1SE7A

Solution structure of the e. coli bacteriophage p1 encoded hot protein: a homologue of the theta subunit of e. coli dna polymerase iii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
MYDWNIAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQLSLQLPKGSDPAYQKDDAVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMOLOGUE OF THE THETA SUBUNIT OF DNA POLYMERASE III
publication title Phage Like It HOT: Solution Structure of the Bacteriophage P1-Encoded HOT Protein, a Homolog of the theta Subunit of E. coli DNA Polymerase III
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Transferase
total genus 18
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 1se7A00
1DU2A 2IDOB 2AE9A 2XY8B 1SE7A 2AXDS
chains in the Genus database with same CATH superfamily
2X9XA 4B3ST 4TUYE 4DV2T 1WRDA 4LF7T 5AQTB 2J47A 2DCFA 2WAUA 3RHWA 3Q9DA 4PJMA 2PTFA 3CQXC 3EAMA 4GK0E 4CI2B 2EHOD 2YDRA 4UVCB 4BJNA 1J1JA 3RF1A 3ZYMA 1LVFA 3TKLB 5AQIB 3N2KE 4UEMA 5DJQC 4AQYT 1QSDA 3CK6A 3OBVE 3TLUA 2XAQB 2ZM2A 3QB5K 1MNEA 2WU2A 5AQJB 4LF5T 4EB6E 2ODVA 4L9IA 3MA9A 5AQHB 2H7VC 2KMFA 3PUVF 2R6GF 1VOMA 2WZIA 2VWAA 2D0UA 4HN9A 4FJOA 5HEGA 3LG7A 4TN7B 4ILUA 3G06A 1NWMX 3VR8A 4UV8B 4U2ZA 1D1AA 1MMGA 4ANJA 4JV5T 3AEDA 2X0HA 1V9DA 2UXBT 3RIFA 3FBZA 3GN5A 1YKEB 1WFDA 5HXRA 1BR1A 1T7SA 4UV9B 2V6XA 1VRBA 4EV6A 3JC6C 3KBUA 2LSGA 4K0KT 5FL1A 2UUBT 4ILCA 3M3ZB 1FEWA 3J9X1 5J0ZA 5HXCA 2XQ8A 5HCMA 3L39A 3VU7H 3AE7A 4KHPT 5HEOA 4X66T 2CXFA 2V5CA 2XY8B 4X1IE 2X0YA 1N32T 2LEHA 4DVDA 4PK6A 4ZS3A 4B3RT 3AVSA 2MPKA 5HCJA 1QLBA 5AQQB 4HGAA 2P9BA 3IHRA 4X5TA 3K3NA 3X1DA 3VKHA 3AXJA 5FL0A 3ZEFB 4X20E 3BQLA 2XAHB 3A5XA 4JI2T 1BR4A 2C5KT 2A3DA 1HF8A 2FUPA 1ZP0A 3C98B 4LF4T 4AQFA 5AQMB 1N36T 4UF0B 3EHZA 4KMCA 2VASA 4E7ZA 5AQVB 5JVDE 5KXJA 4GKKT 3OPCA 1U4QA 2LSKA 1YQ3A 3ZCJA 4CXYA 3C4WA 3LBXA 4LF9T 4K0UA 4JYAT 4HFCA 2X9HA 4U3CA 2NOXA 2Q9QC 2MOZA 5TAOA 5LOVE 4EZ4A 4IL9A 3KV9A 2AE9A 3RKGA 2W4XA 2YDSA 1XDPA 4OX9T 5JR9A 3HKCE 3PU8A 3QK6A 2J4GA 1I6ZA 3VRAA 4V1Av 3UU8A 3PUXF 1NAFA 4HWHA 2WZHA 3JADA 4EEDA 5HYAA 5ABGA 4AKHA 3QOFA 2X67A 5KDMC 3MACA 1HCIA 3CKDA 2LOPA 3PUZF 3OJAA 4OFZA 2XSBA 1SUMB 2AXDS 2DLRA 3ZKRA 4JI8T 2E5VA 2M67A 3FZFB 1E7PA 2BZBA 2X0LB 1B7TA 4CZZB 3JC6D 5LNKA 4Q25A 2NP9A 4PW8A 3KV6A 4H9NC 4IDPA 2L3LA 2NTXA 4XBFB 3LSVA 2FJAA 2CM0A 1WYBA 1XMOT 4JBWF 4COFA 5LJMA 3C4XA 4YXDA 4DMVA 4JEHB 2W67A 4XAXB 4DIDB 4U33A 2NW8A 1BR0A 4U72A 2IUBA 5LP6E 5IYZE 1VCTA 3CX7B 5FKYA 4Z91A 3N9LA 3HR0A 2KSRA 4HEAA 4QXBB 3AE2A 2EHOB 3F2EA 3WAJA 2BS3A 2KNDA 2CMRA 2CEAA 3ONXA 3OYXA 5IWAT 2LKHA 2V7LA 4LMKA 3L09A 2WDVA 2BG9C 3P4QA 2WMNA 1LVKA 3RRCA 2MAWA 4WBOA 2WY2A 4I43B 3JCFA 3AE6A 2CPTA 3O1HA 2MTQA 3AAIA 2KT9A 2B76A 1WYCA 2IC9A 1NENA 1OEDB 2NTYA 5HEHA 4TV9E 4KP3C 3GN5B 3ZT5A 4OHFA 4DR2T 1X79A 2Q9QD 1UK5A 2FJDA 2BVLA 1N33T 3PUSA 2X9WA 4TZ4C 3RIAA 2V7MA 4DR1T 2BS2A 4GIWA 3PJAA 2V26A 5CJ5A 1HNXT 1D1CA 3NZPA 3O1JA 1T8BA 3TLSA 4UR9A 2Q9QA 5LYJE 4XZCA 4QXHB 2ODUA 3UU5A 2ACXA 1UX5A 4UF0A 2ZLYA 5JTGA 5AQOB 5IUXA 1OXZA 5CGMA 1D0ZA 2WS3A 4IL4A 2VKHA 3KV5A 4J2CA 3HKBE 2PFVA 2I0MA 4IE4A 1GQEA 4NUUA 4TV8E 2XQ7A 2VVNA 4PFPA 3PE0A 1MMAA 4PJLA 4IIJE 4YT0A 2QGSA 3Q2MA 2XZEA 3UTKA 2KXPB 4O2AE 3AXJB 2ZM8A 3NZQA 3UQ7A 1U5PA 3F31A 4DUZT 4AKIA 1EZ3A 3SWHA 5LGNB 3CWZB 2LT3A 4IT4A 2JRKA 5ABHA 4I55E 4YTMA 5FY7A 2PG8A 2XHEB 3EABA 1BR2A 4HFHA 1FJGT 3HL6A 4JUYA 2VKDA 3LK3B 3AEGA 3KVBA 3TLVA 4DR3T 1UX4A 3LBXB 2YU2A 4EYYR 2XSAA 5LXTE 2CWYA 4ZOLE 2PJQA 1IJ6A 5AFUL 2UUAT 3A7MA 3MZKB 3RRWA 4X64T 2IAKA 5FXXA 1KK7A 2H89A 5H6QB 2RP4A 4U7YA 2V5DA 4MLKA 4DBRA 1T98A 3AEBA 4EIWA 4CQIA 4DNDA 3EDVA 4WBNE 1ZV4X 1LKXA 2WQYA 2XAFB 1R8IA 3LFMA 3QUJA 2VQFT 3H37A 1HNWT 2BKNA 2M6IA 1MIVA 5L3FB 3LK42 2JQ9A 4HFBA 2BKOA 1MIWA 3H3MA 2CXLA 4AXPA 4LFCT 1W0BA 4YHHT 3K8PC 1H7CA 2BG9A 2ES0A 3MKDA 5FVLA 5J2TE 3PUQA 4AKLA 4LFBT 3RQWA 3AE4A 2VB6A 4F6RC 3C50A 3RIUC 4O4HE 3UU3A 5LJNA 4PK5A 3VRBA 2XQAA 5LMNT 3T8OA 2EHOA 3P4RA 4TWFA 3ONLC 3ONJA 4IDQA 2IC6A 3PURA 4QWNB 4ASKA 4O4LE 2CLYC 5J1GA 4OYKA 3A8YC 3AE9A 3GWHA 3UUNA 2NW7A 2WBLA 3C51A 3ZC1A 3BK9A 3HKEE 2HN2A 2E2AA 1CUNA 2L8KA 4EAHA 4FI5A 4O8SA 4LF8T 1W09A 3ZJ1A 3HKDE 4AISA 4ZEYA 4A98A 4HFDA 3LK2B 3O1IA 5LMUT 3EVYA 3TLTA 2V8SV 3E22E 5FY1A 5E0OA 1OEDA 5LHGB 3GMIA 3P8CD 4LMLA 3P50A 2HPLA 4MBQA 3N9OA 1HS7A 2LM2A 2H3RA 5HXSA 1YQ4A 5L3GB 3HI2A 3VHLA 4HKAA 2XASB 2K24A 4ERRA 3RPUA 2V6YA 3NRYA 2DL1A 3P4PA 5J2UE 2JQHA 2H7OA 4P1NA 2E9XC 3OTOT 2MYSA 4ZI3C 2HHHT 1FIOA 4QHOA 5AQNB 3RYCE 2J1DG 2WM9A 2QYWA 3F57A 4LMJA 2H88A 3AEEA 4QX8B 3ZSSA 2CA5A 4GYSA 1Z0PA 4O2BE 3S4UA 2K3WA 5FMNA 1WR6A 3AA7B 3D0TA 2LSJA 1HFAA 2A2FX 2IHR1 4QXCB 2DHRA 4UVBB 4UXNB 1KNPA 2Q9QB 4P0BA 4DMWA 5LG3A 3DTOA 2D2SA 1QUUA 5BR8T 1E1HB 2N2NA 2HN1A 2K5BB 3ZJ2A 4C91A 3ZYKA 5C8YE 5JDGA 2YU1A 3FXEB 4ZS2A 5L47A 3ETVA 1J5WA 4U2YA 2QRXA 4ADZA 2ZM6T 4DR4T 2FBWA 2CBJA 1FMWA 2Y8DA 4TNVA 3WI3A 2UU9T 1ZOYA 1NEKA 4B3MT 3E0ZA 2RA1A 1AJ3A 4BA9A 4DV6T 5F3JA 3N2GE 2YOEA 4WYVA 4X62T 3FBLA 3AA1B 3PV0F 2Y48B 2LJLA 3AA0B 3RH3A 2BKPA 1UUSA 2FJBA 1MMNA 2CCQA 5L2LA 3KFWX 4G63A 4GYRA 2HPJA 2W2UA 4UIGA 4IE6A 2NW9A 3VR9A 5A1LA 3PU3A 3Q5XA 5KX5E 3N9NA 4KUMB 5KMGP 5FXZA 3I9YA 5CFBA 5LBQB 2KLQA 2QA7A 1IJ5A 5CA0E 3CQCB 4MFRA 2X51A 4TNWA 3Q5DA 3GA8A 3R6NA 2E8IA 2IIUA 2KZ7B 3I9WA 4CI3B 2X9YA 3I0QA 5JQGE 3RC8A 3AVRA 2K48A 4HWDA 2PBIA 2JPFA 4O4IE 3ZMSB 3L3PA 4H9RC 3H3AA 1G8XA 2DNXA 4LFAT 1ZEEA 3KVAA 2E9XD 3RI5A 4ZI3D 2C0SA 2BG9B 3K1SA 3DJBA 2N9DA 3KINB 1KF6A 5LCYA 4ZHQE 3KDSE 5EK4A 3AAAB 4PJJA 2BBHA 3B5MA 3RQUA 3V5SA 4U7IA 4N78D 3CX8B 3RYFE 4ILAA 5AQLB 2V1DB 1IZNB 4BAYB 2E9XA 1JNRA 4I0UA 4DR5T 4YSYA 1SHZC 2VKJA 2VVSA 4B6XA 4H9SE 2Y6XA 4EGWA 4GOUA 2IDOB 2XAGB 3ZMUB 2BBJA 1KEYA 3PUYF 2LE8A 5LGUB 1IBKT 4NXMT 2YDQA 4CN1A 1G73A 4YY3T 1S35A 4ILBA 2IW5B 2D5UA 2XQ5A 4HFVA 4GK5E 5HXHA 3QNUA 1X9BA 2W00A 1Y01A 2KWHA 2CHNA 2UXDT 1MNDA 2V7IA 3AECA 4NUVA 5LB7B 2W0GA 2V6YB 2YN6A 5EK2A 1L0VA 4JEUB 4YSZA 5BMVE 5JDMA 4PFOA 1D0YA 3NVOA 2YEVC 5LHIB 3BQKA 2X66A 5FXVA 3CVRA 1KFYA 3FZKB 2KWIB 1HG5A 3HA4A 5AQFB 2WP9A 4HWIB 3NKZA 3CX6B 3O4XE 1Z8UA 2CRBA 2HH7A 4PAGA 2A9UA 4MALA 3AA6B 3R84B 4ZI7E 4WZXA 3MXZA 3PTRB 2WWVA 1FMVA 5HWXA 4CXXA 1M7KA 4E7SA 3ABVA 4P09A 4ISSA 2J62A 5AQUB 5IHYA 2MBGA 4A56A 4YSXA 4QH4A 3EDUA 3U78A 5HWYA 3L8RA 2JMHA 1SA0E 3RYIE 2LRKA 2XAJB 4HFIA 2KINB 3K3QC 3NWIA 5L3EB 2X68A 3JAFA 1WLXA 4CN6A 4HWFA 2WMOA 2YINA 2L9QA 4KHZF 2W62A 5DABA 4H63V 3T1HT 4EXTA 1DU2A 5F5WA 5DQVA 3FXDB 4KX6A 3V5UA 4EOZB 5AQRB 3P4SA 3J7Yq 4DR7T 1S94A 1XNQT 1LRZA 3U3IA 3RKOA 2LSYA 5JDNA 4DV4T 2VL0A 2JIWA 5JDQA 4X1YE 1XMQT 4L0RA 4WW0A 4ZI2C 4PNIA 4DV3T 3SS1A 5JH7E 2VQET 3SFEA 3MJXA 2BDEA 1IBLT 3AAEB 2CLYB 2K9AA 4DV1T 1US7B 4ZZCA 1WR0A 4JI0T 2VL8A 4YTPA 5CB4E 2LHRA 4AQGA 1MIYA 3EUHA 2CXDA 2XQYA 3ZC0A 5JR9C 2WU5A 3ZYLA 2D0TA 3UU4A 5FY0A 2W66A 5JRCA 3UT5E 2F4VT 3AE1A 2XUEA 4DV5T 2XJ7A 2UUCT 4A97A 4UVAB 3Q5EA 2B1EA 5H6RB 4OK0A 4HTEA 4IDZA 1HX1B 2BS4A 3IEEA 5L3BB 2YK0A 2ZM0A 3OYZA 2IMLA 5JREA 3CIRA 3ESLA 4AIUA 2LOSA 4NXNT 2Z6EA 4EYUA 4NIQA 4JI3T 5ETWA 2E9XB 1XDOA 5GONE 2C5IT 4QH5A 5HXEA 5L4EA 3N2OA 3FB2A 3ANWB 3UUMA 2XPKA 3ZLIA 2RPAA 1HNZT 5M4YA 2E5LT 3CMLA 3O9XA 1D0XA 4UELA 2I59A 3AB3B 3UFGA 2JQQA 3PDYA 1O3XA 4P0AA 3PJAJ 2DWKA 5DQWA 1N34T 3I0OA 5LBMA 4IREA 4L5GA 3UUBA 5LHHB 1I94T 2YKSA 4ZZBA 3UQ4A 3MK7C 5L3DB 1XZYA 4IDOA 1YKHB 2UXCT 1YD8G 3FZLB 3N9MA 2XQ6A 4NPPA 5L3CB 4IDNA 4HWCA 3NRXA 4QX7B 3N5LA 4ZI2D 2JJ9A 4KBMB 3UU6A 2XQ4A 4IE5A 1UCUA 4YTNA 4OYJA 4KI0F 5ADXL 1W9RA 3ZMZB 4DV0T 3AE5A 5LG4A 4M1PA 2ACZA 3PUAA 2DWGA 3I1AA 3CQGB 4AKGA 4JI1T 3P4WA 3P7IA 3RYHE 3VKGA 3RC3A 1T72A 5C3JA 4TX5A 3ZT7A 2LSIA 4IE7A 1VCSA 4IE0A 2G0UA 3KV4A 3QC9A 4CI1B 3Q5WA 1W0AA 2LHNA 1YXRA 3RIUA 3LJCA 4PJNA 5F8PA 1JNZA 2WCAA 3SRZA 2GK9A 4U31A 3BQIA 4HFEA 3ZPOA 4O4JE 3AEFA 4I50E 2XQ9A 4GKJT 4H9OC 1Y64B 4U74A 4AI6A 4QH1A 5AQGB 3ETUA 3UULA 2I6HA 4H9PC 2BVMA 4WNKA 2OA5A 4YFSA 2OLTA 3ZMTB 3IBPA 4C90A 4JI6T 3KBTA 1HG2A 2D9DA 3AE8A 2FJEA 4YJ3E 3ZN1B 1ZHCA 5LA6E 5ABFB 3ZT6A 4YJ2E 1D1BA 4EEBA 3OKQA 3AEAA 5EZYE 5FXWA 2LKGA 4QKNA 4JLEA 3FZMB 3WAKA 4IGUA 2LLYA 2VK9A 4CN4A 5JRCB 1E2AA 5HAXA 4G2AA 2XTLA 2C5JA 2WB5A 1HX8A 3QB5A 5FYMA 2SPCA 2VKOA 2V7KA 1ZKEA 3SOLA 4B3TT 1SE7A 2CWOA 3ANWA 2WSSV 4DR6T 2CHOA 3PUGA 2BG9E 4LF6T 2V7JA 3CPZA 3ZMVB 4YLHA 3TLWA 5HEUA 3UUXB 4F8HA 3ZSTA 5FVKA 2W61A 2WDRA 3PUWF 5JDFA 3N9QA 3IA3A 3W15B 5CA1E 4DV7T 1M62A 2EHOC 2CE7A 4H9QC 3N9PA 2XM1A 3FHNA 3SFDA 4BJMA 2M6BA 5JDHA 4CXWA 4AKRB 3E08A 2XQ3A 3JAEA 1WCRA 1J5ET 5HEJA 3IF8B 1IAPA 5ABEA 2XM2A 3LDQB 2NR4A 1HR0T 2N1GA 1OEDE 1HTJF 3UFEA 4PK4A 5AQKB 4ISTA 3ZN0B 4HE8A 1OEDC 1UURA 2JMKA 1KNRA 3T1YT 4EZHA 4DUYT 2LRLA 5JDLA 2OV9A 1XWMA 2W63A 3B13A 3EI0A 4A5XA 4I4TE 4X65T 1UGOA 2A72A 2QVAA 4MHCA 3RGLA 4JI4T 3NBXX 2WDQA 5C2TA 3C64A 2LM9A 5AQSB 4Z90A 2VURA 2CBIA 4TWHA 2ZMAA 1MMDA 5FP3A 3RX6A 4DBQA 3C4ZA 5L4HA 3K3OA 5LGTB 4YHJA 1XNRT 3RLFF 2UXNB 3OVUA 4Z8XA 3AE3A 1CHUA 3M65A 3B57A 2NWBA 1IBMT 3FZHB 2UXXB 4ZXLA 2DI4A 4AQFC 3DP7A 1YW0A 5EK3A 3ZCIA 4JI7T 1OWAA 1KNZA 2WWUA 4TWDA 4X1KE 2JQKA 4H63H 4JI5T 5JR9B 5ABFA 5FNVE 4IHJE 5AQPB 4DO0A
chains in the Genus database with same CATH topology
1DU2A 2IDOB 2AE9A 2XY8B 1SE7A 2AXDS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DU2 A;  2IDO B;  2AE9 A;  2XY8 B;  1SE7 A;  2AXD S; 
#chains in the Genus database with same CATH topology
 2X9X A;  4B3S T;  4TUY E;  4DV2 T;  1WRD A;  4LF7 T;  5AQT B;  2J47 A;  2DCF A;  2WAU A;  3RHW A;  3Q9D A;  4PJM A;  2PTF A;  3CQX C;  3EAM A;  4GK0 E;  4CI2 B;  2EHO D;  2YDR A;  4UVC B;  4BJN A;  1J1J A;  3RF1 A;  3ZYM A;  1LVF A;  3TKL B;  5AQI B;  3N2K E;  4UEM A;  5DJQ C;  4AQY T;  1QSD A;  3CK6 A;  3OBV E;  3TLU A;  2XAQ B;  2ZM2 A;  3QB5 K;  1MNE A;  2WU2 A;  5AQJ B;  4LF5 T;  4EB6 E;  2ODV A;  4L9I A;  3MA9 A;  5AQH B;  2H7V C;  2KMF A;  3PUV F;  2R6G F;  1VOM A;  2WZI A;  2VWA A;  2D0U A;  4HN9 A;  4FJO A;  5HEG A;  3LG7 A;  4TN7 B;  4ILU A;  3G06 A;  1NWM X;  3VR8 A;  4UV8 B;  4U2Z A;  1D1A A;  1MMG A;  4ANJ A;  4JV5 T;  3AED A;  2X0H A;  1V9D A;  2UXB T;  3RIF A;  3FBZ A;  3GN5 A;  1YKE B;  1WFD A;  5HXR A;  1BR1 A;  1T7S A;  4UV9 B;  2V6X A;  1VRB A;  4EV6 A;  3JC6 C;  3KBU A;  2LSG A;  4K0K T;  5FL1 A;  2UUB T;  4ILC A;  3M3Z B;  1FEW A;  3J9X 1;  5J0Z A;  5HXC A;  2XQ8 A;  5HCM A;  3L39 A;  3VU7 H;  3AE7 A;  4KHP T;  5HEO A;  4X66 T;  2CXF A;  2V5C A;  2XY8 B;  4X1I E;  2X0Y A;  1N32 T;  2LEH A;  4DVD A;  4PK6 A;  4ZS3 A;  4B3R T;  3AVS A;  2MPK A;  5HCJ A;  1QLB A;  5AQQ B;  4HGA A;  2P9B A;  3IHR A;  4X5T A;  3K3N A;  3X1D A;  3VKH A;  3AXJ A;  5FL0 A;  3ZEF B;  4X20 E;  3BQL A;  2XAH B;  3A5X A;  4JI2 T;  1BR4 A;  2C5K T;  2A3D A;  1HF8 A;  2FUP A;  1ZP0 A;  3C98 B;  4LF4 T;  4AQF A;  5AQM B;  1N36 T;  4UF0 B;  3EHZ A;  4KMC A;  2VAS A;  4E7Z A;  5AQV B;  5JVD E;  5KXJ A;  4GKK T;  3OPC A;  1U4Q A;  2LSK A;  1YQ3 A;  3ZCJ A;  4CXY A;  3C4W A;  3LBX A;  4LF9 T;  4K0U A;  4JYA T;  4HFC A;  2X9H A;  4U3C A;  2NOX A;  2Q9Q C;  2MOZ A;  5TAO A;  5LOV E;  4EZ4 A;  4IL9 A;  3KV9 A;  2AE9 A;  3RKG A;  2W4X A;  2YDS A;  1XDP A;  4OX9 T;  5JR9 A;  3HKC E;  3PU8 A;  3QK6 A;  2J4G A;  1I6Z A;  3VRA A;  4V1A v;  3UU8 A;  3PUX F;  1NAF A;  4HWH A;  2WZH A;  3JAD A;  4EED A;  5HYA A;  5ABG A;  4AKH A;  3QOF A;  2X67 A;  5KDM C;  3MAC A;  1HCI A;  3CKD A;  2LOP A;  3PUZ F;  3OJA A;  4OFZ A;  2XSB A;  1SUM B;  2AXD S;  2DLR A;  3ZKR A;  4JI8 T;  2E5V A;  2M67 A;  3FZF B;  1E7P A;  2BZB A;  2X0L B;  1B7T A;  4CZZ B;  3JC6 D;  5LNK A;  4Q25 A;  2NP9 A;  4PW8 A;  3KV6 A;  4H9N C;  4IDP A;  2L3L A;  2NTX A;  4XBF B;  3LSV A;  2FJA A;  2CM0 A;  1WYB A;  1XMO T;  4JBW F;  4COF A;  5LJM A;  3C4X A;  4YXD A;  4DMV A;  4JEH B;  2W67 A;  4XAX B;  4DID B;  4U33 A;  2NW8 A;  1BR0 A;  4U72 A;  2IUB A;  5LP6 E;  5IYZ E;  1VCT A;  3CX7 B;  5FKY A;  4Z91 A;  3N9L A;  3HR0 A;  2KSR A;  4HEA A;  4QXB B;  3AE2 A;  2EHO B;  3F2E A;  3WAJ A;  2BS3 A;  2KND A;  2CMR A;  2CEA A;  3ONX A;  3OYX A;  5IWA T;  2LKH A;  2V7L A;  4LMK A;  3L09 A;  2WDV A;  2BG9 C;  3P4Q A;  2WMN A;  1LVK A;  3RRC A;  2MAW A;  4WBO A;  2WY2 A;  4I43 B;  3JCF A;  3AE6 A;  2CPT A;  3O1H A;  2MTQ A;  3AAI A;  2KT9 A;  2B76 A;  1WYC A;  2IC9 A;  1NEN A;  1OED B;  2NTY A;  5HEH A;  4TV9 E;  4KP3 C;  3GN5 B;  3ZT5 A;  4OHF A;  4DR2 T;  1X79 A;  2Q9Q D;  1UK5 A;  2FJD A;  2BVL A;  1N33 T;  3PUS A;  2X9W A;  4TZ4 C;  3RIA A;  2V7M A;  4DR1 T;  2BS2 A;  4GIW A;  3PJA A;  2V26 A;  5CJ5 A;  1HNX T;  1D1C A;  3NZP A;  3O1J A;  1T8B A;  3TLS A;  4UR9 A;  2Q9Q A;  5LYJ E;  4XZC A;  4QXH B;  2ODU A;  3UU5 A;  2ACX A;  1UX5 A;  4UF0 A;  2ZLY A;  5JTG A;  5AQO B;  5IUX A;  1OXZ A;  5CGM A;  1D0Z A;  2WS3 A;  4IL4 A;  2VKH A;  3KV5 A;  4J2C A;  3HKB E;  2PFV A;  2I0M A;  4IE4 A;  1GQE A;  4NUU A;  4TV8 E;  2XQ7 A;  2VVN A;  4PFP A;  3PE0 A;  1MMA A;  4PJL A;  4IIJ E;  4YT0 A;  2QGS A;  3Q2M A;  2XZE A;  3UTK A;  2KXP B;  4O2A E;  3AXJ B;  2ZM8 A;  3NZQ A;  3UQ7 A;  1U5P A;  3F31 A;  4DUZ T;  4AKI A;  1EZ3 A;  3SWH A;  5LGN B;  3CWZ B;  2LT3 A;  4IT4 A;  2JRK A;  5ABH A;  4I55 E;  4YTM A;  5FY7 A;  2PG8 A;  2XHE B;  3EAB A;  1BR2 A;  4HFH A;  1FJG T;  3HL6 A;  4JUY A;  2VKD A;  3LK3 B;  3AEG A;  3KVB A;  3TLV A;  4DR3 T;  1UX4 A;  3LBX B;  2YU2 A;  4EYY R;  2XSA A;  5LXT E;  2CWY A;  4ZOL E;  2PJQ A;  1IJ6 A;  5AFU L;  2UUA T;  3A7M A;  3MZK B;  3RRW A;  4X64 T;  2IAK A;  5FXX A;  1KK7 A;  2H89 A;  5H6Q B;  2RP4 A;  4U7Y A;  2V5D A;  4MLK A;  4DBR A;  1T98 A;  3AEB A;  4EIW A;  4CQI A;  4DND A;  3EDV A;  4WBN E;  1ZV4 X;  1LKX A;  2WQY A;  2XAF B;  1R8I A;  3LFM A;  3QUJ A;  2VQF T;  3H37 A;  1HNW T;  2BKN A;  2M6I A;  1MIV A;  5L3F B;  3LK4 2;  2JQ9 A;  4HFB A;  2BKO A;  1MIW A;  3H3M A;  2CXL A;  4AXP A;  4LFC T;  1W0B A;  4YHH T;  3K8P C;  1H7C A;  2BG9 A;  2ES0 A;  3MKD A;  5FVL A;  5J2T E;  3PUQ A;  4AKL A;  4LFB T;  3RQW A;  3AE4 A;  2VB6 A;  4F6R C;  3C50 A;  3RIU C;  4O4H E;  3UU3 A;  5LJN A;  4PK5 A;  3VRB A;  2XQA A;  5LMN T;  3T8O A;  2EHO A;  3P4R A;  4TWF A;  3ONL C;  3ONJ A;  4IDQ A;  2IC6 A;  3PUR A;  4QWN B;  4ASK A;  4O4L E;  2CLY C;  5J1G A;  4OYK A;  3A8Y C;  3AE9 A;  3GWH A;  3UUN A;  2NW7 A;  2WBL A;  3C51 A;  3ZC1 A;  3BK9 A;  3HKE E;  2HN2 A;  2E2A A;  1CUN A;  2L8K A;  4EAH A;  4FI5 A;  4O8S A;  4LF8 T;  1W09 A;  3ZJ1 A;  3HKD E;  4AIS A;  4ZEY A;  4A98 A;  4HFD A;  3LK2 B;  3O1I A;  5LMU T;  3EVY A;  3TLT A;  2V8S V;  3E22 E;  5FY1 A;  5E0O A;  1OED A;  5LHG B;  3GMI A;  3P8C D;  4LML A;  3P50 A;  2HPL A;  4MBQ A;  3N9O A;  1HS7 A;  2LM2 A;  2H3R A;  5HXS A;  1YQ4 A;  5L3G B;  3HI2 A;  3VHL A;  4HKA A;  2XAS B;  2K24 A;  4ERR A;  3RPU A;  2V6Y A;  3NRY A;  2DL1 A;  3P4P A;  5J2U E;  2JQH A;  2H7O A;  4P1N A;  2E9X C;  3OTO T;  2MYS A;  4ZI3 C;  2HHH T;  1FIO A;  4QHO A;  5AQN B;  3RYC E;  2J1D G;  2WM9 A;  2QYW A;  3F57 A;  4LMJ A;  2H88 A;  3AEE A;  4QX8 B;  3ZSS A;  2CA5 A;  4GYS A;  1Z0P A;  4O2B E;  3S4U A;  2K3W A;  5FMN A;  1WR6 A;  3AA7 B;  3D0T A;  2LSJ A;  1HFA A;  2A2F X;  2IHR 1;  4QXC B;  2DHR A;  4UVB B;  4UXN B;  1KNP A;  2Q9Q B;  4P0B A;  4DMW A;  5LG3 A;  3DTO A;  2D2S A;  1QUU A;  5BR8 T;  1E1H B;  2N2N A;  2HN1 A;  2K5B B;  3ZJ2 A;  4C91 A;  3ZYK A;  5C8Y E;  5JDG A;  2YU1 A;  3FXE B;  4ZS2 A;  5L47 A;  3ETV A;  1J5W A;  4U2Y A;  2QRX A;  4ADZ A;  2ZM6 T;  4DR4 T;  2FBW A;  2CBJ A;  1FMW A;  2Y8D A;  4TNV A;  3WI3 A;  2UU9 T;  1ZOY A;  1NEK A;  4B3M T;  3E0Z A;  2RA1 A;  1AJ3 A;  4BA9 A;  4DV6 T;  5F3J A;  3N2G E;  2YOE A;  4WYV A;  4X62 T;  3FBL A;  3AA1 B;  3PV0 F;  2Y48 B;  2LJL A;  3AA0 B;  3RH3 A;  2BKP A;  1UUS A;  2FJB A;  1MMN A;  2CCQ A;  5L2L A;  3KFW X;  4G63 A;  4GYR A;  2HPJ A;  2W2U A;  4UIG A;  4IE6 A;  2NW9 A;  3VR9 A;  5A1L A;  3PU3 A;  3Q5X A;  5KX5 E;  3N9N A;  4KUM B;  5KMG P;  5FXZ A;  3I9Y A;  5CFB A;  5LBQ B;  2KLQ A;  2QA7 A;  1IJ5 A;  5CA0 E;  3CQC B;  4MFR A;  2X51 A;  4TNW A;  3Q5D A;  3GA8 A;  3R6N A;  2E8I A;  2IIU A;  2KZ7 B;  3I9W A;  4CI3 B;  2X9Y A;  3I0Q A;  5JQG E;  3RC8 A;  3AVR A;  2K48 A;  4HWD A;  2PBI A;  2JPF A;  4O4I E;  3ZMS B;  3L3P A;  4H9R C;  3H3A A;  1G8X A;  2DNX A;  4LFA T;  1ZEE A;  3KVA A;  2E9X D;  3RI5 A;  4ZI3 D;  2C0S A;  2BG9 B;  3K1S A;  3DJB A;  2N9D A;  3KIN B;  1KF6 A;  5LCY A;  4ZHQ E;  3KDS E;  5EK4 A;  3AAA B;  4PJJ A;  2BBH A;  3B5M A;  3RQU A;  3V5S A;  4U7I A;  4N78 D;  3CX8 B;  3RYF E;  4ILA A;  5AQL B;  2V1D B;  1IZN B;  4BAY B;  2E9X A;  1JNR A;  4I0U A;  4DR5 T;  4YSY A;  1SHZ C;  2VKJ A;  2VVS A;  4B6X A;  4H9S E;  2Y6X A;  4EGW A;  4GOU A;  2IDO B;  2XAG B;  3ZMU B;  2BBJ A;  1KEY A;  3PUY F;  2LE8 A;  5LGU B;  1IBK T;  4NXM T;  2YDQ A;  4CN1 A;  1G73 A;  4YY3 T;  1S35 A;  4ILB A;  2IW5 B;  2D5U A;  2XQ5 A;  4HFV A;  4GK5 E;  5HXH A;  3QNU A;  1X9B A;  2W00 A;  1Y01 A;  2KWH A;  2CHN A;  2UXD T;  1MND A;  2V7I A;  3AEC A;  4NUV A;  5LB7 B;  2W0G A;  2V6Y B;  2YN6 A;  5EK2 A;  1L0V A;  4JEU B;  4YSZ A;  5BMV E;  5JDM A;  4PFO A;  1D0Y A;  3NVO A;  2YEV C;  5LHI B;  3BQK A;  2X66 A;  5FXV A;  3CVR A;  1KFY A;  3FZK B;  2KWI B;  1HG5 A;  3HA4 A;  5AQF B;  2WP9 A;  4HWI B;  3NKZ A;  3CX6 B;  3O4X E;  1Z8U A;  2CRB A;  2HH7 A;  4PAG A;  2A9U A;  4MAL A;  3AA6 B;  3R84 B;  4ZI7 E;  4WZX A;  3MXZ A;  3PTR B;  2WWV A;  1FMV A;  5HWX A;  4CXX A;  1M7K A;  4E7S A;  3ABV A;  4P09 A;  4ISS A;  2J62 A;  5AQU B;  5IHY A;  2MBG A;  4A56 A;  4YSX A;  4QH4 A;  3EDU A;  3U78 A;  5HWY A;  3L8R A;  2JMH A;  1SA0 E;  3RYI E;  2LRK A;  2XAJ B;  4HFI A;  2KIN B;  3K3Q C;  3NWI A;  5L3E B;  2X68 A;  3JAF A;  1WLX A;  4CN6 A;  4HWF A;  2WMO A;  2YIN A;  2L9Q A;  4KHZ F;  2W62 A;  5DAB A;  4H63 V;  3T1H T;  4EXT A;  1DU2 A;  5F5W A;  5DQV A;  3FXD B;  4KX6 A;  3V5U A;  4EOZ B;  5AQR B;  3P4S A;  3J7Y q;  4DR7 T;  1S94 A;  1XNQ T;  1LRZ A;  3U3I A;  3RKO A;  2LSY A;  5JDN A;  4DV4 T;  2VL0 A;  2JIW A;  5JDQ A;  4X1Y E;  1XMQ T;  4L0R A;  4WW0 A;  4ZI2 C;  4PNI A;  4DV3 T;  3SS1 A;  5JH7 E;  2VQE T;  3SFE A;  3MJX A;  2BDE A;  1IBL T;  3AAE B;  2CLY B;  2K9A A;  4DV1 T;  1US7 B;  4ZZC A;  1WR0 A;  4JI0 T;  2VL8 A;  4YTP A;  5CB4 E;  2LHR A;  4AQG A;  1MIY A;  3EUH A;  2CXD A;  2XQY A;  3ZC0 A;  5JR9 C;  2WU5 A;  3ZYL A;  2D0T A;  3UU4 A;  5FY0 A;  2W66 A;  5JRC A;  3UT5 E;  2F4V T;  3AE1 A;  2XUE A;  4DV5 T;  2XJ7 A;  2UUC T;  4A97 A;  4UVA B;  3Q5E A;  2B1E A;  5H6R B;  4OK0 A;  4HTE A;  4IDZ A;  1HX1 B;  2BS4 A;  3IEE A;  5L3B B;  2YK0 A;  2ZM0 A;  3OYZ A;  2IML A;  5JRE A;  3CIR A;  3ESL A;  4AIU A;  2LOS A;  4NXN T;  2Z6E A;  4EYU A;  4NIQ A;  4JI3 T;  5ETW A;  2E9X B;  1XDO A;  5GON E;  2C5I T;  4QH5 A;  5HXE A;  5L4E A;  3N2O A;  3FB2 A;  3ANW B;  3UUM A;  2XPK A;  3ZLI A;  2RPA A;  1HNZ T;  5M4Y A;  2E5L T;  3CML A;  3O9X A;  1D0X A;  4UEL A;  2I59 A;  3AB3 B;  3UFG A;  2JQQ A;  3PDY A;  1O3X A;  4P0A A;  3PJA J;  2DWK A;  5DQW A;  1N34 T;  3I0O A;  5LBM A;  4IRE A;  4L5G A;  3UUB A;  5LHH B;  1I94 T;  2YKS A;  4ZZB A;  3UQ4 A;  3MK7 C;  5L3D B;  1XZY A;  4IDO A;  1YKH B;  2UXC T;  1YD8 G;  3FZL B;  3N9M A;  2XQ6 A;  4NPP A;  5L3C B;  4IDN A;  4HWC A;  3NRX A;  4QX7 B;  3N5L A;  4ZI2 D;  2JJ9 A;  4KBM B;  3UU6 A;  2XQ4 A;  4IE5 A;  1UCU A;  4YTN A;  4OYJ A;  4KI0 F;  5ADX L;  1W9R A;  3ZMZ B;  4DV0 T;  3AE5 A;  5LG4 A;  4M1P A;  2ACZ A;  3PUA A;  2DWG A;  3I1A A;  3CQG B;  4AKG A;  4JI1 T;  3P4W A;  3P7I A;  3RYH E;  3VKG A;  3RC3 A;  1T72 A;  5C3J A;  4TX5 A;  3ZT7 A;  2LSI A;  4IE7 A;  1VCS A;  4IE0 A;  2G0U A;  3KV4 A;  3QC9 A;  4CI1 B;  3Q5W A;  1W0A A;  2LHN A;  1YXR A;  3RIU A;  3LJC A;  4PJN A;  5F8P A;  1JNZ A;  2WCA A;  3SRZ A;  2GK9 A;  4U31 A;  3BQI A;  4HFE A;  3ZPO A;  4O4J E;  3AEF A;  4I50 E;  2XQ9 A;  4GKJ T;  4H9O C;  1Y64 B;  4U74 A;  4AI6 A;  4QH1 A;  5AQG B;  3ETU A;  3UUL A;  2I6H A;  4H9P C;  2BVM A;  4WNK A;  2OA5 A;  4YFS A;  2OLT A;  3ZMT B;  3IBP A;  4C90 A;  4JI6 T;  3KBT A;  1HG2 A;  2D9D A;  3AE8 A;  2FJE A;  4YJ3 E;  3ZN1 B;  1ZHC A;  5LA6 E;  5ABF B;  3ZT6 A;  4YJ2 E;  1D1B A;  4EEB A;  3OKQ A;  3AEA A;  5EZY E;  5FXW A;  2LKG A;  4QKN A;  4JLE A;  3FZM B;  3WAK A;  4IGU A;  2LLY A;  2VK9 A;  4CN4 A;  5JRC B;  1E2A A;  5HAX A;  4G2A A;  2XTL A;  2C5J A;  2WB5 A;  1HX8 A;  3QB5 A;  5FYM A;  2SPC A;  2VKO A;  2V7K A;  1ZKE A;  3SOL A;  4B3T T;  1SE7 A;  2CWO A;  3ANW A;  2WSS V;  4DR6 T;  2CHO A;  3PUG A;  2BG9 E;  4LF6 T;  2V7J A;  3CPZ A;  3ZMV B;  4YLH A;  3TLW A;  5HEU A;  3UUX B;  4F8H A;  3ZST A;  5FVK A;  2W61 A;  2WDR A;  3PUW F;  5JDF A;  3N9Q A;  3IA3 A;  3W15 B;  5CA1 E;  4DV7 T;  1M62 A;  2EHO C;  2CE7 A;  4H9Q C;  3N9P A;  2XM1 A;  3FHN A;  3SFD A;  4BJM A;  2M6B A;  5JDH A;  4CXW A;  4AKR B;  3E08 A;  2XQ3 A;  3JAE A;  1WCR A;  1J5E T;  5HEJ A;  3IF8 B;  1IAP A;  5ABE A;  2XM2 A;  3LDQ B;  2NR4 A;  1HR0 T;  2N1G A;  1OED E;  1HTJ F;  3UFE A;  4PK4 A;  5AQK B;  4IST A;  3ZN0 B;  4HE8 A;  1OED C;  1UUR A;  2JMK A;  1KNR A;  3T1Y T;  4EZH A;  4DUY T;  2LRL A;  5JDL A;  2OV9 A;  1XWM A;  2W63 A;  3B13 A;  3EI0 A;  4A5X A;  4I4T E;  4X65 T;  1UGO A;  2A72 A;  2QVA A;  4MHC A;  3RGL A;  4JI4 T;  3NBX X;  2WDQ A;  5C2T A;  3C64 A;  2LM9 A;  5AQS B;  4Z90 A;  2VUR A;  2CBI A;  4TWH A;  2ZMA A;  1MMD A;  5FP3 A;  3RX6 A;  4DBQ A;  3C4Z A;  5L4H A;  3K3O A;  5LGT B;  4YHJ A;  1XNR T;  3RLF F;  2UXN B;  3OVU A;  4Z8X A;  3AE3 A;  1CHU A;  3M65 A;  3B57 A;  2NWB A;  1IBM T;  3FZH B;  2UXX B;  4ZXL A;  2DI4 A;  4AQF C;  3DP7 A;  1YW0 A;  5EK3 A;  3ZCI A;  4JI7 T;  1OWA A;  1KNZ A;  2WWU A;  4TWD A;  4X1K E;  2JQK A;  4H63 H;  4JI5 T;  5JR9 B;  5ABF A;  5FNV E;  4IHJ E;  5AQP B;  4DO0 A; 
#chains in the Genus database with same CATH homology
 1DU2 A;  2IDO B;  2AE9 A;  2XY8 B;  1SE7 A;  2AXD S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...