1SE7A

Solution structure of the e. coli bacteriophage p1 encoded hot protein: a homologue of the theta subunit of e. coli dna polymerase iii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
MYDWNIAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQLSLQLPKGSDPAYQKDDAVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phage Like It HOT: Solution Structure of the Bacteriophage P1-Encoded HOT Protein, a Homolog of the theta Subunit of E. coli DNA Polymerase III
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Transferase
molecule keywords HOMOLOGUE OF THE THETA SUBUNIT OF DNA POLYMERASE III
total genus 18
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 1se7A00
1DU2A 2XY8B 2AE9A 1SE7A 2AXDS 2IDOB
chains in the Genus database with same CATH superfamily
1W09A 1S94A 3Q2MA 4L9IA 2LRLA 2PBIA 4IE0A 5AQIB 1BR4A 1YQ4A 2J62A 2XTLA 4IE6A 5KMGP 4DV3T 2YDSA 4GIWA 4JYAT 2A72A 4GK0E 2NWBA 5HEUA 1J5WA 2LSJA 2V6XA 2XAQB 4OYJA 4LF6T 4IE7A 3QB5A 4L0RA 4MFRA 4QH1A 4CQIA 5F3JA 5JH7E 4UV8B 1OEDC 5LJNA 4O4IE 4AI6A 4JEHB 4ZZBA 4HWFA 3ZEFB 4DR4T 2LSGA 2KWHA 2C0SA 2NW7A 2NR4A 2X0YA 3KBUA 5LA6E 3CK6A 4EYUA 2F4VT 1D0ZA 2BKOA 3HKCE 2AE9A 3HKDE 3NZPA 2NTXA 4YJ2E 1U4QA 4LF4T 2CLYB 2ES0A 4I0UA 1BR1A 5LGNB 3F31A 3LFMA 2BZBA 5LHIB 2WDRA 2MPKA 2E9XD 3ANWA 3SWHA 4PK6A 4LF8T 5FKYA 2RPAA 2BS4A 1WFDA 5FVKA 2WU5A 1ZV4X 2BG9E 3LDQB 4TWFA 5AQRB 4CXWA 1O3XA 2Z6EA 4EV6A 1OEDA 2YKSA 4H9OC 2XJ7A 3AE4A 3PJAA 3ZT6A 4ANJA 2RP4A 1UX4A 1UX5A 3ZLIA 4EEDA 2LM2A 3PV0F 4CI3B 5FMNA 5HCMA 3AEEA 4KBMB 3AA1B 4JI0T 3HL6A 4PJMA 1T7SA 2A3DA 4YJ3E 3UT5E 3MJXA 5LHGB 2BDEA 4AKLA 3CQCB 5AQFB 4O8SA 3SRZA 4ZI2C 2ACXA 2LE8A 2X9HA 2EHOA 2PG8A 3AB3B 2DLRA 2JQHA 2W0GA 1NWMX 3LK2B 3N9OA 1R8IA 4OYKA 4CXXA 4ZI3C 4F6RC 2Y48B 2K24A 1I94T 4JLEA 4K0UA 3L3PA 4O4HE 1FMWA 2VB6A 2XQ9A 1FEWA 2XQ6A 3I0OA 3K8PC 2CM0A 3RHWA 3ZYLA 4LFAT 4UEMA 3FZFB 2FBWA 3EHZA 5ETWA 4LF9T 4BJMA 3R6NA 5A1LA 4GYRA 3RPUA 1IBLT 4U74A 4QXBB 3MZKB 1NAFA 2XPKA 2Y8DA 4MHCA 3UUXB 3NVOA 3X1DA 4GYSA 4X62T 4ADZA 2VVSA 2BBJA 2LJLA 2CHNA 3ONLC 5DJQC 4AQFA 3AEAA 2WAUA 3AXJA 3LJCA 4PAGA 5JDMA 4BJNA 1WRDA 2YEVC 3L8RA 1E2AA 1XDOA 4QH5A 4H9PC 2NTYA 1ZHCA 2CE7A 3L09A 5J1GA 2CXDA 4OK0A 1AJ3A 4QH4A 4A56A 3K1SA 3UTKA 5CJ5A 3WAJA 4KHZF 4ZI3D 4ASKA 3NZQA 1LVFA 2NOXA 3UFGA 4BA9A 1YW0A 2XHEB 4HFIA 5F5WA 4DNDA 1DU2A 2WWUA 3DP7A 1XMOT 4ILUA 1G8XA 2DI4A 4IDPA 1UGOA 5CA0E 4ZHQE 4P0AA 1N32T 2BVLA 5JRCA 4ZI2D 4DUYT 3KVBA 3C4ZA 4TWHA 3T8OA 4HFBA 3FXEB 2V8SV 5JVDE 4X1KE 1J1JA 3M65A 3QOFA 4Z90A 3U78A 3C64A 3ABVA 4Z91A 3I0QA 1LVKA 2ZMAA 3ZYMA 5HEJA 3Q9DA 4IL4A 4ISTA 1M62A 2X9XA 3K3NA 2UXXB 2UXNB 2LKGA 2BG9B 2CPTA 2IHR1 3HA4A 3LBXB 3NKZA 5AQJB 3EAMA 4PW8A 4DV5T 4EAHA 4E7SA 4DV1T 4EEBA 3M3ZB 3P4WA 4KUMB 5LMUT 1XZYA 4U72A 1HX1B 5AQGB 1YKHB 1VRBA 2JRKA 4MBQA 2MAWA 1IBKT 4DV6T 2V7JA 3EDVA 1KK7A 3KDSE 4P0BA 1QLBA 5DABA 3RC3A 3O1IA 2X51A 2JMHA 2VVNA 2BS2A 2DL1A 2YINA 4IT4A 4KP3C 4YTMA 5HWYA 5LBMA 2JPFA 5LOVE 2XASB 3Q5XA 2N9DA 3Q5EA 3AEDA 4OHFA 2P9BA 3IBPA 2WB5A 2CLYC 1MNEA 2DHRA 2VKDA 4DV2T 4LFBT 4CXYA 4HWDA 5HXHA 2WP9A 3RIFA 3ZCJA 2XSAA 2UXCT 4UR9A 3AE3A 3CQGB 5BMVE 1Z8UA 1L0VA 3AAEB 3N9MA 4G63A 1H7CA 3PUQA 1IBMT 3RRWA 5IUXA 4B3RT 2CMRA 2VWAA 3OBVE 1N34T 3UUMA 2VKHA 1D0YA 1KNPA 1YKEB 5JDNA 4FI5A 5CFBA 1WR6A 2X0HA 3J7Yq 3GN5B 1VCTA 3ZN0B 1VOMA 2KNDA 2W61A 4DUZT 1MIWA 2CWYA 2J4GA 4TUYE 1OEDE 3KFWX 1MMGA 1HR0T 2ACZA 4MALA 2B1EA 4DR2T 3UU5A 1ZKEA 2FJDA 3GN5A 3PDYA 4HFHA 3F2EA 4UELA 3TKLB 3KV5A 3ONJA 5L4HA 3RYHE 4YSZA 2E9XB 2I6HA 3AAAB 5FXXA 5HXRA 1ZP0A 2WMOA 2KINB 3KV9A 4I43B 2WWVA 3FZLB 5LP6E 3PUSA 2C5JA 4YSYA 5JRCB 3KINB 1U5PA 1IJ5A 2WDVA 3BK9A 4JI2T 4DR6T 2HHHT 1HCIA 3ZN1B 2BG9C 2BKPA 2D2SA 2W67A 3AE1A 2DCFA 3ZYKA 2L3LA 4IL9A 5EK3A 2IUBA 5EZYE 5HYAA 2IC6A 2WSSV 2ODUA 1D1AA 4IDZA 4X65T 3CKDA 3QC9A 4NUVA 3N9LA 4J2CA 5LXTE 3P50A 4HTEA 3UUNA 2CWOA 3C4XA 4GOUA 4I4TE 4JEUB 3WI3A 3A7MA 4Q25A 1HG2A 1FIOA 2K5BB 2NW8A 3SFDA 3AE5A 4TV9E 2W2UA 5DQWA 4JI8T 2UXDT 2WZHA 3MA9A 2QVAA 5C2TA 5LJMA 2C5IT 3AA7B 5HWXA 3N9NA 1CHUA 3ZMSB 5BR8T 3VKHA 2PTFA 3H3AA 2W62A 4NPPA 4DO0A 2CCQA 5AQSB 5L3EB 3JADA 2L8KA 4HFDA 4ISSA 2Y6XA 3LG7A 3ZPOA 4C90A 1XDPA 1T72A 2HN1A 3NRYA 5JDQA 1ZOYA 3CMLA 3T1YT 2H89A 4NUUA 4H9NC 3KBTA 3TLSA 4CN6A 4DBRA 1LKXA 1N33T 2VL8A 4DR3T 5HXCA 3ZT7A 2VL0A 2W66A 3RLFF 1QSDA 2IIUA 2V5DA 4DVDA 2CRBA 4IIJE 3ZMTB 4EYYR 1BR0A 2LSIA 4U31A 1HNXT 4QX7B 3FXDB 4HFVA 4B6XA 2XAFB 3H37A 1BR2A 4NIQA 1FJGT 2GK9A 5LCYA 2LOPA 2Q9QA 3VKGA 4WBOA 3UU3A 5C8YE 3ETUA 1D1BA 3UFEA 2XQ5A 4QXHB 2V5CA 4EOZB 5JDGA 1KF6A 2K48A 3AEFA 4OFZA 3FHNA 4AKIA 2ZM8A 5FXVA 5HCJA 3VU7H 4COFA 4I55E 3AE9A 3EDUA 3RIAA 4DR1T 2LEHA 1OXZA 4LMKA 2BS3A 2X9YA 5L3FB 3AE7A 2YU1A 3C98B 3EUHA 1UK5A 2AXDS 2SPCA 5EK2A 5AQVB 4PJNA 2DWGA 2CBJA 3R84B 5CA1E 2WQYA 2K9AA 1KFYA 4NXMT 4KHPT 3P4SA 5EK4A 5AQMB 4CN4A 5ABEA 3ESLA 1KNRA 1V9DA 4HFCA 2JMKA 2V7LA 3PJAJ 3O4XE 2KZ7B 3PUZF 4TV8E 2I59A 3ONXA 4H9QC 3UU4A 2X66A 3MKDA 5IHYA 5JR9C 3LSVA 3FZMB 5LMNT 4DV7T 2X67A 4LF5T 3RC8A 4DV4T 3N2OA 5TAOA 4BAYB 4DMWA 4DV0T 4PJLA 2JQ9A 1HX8A 3FZKB 5AQOB 1D0XA 3RRCA 3RYIE 2XQ7A 3JAFA 3ETVA 3V5UA 2UXBT 5J0ZA 2BG9A 5L3GB 5FVLA 4X64T 1XNRT 5AQUB 4A97A 2MTQA 1HFAA 1UCUA 2XSBA 2IDOB 3PUAA 4FJOA 2LSKA 4V1Av 5CB4E 4CZZB 1MMDA 2Q9QB 3BQKA 4YTNA 4M1PA 1OEDB 3VHLA 1MMNA 2J47A 2YN6A 2QYWA 3N9QA 1MNDA 2V26A 2E2AA 3I9WA 4ILBA 1EZ3A 3CQXC 3HI2A 2WCAA 2WM9A 3JCFA 2KMFA 4H9RC 5HEHA 2HH7A 3VR9A 4A98A 5L47A 2BVMA 2KSRA 4HFEA 2WS3A 4JI5T 3ZMVB 4YTPA 2OV9A 1HNZT 2KLQA 1HNWT 2IW5B 3TLTA 2V6YA 4TNVA 3QK6A 5HEGA 1FMVA 2YK0A 2XQAA 5C3JA 3T1HT 4L5GA 4IE5A 3U3IA 5DQVA 5LGTB 4ZS2A 4WNKA 3UU6A 2D0TA 5LYJE 2A9UA 4U2ZA 3B57A 4XAXB 4CI1B 3QB5K 3RI5A 1J5ET 3CX6B 4ZOLE 4ERRA 1T98A 4B3MT 1SHZC 3QNUA 4I50E 2PJQA 3S4UA 4HWCA 2HN2A 2XAJB 2XQYA 2LHNA 3RIUA 4AISA 5AQKB 3RYFE 3IHRA 5ADXL 4JV5T 3CPZA 3MACA 2OLTA 3MXZA 3PUVF 4HE8A 5JDLA 2UUAT 2NP9A 4GKJT 2W63A 1GQEA 3LBXA 2XQ3A 4B3ST 1MIVA 1UUSA 5M4YA 4YY3T 1SE7A 2M6BA 2XM1A 2YU2A 4JI1T 2PFVA 1JNRA 3ZT5A 5FL1A 4IDOA 3V5SA 2JQKA 1CUNA 3FZHB 3CX7B 3EVYA 3GA8A 1HG5A 1IAPA 2XQ8A 4HGAA 4EGWA 4ZEYA 2XZEA 3A8YC 2V1DB 3DJBA 4QX8B 5HXEA 4YHHT 4AKRB 1WCRA 4HWHA 3CX8B 2X0LB 4QKNA 5E0OA 3UU8A 2I0MA 4X1IE 3A5XA 4PFOA 2KWIB 2XQ4A 3KV6A 4YHJA 2WDQA 5AQNB 2VURA 4KX6A 4O4JE 5FY7A 2IAKA 4Z8XA 3K3OA 3P7IA 2KT9A 5LGUB 4YT0A 4K0KT 2E9XA 4IHJE 4UV9B 2MBGA 5L3DB 2D9DA 2A2FX 3FBZA 1LRZA 3OKQA 1X79A 3B13A 2KXPB 4YLHA 4PNIA 2D5UA 3C51A 3LK42 2WY2A 1E1HB 4DMVA 4JI6T 4XBFB 1HS7A 3JAEA 1WR0A 2EHOC 3RKOA 4CI2B 5LHHB 2CXFA 1SUMB 2LSYA 3ZC0A 2FJBA 1YD8G 3JC6D 4H9SE 3AXJB 1YQ3A 2QA7A 2B76A 3I1AA 3PTRB 2UU9T 3FBLA 1HF8A 1W9RA 3OYXA 3Q5DA 5FYMA 3AAIA 4ILCA 3AVSA 2H3RA 4EB6E 5KXJA 3VRAA 5GONE 2DNXA 4X66T 4JUYA 1NENA 2ODVA 5L2LA 2XM2A 3OJAA 5HXSA 4GKKT 2VQET 2E5VA 1QUUA 4HWIB 3SS1A 3P8CD 2D0UA 5H6RB 2UUCT 4AKGA 2N1GA 4PK5A 2YDQA 3PU8A 3RYCE 3OTOT 3HKBE 1MIYA 4UF0B 5FNVE 2E8IA 5HEOA 3O9XA 2JIWA 2LT3A 4E7ZA 1WLXA 3ZCIA 1SA0E 2G0UA 1OWAA 2WMNA 2EHOB 2XAGB 4UXNB 2XUEA 2YOEA 1E7PA 4ZZCA 3AE2A 1B7TA 5AQQB 3PU3A 2X9WA 2FJEA 4KMCA 4AIUA 5LG4A 2ZM6T 5LB7B 4AQGA 5JQGE 3NRXA 4A5XA 5KDMC 4H63V 2IC9A 3LK3B 2C5KT 2CXLA 5HAXA 3RGLA 5L3BB 3UQ7A 5FL0A 3K3QC 2LM9A 5J2UE 3TLUA 3ZMZB 4AXPA 3H3MA 4EZHA 2W4XA 2E5LT 5LG3A 4H63H 4LFCT 4PK4A 1JNZA 2VKOA 3OVUA 2M67A 3OYZA 5AQPB 3VRBA 3RIUC 2W00A 2EHOD 4EZ4A 5J2TE 3BQIA 4CN1A 5IWAT 2V7MA 4UIGA 3ZSTA 1WYBA 5JTGA 3E22E 4OX9T 1Y64B 4WYVA 5IYZE 3MK7C 2XY8B 3N9PA 4JBWF 3ZC1A 4EIWA 5L3CB 1W0BA 5L4EA 4JI3T 3RX6A 1XWMA 2CHOA 2VASA 5JDHA 4AQYT 3HR0A 2BKNA 2E9XC 3F57A 3Q5WA 4ZS3A 3TLVA 3UQ4A 2LKHA 2Q9QD 2RA1A 3ZKRA 4YXDA 5ABFA 1UURA 4N78D 5AFUL 4U33A 2HPJA 3VR8A 2FUPA 4U7YA 4X20E 3HKEE 4IDNA 3O1HA 4WW0A 4B3TT 3CVRA 2JQQA 2N2NA 3JC6C 3L39A 3NWIA 2MYSA 4UVCB 5FY0A 4DR7T 2MOZA 1S35A 1D1CA 4LMJA 3BQLA 1Y01A 3E0ZA 2OA5A 2L9QA 4AKHA 1I6ZA 2ZLYA 4HKAA 3G06A 4ZXLA 3FB2A 4KI0F 1N36T 4DR5T 2LOSA 4MLKA 4IE4A 2WU2A 3C4WA 2WZIA 4TN7B 5AQHB 5JDFA 3UUBA 3NBXX 3W15B 2VKJA 2ZM0A 2NW9A 1X9BA 2M6IA 4XZCA 1VCSA 3J9X1 1XNQT 3SOLA 1KNZA 1T8BA 5JR9B 2QGSA 2H7VC 3N2KE 3OPCA 1WYCA 4QWNB 4O2AE 4TNWA 1KEYA 2V7IA 3B5MA 4P1NA 2VK9A 3P4PA 3N2GE 3RQUA 5F8PA 3P4QA 3WAKA 4UVBB 4U3CA 3RQWA 4UF0A 5KX5E 3CWZB 1US7B 2V6YB 3C50A 3GMIA 3KVAA 5FP3A 5AQTB 4ZI7E 3N5LA 4O4LE 2CBIA 3P4RA 5AQLB 5ABGA 4LMLA 2X68A 3AA6B 2K3WA 3EABA 2Q9QC 2LRKA 4TX5A 3IF8B 3ZJ1A 3PUWF 3RF1A 3UULA 3GWHA 4NXNT 1YXRA 3DTOA 4U7IA 3E08A 3ZSSA 2CA5A 4LF7T 2XAHB 4PFPA 5FY1A 2R6GF 3PUYF 2HPLA 1Z0PA 4YFSA 3AEGA 5FXZA 3SFEA 4EXTA 4ILAA 1ZEEA 3ANWB 5ABFB 3O1JA 3AE6A 4TZ4C 1NEKA 4IDQA 3PUGA 5LBQB 1IZNB 4O2BE 3AA0B 3QUJA 2CEAA 4YSXA 1G73A 3PE0A 3PURA 5ABHA 4WZXA 2JJ9A 2H88A 2FJAA 3AECA 4HN9A 2H7OA 4P09A 4AQFC 5LNKA 1IJ6A 2LLYA 2YDRA 3IA3A 3D0TA 5H6QB 4F8HA 4X1YE 4JI7T 4X5TA 2QRXA 4U2YA 5JR9A 4UVAB 4JI4T 4IGUA 2J1DG 3PUXF 4WBNE 2IMLA 4HEAA 1MMAA 4IREA 2V7KA 3AE8A 3EI0A 3ZJ2A 4DIDB 1XMQT 3KV4A 1W0AA 4C91A 4DBQA 2DWKA 2WBLA 1M7KA 4PJJA 4QXCB 5JREA 3AVRA 3IEEA 1HTJF 2UUBT 2ZM2A 3I9YA 3TLWA 2BBHA 3RH3A 3ZMUB 4G2AA 5CGMA 2VQFT 3AEBA 5FXWA 2LHRA 3RKGA 3CIRA 4TWDA 4GK5E 4QHOA
chains in the Genus database with same CATH topology
1DU2A 2XY8B 2AE9A 1SE7A 2AXDS 2IDOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DU2 A;  2XY8 B;  2AE9 A;  1SE7 A;  2AXD S;  2IDO B; 
#chains in the Genus database with same CATH topology
 1W09 A;  1S94 A;  3Q2M A;  4L9I A;  2LRL A;  2PBI A;  4IE0 A;  5AQI B;  1BR4 A;  1YQ4 A;  2J62 A;  2XTL A;  4IE6 A;  5KMG P;  4DV3 T;  2YDS A;  4GIW A;  4JYA T;  2A72 A;  4GK0 E;  2NWB A;  5HEU A;  1J5W A;  2LSJ A;  2V6X A;  2XAQ B;  4OYJ A;  4LF6 T;  4IE7 A;  3QB5 A;  4L0R A;  4MFR A;  4QH1 A;  4CQI A;  5F3J A;  5JH7 E;  4UV8 B;  1OED C;  5LJN A;  4O4I E;  4AI6 A;  4JEH B;  4ZZB A;  4HWF A;  3ZEF B;  4DR4 T;  2LSG A;  2KWH A;  2C0S A;  2NW7 A;  2NR4 A;  2X0Y A;  3KBU A;  5LA6 E;  3CK6 A;  4EYU A;  2F4V T;  1D0Z A;  2BKO A;  3HKC E;  2AE9 A;  3HKD E;  3NZP A;  2NTX A;  4YJ2 E;  1U4Q A;  4LF4 T;  2CLY B;  2ES0 A;  4I0U A;  1BR1 A;  5LGN B;  3F31 A;  3LFM A;  2BZB A;  5LHI B;  2WDR A;  2MPK A;  2E9X D;  3ANW A;  3SWH A;  4PK6 A;  4LF8 T;  5FKY A;  2RPA A;  2BS4 A;  1WFD A;  5FVK A;  2WU5 A;  1ZV4 X;  2BG9 E;  3LDQ B;  4TWF A;  5AQR B;  4CXW A;  1O3X A;  2Z6E A;  4EV6 A;  1OED A;  2YKS A;  4H9O C;  2XJ7 A;  3AE4 A;  3PJA A;  3ZT6 A;  4ANJ A;  2RP4 A;  1UX4 A;  1UX5 A;  3ZLI A;  4EED A;  2LM2 A;  3PV0 F;  4CI3 B;  5FMN A;  5HCM A;  3AEE A;  4KBM B;  3AA1 B;  4JI0 T;  3HL6 A;  4PJM A;  1T7S A;  2A3D A;  4YJ3 E;  3UT5 E;  3MJX A;  5LHG B;  2BDE A;  4AKL A;  3CQC B;  5AQF B;  4O8S A;  3SRZ A;  4ZI2 C;  2ACX A;  2LE8 A;  2X9H A;  2EHO A;  2PG8 A;  3AB3 B;  2DLR A;  2JQH A;  2W0G A;  1NWM X;  3LK2 B;  3N9O A;  1R8I A;  4OYK A;  4CXX A;  4ZI3 C;  4F6R C;  2Y48 B;  2K24 A;  1I94 T;  4JLE A;  4K0U A;  3L3P A;  4O4H E;  1FMW A;  2VB6 A;  2XQ9 A;  1FEW A;  2XQ6 A;  3I0O A;  3K8P C;  2CM0 A;  3RHW A;  3ZYL A;  4LFA T;  4UEM A;  3FZF B;  2FBW A;  3EHZ A;  5ETW A;  4LF9 T;  4BJM A;  3R6N A;  5A1L A;  4GYR A;  3RPU A;  1IBL T;  4U74 A;  4QXB B;  3MZK B;  1NAF A;  2XPK A;  2Y8D A;  4MHC A;  3UUX B;  3NVO A;  3X1D A;  4GYS A;  4X62 T;  4ADZ A;  2VVS A;  2BBJ A;  2LJL A;  2CHN A;  3ONL C;  5DJQ C;  4AQF A;  3AEA A;  2WAU A;  3AXJ A;  3LJC A;  4PAG A;  5JDM A;  4BJN A;  1WRD A;  2YEV C;  3L8R A;  1E2A A;  1XDO A;  4QH5 A;  4H9P C;  2NTY A;  1ZHC A;  2CE7 A;  3L09 A;  5J1G A;  2CXD A;  4OK0 A;  1AJ3 A;  4QH4 A;  4A56 A;  3K1S A;  3UTK A;  5CJ5 A;  3WAJ A;  4KHZ F;  4ZI3 D;  4ASK A;  3NZQ A;  1LVF A;  2NOX A;  3UFG A;  4BA9 A;  1YW0 A;  2XHE B;  4HFI A;  5F5W A;  4DND A;  1DU2 A;  2WWU A;  3DP7 A;  1XMO T;  4ILU A;  1G8X A;  2DI4 A;  4IDP A;  1UGO A;  5CA0 E;  4ZHQ E;  4P0A A;  1N32 T;  2BVL A;  5JRC A;  4ZI2 D;  4DUY T;  3KVB A;  3C4Z A;  4TWH A;  3T8O A;  4HFB A;  3FXE B;  2V8S V;  5JVD E;  4X1K E;  1J1J A;  3M65 A;  3QOF A;  4Z90 A;  3U78 A;  3C64 A;  3ABV A;  4Z91 A;  3I0Q A;  1LVK A;  2ZMA A;  3ZYM A;  5HEJ A;  3Q9D A;  4IL4 A;  4IST A;  1M62 A;  2X9X A;  3K3N A;  2UXX B;  2UXN B;  2LKG A;  2BG9 B;  2CPT A;  2IHR 1;  3HA4 A;  3LBX B;  3NKZ A;  5AQJ B;  3EAM A;  4PW8 A;  4DV5 T;  4EAH A;  4E7S A;  4DV1 T;  4EEB A;  3M3Z B;  3P4W A;  4KUM B;  5LMU T;  1XZY A;  4U72 A;  1HX1 B;  5AQG B;  1YKH B;  1VRB A;  2JRK A;  4MBQ A;  2MAW A;  1IBK T;  4DV6 T;  2V7J A;  3EDV A;  1KK7 A;  3KDS E;  4P0B A;  1QLB A;  5DAB A;  3RC3 A;  3O1I A;  2X51 A;  2JMH A;  2VVN A;  2BS2 A;  2DL1 A;  2YIN A;  4IT4 A;  4KP3 C;  4YTM A;  5HWY A;  5LBM A;  2JPF A;  5LOV E;  2XAS B;  3Q5X A;  2N9D A;  3Q5E A;  3AED A;  4OHF A;  2P9B A;  3IBP A;  2WB5 A;  2CLY C;  1MNE A;  2DHR A;  2VKD A;  4DV2 T;  4LFB T;  4CXY A;  4HWD A;  5HXH A;  2WP9 A;  3RIF A;  3ZCJ A;  2XSA A;  2UXC T;  4UR9 A;  3AE3 A;  3CQG B;  5BMV E;  1Z8U A;  1L0V A;  3AAE B;  3N9M A;  4G63 A;  1H7C A;  3PUQ A;  1IBM T;  3RRW A;  5IUX A;  4B3R T;  2CMR A;  2VWA A;  3OBV E;  1N34 T;  3UUM A;  2VKH A;  1D0Y A;  1KNP A;  1YKE B;  5JDN A;  4FI5 A;  5CFB A;  1WR6 A;  2X0H A;  3J7Y q;  3GN5 B;  1VCT A;  3ZN0 B;  1VOM A;  2KND A;  2W61 A;  4DUZ T;  1MIW A;  2CWY A;  2J4G A;  4TUY E;  1OED E;  3KFW X;  1MMG A;  1HR0 T;  2ACZ A;  4MAL A;  2B1E A;  4DR2 T;  3UU5 A;  1ZKE A;  2FJD A;  3GN5 A;  3PDY A;  4HFH A;  3F2E A;  4UEL A;  3TKL B;  3KV5 A;  3ONJ A;  5L4H A;  3RYH E;  4YSZ A;  2E9X B;  2I6H A;  3AAA B;  5FXX A;  5HXR A;  1ZP0 A;  2WMO A;  2KIN B;  3KV9 A;  4I43 B;  2WWV A;  3FZL B;  5LP6 E;  3PUS A;  2C5J A;  4YSY A;  5JRC B;  3KIN B;  1U5P A;  1IJ5 A;  2WDV A;  3BK9 A;  4JI2 T;  4DR6 T;  2HHH T;  1HCI A;  3ZN1 B;  2BG9 C;  2BKP A;  2D2S A;  2W67 A;  3AE1 A;  2DCF A;  3ZYK A;  2L3L A;  4IL9 A;  5EK3 A;  2IUB A;  5EZY E;  5HYA A;  2IC6 A;  2WSS V;  2ODU A;  1D1A A;  4IDZ A;  4X65 T;  3CKD A;  3QC9 A;  4NUV A;  3N9L A;  4J2C A;  5LXT E;  3P50 A;  4HTE A;  3UUN A;  2CWO A;  3C4X A;  4GOU A;  4I4T E;  4JEU B;  3WI3 A;  3A7M A;  4Q25 A;  1HG2 A;  1FIO A;  2K5B B;  2NW8 A;  3SFD A;  3AE5 A;  4TV9 E;  2W2U A;  5DQW A;  4JI8 T;  2UXD T;  2WZH A;  3MA9 A;  2QVA A;  5C2T A;  5LJM A;  2C5I T;  3AA7 B;  5HWX A;  3N9N A;  1CHU A;  3ZMS B;  5BR8 T;  3VKH A;  2PTF A;  3H3A A;  2W62 A;  4NPP A;  4DO0 A;  2CCQ A;  5AQS B;  5L3E B;  3JAD A;  2L8K A;  4HFD A;  4ISS A;  2Y6X A;  3LG7 A;  3ZPO A;  4C90 A;  1XDP A;  1T72 A;  2HN1 A;  3NRY A;  5JDQ A;  1ZOY A;  3CML A;  3T1Y T;  2H89 A;  4NUU A;  4H9N C;  3KBT A;  3TLS A;  4CN6 A;  4DBR A;  1LKX A;  1N33 T;  2VL8 A;  4DR3 T;  5HXC A;  3ZT7 A;  2VL0 A;  2W66 A;  3RLF F;  1QSD A;  2IIU A;  2V5D A;  4DVD A;  2CRB A;  4IIJ E;  3ZMT B;  4EYY R;  1BR0 A;  2LSI A;  4U31 A;  1HNX T;  4QX7 B;  3FXD B;  4HFV A;  4B6X A;  2XAF B;  3H37 A;  1BR2 A;  4NIQ A;  1FJG T;  2GK9 A;  5LCY A;  2LOP A;  2Q9Q A;  3VKG A;  4WBO A;  3UU3 A;  5C8Y E;  3ETU A;  1D1B A;  3UFE A;  2XQ5 A;  4QXH B;  2V5C A;  4EOZ B;  5JDG A;  1KF6 A;  2K48 A;  3AEF A;  4OFZ A;  3FHN A;  4AKI A;  2ZM8 A;  5FXV A;  5HCJ A;  3VU7 H;  4COF A;  4I55 E;  3AE9 A;  3EDU A;  3RIA A;  4DR1 T;  2LEH A;  1OXZ A;  4LMK A;  2BS3 A;  2X9Y A;  5L3F B;  3AE7 A;  2YU1 A;  3C98 B;  3EUH A;  1UK5 A;  2AXD S;  2SPC A;  5EK2 A;  5AQV B;  4PJN A;  2DWG A;  2CBJ A;  3R84 B;  5CA1 E;  2WQY A;  2K9A A;  1KFY A;  4NXM T;  4KHP T;  3P4S A;  5EK4 A;  5AQM B;  4CN4 A;  5ABE A;  3ESL A;  1KNR A;  1V9D A;  4HFC A;  2JMK A;  2V7L A;  3PJA J;  3O4X E;  2KZ7 B;  3PUZ F;  4TV8 E;  2I59 A;  3ONX A;  4H9Q C;  3UU4 A;  2X66 A;  3MKD A;  5IHY A;  5JR9 C;  3LSV A;  3FZM B;  5LMN T;  4DV7 T;  2X67 A;  4LF5 T;  3RC8 A;  4DV4 T;  3N2O A;  5TAO A;  4BAY B;  4DMW A;  4DV0 T;  4PJL A;  2JQ9 A;  1HX8 A;  3FZK B;  5AQO B;  1D0X A;  3RRC A;  3RYI E;  2XQ7 A;  3JAF A;  3ETV A;  3V5U A;  2UXB T;  5J0Z A;  2BG9 A;  5L3G B;  5FVL A;  4X64 T;  1XNR T;  5AQU B;  4A97 A;  2MTQ A;  1HFA A;  1UCU A;  2XSB A;  2IDO B;  3PUA A;  4FJO A;  2LSK A;  4V1A v;  5CB4 E;  4CZZ B;  1MMD A;  2Q9Q B;  3BQK A;  4YTN A;  4M1P A;  1OED B;  3VHL A;  1MMN A;  2J47 A;  2YN6 A;  2QYW A;  3N9Q A;  1MND A;  2V26 A;  2E2A A;  3I9W A;  4ILB A;  1EZ3 A;  3CQX C;  3HI2 A;  2WCA A;  2WM9 A;  3JCF A;  2KMF A;  4H9R C;  5HEH A;  2HH7 A;  3VR9 A;  4A98 A;  5L47 A;  2BVM A;  2KSR A;  4HFE A;  2WS3 A;  4JI5 T;  3ZMV B;  4YTP A;  2OV9 A;  1HNZ T;  2KLQ A;  1HNW T;  2IW5 B;  3TLT A;  2V6Y A;  4TNV A;  3QK6 A;  5HEG A;  1FMV A;  2YK0 A;  2XQA A;  5C3J A;  3T1H T;  4L5G A;  4IE5 A;  3U3I A;  5DQV A;  5LGT B;  4ZS2 A;  4WNK A;  3UU6 A;  2D0T A;  5LYJ E;  2A9U A;  4U2Z A;  3B57 A;  4XAX B;  4CI1 B;  3QB5 K;  3RI5 A;  1J5E T;  3CX6 B;  4ZOL E;  4ERR A;  1T98 A;  4B3M T;  1SHZ C;  3QNU A;  4I50 E;  2PJQ A;  3S4U A;  4HWC A;  2HN2 A;  2XAJ B;  2XQY A;  2LHN A;  3RIU A;  4AIS A;  5AQK B;  3RYF E;  3IHR A;  5ADX L;  4JV5 T;  3CPZ A;  3MAC A;  2OLT A;  3MXZ A;  3PUV F;  4HE8 A;  5JDL A;  2UUA T;  2NP9 A;  4GKJ T;  2W63 A;  1GQE A;  3LBX A;  2XQ3 A;  4B3S T;  1MIV A;  1UUS A;  5M4Y A;  4YY3 T;  1SE7 A;  2M6B A;  2XM1 A;  2YU2 A;  4JI1 T;  2PFV A;  1JNR A;  3ZT5 A;  5FL1 A;  4IDO A;  3V5S A;  2JQK A;  1CUN A;  3FZH B;  3CX7 B;  3EVY A;  3GA8 A;  1HG5 A;  1IAP A;  2XQ8 A;  4HGA A;  4EGW A;  4ZEY A;  2XZE A;  3A8Y C;  2V1D B;  3DJB A;  4QX8 B;  5HXE A;  4YHH T;  4AKR B;  1WCR A;  4HWH A;  3CX8 B;  2X0L B;  4QKN A;  5E0O A;  3UU8 A;  2I0M A;  4X1I E;  3A5X A;  4PFO A;  2KWI B;  2XQ4 A;  3KV6 A;  4YHJ A;  2WDQ A;  5AQN B;  2VUR A;  4KX6 A;  4O4J E;  5FY7 A;  2IAK A;  4Z8X A;  3K3O A;  3P7I A;  2KT9 A;  5LGU B;  4YT0 A;  4K0K T;  2E9X A;  4IHJ E;  4UV9 B;  2MBG A;  5L3D B;  2D9D A;  2A2F X;  3FBZ A;  1LRZ A;  3OKQ A;  1X79 A;  3B13 A;  2KXP B;  4YLH A;  4PNI A;  2D5U A;  3C51 A;  3LK4 2;  2WY2 A;  1E1H B;  4DMV A;  4JI6 T;  4XBF B;  1HS7 A;  3JAE A;  1WR0 A;  2EHO C;  3RKO A;  4CI2 B;  5LHH B;  2CXF A;  1SUM B;  2LSY A;  3ZC0 A;  2FJB A;  1YD8 G;  3JC6 D;  4H9S E;  3AXJ B;  1YQ3 A;  2QA7 A;  2B76 A;  3I1A A;  3PTR B;  2UU9 T;  3FBL A;  1HF8 A;  1W9R A;  3OYX A;  3Q5D A;  5FYM A;  3AAI A;  4ILC A;  3AVS A;  2H3R A;  4EB6 E;  5KXJ A;  3VRA A;  5GON E;  2DNX A;  4X66 T;  4JUY A;  1NEN A;  2ODV A;  5L2L A;  2XM2 A;  3OJA A;  5HXS A;  4GKK T;  2VQE T;  2E5V A;  1QUU A;  4HWI B;  3SS1 A;  3P8C D;  2D0U A;  5H6R B;  2UUC T;  4AKG A;  2N1G A;  4PK5 A;  2YDQ A;  3PU8 A;  3RYC E;  3OTO T;  3HKB E;  1MIY A;  4UF0 B;  5FNV E;  2E8I A;  5HEO A;  3O9X A;  2JIW A;  2LT3 A;  4E7Z A;  1WLX A;  3ZCI A;  1SA0 E;  2G0U A;  1OWA A;  2WMN A;  2EHO B;  2XAG B;  4UXN B;  2XUE A;  2YOE A;  1E7P A;  4ZZC A;  3AE2 A;  1B7T A;  5AQQ B;  3PU3 A;  2X9W A;  2FJE A;  4KMC A;  4AIU A;  5LG4 A;  2ZM6 T;  5LB7 B;  4AQG A;  5JQG E;  3NRX A;  4A5X A;  5KDM C;  4H63 V;  2IC9 A;  3LK3 B;  2C5K T;  2CXL A;  5HAX A;  3RGL A;  5L3B B;  3UQ7 A;  5FL0 A;  3K3Q C;  2LM9 A;  5J2U E;  3TLU A;  3ZMZ B;  4AXP A;  3H3M A;  4EZH A;  2W4X A;  2E5L T;  5LG3 A;  4H63 H;  4LFC T;  4PK4 A;  1JNZ A;  2VKO A;  3OVU A;  2M67 A;  3OYZ A;  5AQP B;  3VRB A;  3RIU C;  2W00 A;  2EHO D;  4EZ4 A;  5J2T E;  3BQI A;  4CN1 A;  5IWA T;  2V7M A;  4UIG A;  3ZST A;  1WYB A;  5JTG A;  3E22 E;  4OX9 T;  1Y64 B;  4WYV A;  5IYZ E;  3MK7 C;  2XY8 B;  3N9P A;  4JBW F;  3ZC1 A;  4EIW A;  5L3C B;  1W0B A;  5L4E A;  4JI3 T;  3RX6 A;  1XWM A;  2CHO A;  2VAS A;  5JDH A;  4AQY T;  3HR0 A;  2BKN A;  2E9X C;  3F57 A;  3Q5W A;  4ZS3 A;  3TLV A;  3UQ4 A;  2LKH A;  2Q9Q D;  2RA1 A;  3ZKR A;  4YXD A;  5ABF A;  1UUR A;  4N78 D;  5AFU L;  4U33 A;  2HPJ A;  3VR8 A;  2FUP A;  4U7Y A;  4X20 E;  3HKE E;  4IDN A;  3O1H A;  4WW0 A;  4B3T T;  3CVR A;  2JQQ A;  2N2N A;  3JC6 C;  3L39 A;  3NWI A;  2MYS A;  4UVC B;  5FY0 A;  4DR7 T;  2MOZ A;  1S35 A;  1D1C A;  4LMJ A;  3BQL A;  1Y01 A;  3E0Z A;  2OA5 A;  2L9Q A;  4AKH A;  1I6Z A;  2ZLY A;  4HKA A;  3G06 A;  4ZXL A;  3FB2 A;  4KI0 F;  1N36 T;  4DR5 T;  2LOS A;  4MLK A;  4IE4 A;  2WU2 A;  3C4W A;  2WZI A;  4TN7 B;  5AQH B;  5JDF A;  3UUB A;  3NBX X;  3W15 B;  2VKJ A;  2ZM0 A;  2NW9 A;  1X9B A;  2M6I A;  4XZC A;  1VCS A;  3J9X 1;  1XNQ T;  3SOL A;  1KNZ A;  1T8B A;  5JR9 B;  2QGS A;  2H7V C;  3N2K E;  3OPC A;  1WYC A;  4QWN B;  4O2A E;  4TNW A;  1KEY A;  2V7I A;  3B5M A;  4P1N A;  2VK9 A;  3P4P A;  3N2G E;  3RQU A;  5F8P A;  3P4Q A;  3WAK A;  4UVB B;  4U3C A;  3RQW A;  4UF0 A;  5KX5 E;  3CWZ B;  1US7 B;  2V6Y B;  3C50 A;  3GMI A;  3KVA A;  5FP3 A;  5AQT B;  4ZI7 E;  3N5L A;  4O4L E;  2CBI A;  3P4R A;  5AQL B;  5ABG A;  4LML A;  2X68 A;  3AA6 B;  2K3W A;  3EAB A;  2Q9Q C;  2LRK A;  4TX5 A;  3IF8 B;  3ZJ1 A;  3PUW F;  3RF1 A;  3UUL A;  3GWH A;  4NXN T;  1YXR A;  3DTO A;  4U7I A;  3E08 A;  3ZSS A;  2CA5 A;  4LF7 T;  2XAH B;  4PFP A;  5FY1 A;  2R6G F;  3PUY F;  2HPL A;  1Z0P A;  4YFS A;  3AEG A;  5FXZ A;  3SFE A;  4EXT A;  4ILA A;  1ZEE A;  3ANW B;  5ABF B;  3O1J A;  3AE6 A;  4TZ4 C;  1NEK A;  4IDQ A;  3PUG A;  5LBQ B;  1IZN B;  4O2B E;  3AA0 B;  3QUJ A;  2CEA A;  4YSX A;  1G73 A;  3PE0 A;  3PUR A;  5ABH A;  4WZX A;  2JJ9 A;  2H88 A;  2FJA A;  3AEC A;  4HN9 A;  2H7O A;  4P09 A;  4AQF C;  5LNK A;  1IJ6 A;  2LLY A;  2YDR A;  3IA3 A;  3D0T A;  5H6Q B;  4F8H A;  4X1Y E;  4JI7 T;  4X5T A;  2QRX A;  4U2Y A;  5JR9 A;  4UVA B;  4JI4 T;  4IGU A;  2J1D G;  3PUX F;  4WBN E;  2IML A;  4HEA A;  1MMA A;  4IRE A;  2V7K A;  3AE8 A;  3EI0 A;  3ZJ2 A;  4DID B;  1XMQ T;  3KV4 A;  1W0A A;  4C91 A;  4DBQ A;  2DWK A;  2WBL A;  1M7K A;  4PJJ A;  4QXC B;  5JRE A;  3AVR A;  3IEE A;  1HTJ F;  2UUB T;  2ZM2 A;  3I9Y A;  3TLW A;  2BBH A;  3RH3 A;  3ZMU B;  4G2A A;  5CGM A;  2VQF T;  3AEB A;  5FXW A;  2LHR A;  3RKG A;  3CIR A;  4TWD A;  4GK5 E;  4QHO A; 
#chains in the Genus database with same CATH homology
 1DU2 A;  2XY8 B;  2AE9 A;  1SE7 A;  2AXD S;  2IDO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...