROA 3DEUA 1O3TA 4RXUA 3L09A 1I27A 2A3SA 5KVRA 1XCBA 3HJFA 1QGPA 5LHGA 3VOEA 3E5XA 2Z33A 1GXPA 2HDCA 2XASA 3H5TA 3HDGA 4RGUA 4LLNA 1QMPA 4I02A 1ZHFA 1JF8A 3F6VA 5DUKA 2FQYA 3CRNA 4R1HA 1E6MA 5B3JC 4YS6A 2FW0A 4Z99A 2V1DA 4LRQA 2DW4A 3KP2A 1GUBA 1KYZA 4UHJA 3CLOA 1ZVVA 1CHNA 2AYXA 1LNWA 2CFXA 5JFRA 2CW0F 5TRDA 3RVRA 4I09A 2NRAC 2EV5A 4UUVA 3HTUA 4G6DA 5HQJA 4ENJA 2CWDA 2FXIA 3R60A 2CQKA 4GCVA 3MQ4A 4L5IA 3N6VA 2QSJA 4B8XA 4E70A 3HUTA 6ABPA 3KKEA 3QRFF 2B0LA 2QZ8A 5JNVA 4HBLA 4ESJA 3I53A 1FYLA 1NXVA 2GA2A 5CVUA 4HZFA 4RY0A 4RKQA 3ZMSA 3RVNA 1HSJA 4IRXA 2ZCWA 2R7DA 5CVRA 3KS9A 4IMIB 1ZH5A 4CICA 1J5YA 3RVLA 1IN6A 4IMJB 1PEYA 2A61A 5L3EA 3TO6A 1TNTA 1YW9A 4ML3A 3NQOA 2PJPA 2MLKA 3GFJA 4MQFB 3QEKA 1Z2EA 3VODA 2A9PA 3WG9A 2RJOA 2DTRA 3U2RA 1NXSA 3DBIA 5J6XA 5DV5A 2ZKZA 1XDUA 5HKOA 3V8JA 4M6YA 1QQIA 1K7AA 1USKA 1I3CA 5JI6A 4Q4ZF 4OIOF 5E8GA 4P55A 3EJWA 2NS0A 2A6EF 4IGAA 2UWMA 3IP5A 5HM6A 3F8CA 5FLXZ 6PAXA 3N0WA 3OV8A 1Z16A 1YS6A 2GZWA 2R3SA 2EWNA 1L0OC 4UHTA 2FMFA 2A68F 2EFNA 3MAJA 1XSVA 4HDUA 2E4VA 4EYOA 1ZH2A 4YIIA 2V0NA 3WU0A 1RXIA 2NT3A 2FMHA 1SD7A 4RY9A 3OMXA 3KZYA 3ABTA 4I98B 3EODA 3OLWA 3IC7A 3F22A 1G4DA 1MDMB 1T0FA 1CF7A 3RVOA 3K4HA 4JP1A 2NNNA 3HSRA 3CZ5A 3IHUA 2WMYA 1JDNA 4KIBA 3CLKA 3WU1B 3GBPA 2L4AA 2VOPA 5E1XA 1Z05A 4EJWA 3H5WA 2EK5A 3KP6A 4G0ZA 2QW1A 2NZUG 5EEHA 5F6FA 3HRUA 1QO0A 4NB5A 2XUBA 2K4JA 4RU1A 1X3UA 1ZG1A 1S29A 4M6XA 3F6CA 4LJZF 1U8RA 4Q6BA 2FBIA 1FZPB 1W5SA 4W5RA 1IUYA 2PLYA 3W6KB 1EV7A 2PL9A 5T7BA 5HOOA 5FFXA 1R5GA 2JVIA 2HYGD 3GWGA 4UHKA 4YRZA 1EH8A 5E17F 3R0AA 5ILSA 3HVRA 1FNNA 3RKWA 1RUNA 4BQAA 1Q1HA 5EWJA 3HO1A 4A0YA 2XV4S 2VBWA 3C3KA 1U5TC 3MZYA 3ROFA 1U2QA 2MYUA 3W9SA 4NQRA 4PICA 1EFAA 5TQ0A 3ZPLA 4P9FA 1R1VA 5BS6A 4KMFA 2HQBA 2ZO4A 4M9SA 1LBHA 1R58A 5B3JA 5JVTA 3BILA 1PEAA 2DPDA 2Y75A 1DRKA 1WI9A 4IRIA 5LRSA 4ZYHA 4O1HA 4YFXF 1OXKB 1Z7UA 2HTJA 2ZAYA 3KYJB 1BIBA 1YO5C 5JS1A 4RB1A 1ABEA 4OOIA 2PN6A 2E4YA 4HA8A 2F2EA 3M8EA 1RI7A 2JPCA 5BR1A 4MRMB 2PG4A 5GQSA 3Q15C 4Q48A 4S05A 3P9IA 3GFIA
chains in the Genus database with same CATH superfamily
1G6KA 3T4PA 2X2PA 1QPIA 4B8WA 1D8JA 4JJGA 1KEPA 3BTJA 4BKOA 3S2UA 4IIEA 1TQHA 4RMGA 5IJ0A 2VJJA 5C44J 1ENPA 5GV7A 2P77A 2K86A 4FYXA 3CCCA 4E1AA 3C15C 4ZVPA 4MV1A 4ESOA 4AT1A 4P93A 2ZTHA 5BUQA 2XA9A 5F04A 2AZXA 1M1NA 1QH0A 4G56A 4OL9A 3GRZA 2JCGA 4XOPA 2X7JA 2SNIE 1NW5A 1X3LA 3ZCPA 3L8HA 2NAZA 2F5EA 5AVRA 1YTYA 1YKFA 3F96A 3TGPA 4N0QA 3HA7A 1XN7A 4RXTA 5IDWA 3D5RC 2IZ0A 1XLWA 3U3MA 2BLLA 1U7XA 1SBZA 5HS7A 1REQA 2GEFA 2QLBA 3NT5A 4KQWA 2ZUTA 1XKXA 3WNZA 2P69A 1UODA 4Q19A 3HFSA 1IY1A 2BFEB 3O03A 5A2GA 3HKCB 5DVZA 4MKXA 5L7YA 1XZLA 2GNOA 2H5IA 3RZOJ 1Z0IA 2O7VA 2HHAA 2CMGA 3AEXA 1C3EA 1R27A 2OPBA 4TWJA 2QKLB 4WADA 3A10A 1X87A 2Z3WA 3GA7A 2OUIA 4PVDA 1R6XA 1V6SA 4L8YA 4OHKA 4CKWB 5HKKD 5B2EA 2ZK7A 1RKVA 3TPFA 4P5OA 5KYNA 5LZ2A 3DKKA 2QK4A 4H6WA 1WETA 1QQTA 5GJVC 3TLGA 3H5LA 5HCUA 3CZAA 5TDHA 3WK9A 4BGEA 4F9GA 1SXQA 3VR0A 3RZDJ 3SDZA 4CV0A 1VRCA 3SQWA 4A10A 2CGEA 1IXCA 2DMUA 2V8BA 3L82B 3QMWA 1LFDB 4JXKA 4FGUA 2JJYA 3FKQA 4PVCA 1ZNZA 1OWPA 1FSSA 3FE2A 3N2KB 2VNAA 4PX2A 2LCQA 4F4UA 2GR9A 1L5VA 1YX3A 2P5LC 1DLJA 4LGVA 1SB9A 1L7MA 1R36A 1SVOA 3GFLA 3UFBA 3PQFA 3V4LA 3VISA 1KQ8A 1P3DA 1GCIA 2Y0EA 5FTMA 4BY1J 3T1QA 3A1DA 1U9JA 1YRAA 3ZTWA 1X15A 5ESRA 3E15A 4EYSA 4YRKA 3Q3IA 2ZUDA 4MW4A 3SCZA 5KNDA 3T5PA 1W0TA 1ZCJA 2F8MA 1JEEA 1SOWA 1W5AA 1Y4DE 2ODBA 1UMDA 3QPWA 4CM4A 3OZUA 4ALKA 1ZL0A 1V1RA 3LX6A 4WLVA 4N9QA 4WXYB 3GOQA 2AE2A 1XZCA 4UHCA 3HUDA 3DM9B 3DXJF 5IPAA 1XRRA 3D9QX 4ZHSA 2ZCUA 1KAOA 3WZMA 4NCKA 4C5AA 3C48A 3SM3A 5C37A 4GSLA 2IU6A 3UJPA 2EP8A 4M8LA 1DHRA 3MUFA 4PE5B 3PQDA 5C81A 1NW7A 4FYHA 4LAFA 4GGOA 3RFTA 5ADUS 1FXUA 3A9SA 3HNRA 3HVHA 4URVR 1P0QA 2IL1A 5ECDA 4Q1DA 3CEMA 4XYEA 4NYMR 2YU9J 1FLIA 3HP1A 4PQEA 5CNMA 5DN9A 5BNIA 2QN6A 4MOWA 2AZTA 4TWAA 4TLEA 4MTDA 4ZI5A 5JW6A 1E0JA 3RLIA 1NKVA 4D9KA 2LVSA 4TKVB 4HPQA 1LJUA 4IDQA 3DBHB 4FNOA 4F12A 3VR1A 4N9WA 2P6SA 1Z28A 4V0LA 2IZ5A 2GYUA 2ZDHA 3K8OE 2PT7A 4DJJA 1XQVA 1PT8A 3J7ZI 4BE9A 3V8LA 1FSGA 3QU3A 1XROA 1XEAA 1EFPB 2BFCB 3ZD7A 3MWFA 1XMXA 5GPAA 1S4MA 3C6QA 5DK6A 1ZMXA 4CPDA 4YPOA 3IPXA 1V8OA 1DJQA 4JITA 3WL3A 1XBTA 2J3IA 3PM1A 5L40A 3WFZA 3EGDA 2XGMA 3OWHA 3DEAA 3DMTA 2WF9A 2Y77A 1O6BA 1KYYA 4LI3X 3MRSA 3E3VA 2GXBA 5G0SA 1GKKA 1KIFA 4N12A 5DV9A 4BNUA 4F86A 4QT4A 5JZVA 1W8DA 1G98A 2A5GA 1SFUA 5ALHA 5ALGA 2OCAA 1XZJA 3OTHA 1RWMA 2PJRB 4UUPA 5TPWA 3JREA 3JWIA 4IHQA 3RU9A 2NZ2A 3WL4A 3IVXA 2FKNA 4IG9A 5JTTA 5DT2A 3I92A 5G4KB 1WHTA 3SLKA 1OFUX 1N5KA 2DRIA 2PK3A 3Q4GA 5EZ6B 5SY4A 4DCCA 5M04A 3RNLA 1JT9A 1PJ2A 1T4DA 1LBTA 4FFVA 5CK4A 4AAYA 2IZOA 3DEFA 4IZOA 1UBLS 2FXVA 4CG0A 5K05A 3V9AA 3DKRA 2JEYA 3DEWA 1QXSA 2WZBA 2OLKA 2QRNA 4KGDA 5CURA 4E08A 3FMSA 3LJKA 4D44A 2XQIA 3CT6A 1LSOA 3VKGA 4O3MA 5CVIA 1J0AA 3EGDB 1C9YA 1EGMB 3JQBC 4HLUC 4IEFB 4EUFA 2VJNA 1RM0A 1NG7A 1MNQA 4NFYA 3T3OA 2ELJA 1SU8A 2XCIA 5I45A 2H0AA 3ELWA 1L5RA 4AK9A 3CZQA 3SI7A 1UJNA 5FI0B 4EW6A 3FOBA 4F6RB 2HEGA 2QLZA 1RVV1 4BLUA 1Z1DA 3HABA 2BGCA 4YRTA 1TFRA 2OFFA 2Y6VA 3THXB 1JKFA 2VCEA 2I1WA 2RIRA 2J6HA 3KHKA 4P3XA 1OWMA 2O59A 1LRKA 4QWMA 4Z49A 4M9XA 1CT9A 2RNGA 1SA0B 1L4MA 2XMCA 3IRRA 3DAFA 3JVUA 4LMBA 5F21A 2OUMA 1IMOA 2GFIA 4D3DA 1M8FA 1DIHA 1RMYA 1FUUA 4IO0A 4MWZA 1R49A 1FFGA 2FWNA 4MEBA 5AM4A 1RRCA 2ZXUA 4YRMA 1WP9A 5AWFC 1T56A 5BOSB 2PZMA 1P81A 4XGIA 4B84A 2D2XA 1ISPA 5DGDA 3PUHA 3N8GA 1ZARA 1OR7C 5FKLA 1ZZEA 1LPAB 4M1TA 4XTRA 4ZCRA 5CD9A 1ODJA 3DOEA 1XGOA 3IS3A 3K35A 4YRDA 421PA 2OBFA 4H2DA 2ZIFA 4M1MA 1MENA 1QO0D 1TAQA 5JE8A 4TLAA 3KE2A 2J0UB 2KBFA 5ALKA 1NJ5A 4PNZA 3TDKA 3GG9A 4WECA 3EDRA 1JEYA 3JD0A 1ST3A 4PJMA 2R44A 3I04M 4F9TA 4NZMA 2DPXA 4J0GA 2FMLA 3D3JA 1FP1D 4FNAA 3EBLA 4GRAA 4RKFA 4HDNA 3HPGA 3PUBA 4EM1A 3CCSI 1DBPA 1JLSA 1K9SA 2VT3A 4AZ3B 1X7YB 5AVSA 3TF5A 5M5XJ 3GRFA 3D5SC 4KRFA 1YR3A 3LUHA 3PKJA 3RIMA 4WLFA 1Z17A 3O9ZA 5DLPA 4CMCA 5GIOE 2RD2A 3LPCA 2X5NA 1OA0A 5K5RA 1GVHA 1T98A 2H07A 4D9NA 1FS4A 4KR2A 2QMZA 1PFVA 3H2JA 1V9SA 3WQBA 5K3SA 4L95C 1RXEA 4I19A 1XDDA 1YWGO 3I05A 2I65A 4D92A 1DDOA 4TQGA 3IT0A 1T15A 1NRXA 2FGJA 4S1NA 5JPCA 2A0WA 2ZANA 4F04A 2IOYA 1H89C 1L1RA 1OBFO 2P91A 3OQPA 2WJIA 1UDBA 2OD5A 1W0UA 1KFCB 2H2FA 2OGSA 2PZBA 3CF5F 2VA9A 2X5KO 4EGFA 3M4JA 5CLFA 4DIBA 3C3CA 4HX4A 3PEVA 5I01A 1SU6A 4BRWA 4LTNA 3EDPA 4KAAA 3SX2A 5KVSA 1U9YA 1HORA 1HYBA 1E4OA 2AOUA 3ZVNA 3LP6A 2QX6A 1UQRA 2Y8EA 3VMFA 3SHVA 2B94A 1UPFA 5KTSA 3FPEA 1U7ZA 1Y82A 3V8PA 3NP7A 3UF0A 3L6UA 2OBLA 4Y52J 4RTLA 2K02A 1K4YA 4U7PB 4OAOA 2HOSA 1S2NA 3O9MA 4K3VA 1DQRA 3VYUB 1VYVA 3QLVC 4HGNA 5TS2A 2BGLA 3B1ZA 1J7KA 1CZOA 1XX6A 1R23A 1C30B 2N1MA 2FU4A 1ESMA 3N8IA 3ML1A 3QRWA 1A31A 4HOBA 5F1JA 3GTJJ 4I5IA 3UT6A 3Q11A 3PD0A 1XZDA 2A9RA 1TLHB 4CMKA 1UP4A 2CQNA 3F1LA 4HLDA 4M1QA 1FUYB 3RIXA 4AZ3A 3OM1A 4XBFA 4JXXA 2BN4A 3PVSA 4FYJA 2JFZA 2Z6AA 1C50A 4U7FA 1TYDE 1XD7A 1W2GA 2ZRLA 3IAS6 3KD2A 3NHKA 3NOVA 3Q12A 5I4CA 2EV9A 5TMPA 4RQAA 1O8CA 1XCOA 4ESEA 4L08A 2IPOA 2GXQA 1ISHA 4R8HA 1B8UA 5K1YA 3OS0A 1NR1A 4FI3F 5KYWA 1S3SA 3F5QA 2IPNA 2EBFX 3AR2A 3W5UA 2YWFA 3L1JA 2W43A 1H2AS 4ZCLA 3OQIB 2XCSB 3K5PA 1SHKA 1IZZA 2JAHA 3TLAA 2JQ7A 1VKOA 1UC4B 4WCFC 3VKVA 4JGIA 3TEFA 3TTSA 4MS1A 1CUYA 4YP0A 5A71A 1L0BA 3U7IA 1S2MA 4CYDA 3F72A 1CFZA 1IEQA 3BDIA 2PX9A 5FOVA 3M3DA 2DUUA 2W5UA 3NTQA 1WULS 4FKBA 4IH9A 4Z9BA 4XLNF 1R8XA 1RYZA 5IJ9B 4EMBA 1IWPB 2PX4A 1AJEA 3C3MA 1F6DA 1XA0A 1ETUA 3KU4A 2OFOA 2JDIA 4LBVA 2PUHA 3BRWD 4PYMA 1PDOA 2HWWA 2JKYA 4YCLA 3CJNA 2QTWB 2V7GA 2VWGA 1XQXA 3VPDA 1WNTA 2GZAA 3FNIA 3OH8A 3NYQA 3QOYA 4Y6RA 5HE9A 5LLDA 4U88A 2MR5A 1D0ZA 1HQKA 2H8KA 2V3VA 2BGIA 3T0IA 5LVAA 4K03A 2BE9A 2DG2A 4BASA 4EPVA 4FE4A 4L9VA 2VYVA 1TRHA 3GL9A 1I5RA 3K1ZA 1IXRC 3OCJA 3PX3A 1ESDA 3OQJA 3C6KA 3FCUB 2E4ZA 2XDAA 4NOMA 5HM8A 4UV9A 2ERCA 1LJLA 2XNHA 3JS5A 3DGFC 3LUJA 4NG4A 3BR5A 5D4SA 1CEXA 3BGWA 2ZROA 3L8MA 4ZAXA 2MABA 3U3RA 4LZLA 3U09A 3LBFA 1HBXG 4E22A 9LDTA 2K9MA 4BBPA 3ORYA 2UYOA 1ZN7A 2H08A 4YIRX 1NXTA 4LWQA 4X7PA 1QYWA 3V7WA 1EFRD 3RTEA 2UUOA 3CX3A 3F6RA 1E89A 1U8UA 2HUPA 1G4HA 1LK0A 2QI9C 2X2FA 2YIDA 1QYDA 3TQOA 2NW6A 4EW1A 1RKQA 2OQRA 5HTKA 1DAFA 1OAAA 4EZBA 1G4AE 4MUXA 3NVMB 4U8HA 5J1RA 4URHA 3GCMA 3TW6A 4YMSA 2C78A 4MGKR 3T1VA 4DQ0A 4ETNA 1YS9A 2L18A 5GZ1A 2FSWA 2DPLA 2VTDA 2DQRA 4HS4A 4NCIA 2CQXA 3S2DJ 1Q74A 1DPUA 1XF1A 2PQ6A 1S5LC 4PTYA 2YINC 2VQCA 3KT6A 1P9OA 4I8XA 5E1ZB 1O7FA 4K9NA 2DKFA 2Q2EA 2H94A 1KC3A 2QZJA 3DE2X 2V7BA 4HUQA 1W34A 3N2EA 1VQ1A 5JECA 2FUEA 5D5XB 1JQDA 2XRMA 4MVJF 3QTTA 1JX6A 2EKDA 3QVSA 4XLCA 4Q82A 3ZHQA 2QAIA 3H8JA 4PXSA 5CNJA 2IKSA 2J48A 2QGFA 1L5GB 3ZG6A 5A5DA 3A9VA 1P5ZB 3FSEA 2JHPA 3O91A 4CIDA 4ANJA 1R0RE 4RV4A 4RO0A 5AI0A 1O57A 1UAYA 1PL6A 1XVVA 3R3WA 3DE0X 4ZYLA 3O4FA 4U7HA 4AY5A 3MD2A 3JRBA 4L6IA 3Q0TA 1SHLA 4REOA 4DC1A 1P0CA 4IVNA 1PR4A 3OPMA 3R23A 3ZNNA 4JK1X 3HXLA 2VK1A 5FFMA 5KSWB 4LV6A 4GEKA 4HW0A 4QPNA 1LJ9A 1AU7A 3LUGA 3AM4A 1QIGA 1PWHA 1U0TA 1TF2A 2PH7A 4J6EA 4RF5A 3SYNA 3JYQA 2OTLI 4HLQB 3T0YA 3QYPA 5EJAA 3BA1A 4AF7A 2WUGA 3FUWA 3KAKA 1B14A 2BHYA 3AR5A 2FEKA 2J4CA 3H7AA 3STYA 1G16A 4DEXA 5JMWA 1FMLA 3ICQB 2JHAA 1QCYA 4J4BA 4OQMA 5AVVA 2YQ5A 3H2SA 2TSYB 2VYVD 1R16A 1VI6A 3DMHA 1FJ2A 2ZRIA 4XCXA 2JASA 2W6NA 2OAZA 4U2GA 1KVUA 4E5PA 2IYOA 2UVDA 4GECA 4FKZA 1B3BA 2XE8A 2O3UA 1GZ3A 3WIEA 1H05A 4R0MA 1OAOA 1KA8A 3RRZA 3EHDA 1CZHA 3WVNA 1FDOA 4XLFA 4PCVA 4IMRA 5FAXA 2RMKA 1CRQA 5K3BA 1SXJB 3JRAA 1CS4C 2ZM6B 3TOCA 4Q02A 4ALIA 1NQ5A 3BC8A 3SF8A 4CTOA 4KWHA 4NL4H 1ON1A 1Y1VJ 1HYEA 2UYGA 5EIWA 3C4QA 2PZFA 4G1UC 4M6VA 3SICE 5JCZA 5A0TA 1PAUA 5A2QK 1F4PA 4ZZDA 3H1TA 1GLGA 3IDAA 4UM7A 5HODA 3JQQA 3PCTA 1Y34E 3DULA 3KXPA 3L01A 4M76B 3MB8A 5EXSA 3ZR4B 3A9WA 1Y0UA 1KMIY 3AESA 4Y2RA 3OOUA 1D4OA 3KYLA 3VEPA 1WLSA 2HLNA 4UCXA 4H4DA 3SNKA 4AYTA 1ZK1A 3DZDA 5CTJA 1EJ6A 3GEZA 3FFXA 3SQOA 1EB9A 1JXOA 1ZGWA 1UZUA 5M29A 2AXLA 3KXKA 2W7NA 3D6AA 4JNCA 1W36B 3FM3A 1W5CC 1N6NA 1FB5A 5ALMA 5IWAB 1IDOA 2VQ6A 3OU2A 4ESHA 1T9KA 2UXXA 1P17A 5K3CA 4EFDA 1AMNA 5EP4A 5ER6A 3AR4A 5IP7J 1GFSA 4HLCA 4W82A 3E4CA 5TF4A 4MUKA 1L5FA 1S1CA 3TZHA 4NMXB 3NBUA 4Q37A 2XMGA 3IKJA 2LDUA 2WC1A 2OBPA 3I6ZA 4UUNA 4N6NA 3FG9A 5ELMA 1G5RA 4S0HB 3JAKA 4V0OA 1BWQA 1U28C 5IDYA 3ZE0B 1Q14A 4C21A 2H1LA 5BPIA 5CDHA 1NBOA 3NWJA 4YI3A 3BT9A 2UUZA 4ZQIA 2G04A 3B1YA 3GH3A 3NV7A 1G3WA 1W59A 3F98A 3H1AA 4TT8A 5ALSA 3VGPA 3W5DA 2IHJA 1JPJA 1WU7A 3ICOA 1GO2A 4PPYA 2PJRA 2TECE 5TPWB 2WUFA 2XXJA 4WJZA 3SOZA 1MZBA 2LNBA 3W4JA 4YG2F 4EKNB 5FTKA 4J7XA 2CYBA 3EDYA 3MUOA 2A07F 4NCHA 2G9UA 3JQDA 4X90A 1XIVA 3U9GA 4GM1A 3O93A 1B6SA 2JRTA 1ZU5A 2W4QA 3OYNA 5L3GA 5TJ9A 2I33A 5LEKA 4BP8A 3MSXA 2EIXA 2JLCA 1URPA 3AESB 2ONZA 2EHDA 2QD1A 2XHEA 3HJCA 3GZTB 3I1IA 3SYRA 4QU9A 2HEOA 3QP9A 5AJTA 1MG5A 4DLBA 1XGMA 1LC0A 3KZVA 5ALFA 3R7FA 5LP6A 2BE5F 1JHMA 2AMJA 3B1JA 2AFRA 4AYXA 3LVQE 1WDWB 1T5OA 3I1FA 3QWHA 4M0FA 4KQMA 1UBMS 1W9MA 4ZALA 3PUWA 3DU6A 4NEGA 2GOXB 2O7SA 3FUUA 1C8BA 1WQ4A 3ZQ7A 2COEA 2PA0A 2VZ8A 4JVOA 3BCBA 1KSFX 4PLWA 4A23A 4UUOA 1Z0JA 3B2EA 2XOKD 3IOCA 3RYFB 4D97A 4BKQA 1UWKA 1YI8A 4JL5A 5A04A 4LDNA 4QE3A 2BD0A 3K6SA 2ZRJA 2ZAIA 1NP7A 4FFMA 2HKXA 3MZ0A 4K2EA 2FYTA 1GILA 5AT1A 3BWGA 2ZSDA 2QP3A 3EG9A 3OPXA 4RY2A 3RWOA 3CCMI 4E5UA 3HJBA 5ELLA 1U3GA 2HJRA 1SKYE 3DZ8A 3EQ7A 1P2SA 1ORIA 3ORQA 4KQEA 4YDRA 5HF9A 3LXMA 3LSTA 1MRNA 3NM5A 3OTWA 2D59A 4WIAA 4WKBA 3KKOA 3K7EA 4WKGA 1TQDA 2XYHA 3ZD9A 2JF0A 1CEEA 4LVUA 4NZ9A 2BONA 1C8LA 1ZJ6A 2GK6A 2P3SA 2YN4A 3EGXA 1C80A 3I83A 1FLVA 4ZVOA 2W2LD 3RYFA 5AKGA 1R8SA 2EZKA 2J5XA 2I3DA 1I3AA 4KX5A 3BHIA 2MSWA 1IO2A 3FYTA 3GXOA 1C0WA 3GTOJ 3P96A 3MKLA 3FB1A 2CRGA 1MB4A 1PQYA 2FG6C 5BW8A 2F5FA 4DGQA 1U9IC 3RKQA 5JHGB 1U2DC 2FA5A 4YACA 5BUCA 2YWCA 4LQ4A 3UAYA 4QHTA 3WLMA 3KDPA 1H0KA 2G7UA 5LA6B 2MA3A 4P4GA 2NUTB 4KKVA 5ICMA 3AG2H 3OYDA 3F90A 2F62A 4G6QA 4ACAA 2C29D 4XONA 2PUBA 3ZDRA 3PWKA 1T39A 2WD7A 1OB5A 1ZKGA 5B7GA 2W0MA 1UMQA 5FYDA 3DPLC 4D1QA 2F55A 4J1NA 3KPJA 1XAJA 1UANA 3LSPA 3LA2A 2H7XA 3GCGA 4YP6A 5EWMB 5KYYB 1ABFA 1X4PA 3GAZA 5F52A 3HTSB 2IS1A 3EEIA 1W7PD 5H5JA 3VB2A 1OLSA 2OD7A 2XGOA 2ZBDA 3TB6A 4U6QA 4DF3A 1ZOLA 2VI6A 5KB3A 3IR5A 3FHZA 1RM3A 3LKBA 3ZQHA 4I1UA 4W99A 5HKLA 4DDVA 3MWJA 1UEIA 5BWBA 3W7AA 1SO8A 4Y2VA 4WACA 2E2WA 4U0JA 3ZGNA 1BI2A 2YJ4A 1XS9A 1FBNA 1UC8A 1E66A 3G6EI 1N2CB 2NO9A 3FPKA 2Q1UA 3IAUA 3MXTA 2X42A 4WGFA 5TT1A 2J9FA 2Q7DA 1JTFA 4AIKA 1E61A 3KZIC 4R40A 2ZYUX 5CA1F 1XVIA 1HT0A 2XA2A 3HKDB 4CG3A 3FPJA 2XAHA 3HMQA 3AEKB 3KJIA 2R7SA 4PHGA 3P97A 1T36B 4WZAB 1IVSA 4FI3C 2ZQ5A 3CUQA 2A5YB 4I1YA 3N3BC 4JVNA 3KTDA 1P1RA 1IC6A 5BR4A 1U5CA 3RCOA 1FUEA 5CX4A 1KO1A 4JR2A 1HZZC 2QYTA 3VJLA 1O89A 4CQJA 4LYYA 4UUTA 4QVKA 1JFVA 1QK4A 2Q21A 3K53A 3LLCA 3Q72A 3A1SA 1XELA 2WEKA 4BE1A 2Q9BA 2ME6A 2ZIWB 2RGAA 3BZKA 4M2LA 3O90A 1UZLA 1DCMA 2VZ9A 3T1YB 4NYMQ 1DZIA 2IV3A 2MMCA 4ZT5A 1QFZA 3COVA 3GR6A 3HKDA 2WJPA 2FMIA 3OY7A 1EH7A 2L01A 4WV3A 5AHXA 2FQ4A 4JB3A 4EEKA 2I6TA 4BLSA 4IX9A 4KAJA 1SCUB 4Q3EA 4UAGA 4AROA 3J7AC 1XLTC 2BW0A 1ZM9A 1TADA 1VQMI 2FSIA 3PDJA 3FWYA 4EX6A 4G4GA 1ZCFA 3W5IA 1TCVA 5F76A 4HAIA 3O74A 2QTRA 1VCOA 1NZDA 4HTAA 4UBKA 3WRXC 2ZGVA 4I4CA 2AG0A 1ULTA 2H1KA 2G4CA 3CRZA 4LSGA 1C3OA 1JHZA 3LWBA 3LQQA 4DMMA 3V7FA 1UT5A 5D5HA 4FU0A 2PUAA 3F7NA 3OF5A 1VJRA 2XGXA 1R4MB 1LSSA 2IEDA 1B59A 2OV8A 3E0XA 4OUDA 1M6NA 4H15A 2OZ6A 1E3PA 1YR1A 2WY8Q 1AK1A 3IILA 3L93A 3A4IA 3AOEC 2PO5A 3BORA 2F3SA 4HP8A 2KPOA 1U81A 2FAXA 2BGRA 5E1OA 2R8BA 4UY8I 1BMFA 2BY4A 4BMNA 2VI5A 5K7ZA 3GP3A 4QBTA 3TLXA 3M5WA 4KOEC 4PINA 1QQ5A 2GEBA 2WWGA 4JMPA 5ABPA 4XEHA 5ALRA 2ZU0C 5C35A 4CWAA 3Q5EA 3EVAA 2WQZA 2CUKA 4R1UA 1TQIA 2DFDA 4KQ6A 3NOXA 1KU2A 4HEQA 3ERMA 1Z7WA 4PC3A 4DRXA 1VB5A 2K87A 3GJYA 4HF2A 1IBMB 2VZLA 2QM3A 4ZDPA 1JDTA 1TZJA 3G9TA 3JQAB 3NS7A 1KSGA 3X1KA 3ND9A 4HDKB 2CVFA 2LDXA 1AKUA 3A0BC 3HA3A 4GUAA 3AEUB 1MJBA 1OFGA 2GN9A 2W6MA 3Q1KA 2RCNA 4TVBA 4KXMA 3TN7A 2P5KA 3WIBA 4ER7A 5K0FA 3IOYA 2IKQA 2IS6A 4P7BA 5CFNA 1XTBA 1BEZA 1NXPA 1RQ2A 3O8QB 3FVTA 3OSZA 5FO1A 1ECFA 1R74A 1AS0A 3WGUA 4E5DA 2K2QB 5IZ4A 4PONA 1PD0A 3HU2A 1KI9A 2IUTA 1NX6A 3FCSB 3KQSA 5BVHB 2ZT7A 3TLYA 3JQEA 4HUQB 4IHAA 3OCCA 1P4JA 4MKHA 2XXAB 1SEUA 2GZRA 4CLRB 3BR1A 1SXJD 3RHFA 3K30A 3EVDA 3V4ZA 5ILOA 2HPAA 4AJ4A 3JAMA 2P8SA 3BJIC 1D5VA 4M9UA 5EMLA 1E1MA 4JX8A 5EMMA 4C5CA 5I51A 1ZRMA 2BVNA 2FP3A 4MB6A 5ALDA 2UZ1B 5EERA 1P9WA 2P4HX 2F5CA 4L74A 4BLTA 2YRXA 5LOVB 1RFLA 4MV8A 3UYLA 3RIHA 3D3WB 4F5ZA 3P9ZA 1MUUA 1E18A 5GADJ 2MGQA 2Y1XA 2DQSA 4I1SA 4PG7A 3DPUA 2PS9A 3HOZJ 1YFLA 3SFTA 2J6CA 2HNBA 4HWSA 2C1XA 3ZWKA 2YXLA 2WRZA 4R98A 1OTHA 1L7QA 1NIPA 4X8OA 4ON0A 3GUZA 5FNVF 2NP6A 4CKBB 3AV0B 4IDNA 1TEHA 2AHOA 4BJTA 4GEGA 4GYJA 4OYHA 3FNQA 5SZJA 1EGHA 2R6JA 5JEEA 4R8KA 1H2WA 1C0EA 4L9TA 3TW4A 4O4IB 1BTOA 5LGNA 1LRLA 5FOXA 4B87A 2JLSA 1JR3D 5EJCA 2R00A 4DM7A 1UBKS 1GUUA 2QVYX 1G9XA 2DFFA 1DV1A 3BKXA 3H65A 3QJYA 3L79A 4NFLA 4DWWA 4EJ0A 4FT2A 4JUDX 3R3YA 5JNTA 1G1AA 2GJ9A 2IOHA 3QWFA 4HB2A 5ALVA 5HJ7A 2BGTA 2AVNA 2W2PA 1A4RA 3LF2A 1QBJA 1BJRE 4LGCA 3RW9A 2XVCA 1N2SA 1WB4A 2A9OA 5CH3A 5FL3A 4RAOA 2H7VA 1JA9A 2TMKA 3B85A 4EH1A 3QE4A 2BELA 1ZXXA 1Q11A 1T4GA 3R0XA 5DM6F 1R6DA 1ISRA 3BLYA 4LLGF 2B8EA 2G0TA 3QPUA 2ATEA 1MBHA 1K88A 3EBPA 3TZKA 3O6BB 3HSSA 2YW9A 4LJKA 4RAYA 4U6SA 1Q0UA 3RIRA 1VZ0A 1T08B 2XAUA 1JYEA 1QC5B 1XPXA 3CNBA 3JQ9A 4XDGA 3U7EB 4MLOA 2PD3A 5CA0F 1E9CA 3A1TA 3ESXA 4JVMA 3NKLA 5I7FA 2DHDA 2G9QA 3N5KA 1ZINA 2BISA 3DHVA 4WCVA 4AZVA 3GK3A 3E27A 4FFPA 2AF4C 2WD9A 1T9GR 1JKJB 3FYUA 3CLTC 3OEHD 5ED0A 2X58A 2XYPA 5JZBA 3G02A 4YJ3B 4BKRA 1C0LA 4NV1A 5HNFA 2ISYA 2C4MA 1UOPA 3F8FA 2D1VA 2MINA 3OT1A 4M86A 3HC7A 3QUBA 3I4MJ 4OKIA 5ERGB 2ZR0A 1MCZA 2G4LA 1S2LA 3CP2A 2HX1A 2N42A 2WABA 3SS8A 3V3KA 1JMKC 1TDJA 2TMGA 1GPDG 1YGPA 2CXTA 5NULA 3ZTYA 3AVPA 2J45A 2VUHB 4LZJA 3PWSA 4KU4A 1E1DA 2F3TA 4N7RA 4AURA 1QUFA 4U7WA 2FP4B 1PWXA 4BP3A 1DBSA 2JEOA 1O1YA 3VPFA 3KB1A 1IN5A 1TECE 2X3UA 6YASA 3TUZC 2VP3A 5BN1A 2M9MA 4HF1A 2HA3A 4QEKA 1DWPA 1RWXA 2HA5A 2ZJAA 1U78A 1EFKA 3AUYA 2BSQA 2QXTA 2VYNA 3VC7A 3IB3A 2PL1A 3S8MA 1HOMA 3Q5FA 1GZVA 4CIXA 2E71A 3A11A 1C3XA 1EFUA 2J3DA 3FBGA 4QYXA 2UXDB 2OBNA 2IQIA 2PX8A 4TMXA 2VOJA 1VHDA 2R97A 3TPCA 5K8TA 5FLMJ 1N36B 2OCDA 5J4YA 1LWOA 5JDCC 1JEAA 3MWGA 3DVLA 4MS4A 4OHCA 5F4BA 1YU6A 1PDNC 1NSFA 3W6NA 4EPTA 4IKPA 4MUHA 4C3OB 4HAYA 3ILXA 1CR1A 1ETQA 1WVRA 4RLHA 5CG1A 1YFJA 3EBOA 1E1RD 2WU0A 4XPIA 2VJCA 1VLHA 4DFDA 1LD3A 1LH0A 3VZQA 4GX5A 4ZJUA 4H59A 4MULA 3HEBA 2I54A 3HCWA 4NHOA 4UARA 1NOIA 3JVIA 5BUSA 1VP9A 3L84A 3K4BA 4U5XA 3MJVA 5D8KB 1XKLA 4FQ5A 3CDHA 3ZWCA 4LITA 1A4IA 3E05A 1LI5A 2CNKA 4IF6A 3MN1A 5IZCC 1IG7A 1Q15A 2X3YA 5EKDA 1VIVA 1MLDA 1PLKA 4E7LA 1DO8A 1FRVA 1U1GA 3OQ6A 3VFZA 3KEYA 2EFPA 3BMXA 1J42A 1XZPA 1ZJYA 3HQ4O 4P4SB 2ZC2A 1BDMA 1RJGA 1UBTS 1UM9A 1VFPA 3HN7A 2ZYHA 4QYSA 3RADC 2CJWB 1RXYA 3KLOA 4HFNA 2Q41A 5C8YB 5E2IA 4B3DA 2W57A 3CO5A 3O1JC 5F1RA 4A5MA 1DMRA 3WGGA 4MFEA 1MJ5A 3T5CA 1YTLA 1A5SB 1KI6A 3DLTA 4LMPA 3GYHX 4MJ3A 3I9JA 4ZRNA 4K6KA 4MUJA 2QMHA 3TNJA 4BFXA 3BFPA 3AVQA 5AMXA 3FSGA 4ZDWA 2VJDA 3S2HJ 2NYUA 4CM9A 4QTRA 4QUEA 5EVCA 2EAUA 3C1AA 4P0QB 5SZHB 1TZ2A 5LDGA 1ZJ5A 1GUYA 2NADA 1W25A 1R10A 1DIBA 5ERYA 4AG5A 2PX2A 4CLDA 4NC7A 3I55I 3B3GA 5IKEA 2OHIA 1ST2A 4GI5A 2XZPA 3FRJA 4ZYEA 4CE6A 3OIFA 3RKYA 1TUBB 4CCKA 4G81A 3MPUA 4Y6SA 4D56A 1QG6A 3ZE6A 3UAZA 4KHZA 4UASA 5C46F 3AVWA 3DCNA 2GFQA 4P96A 4PZUA 3A4YA 3LA3A 4EM2A 3UCEA 3L2WA 2ZSJA 1RYMA 3WRVA 2E1OA 3ECSA 5F5LA 1YS7A 5B7QA 1JR2A 1N8KA 1VE6A 5DM1A 1PFKA 5KHDA 3OYHA 2M32A 2O7RA 2UAGA 2SKCA 4HK4A 4KE7A 5JSUA 5DYMA 1G21B 2FEZA 5D00A 5DM60 1VFCA 4II7A 2JBAA 4O2AB 1QDLB 2BR4A 3ZNPA 3T8TA 2RV8A 3WLRA 2UXBB 4UAUA 3IPAA 4L73A 2FH5B 3B9PA 2BEKA 3L7LA 4KIWA 3QEMA 2HNHA 1R18A 4XYGA 4ZVTA 6CHYA 1ZD3A 3BGVA 1EFTA 4HWOA 5FPPA 5LYYA 4YJGA 3RWMB 4E94A 1Q3TA 5BMVA 5A0VA 2H4JA 1M0WA 4RDHA 4V1CA 3B20A 4FN4A 3DV0A 3S17J 3AHFA 1XPOA 5IVIA 3V1TC 4LJ9A 3B89A 1G6HA 3BOSA 2RKWA 4P38A 3RO7A 1W7PA 4J1TC 2IGOA 1GRVA 3QOEA 2RNJA 1R9GA 2GCGA 3OSUA 2ZRPA 4Q3NA 5E3JA 2H2WA 3B1FA 3LY7A 1J2XA 2H9YA 1QGZA 4WL0A 3EPZA 3WLKX 2PSHA 4EJFA 4TYWA 2BOLA 1O4XA 4RMJA 4ZN6A 5IANA 5E6RA 4W5NA 4EB6A 4ZMSA 5SZKB 4A0RA 4E6EA 3AERA 3DD1A 4RIGA 1GL3A 1QLJA 3DMTC 1X42A 2PMHA 2HMVA 1NBWB 4RQUA 2G7MC 4TTSA 3RUCA 1RWPA 5ALPA 4ZVLA 1HSTA 5D5UB 2D8AA 3MHPA 3QLUA 3DVRX 2OQ2A 4CCLA 1MNEA 2ETHA 1XDZA 3I5UA 3QBTA 1AMUA 4XWOA 1R3DA 1WJAA 1ZMOA 4ALNA 4ZGBA 1I33A 5K0SA 4DIDA 4RD1A 4PFJA 5G1PA 1A8HA 3TBFA 8AT1A 3W1WA 4P7FA 2H06A 3ZW9A 5BORA 2GT1A 4GMGA 2GX6A 3O4RA 3LXUX 4KPGA 4NU0A 3VPSA 2E55A 5F2NA 4R0VA 1POGA 3DTYA 4XIIA 1Z4QA 2WIBA 2C98A 1LQ1A 2DWUA 4NYIQ 5BWCA 4G23A 3K1AB 2NQ8A 2WAQA 2LF8A 3D0QA 4Y7NJ 1MX9A 2EGGA 2CYYA 3VSKA 1SZPA 2FPIB 2YV5A 2EFCB 4GICA 1JALA 3PXXA 4UFOA 1B74A 4UPVA 1E9EA 1NMYA 3ESWB 1I4EB 5CPRB 5KK1A 4BATA 1OR7A 1CZUA 4HBGA 4AZTA 4XE5A 1OIVA 5TJJA 2KLHA 2DKNA 4MKRA 4WVFA 1XEXA 2VJAA 2W82A 1BA2A 4OQEA 4NCJA 1Z8DA 4F2PA 4BWVA 2LK2A 4C30A 1OZGA 4IVQA 4EMTA 2J9XB 1RZ3A 1XA4A 2NPIA 3LW7A 4FQ8A 1IVYA 1Z75A 4G8CA 2IA1A 1Q50A 4G2TA 4HDAA 4RK5A 3G7UA 3LSGA 4PQFA 4G41A 3OY2A 4DR2B 2J9RA 3GLIB 1HGXA 3F0CA 1UJ8A 3L6OO 1NXOA 1XXHB 1L5HB 1ZAKA 5IFLA 5KNDH 4FFNA 1D1BA 4AS3A 4J2OA 1MO6A 2FETA 1E3LA 4JH0A 5DTIA 3VNAA 2IRWA 2Q7XA 2XVMA 4ZFNA 2D1HA 2WAOA 5CB4A 2JI9A 3AMVA 3JAKB 3D6TB 5I7WA 4FWIB 1D9ZA 2L9SA 3AVVA 1F6BA 3DE4X 5E9WA 1D1CA 1DT5A 2H9IA 4QFBA 2ATIA 1WCYA 1CQZA 3GD7A 3LI2A 3NAGA 2RGBA 1BJAA 1D1TA 3AOEA 5IF3A 5ICCA 2B69A 2O1SA 2OL4A 2BL4A 3DXFA 4BL0B 3OM0A 2HZDA 3PQ5A 3BHNA 4JENA 2ECFA 5FWDA 4ZYTA 2QB5A 3SSNA 1KPHA 2Q8KA 3FTFA 1H5NA 3DMDA 4C3VA 2ZJRF 3D5EA 1R4NA 2M1BA 3CPJB 1KTIA 1CY8A 2PNFA 2BWJA 1CVLA 1GNQA 2VSFA 4YK7A 1HQDA 2D3TA 1OPXA 4IYRA 4E07A 2F9FA 1B8NA 4EKIA 4ESVA 2G1KA 2RHOA 4IMPA 5TQ2B 1YK0A 4FDVA 1WUTA 4W5WA 1KPGA 5H02A 3VSCA 5DISB 1GITA 3Q0IA 1BMTA 3I34X 4U02A 2PS0A 1B9MA 1ZONA 3EQ9A 4B17A 4JR0A 4YRJA 1JIIA 1AKHA 3FMIA 2FPUA 2JANA 3BP8A 3D8SA 5L3QB 1WHTB 4JGBA 3A27A 1GYQA 3OOWA 3RROA 3CO0S 1SC4A 3LCJA 4NDAA 4XPIB 4G09A 5CDFA 2O7NA 4TN1A 1GFWA 1W2HA 2C04A 2FQ1A 1WMBA 2P5UA 4L0CA 3TBHA 5E6SB 1PJAA 2VUIB 1EJBA 4G1CA 4KIUA 3ZXIA 4A9AA 1L7RA 1F43A 1QIEA 2AJTA 2X1CA 4N4NB 4EL5A 1ZW1A 4DRZA 3T06B 2ZBKA 2R6HA 4MKGA 1M7GA 3I09A 4QICA 1U11A 3PVCA 4N82A 2VJLA 4C20A 2C2XA 4JHXA 2D5AA 5AVTA 4BHCA 3FAZA 3JPYA 3KZOA 4YMGA 5IWCA 1W73A 1P4WA 3K8QA 4IQ0A 4LDAA 4IDEA 3JRHA 3LNQA 5LYJA 5LZ4A 4CSWA 1L4KA 4YFNF 3QHAA 1T4CA 1YQQA 4KREA 4LV5B 4HNRA 3CMAI 2QRUA 4K5QA 1IOWA 4XPZA 5T8KC 3SVLA 3GTLJ 1GVDA 5F23A 3RYCB 3TIFA 4F93B 3GDGA 3O8CA 1XP5A 1WKCA 3ZCQA 4GO1A 2IUSA 2J41A 2J3LA 4JBIA 2JNWA 1RLUA 1X74A 1Z5ZA 2G1JA 3FCAA 1BFKA 1MBFA 1U2TA 2R68A 1QE0A 3IDZA 2C9MA 3KSMA 1I5ZA 2PFBA 1K6YA 3RSNA 2PZLA 3PGKA 4C43A 5AUOB 4I81A 5BQXA 1TO2E 2W7TA 3H17A 1IULA 4BCCA 1GNLA 1AA6A 3DTTA 1QZEA 3CD6I 1DX6A 2XR1A 3JYNA 3QUTA 4XFKA 5AI8A 1HM5A 3UMJA 2O3FA 2Q3CA 1P8JA 1TMGE 3JQAA 4KVFA 1UHSA 3FNHA 3BD8A 2VASA 2O8DA 2NS7A 2XCQA 2Z4TA 3GJ8A 3LPLA 5AJXA 2O8CA 3IL2A 1W6RA 1GAJA 1VRWA 3BD9A 4OXNA 5AKJA 5GAHJ 2A6HF 5L45A 5EMKA 5BPDA 1J70A 1OCEA 2PBLA 2AZDA 3QW2A 3UICA 4ZODA 2PYIA 4RYDA 3I6MA 1Z62A 2EGUA 4ZYYA 3WMFA 3CUVA 4FJ0A 3B7WA 3OURA 4J2HA 3IOMA 4HX2A 4D4HA 3IIIA 2VSQA 1Z6RA 2L82A 3ZXYA 5SYAA 1A04A 1F6WA 1ZK0A 5EIXA 5CLIA 1EMDA 5F7JA 5IPFA 2B78A 2XUAA 2I71A 3W2IA 1SIWA 1DEHA 1B7GO 3ETCA 1I14A 3ONDA 3VAAA 1EH6A 4OGFA 2C2ZA 2PG3A 5I8PA 5AOAA 5K0EA 3J80A 1PT9A 2R7TA 2IBMA 1DUSA 1NP6A 2HK8A 4OA8A 1H9CA 2WFMA 3JRDA 2YWGA 3CIFA 2GYYA 3DW1X 1H8AC 1H2YA 3BXXA 4IM7A 3AB8A 2A9KA 3FYHA 5LCXA 4O2BF 1PUEE 1H6CA 1JPNA 4UU0A 4G0WA 5DZSA 1FSHA 3UMBA 3K2BA 2QM0A 2IPLA 5ALEA 3ZE1B 4G4JA 4ZI3A 3IDSA 3WLLA 5LR6A 2BY2A 2FLVA 1O95D 3C5CA 3EWNA 4OQNA 4GC5A 2QL7A 4O4HF 3V8BA 5KCMA 2P35A 5KAFC 3ZGOA 4PC1A 4O08A 1E3JA 4B3SB 1N0HA 3ZE7A 2DA6A 3NRVA 1U5TA 4NOJA 4EZEA 4UUSA 1OZ0A 3ZI0A 1GZ4A 3GLIE 3V3TA 1OBOA 4P8RA 4WTOA 4HH1A 5FWXB 2Q9UA 1RD4A 3C5EA 3ABUA 2GN1A 1S96A 2A86A 3H4VA 4XGRA 2VG8A 1PJSA 3OIDA 1P4SA 2CK3D 4JP3A 5ULLA 2W22A 4YUZA 1OFHA 4GQBA 2QXYA 4LV8B 4LVOA 5CVTA 1HDIA 4KG7A 1WKVA 2UV1A 3K5IA 4EPXA 5J4HA 4Y2JA 2QUFA 3MOIA 4MO2A 2MMGA 2UZ3A 2Z9DA 3EB9A 2OO5C 4P4TA 2IY7A 3SHWA 1JA0A 3EC2A 1D5WA 1VZ2A 4S04A 2FN4A 4GMDA 1D6NA 1XOIA 5FFNA 4LF7B 1YL6A 1KDYA 3O3CA 3UV7A 1DOAA 1Q0LA 1E92A 2ICWG 3IT3A 4HQKA 3NEUA 5A3VA 1KO7A 2ET6A 3JQAD 5IDXA 4HATA 4IS2A 1SOVA 3CR7A 2OKGA 3CO7C 1OQYA 2QTFA 2YXNA 3QLTA 4Y6PA 4DLPA 1C4OA 3FZGA 1IF1A 4XK4A 3LK7A 4FYMA 3A25A 4ITUA 5H6QA 1GGEA 3RC9A 4AIIA 1MHTA 5JD4A 5CPBA 1FS5A 4UOEA 4EEFG 3OPYB 3BPVA 2ID7A 5F9HA 1G9TA 1UKYA 4J0CA 1X39A 4CF5A 1NW8A 1GEEA 4FLFA 4H3HB 4ODIA 1DXYA 3A02A 4B6SA 4OI4A 3FX3A 1PGNA 1YHNA 1YQGA 2AR7A 3ZN1A 2TYSB 3ABRB 4PSVA 4XQGA 2ISCA 4E3WA 5KX5F 3E5UA 2OXIA 4CZCA 3TO7A 4PYKA 1PWEA 4IILA 2O20A 4B9AA 5G02A 3LW8A 4MQMA 5KYXA 3UWOA 2CHUA 2ADFA 3JVDA 1FJLA 4HNQA 2M4KA 4FLEA 4X00A 3DVAA 3V7CA 4XICA 3GLKA 2YWXA 4N8EA 2IWRA 4EUHA 1T8SA 2RGWA 3EGIA 4BNFA 2JC3A 4Q21A 3K72B 3UKDA 3HB4X 2FCRA 2E4XA 1R12A 1QM5A 4PFKA 4DBZA 2IW5A 3H1EA 1G2IA 1YUNA 3FI0A 3R40A 4HDNB 2CNWD 4P3PA 2J08A 3T15A 4D99A 4QC2A 3HG9A 1U90A 3OJCA 4R9NA 3QU6A 3MT0A 3PC8A 3QPBA 4FPXA 4JVSB 4UUQA 3N76A 1IN4A 3WWOA 4QVIA 1MG0A 2E7WA 2O2ZA 3KEGA 4QEDA 1M7HA 3G6WA 1Q0QA 2AG8A 2E5WA 2HQ1A 4JL8A 1N9ZA 5ARDA 1EDBA 1CRZA 1UQUA 1YKSA 2JIZA 1IN8A 1OV4A 4LHEA 4R8LA 3WWCA 4L9SA 2O9LA 2FZKA 3B6MA 1ODDA 4ZDLA 2F3PA 4F71A 3HLTA 3IAXA 2XB8A 2HSGA 3IVCA 1WNFA 1XF9A 4KQFA 3GCZA 2IPMA 5AKXA 3Q7EA 1XJCA 1IRIA 1OPRA 1L3IA 4TV7A 1C14A 4H4CA 4F52A 1P4AA 4Q1FA 2IYAA 3KC2A 5BT9A 5KSZA 1LQTA 3NBQA 1VKNA 2IGTA 4HNAB 2AI3A 2PAFA 3JRFA 2XLBA 5CEEA 4HAOA 3PEYA 1IJWC 4ER0A 3LSJA 4LB5A 3D3QA 3PUIA 4RETA 3FBIB 4DPLA 4AD8A 2CKDA 4U7JA 5FA8A 3AF2A 3SWWA 3BKWA 3USCS 3S8YA 2G6BA 3QVVA 4FMPA 4R79A 2A1TS 2RARA 2CBXA 1ADFA 5IJWA 2JCVA 4C87A 4KN6A 2JJ7A 1GP2A 1SCQA 2B1GA 4OI2A 4P3YA 5C34B 3A2NA 5FI3A 2Z98A 3H84A 3IERA 4R2IA 4BX0A 3FOEC 3ZZTA 1BCSA 3EAQA 4JOQA 3GU3A 3RHTA 1NNEA 5E6RB 1UPUA 2N9UA 2Q4EA 4NS4A 3DAHA 2XF5A 3CCQI 3COAC 2Y1GA 3EWSA 2P78A 3PPYA 1TKAA 3G2KA 4Q9DA 1O87A 2ODPA 4RPLA 4F5WA 5HKKA 2IYWA 5LGUA 3QOPA 4BY7J 2BR3A 1PYVA 3OX3A 4M73A 1RMQA 1PJQA 1Z2NX 1PS0A 5FA6A 5AXDA 1PW5A 2ZBQA 4LQDA 1TCUA 2FX5A 1OLUA 3VZCA 2E34A 2VJBA 2ZJ5A 3PJGA 3M89A 5PGMA 2AJCA 3BE4A 1GTL1 1KI2A 1FTQA 2PLWA 4RD0A 1ODFA 5HIJA 3C6MA 1BDHA 3FRIA 1NNUA 1DAKA 2JD2A 2PL3A 4P6VF 1QONA 3B5EA 5HEKA 2NYXA 2XADA 3RS9A 3PQEA 4C4AA 3RVBA 1D5CA 3KAPA 1XTTA 3LT5A 1Y39A 1OWNA 3J7YJ 3BWEA 2HQ5A 3VTZA 2IS2A 5JSZA 1OCPA 2EFDB 4TTVA 3AETB 5JWRA 4OHFA 2BGGA 5BV8A 1F4KA 1AV7A 2OLEA 2XEXA 3E22A 3K9GA 3IQWA 4FR0A 3Q8WA 3K10A 1MEJA 3HACA 4FYPA 5EIFA 3ROPA 4ETWA 1TJYA 3I54A 2R8RA 2E7XA 1LI7A 2P2SA 4YQEA 4N3AA 4JBLA 4OSEA 5DYWA 3NVDA 2CNLA 3KQNA 3NJ4A 2R4GA 3IBFA 1R88A 1RAHA 1KVTA 3DCFA 3R5KA 4L4UA 3DXYA 2SHKA 3UAOA 3ES9A 2PRIA 4DR1B 4JHLA 5E4TA 1X86B 4G7ZF 3M6WA 1VIDA 1AXGA 2IIPA 4HGRA 2PX0A 5AW1A 3OZGA 2HB6A 2NPFA 5GVSA 1BROA 3LVFO 1JHUA 3ZX4A 3DXZA 4FEGA 1RBZA 3ON5A 3CNEA 4EYQA 4BJ6A 1C3OB 1NL3A 2P5YA 4YHHB 1J06A 4N3NA 4L76A 3QLVA 4NULA 1C2YA 5AKEA 3K4MA 3ANXA 4F3CA 4EA9A 4QRDA 1P6QA 4FHEA 4X1YA 5EIBC 3AG1H 1J07A 1MGPA 4MKIA 4RV5A 2KT0A 1ZRSA 4D4KA 3W5BA 1V54H 1UFOA 2BBWA 4Y3OA 1YJ9I 2GAAA 3DZKA 1HL3A 3T99A 3ONEA 3EZ9A 3ZLTA 1E2IA 1D4AA 2PWBA 1G19A 1NT4A 4P9NA 2Q2VA 4A2CA 3GLHE 3VR6A 3HVKA 5KVAA 1HFJA 4L9NA 5KTYA 1QHXA 4XUGB 1Z63A 4TKZA 1Y1KE 3TSCA 4DTCA 3TD9A 1TX4B 3C14C 3OZEA 1SXJE 3NHWA 4PZYA 2BEWB 3VPHA 3LK6A 2BHSA 3FWPA 3SR0A 3R76A 1DG3A 2DT8A 1UPAA 2ZG6A 3HLYA 4H1VA 3ZC3A 4J3FA 4Y6QA 1FDTA 1BE0A 4KVAA 1C8VB 1S2GA 1A98A 1W29A 1R4NB 2VC0A 3AC0A 3EIWA 3L8DA 5K7HA 3PR2B 3LFKA 3RFCA 3FDZA 3MWKA 2QLLA 1SZDA 1YR6A 5FV7A 1W47A 4YRPA 1XQYA 4NBLA 1GCAA 3B3FA 4UUMA 1ULAA 2OORC 4XGQA 3WHCA 3PU6A 5J9FA 3DBVO 2Z58A 1L7EA 4BWFB 2C61A 3UNGC 4U63A 4EVRA 4XOIA 2HA4A 4RPIA 1JQBA 2B63J 1LBIA 1N6IA 3AO0B 3I2JA 3OTIA 4FQ7A 1HV8A 1IY8A 2JWTA 5TF0A 2F8SA 4FYWA 2HR3A 1TU3A 4Y2QA 1P5FA 1DJNA 1RQLA 3KPYA 5L3QA 3C3XA 3UZUA 1EQUA 1O5IA 3X1XA 2O8FB 1YGYA 1WEHA 2GHQA 2R7XA 2W70A 4H18A 5AKHA 4ZVKA 1ULSA 3MF4A 1UXOA 1BU5A 1YSCA 3LBIA 3CVVA 2WVHA 1EYZA 2CXHA 2ISSD 2X4IA 1WXGA 2EA4A 3WWYA 1EWKA 3DDWA 3LX4A 3ZQFA 1Z0SA 5CNKA 1IWOA 1GUFA 1L5KA 1JHPA 4C5BA 3WB9A 2A0XA 2O2XA 3F5FA 1RYBA 3NAMA 3DUFA 3CZPA 2NS8A 4IGIA 1C9EA 1JMVA 4CEIA 3DYBA 2WK1A 1DAEA 4D80A 4FB5A 4C4ZA 1VQ6I 3CKYA 3DTEA 4MS1B 3KYDB 1HOTA 4O8CA 4L2IA 2OD9A 1FU7A 4X95A 1GCGA 1ZA2A 3KLBA 3ABZA 3KPWA 1JDBB 5E9AA 4HRXA 2XVAA 1TZMA 5JYBA 3BGOS 1K8RA 2BP7A 5AHOA 4QJIA 5D87A 1V1JA 5TGTA 4JJKA 1EM6A 4PYQA 3V42A 2D00A 3Q88A 4HMOA 5C7LO 1NVWQ 2NXCA 2YRWA 2AQIA 3OBIA 2K5UA 1P0PA 2ZPTX 4CYMA 1M8JA 3JW8A 3KZMA 4B45A 1SFEA 4AVPA 3F6YA 1JT2A 1OV6A 2GPWA 2B8NA 1LJ8A 2Q3BA 4O2AA 4KT5C 3C5VA 4DUGA 1RZRA 4WDQA 1VE3A 1PFGA 2QRGA 3FDXA 1QO7A 1HI9A 4P33A 4QPQA 3FYCA 3K0AA 1B72A 1DBVO 4OUDB 2AQFA 3JWPA 4B8YA 1EVQA 3FVWA 3R5HA 4QOIA 5BQPA 1BC7C 3QUQA 3FXOA 3CCLI 1RAGA 1YE3A 1H0RA 1OX5A 1SM4A 4FYVA 5CIWA 5EIHA 2GVZC 1XRLA 3QMPA 1AT1A 5JD6A 4ALMA 4QHYA 1IDN1 1F0KA 2YVQA 3QKTA 1G66A 2Y0DA 3M1CA 5BMOA 5GADl 3ZGXA 5LMNB 2VZ0A 3TZQA 1KQ0A 5IH3A 4XWYA 3ZHZA 2QU8A 3R5FA 4F5EA 2XIGA 3N05A 2VXBA 1K79A 3B8HA 2CE2X 5F7XA 4YJ2A 1K68A 1D07A 1CQIA 1SD2A 2CXSA 2QRKA 4IVPA 2HT6A 3ZQUA 4KXLA 4A93J 2WWFA 5DCWA 3CH7A 4OU0A 4AJIA 4BLVA 1OGJA 3IP8A 4GR9A 3REOA 4L27A 4R1QA 1U1FA 2ZYAA 3TJRA 4IGEA 4HDOB 3AP1A 2AFHE 3C7DB 4U7BA 3PJEA 5D6OA 1ACJA 1LLUA 3WGJA 3PK0A 4OIRF 1IOLA 1KARA 2EZ8A 2XB0X 3EF0A 3OTOB 5INTA 2GPBA 4URWR 4Z8XA 3V48A 2XNDD 1WCMJ 1HDRA 3NATA 3NWBA 4L22A 1Y6QA 1BHJA 1NLFA 3F4KA 4ED9A 4KO3S 1N9GB 3MCTA 4D9IA 2NUPB 2DFTA 1ZK8A 3I8XA 5KOHB 1DSSG 3S1QJ 2XSZA 1JH8A 2ZT6A 3MZ8A