1SE7A

Solution structure of the e. coli bacteriophage p1 encoded hot protein: a homologue of the theta subunit of e. coli dna polymerase iii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
b'MYDWNIAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQLSLQLPKGSDPAYQKDDAVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMOLOGUE OF THE THETA SUBUNIT OF DNA POLYMERASE III
publication title Phage Like It HOT: Solution Structure of the Bacteriophage P1-Encoded HOT Protein, a Homolog of the theta Subunit of E. coli DNA Polymerase III
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Transferase
total genus 18
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 1se7A00
2AXDS 2IDOB 1SE7A 2XY8B 2AE9A 1DU2A
chains in the Genus database with same CATH superfamily
4DV4T 2MPKA 4WYVA 3RH3A 4U7IA 1XMQT 1MMNA 3ZMTB 1LRZA 3TLVA 1D0XA 2N1GA 4JV5T 2WB5A 3UFGA 2V7MA 4YTPA 4P1NA 3OVUA 2IMLA 4M1PA 4KX6A 4BA9A 3KFWX 3JCFA 4PFPA 2Y8DA 3SS1A 2DWGA 2E9XA 2NTXA 3N2GE 4Z8XA 4EZ4A 4V1Av 2PG8A 3SFEA 3P4SA 2YU2A 2E9XB 1UURA 3SRZA 2RP4A 2WU5A 4PJMA 4L0RA 4HWIB 4O2BE 4JI8T 4FI5A 2CM0A 4PNIA 2M6BA 4U74A 3QOFA 2LM9A 5FP3A 4J2CA 5HXRA 1XNRT 3ZC1A 3UQ4A 3RKGA 4U33A 3AB3B 3PUGA 2R6GF 4CN1A 5AQLB 1YKHB 1FEWA 2C5IT 1NWMX 4ERRA 3ZEFB 2A9UA 4LF7T 5FVLA 4EGWA 5EK4A 2WQYA 2BS3A 4ZZBA 4C91A 4DV7T 2KT9A 5JR9C 1MIYA 3ZSSA 4ILAA 2CA5A 4HFDA 1KFYA 1YD8G 3EHZA 2XQ9A 5IYZE 4O4LE 5HWXA 4B3ST 3CMLA 3ONXA 5AQVB 1U4QA 2YN6A 3PV0F 4LFCT 2WCAA 1QUUA 5CGMA 3IHRA 2CLYB 2XM1A 1QLBA 4AISA 3O9XA 2UUBT 5L3FB 2IC6A 2FBWA 4TWHA 1VOMA 2UXDT 4P0AA 4EOZB 3KBTA 2X51A 2XQ8A 4XAXB 3DTOA 3OPCA 3NBXX 3RQUA 5HCJA 4AI6A 5IHYA 2KWHA 2AE9A 4Z90A 3JAFA 4IIJE 1UX4A 4H9QC 3PTRB 3KV9A 2W00A 4TWFA 2JQQA 1V9DA 4BJNA 3LK2B 2YU1A 3EDUA 4WBNE 3K1SA 1W0BA 2BZBA 3QC9A 4DR1T 3Q5XA 2EHOC 4PW8A 5FVKA 3JC6D 1MMAA 3AA7B 1ZP0A 2VKOA 1JNZA 5FNVE 3PU8A 3PUYF 5JDFA 2CWOA 3CVRA 2XAHB 3F2EA 5LGUB 4YXDA 2CPTA 3HKCE 4QXCB 2BVMA 2XQYA 1HX8A 4QX8B 2E5VA 1VCTA 2X9WA 4F8HA 1ZHCA 2XAQB 3RC8A 5AQHB 2BBJA 2E8IA 3PUVF 4PK4A 2M67A 4CQIA 1KF6A 2JMHA 5BMVE 3OKQA 2CE7A 3AE3A 3GWHA 2X0HA 3IA3A 4DNDA 1E1HB 2W66A 4TNWA 2I0MA 4IGUA 5F8PA 1G73A 5JDHA 3ZYKA 2NTYA 3IBPA 1AJ3A 3AVSA 5LJMA 2WDQA 2Y6XA 1GQEA 3UU4A 5ADXL 2H88A 3P4WA 1UK5A 3PURA 2WY2A 2BS2A 2DWKA 5KX5E 3AE1A 3E22E 3AEGA 4U72A 4DV6T 2RPAA 1XNQT 3M65A 2YINA 1J5WA 3O4XE 4DR2T 2WU2A 3LDQB 2IDOB 4JBWF 5HXCA 3HL6A 4ZHQE 4TZ4C 3N9MA 4K0KT 2YK0A 2KINB 4IHJE 2P9BA 2IIUA 5E0OA 5JDGA 2HHHT 5DQVA 2WZIA 5HXEA 1VRBA 2LJLA 5HXSA 5CA1E 4X20E 3TLUA 5ABEA 2KZ7B 4IE5A 3I0OA 2JJ9A 2NP9A 3ZYMA 4CI2B 3ETVA 4B3RT 4WNKA 3F31A 3A8YC 3N2OA 4H9SE 2LSKA 4DMVA 2E9XD 1HCIA 2YOEA 5IUXA 5KXJA 4U31A 3CX8B 4ILUA 1SE7A 3CQGB 1L0VA 4B6XA 1ZEEA 4LMKA 5M4YA 4YTMA 5LHIB 5HYAA 3AE4A 2Q9QA 3C4WA 4OHFA 1HR0T 5DQWA 3RIFA 4KMCA 4PJJA 2LM2A 4I0UA 3IF8B 5A1LA 3LFMA 2VKHA 2ZLYA 5ABFA 2Q9QB 2BG9E 2BG9A 5FYMA 2E5LT 4ZI2C 2IUBA 3VU7H 2KMFA 5AQUB 1QSDA 4PK6A 1IJ6A 3VKHA 2BG9B 3OBVE 2LSIA 3KINB 2LE8A 4OFZA 4H63V 5LYJE 3RC3A 2W63A 3FBLA 4CXWA 4JI5T 4YFSA 2XJ7A 4TUYE 4H9RC 2H7OA 2X0YA 4XBFB 4IE0A 3O1IA 2HH7A 2VKDA 2CXFA 3PUWF 4G63A 4A98A 1S35A 4MBQA 3UU5A 3Q9DA 3UUNA 3A7MA 1HNXT 4PJLA 1IJ5A 1T7SA 2M6IA 5JDLA 2W67A 3CQCB 2IW5B 2BBHA 2ODVA 4CN6A 4COFA 1UUSA 4DR5T 3UUXB 4AKIA 4UV8B 5H6QB 2D9DA 4JI0T 5LB7B 1WR0A 3R84B 1HNZT 2KLQA 4ZI3D 3PJAA 2VL8A 4ILCA 3H3MA 4EZHA 5AQQB 4X5TA 3AA0B 4UIGA 2A72A 3P4RA 2ZM0A 2XQ3A 3HI2A 2K5BB 4CZZB 3E0ZA 3ABVA 3RIUC 1X9BA 1WR6A 2UXNB 4JI1T 5AQNB 2Z6EA 3MA9A 2KWIB 3L39A 2LKGA 3HR0A 3AE7A 4WW0A 2E2AA 4H9NC 1WRDA 2LSYA 3ZCIA 2WZHA 4U2ZA 1SHZC 3LJCA 1N36T 4OX9T 3N9NA 4JEHB 5LG4A 2YKSA 4O4HE 1YQ4A 1YXRA 5L4EA 3PE0A 2LRLA 5JDNA 4LFAT 3ESLA 4U2YA 4AKHA 1E2AA 2HN2A 4ZI7E 2XAFB 4LF4T 3C4XA 2FJEA 4HFIA 4H9PC 4MALA 2VL0A 4DO0A 3L09A 4DV3T 4P09A 4I55E 1XWMA 5FY1A 2MYSA 2CWYA 2L9QA 1Y01A 4DV2T 2A3DA 2E9XC 1D0YA 3EI0A 1WYCA 2UXXB 2BKPA 4DR7T 1MMGA 3N9PA 4EEBA 1N33T 4U3CA 2K48A 3ZSTA 2NW8A 3VR9A 4I50E 5L3GB 3UU3A 1N34T 2WDRA 3MK7C 5LNKA 4Q25A 4UELA 2J47A 2ZM8A 4IE7A 3OTOT 3RLFF 5AQMB 3J7Yq 5JREA 4KUMB 4H9OC 3RKOA 3PUAA 3PJAJ 4JYAT 4GKKT 5AQOB 3BQKA 3AAEB 2IAKA 4CXXA 3UT5E 2WAUA 2YDQA 1HG5A 3IEEA 2HPJA 4KHPT 4LF8T 4ASKA 1O3XA 1HTJF 5L4HA 5LGNB 5JR9A 2H3RA 3S4UA 3RPUA 3PUXF 4YJ3E 1XDPA 5JR9B 4YHHT 1W09A 1B7TA 1YQ3A 4EEDA 3AXJA 4GKJT 5HEOA 5CFBA 4HEAA 4JI3T 3AXJB 1KK7A 3H3AA 4NUVA 3JAEA 2LHRA 1HNWT 4QH1A 2V6YA 2K9AA 5AQTB 4IL9A 5FXVA 3LK42 1W0AA 1BR1A 4HWHA 3NWIA 5JDMA 4F6RC 2V6YB 4E7ZA 2G0UA 4OK0A 4IE6A 5EZYE 3T1YT 4GK0E 2NOXA 2Q9QD 1WCRA 3SOLA 5C8YE 4PJNA 3P8CD 4GK5E 2XAJB 1R8IA 4IDPA 2ZMAA 3RF1A 3BQIA 4I4TE 3AE6A 2VQFT 2LSGA 2BS4A 2CHOA 3NVOA 4JLEA 4LFBT 4DMWA 2YDRA 4WBOA 2BKNA 4UV9B 2XUEA 4IDQA 4CXYA 4LMLA 2WWUA 4ILBA 5HWYA 4X65T 2V1DB 1MIWA 4TV8E 1KEYA 3T8OA 1D1CA 4OYKA 5LGTB 3ZYLA 2V6XA 1FIOA 4KI0F 4OYJA 3B13A 5FL0A 3ZC0A 2MTQA 3ZCJA 2CRBA 4KHZF 2V7IA 3WAKA 4E7SA 1T72A 4O2AE 3EABA 2XTLA 4YHJA 3KV4A 2XASB 4AIUA 4MFRA 4IE4A 3OJAA 2L8KA 2XM2A 3P4QA 4QKNA 3UU6A 5L47A 4TWDA 3I9YA 4JI2T 4X1YE 4YLHA 4IDOA 4MLKA 2UUCT 3KVBA 5AQJB 3RX6A 2UUAT 1Z0PA 3O1HA 3EUHA 2X0LB 3SFDA 4FJOA 1DU2A 4AKLA 4GOUA 3RHWA 2OV9A 2IHR1 5AQPB 4LF5T 4NPPA 2XSAA 4AQGA 2BDEA 2BVLA 2W4XA 5LHGB 4ZZCA 4DV1T 1D0ZA 3W15B 3ETUA 3ANWA 2FJBA 4LMJA 2WMNA 2WWVA 2V5DA 4UF0A 2QA7A 3ANWB 2XQAA 4YJ2E 3O1JA 2YEVC 3FZLB 4UF0B 4HFVA 4QWNB 3EAMA 4CI1B 5LG3A 1FMWA 2NW9A 2MAWA 3FZFB 1LVFA 5JQGE 4IT4A 2X66A 2W62A 3RQWA 2QYWA 4UVAB 1US7B 5AQIB 2VASA 5FXZA 3MZKB 1XDOA 1CHUA 5HXHA 2IC9A 2ES0A 3RI5A 2JPFA 3AE2A 3MACA 5GONE 4TX5A 3CIRA 3CX6B 2CBIA 3ZJ1A 4EXTA 4PAGA 4UR9A 2JQHA 4GIWA 3JC6C 5ABFB 4U7YA 4DBRA 4N78D 2L3LA 3NZPA 4ANJA 4X64T 4DR6T 3VRAA 2VVSA 5FXXA 2WM9A 2C0SA 2W61A 2HN1A 3V5SA 3OYXA 1OEDC 3H37A 3U3IA 2XQ4A 4CI3B 2VWAA 3VR8A 1D1AA 4ISTA 3C64A 5LOVE 5KMGP 3AEBA 3A5XA 4MHCA 2ZM2A 5ABGA 1UCUA 5H6RB 4AQYT 4QXBB 4TV9E 1UGOA 3DP7A 1WFDA 3KV6A 4X66T 1D1BA 3AA6B 4Z91A 3FXDB 2BKOA 3UU8A 3MXZA 4UEMA 4UVCB 4DVDA 3GN5A 3LK3B 3ZN1B 1WLXA 3AAIA 3L8RA 5HAXA 2UXBT 2CHNA 2JMKA 5L3BB 4L9IA 3UTKA 4NIQA 5CB4E 4ZEYA 4ZXLA 4CN4A 2DCFA 3C51A 3RYCE 3FB2A 1MIVA 3AE5A 5DABA 3ZMVB 1IBKT 3K8PC 3K3QC 3MJXA 1MNEA 4AQFA 5LXTE 4HKAA 3CWZB 3RIUA 4ZOLE 4HWFA 4IREA 4H63H 4AKRB 2A2FX 3AE9A 4EB6E 1ZKEA 3P7IA 1MNDA 3ZMUB 4YTNA 1NAFA 2XQ7A 5KDMC 2YDSA 4ZS2A 4HFCA 2JQ9A 2VVNA 2DI4A 2V7JA 1J1JA 4A56A 3HKEE 4IDZA 3PUZF 1HX1B 2NR4A 3Q5DA 1MMDA 2X9HA 3VHLA 4A5XA 3P4PA 4X1IE 5J0ZA 5CJ5A 3NRXA 4EIWA 2VKJA 4QHOA 2XQ6A 4A97A 5J2TE 1M7KA 4B3TT 3VKGA 5LCYA 2NW7A 3BQLA 1SA0E 1E7PA 2JRKA 4B3MT 2ODUA 3ZN0B 2HPLA 1OXZA 3FBZA 4QH4A 5LMUT 5C3JA 2WDVA 3M3ZB 4PK5A 4HFEA 3NRYA 5LHHB 4DUZT 4QX7B 4TN7B 4G2AA 3C4ZA 1I94T 3F57A 3B57A 2XAGB 3TLSA 4DUYT 3FXEB 1HS7A 4DV5T 4HN9A 2QVAA 4JI7T 1IZNB 2XY8B 3C98B 3UFEA 2X9XA 3BK9A 4NXMT 3U78A 3QNUA 3ZLIA 2VB6A 2F4VT 1H7CA 2DL1A 3TLWA 3G06A 1CUNA 4JUYA 3RYHE 1Z8UA 3KVAA 4EV6A 4BJMA 1OWAA 2NWBA 5ABHA 1ZV4X 4YSXA 2CLYC 3OYZA 2OLTA 1T98A 3VRBA 2D0UA 5JVDE 3ZJ2A 5F5WA 2CXDA 2H89A 4I43B 4DR3T 2PTFA 2LKHA 2VQET 5J2UE 5C2TA 4UXNB 2DLRA 3HA4A 1FJGT 3KBUA 5BR8T 2DHRA 4HGAA 3RYFE 4ZI3C 2D5UA 2W0GA 3AEAA 3QB5A 4BAYB 1YW0A 2V8SV 3T1HT 4ADZA 1BR2A 2WS3A 3AECA 2EHOA 4GYSA 5LMNT 2D0TA 3NKZA 3RRCA 5LA6E 2EHOB 3ZT5A 4ZI2D 1HF8A 3KV5A 3ZMZB 5FY0A 4YSYA 4O4IE 1W9RA 2B1EA 3AEFA 2AXDS 3AEDA 2J1DG 5L2LA 4X1KE 1BR0A 3LBXA 3Q5WA 1EZ3A 1ZOYA 3CX7B 3ZPOA 1WYBA 5LJNA 2JIWA 3EDVA 3RIAA 3LBXB 2LSJA 3N9QA 3LSVA 1JNRA 5JTGA 2J4GA 4X62T 2FUPA 1T8BA 2ACXA 2D2SA 1NENA 4DV0T 3P50A 2XHEB 2C5JA 1KNRA 3CPZA 1IBMT 4HWDA 4LF6T 4DR4T 1UX5A 4HTEA 3I0QA 2KXPB 4YY3T 1BR4A 1LKXA 3FZKB 2WSSV 3GMIA 2I6HA 4HFBA 1NEKA 1XMOT 4LF9T 4TNVA 5HEHA 3NZQA 5IWAT 3QUJA 3ONJA 3B5MA 5LP6E 1U5PA 2W2UA 3V5UA 2X9YA 2OA5A 2I59A 1J5ET 3I9WA 2XPKA 1M62A 3UUBA 5ETWA 3ONLC 4O4JE 2GK9A 4NXNT 2LOPA 2KNDA 4JI4T 3ZMSB 2LLYA 3D0TA 5JRCA 3AAAB 4JI6T 2LEHA 2X68A 3N5LA 3WI3A 5HCMA 4PFOA 3ZKRA 4JEUB 2CEAA 5JRCB 1YKEB 5LBMA 3K3OA 4EYYR 3HKBE 2CCQA 3TKLB 2X67A 4EYUA 5HEJA 2PJQA 3FZMB 5F3JA 2SPCA 3WAJA 2CMRA 2MOZA 3AE8A 3C50A 2K24A 3E08A 2V7LA 3PUQA 2UXCT 4DBQA 3ZT6A 2WBLA 2PBIA 2QGSA 3R6NA 5FL1A 5AQSB 2JQKA 4AXPA 2XQ5A 5JDQA 3N2KE 2C5KT 4K0UA 3AVRA 3DJBA 5FXWA 4QH5A 4NUUA 4DIDB 3KDSE 5HEGA 2FJDA 4GYRA 2LRKA 2V5CA 4YSZA 3Q2MA 4P0BA 3RYIE 3CKDA 1HFAA 3PU3A 1KNZA 3QB5K 3GA8A 5AQRB 2Q9QC 2CXLA 2H7VC 1I6ZA 4HWCA 5FY7A 3HKDE 3Q5EA 2XZEA 3LG7A 1N32T 2BG9C 2LT3A 2WP9A 5HEUA 3QK6A 4ISSA 2J62A 4IL4A 5EK3A 4AKGA 4L5GA 2CBJA 5AQFB 2QRXA 3UUMA 5EK2A 2DNXA 3AEEA 5J1GA 5LBQB 5L3DB 3RRWA 1KNPA 2ZM6T 1HG2A 1OEDE 3X1DA 1OEDA 2K3WA 3CK6A 3MKDA 5AFUL 4QXHB 1OEDB 3N9OA 3L3PA 3FHNA 2UU9T 1IAPA 3UULA 5FKYA 2LOSA 3EVYA 2V7KA 2B76A 1VCSA 3JADA 2RA1A 3PDYA 4KBMB 5CA0E 2WMOA 3J9X1 3SWHA 3GN5B 4EAHA 4HFHA 2FJAA 1XZYA 4UVBB 2Y48B 1G8XA 1IBLT 3ZT7A 3CQXC 2XSBA 1FMVA 5AQKB 2MBGA 3N9LA 2VURA 3PUSA 5AQGB 1Y64B 5L3EB 4WZXA 2VK9A 2EHOD 2N9DA 4AQFC 5L3CB 5DJQC 3I1AA 3K3NA 2ACZA 4ZS3A 2N2NA 3AA1B 2KSRA 2V26A 4KP3C 1S94A 1SUMB 1X79A 4C90A 5FMNA 3TLTA 5TAOA 5JH7E 3FZHB 4IDNA 4O8SA 4YT0A 4HE8A 3UQ7A 3RGLA 4XZCA 2LHNA 1LVKA 2PFVA
chains in the Genus database with same CATH topology
2AXDS 2IDOB 1SE7A 2XY8B 2AE9A 1DU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXD S;  2IDO B;  1SE7 A;  2XY8 B;  2AE9 A;  1DU2 A; 
#chains in the Genus database with same CATH topology
 4DV4 T;  2MPK A;  4WYV A;  3RH3 A;  4U7I A;  1XMQ T;  1MMN A;  3ZMT B;  1LRZ A;  3TLV A;  1D0X A;  2N1G A;  4JV5 T;  2WB5 A;  3UFG A;  2V7M A;  4YTP A;  4P1N A;  3OVU A;  2IML A;  4M1P A;  4KX6 A;  4BA9 A;  3KFW X;  3JCF A;  4PFP A;  2Y8D A;  3SS1 A;  2DWG A;  2E9X A;  2NTX A;  3N2G E;  4Z8X A;  4EZ4 A;  4V1A v;  2PG8 A;  3SFE A;  3P4S A;  2YU2 A;  2E9X B;  1UUR A;  3SRZ A;  2RP4 A;  2WU5 A;  4PJM A;  4L0R A;  4HWI B;  4O2B E;  4JI8 T;  4FI5 A;  2CM0 A;  4PNI A;  2M6B A;  4U74 A;  3QOF A;  2LM9 A;  5FP3 A;  4J2C A;  5HXR A;  1XNR T;  3ZC1 A;  3UQ4 A;  3RKG A;  4U33 A;  3AB3 B;  3PUG A;  2R6G F;  4CN1 A;  5AQL B;  1YKH B;  1FEW A;  2C5I T;  1NWM X;  4ERR A;  3ZEF B;  2A9U A;  4LF7 T;  5FVL A;  4EGW A;  5EK4 A;  2WQY A;  2BS3 A;  4ZZB A;  4C91 A;  4DV7 T;  2KT9 A;  5JR9 C;  1MIY A;  3ZSS A;  4ILA A;  2CA5 A;  4HFD A;  1KFY A;  1YD8 G;  3EHZ A;  2XQ9 A;  5IYZ E;  4O4L E;  5HWX A;  4B3S T;  3CML A;  3ONX A;  5AQV B;  1U4Q A;  2YN6 A;  3PV0 F;  4LFC T;  2WCA A;  1QUU A;  5CGM A;  3IHR A;  2CLY B;  2XM1 A;  1QLB A;  4AIS A;  3O9X A;  2UUB T;  5L3F B;  2IC6 A;  2FBW A;  4TWH A;  1VOM A;  2UXD T;  4P0A A;  4EOZ B;  3KBT A;  2X51 A;  2XQ8 A;  4XAX B;  3DTO A;  3OPC A;  3NBX X;  3RQU A;  5HCJ A;  4AI6 A;  5IHY A;  2KWH A;  2AE9 A;  4Z90 A;  3JAF A;  4IIJ E;  1UX4 A;  4H9Q C;  3PTR B;  3KV9 A;  2W00 A;  4TWF A;  2JQQ A;  1V9D A;  4BJN A;  3LK2 B;  2YU1 A;  3EDU A;  4WBN E;  3K1S A;  1W0B A;  2BZB A;  3QC9 A;  4DR1 T;  3Q5X A;  2EHO C;  4PW8 A;  5FVK A;  3JC6 D;  1MMA A;  3AA7 B;  1ZP0 A;  2VKO A;  1JNZ A;  5FNV E;  3PU8 A;  3PUY F;  5JDF A;  2CWO A;  3CVR A;  2XAH B;  3F2E A;  5LGU B;  4YXD A;  2CPT A;  3HKC E;  4QXC B;  2BVM A;  2XQY A;  1HX8 A;  4QX8 B;  2E5V A;  1VCT A;  2X9W A;  4F8H A;  1ZHC A;  2XAQ B;  3RC8 A;  5AQH B;  2BBJ A;  2E8I A;  3PUV F;  4PK4 A;  2M67 A;  4CQI A;  1KF6 A;  2JMH A;  5BMV E;  3OKQ A;  2CE7 A;  3AE3 A;  3GWH A;  2X0H A;  3IA3 A;  4DND A;  1E1H B;  2W66 A;  4TNW A;  2I0M A;  4IGU A;  5F8P A;  1G73 A;  5JDH A;  3ZYK A;  2NTY A;  3IBP A;  1AJ3 A;  3AVS A;  5LJM A;  2WDQ A;  2Y6X A;  1GQE A;  3UU4 A;  5ADX L;  2H88 A;  3P4W A;  1UK5 A;  3PUR A;  2WY2 A;  2BS2 A;  2DWK A;  5KX5 E;  3AE1 A;  3E22 E;  3AEG A;  4U72 A;  4DV6 T;  2RPA A;  1XNQ T;  3M65 A;  2YIN A;  1J5W A;  3O4X E;  4DR2 T;  2WU2 A;  3LDQ B;  2IDO B;  4JBW F;  5HXC A;  3HL6 A;  4ZHQ E;  4TZ4 C;  3N9M A;  4K0K T;  2YK0 A;  2KIN B;  4IHJ E;  2P9B A;  2IIU A;  5E0O A;  5JDG A;  2HHH T;  5DQV A;  2WZI A;  5HXE A;  1VRB A;  2LJL A;  5HXS A;  5CA1 E;  4X20 E;  3TLU A;  5ABE A;  2KZ7 B;  4IE5 A;  3I0O A;  2JJ9 A;  2NP9 A;  3ZYM A;  4CI2 B;  3ETV A;  4B3R T;  4WNK A;  3F31 A;  3A8Y C;  3N2O A;  4H9S E;  2LSK A;  4DMV A;  2E9X D;  1HCI A;  2YOE A;  5IUX A;  5KXJ A;  4U31 A;  3CX8 B;  4ILU A;  1SE7 A;  3CQG B;  1L0V A;  4B6X A;  1ZEE A;  4LMK A;  5M4Y A;  4YTM A;  5LHI B;  5HYA A;  3AE4 A;  2Q9Q A;  3C4W A;  4OHF A;  1HR0 T;  5DQW A;  3RIF A;  4KMC A;  4PJJ A;  2LM2 A;  4I0U A;  3IF8 B;  5A1L A;  3LFM A;  2VKH A;  2ZLY A;  5ABF A;  2Q9Q B;  2BG9 E;  2BG9 A;  5FYM A;  2E5L T;  4ZI2 C;  2IUB A;  3VU7 H;  2KMF A;  5AQU B;  1QSD A;  4PK6 A;  1IJ6 A;  3VKH A;  2BG9 B;  3OBV E;  2LSI A;  3KIN B;  2LE8 A;  4OFZ A;  4H63 V;  5LYJ E;  3RC3 A;  2W63 A;  3FBL A;  4CXW A;  4JI5 T;  4YFS A;  2XJ7 A;  4TUY E;  4H9R C;  2H7O A;  2X0Y A;  4XBF B;  4IE0 A;  3O1I A;  2HH7 A;  2VKD A;  2CXF A;  3PUW F;  4G63 A;  4A98 A;  1S35 A;  4MBQ A;  3UU5 A;  3Q9D A;  3UUN A;  3A7M A;  1HNX T;  4PJL A;  1IJ5 A;  1T7S A;  2M6I A;  5JDL A;  2W67 A;  3CQC B;  2IW5 B;  2BBH A;  2ODV A;  4CN6 A;  4COF A;  1UUS A;  4DR5 T;  3UUX B;  4AKI A;  4UV8 B;  5H6Q B;  2D9D A;  4JI0 T;  5LB7 B;  1WR0 A;  3R84 B;  1HNZ T;  2KLQ A;  4ZI3 D;  3PJA A;  2VL8 A;  4ILC A;  3H3M A;  4EZH A;  5AQQ B;  4X5T A;  3AA0 B;  4UIG A;  2A72 A;  3P4R A;  2ZM0 A;  2XQ3 A;  3HI2 A;  2K5B B;  4CZZ B;  3E0Z A;  3ABV A;  3RIU C;  1X9B A;  1WR6 A;  2UXN B;  4JI1 T;  5AQN B;  2Z6E A;  3MA9 A;  2KWI B;  3L39 A;  2LKG A;  3HR0 A;  3AE7 A;  4WW0 A;  2E2A A;  4H9N C;  1WRD A;  2LSY A;  3ZCI A;  2WZH A;  4U2Z A;  1SHZ C;  3LJC A;  1N36 T;  4OX9 T;  3N9N A;  4JEH B;  5LG4 A;  2YKS A;  4O4H E;  1YQ4 A;  1YXR A;  5L4E A;  3PE0 A;  2LRL A;  5JDN A;  4LFA T;  3ESL A;  4U2Y A;  4AKH A;  1E2A A;  2HN2 A;  4ZI7 E;  2XAF B;  4LF4 T;  3C4X A;  2FJE A;  4HFI A;  4H9P C;  4MAL A;  2VL0 A;  4DO0 A;  3L09 A;  4DV3 T;  4P09 A;  4I55 E;  1XWM A;  5FY1 A;  2MYS A;  2CWY A;  2L9Q A;  1Y01 A;  4DV2 T;  2A3D A;  2E9X C;  1D0Y A;  3EI0 A;  1WYC A;  2UXX B;  2BKP A;  4DR7 T;  1MMG A;  3N9P A;  4EEB A;  1N33 T;  4U3C A;  2K48 A;  3ZST A;  2NW8 A;  3VR9 A;  4I50 E;  5L3G B;  3UU3 A;  1N34 T;  2WDR A;  3MK7 C;  5LNK A;  4Q25 A;  4UEL A;  2J47 A;  2ZM8 A;  4IE7 A;  3OTO T;  3RLF F;  5AQM B;  3J7Y q;  5JRE A;  4KUM B;  4H9O C;  3RKO A;  3PUA A;  3PJA J;  4JYA T;  4GKK T;  5AQO B;  3BQK A;  3AAE B;  2IAK A;  4CXX A;  3UT5 E;  2WAU A;  2YDQ A;  1HG5 A;  3IEE A;  2HPJ A;  4KHP T;  4LF8 T;  4ASK A;  1O3X A;  1HTJ F;  5L4H A;  5LGN B;  5JR9 A;  2H3R A;  3S4U A;  3RPU A;  3PUX F;  4YJ3 E;  1XDP A;  5JR9 B;  4YHH T;  1W09 A;  1B7T A;  1YQ3 A;  4EED A;  3AXJ A;  4GKJ T;  5HEO A;  5CFB A;  4HEA A;  4JI3 T;  3AXJ B;  1KK7 A;  3H3A A;  4NUV A;  3JAE A;  2LHR A;  1HNW T;  4QH1 A;  2V6Y A;  2K9A A;  5AQT B;  4IL9 A;  5FXV A;  3LK4 2;  1W0A A;  1BR1 A;  4HWH A;  3NWI A;  5JDM A;  4F6R C;  2V6Y B;  4E7Z A;  2G0U A;  4OK0 A;  4IE6 A;  5EZY E;  3T1Y T;  4GK0 E;  2NOX A;  2Q9Q D;  1WCR A;  3SOL A;  5C8Y E;  4PJN A;  3P8C D;  4GK5 E;  2XAJ B;  1R8I A;  4IDP A;  2ZMA A;  3RF1 A;  3BQI A;  4I4T E;  3AE6 A;  2VQF T;  2LSG A;  2BS4 A;  2CHO A;  3NVO A;  4JLE A;  4LFB T;  4DMW A;  2YDR A;  4WBO A;  2BKN A;  4UV9 B;  2XUE A;  4IDQ A;  4CXY A;  4LML A;  2WWU A;  4ILB A;  5HWY A;  4X65 T;  2V1D B;  1MIW A;  4TV8 E;  1KEY A;  3T8O A;  1D1C A;  4OYK A;  5LGT B;  3ZYL A;  2V6X A;  1FIO A;  4KI0 F;  4OYJ A;  3B13 A;  5FL0 A;  3ZC0 A;  2MTQ A;  3ZCJ A;  2CRB A;  4KHZ F;  2V7I A;  3WAK A;  4E7S A;  1T72 A;  4O2A E;  3EAB A;  2XTL A;  4YHJ A;  3KV4 A;  2XAS B;  4AIU A;  4MFR A;  4IE4 A;  3OJA A;  2L8K A;  2XM2 A;  3P4Q A;  4QKN A;  3UU6 A;  5L47 A;  4TWD A;  3I9Y A;  4JI2 T;  4X1Y E;  4YLH A;  4IDO A;  4MLK A;  2UUC T;  3KVB A;  5AQJ B;  3RX6 A;  2UUA T;  1Z0P A;  3O1H A;  3EUH A;  2X0L B;  3SFD A;  4FJO A;  1DU2 A;  4AKL A;  4GOU A;  3RHW A;  2OV9 A;  2IHR 1;  5AQP B;  4LF5 T;  4NPP A;  2XSA A;  4AQG A;  2BDE A;  2BVL A;  2W4X A;  5LHG B;  4ZZC A;  4DV1 T;  1D0Z A;  3W15 B;  3ETU A;  3ANW A;  2FJB A;  4LMJ A;  2WMN A;  2WWV A;  2V5D A;  4UF0 A;  2QA7 A;  3ANW B;  2XQA A;  4YJ2 E;  3O1J A;  2YEV C;  3FZL B;  4UF0 B;  4HFV A;  4QWN B;  3EAM A;  4CI1 B;  5LG3 A;  1FMW A;  2NW9 A;  2MAW A;  3FZF B;  1LVF A;  5JQG E;  4IT4 A;  2X66 A;  2W62 A;  3RQW A;  2QYW A;  4UVA B;  1US7 B;  5AQI B;  2VAS A;  5FXZ A;  3MZK B;  1XDO A;  1CHU A;  5HXH A;  2IC9 A;  2ES0 A;  3RI5 A;  2JPF A;  3AE2 A;  3MAC A;  5GON E;  4TX5 A;  3CIR A;  3CX6 B;  2CBI A;  3ZJ1 A;  4EXT A;  4PAG A;  4UR9 A;  2JQH A;  4GIW A;  3JC6 C;  5ABF B;  4U7Y A;  4DBR A;  4N78 D;  2L3L A;  3NZP A;  4ANJ A;  4X64 T;  4DR6 T;  3VRA A;  2VVS A;  5FXX A;  2WM9 A;  2C0S A;  2W61 A;  2HN1 A;  3V5S A;  3OYX A;  1OED C;  3H37 A;  3U3I A;  2XQ4 A;  4CI3 B;  2VWA A;  3VR8 A;  1D1A A;  4IST A;  3C64 A;  5LOV E;  5KMG P;  3AEB A;  3A5X A;  4MHC A;  2ZM2 A;  5ABG A;  1UCU A;  5H6R B;  4AQY T;  4QXB B;  4TV9 E;  1UGO A;  3DP7 A;  1WFD A;  3KV6 A;  4X66 T;  1D1B A;  3AA6 B;  4Z91 A;  3FXD B;  2BKO A;  3UU8 A;  3MXZ A;  4UEM A;  4UVC B;  4DVD A;  3GN5 A;  3LK3 B;  3ZN1 B;  1WLX A;  3AAI A;  3L8R A;  5HAX A;  2UXB T;  2CHN A;  2JMK A;  5L3B B;  4L9I A;  3UTK A;  4NIQ A;  5CB4 E;  4ZEY A;  4ZXL A;  4CN4 A;  2DCF A;  3C51 A;  3RYC E;  3FB2 A;  1MIV A;  3AE5 A;  5DAB A;  3ZMV B;  1IBK T;  3K8P C;  3K3Q C;  3MJX A;  1MNE A;  4AQF A;  5LXT E;  4HKA A;  3CWZ B;  3RIU A;  4ZOL E;  4HWF A;  4IRE A;  4H63 H;  4AKR B;  2A2F X;  3AE9 A;  4EB6 E;  1ZKE A;  3P7I A;  1MND A;  3ZMU B;  4YTN A;  1NAF A;  2XQ7 A;  5KDM C;  2YDS A;  4ZS2 A;  4HFC A;  2JQ9 A;  2VVN A;  2DI4 A;  2V7J A;  1J1J A;  4A56 A;  3HKE E;  4IDZ A;  3PUZ F;  1HX1 B;  2NR4 A;  3Q5D A;  1MMD A;  2X9H A;  3VHL A;  4A5X A;  3P4P A;  4X1I E;  5J0Z A;  5CJ5 A;  3NRX A;  4EIW A;  2VKJ A;  4QHO A;  2XQ6 A;  4A97 A;  5J2T E;  1M7K A;  4B3T T;  3VKG A;  5LCY A;  2NW7 A;  3BQL A;  1SA0 E;  1E7P A;  2JRK A;  4B3M T;  2ODU A;  3ZN0 B;  2HPL A;  1OXZ A;  3FBZ A;  4QH4 A;  5LMU T;  5C3J A;  2WDV A;  3M3Z B;  4PK5 A;  4HFE A;  3NRY A;  5LHH B;  4DUZ T;  4QX7 B;  4TN7 B;  4G2A A;  3C4Z A;  1I94 T;  3F57 A;  3B57 A;  2XAG B;  3TLS A;  4DUY T;  3FXE B;  1HS7 A;  4DV5 T;  4HN9 A;  2QVA A;  4JI7 T;  1IZN B;  2XY8 B;  3C98 B;  3UFE A;  2X9X A;  3BK9 A;  4NXM T;  3U78 A;  3QNU A;  3ZLI A;  2VB6 A;  2F4V T;  1H7C A;  2DL1 A;  3TLW A;  3G06 A;  1CUN A;  4JUY A;  3RYH E;  1Z8U A;  3KVA A;  4EV6 A;  4BJM A;  1OWA A;  2NWB A;  5ABH A;  1ZV4 X;  4YSX A;  2CLY C;  3OYZ A;  2OLT A;  1T98 A;  3VRB A;  2D0U A;  5JVD E;  3ZJ2 A;  5F5W A;  2CXD A;  2H89 A;  4I43 B;  4DR3 T;  2PTF A;  2LKH A;  2VQE T;  5J2U E;  5C2T A;  4UXN B;  2DLR A;  3HA4 A;  1FJG T;  3KBU A;  5BR8 T;  2DHR A;  4HGA A;  3RYF E;  4ZI3 C;  2D5U A;  2W0G A;  3AEA A;  3QB5 A;  4BAY B;  1YW0 A;  2V8S V;  3T1H T;  4ADZ A;  1BR2 A;  2WS3 A;  3AEC A;  2EHO A;  4GYS A;  5LMN T;  2D0T A;  3NKZ A;  3RRC A;  5LA6 E;  2EHO B;  3ZT5 A;  4ZI2 D;  1HF8 A;  3KV5 A;  3ZMZ B;  5FY0 A;  4YSY A;  4O4I E;  1W9R A;  2B1E A;  3AEF A;  2AXD S;  3AED A;  2J1D G;  5L2L A;  4X1K E;  1BR0 A;  3LBX A;  3Q5W A;  1EZ3 A;  1ZOY A;  3CX7 B;  3ZPO A;  1WYB A;  5LJN A;  2JIW A;  3EDV A;  3RIA A;  3LBX B;  2LSJ A;  3N9Q A;  3LSV A;  1JNR A;  5JTG A;  2J4G A;  4X62 T;  2FUP A;  1T8B A;  2ACX A;  2D2S A;  1NEN A;  4DV0 T;  3P50 A;  2XHE B;  2C5J A;  1KNR A;  3CPZ A;  1IBM T;  4HWD A;  4LF6 T;  4DR4 T;  1UX5 A;  4HTE A;  3I0Q A;  2KXP B;  4YY3 T;  1BR4 A;  1LKX A;  3FZK B;  2WSS V;  3GMI A;  2I6H A;  4HFB A;  1NEK A;  1XMO T;  4LF9 T;  4TNV A;  5HEH A;  3NZQ A;  5IWA T;  3QUJ A;  3ONJ A;  3B5M A;  5LP6 E;  1U5P A;  2W2U A;  3V5U A;  2X9Y A;  2OA5 A;  2I59 A;  1J5E T;  3I9W A;  2XPK A;  1M62 A;  3UUB A;  5ETW A;  3ONL C;  4O4J E;  2GK9 A;  4NXN T;  2LOP A;  2KND A;  4JI4 T;  3ZMS B;  2LLY A;  3D0T A;  5JRC A;  3AAA B;  4JI6 T;  2LEH A;  2X68 A;  3N5L A;  3WI3 A;  5HCM A;  4PFO A;  3ZKR A;  4JEU B;  2CEA A;  5JRC B;  1YKE B;  5LBM A;  3K3O A;  4EYY R;  3HKB E;  2CCQ A;  3TKL B;  2X67 A;  4EYU A;  5HEJ A;  2PJQ A;  3FZM B;  5F3J A;  2SPC A;  3WAJ A;  2CMR A;  2MOZ A;  3AE8 A;  3C50 A;  2K24 A;  3E08 A;  2V7L A;  3PUQ A;  2UXC T;  4DBQ A;  3ZT6 A;  2WBL A;  2PBI A;  2QGS A;  3R6N A;  5FL1 A;  5AQS B;  2JQK A;  4AXP A;  2XQ5 A;  5JDQ A;  3N2K E;  2C5K T;  4K0U A;  3AVR A;  3DJB A;  5FXW A;  4QH5 A;  4NUU A;  4DID B;  3KDS E;  5HEG A;  2FJD A;  4GYR A;  2LRK A;  2V5C A;  4YSZ A;  3Q2M A;  4P0B A;  3RYI E;  3CKD A;  1HFA A;  3PU3 A;  1KNZ A;  3QB5 K;  3GA8 A;  5AQR B;  2Q9Q C;  2CXL A;  2H7V C;  1I6Z A;  4HWC A;  5FY7 A;  3HKD E;  3Q5E A;  2XZE A;  3LG7 A;  1N32 T;  2BG9 C;  2LT3 A;  2WP9 A;  5HEU A;  3QK6 A;  4ISS A;  2J62 A;  4IL4 A;  5EK3 A;  4AKG A;  4L5G A;  2CBJ A;  5AQF B;  2QRX A;  3UUM A;  5EK2 A;  2DNX A;  3AEE A;  5J1G A;  5LBQ B;  5L3D B;  3RRW A;  1KNP A;  2ZM6 T;  1HG2 A;  1OED E;  3X1D A;  1OED A;  2K3W A;  3CK6 A;  3MKD A;  5AFU L;  4QXH B;  1OED B;  3N9O A;  3L3P A;  3FHN A;  2UU9 T;  1IAP A;  3UUL A;  5FKY A;  2LOS A;  3EVY A;  2V7K A;  2B76 A;  1VCS A;  3JAD A;  2RA1 A;  3PDY A;  4KBM B;  5CA0 E;  2WMO A;  3J9X 1;  3SWH A;  3GN5 B;  4EAH A;  4HFH A;  2FJA A;  1XZY A;  4UVB B;  2Y48 B;  1G8X A;  1IBL T;  3ZT7 A;  3CQX C;  2XSB A;  1FMV A;  5AQK B;  2MBG A;  3N9L A;  2VUR A;  3PUS A;  5AQG B;  1Y64 B;  5L3E B;  4WZX A;  2VK9 A;  2EHO D;  2N9D A;  4AQF C;  5L3C B;  5DJQ C;  3I1A A;  3K3N A;  2ACZ A;  4ZS3 A;  2N2N A;  3AA1 B;  2KSR A;  2V26 A;  4KP3 C;  1S94 A;  1SUM B;  1X79 A;  4C90 A;  5FMN A;  3TLT A;  5TAO A;  5JH7 E;  3FZH B;  4IDN A;  4O8S A;  4YT0 A;  4HE8 A;  3UQ7 A;  3RGL A;  4XZC A;  2LHN A;  1LVK A;  2PFV A; 
#chains in the Genus database with same CATH homology
 2AXD S;  2IDO B;  1SE7 A;  2XY8 B;  2AE9 A;  1DU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...