1SE7A

Solution structure of the e. coli bacteriophage p1 encoded hot protein: a homologue of the theta subunit of e. coli dna polymerase iii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
b'MYDWNIAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQLSLQLPKGSDPAYQKDDAVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMOLOGUE OF THE THETA SUBUNIT OF DNA POLYMERASE III
publication title Phage Like It HOT: Solution Structure of the Bacteriophage P1-Encoded HOT Protein, a Homolog of the theta Subunit of E. coli DNA Polymerase III
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Transferase
total genus 18
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 1se7A00
1SE7A 2XY8B 2AXDS 1DU2A 2IDOB 2AE9A
chains in the Genus database with same CATH superfamily
3WI3A 2LSGA 4CI3B 1YKHB 3ZCJA 1UGOA 3AE4A 2LKHA 2X0HA 3QC9A 4AQGA 4EEBA 3CKDA 4EAHA 3TLTA 4HFHA 4NXNT 4AISA 1D1BA 4AKRB 5DQVA 3AB3B 3UUNA 1KNPA 2A72A 4HGAA 3K3QC 2ZM0A 3Q5XA 4JUYA 3NVOA 4Z91A 3LBXB 3PUAA 2HHHT 3AECA 4P0BA 5LJNA 3C4WA 3O1JA 2K9AA 4DR6T 2HPLA 2W00A 2E2AA 3OJAA 4LF7T 2X66A 3K3OA 4L5GA 2D0TA 4HFBA 5AQUB 5J1GA 2UXNB 3FZKB 3N2OA 4X66T 5CJ5A 2UXXB 3RYIE 1ZOYA 1W09A 5AQHB 3ZMUB 3EDUA 3R6NA 2FJDA 4IDNA 5HEUA 2D9DA 1Z8UA 3FZHB 4PJJA 3AEGA 1IBKT 3ZYMA 1FMWA 4JI0T 5J2UE 4XZCA 4ZOLE 5FL1A 3NWIA 3RC8A 2ZMAA 2OV9A 4KI0F 2KZ7B 4F6RC 3KV6A 2XQ8A 2KT9A 3I0OA 2XQ7A 5AQNB 5L3EB 3N2GE 3ZYLA 2YK0A 3TLSA 4YY3T 2HH7A 2W61A 4HE8A 4AXPA 3WAKA 2WCAA 3BK9A 2N9DA 4ZI3C 3UQ7A 4CXYA 4ISSA 5M4YA 4ASKA 3RIFA 1KNRA 2V6YB 2ZM8A 3I9WA 2H89A 2HN2A 2YEVC 4HWHA 4EYUA 4CXWA 1MIVA 5CFBA 2PFVA 1W9RA 3FHNA 5L3BB 3O4XE 3MKDA 2JJ9A 4PJMA 2EHOA 5ABFA 3CMLA 4DBRA 2X9XA 1UCUA 1IBLT 4DV1T 2V26A 4ZZBA 3GMIA 4O2BE 1W0BA 4GK0E 2LSIA 3CX6B 3E0ZA 1J5ET 1YW0A 3EAMA 3C4ZA 4IDQA 2XAFB 4O4HE 3I1AA 2JIWA 4X1KE 4TZ4C 1MNDA 5A1LA 3KINB 2W66A 2A2FX 1HX8A 2V6YA 2H88A 2I0MA 4UXNB 1KK7A 5KDMC 4B3MT 5JR9B 4JI6T 4X65T 4DV7T 3IF8B 2BS4A 3KDSE 4YXDA 2QGSA 2LM2A 2FJAA 2BKNA 3VR9A 2ZLYA 2X0YA 2CLYC 3CX7B 3OYZA 2V7KA 4YJ3E 2N2NA 2XPKA 2C0SA 3P7IA 4MALA 5C8YE 2ES0A 2UXCT 3UTKA 4Q25A 1J1JA 4X5TA 2XAHB 5FNVE 4OYJA 4JEHB 3RX6A 5KXJA 3KV4A 5JR9A 2LKGA 4IL4A 5EZYE 5IWAT 1YKEB 3UUMA 3ZCIA 2JQ9A 2BKPA 4DV2T 1WCRA 5LMNT 1ZV4X 4TN7B 3UU8A 1HS7A 4WZXA 4G2AA 2KWIB 4PW8A 2Q9QB 3PJAA 4BJNA 4XBFB 1LVKA 2K3WA 1X79A 5C3JA 2P9BA 4NPPA 4E7ZA 3ZPOA 3M3ZB 3RIUC 5HAXA 4A97A 4JI2T 3O9XA 2KSRA 5IHYA 2L9QA 2JRKA 5KMGP 2FUPA 3PTRB 4ILAA 2XQYA 4H9QC 5LG4A 4DR1T 2JMKA 1SE7A 2LRLA 2XAQB 4HFDA 2VL8A 5EK2A 3EABA 4LFCT 3UQ4A 3N9NA 3RYFE 4Z90A 3W15B 5L3GB 2YOEA 3Q5WA 2IW5B 4P1NA 5L3FB 4ZI2C 1E1HB 2RA1A 1WYBA 2K24A 3C51A 4JI5T 2KINB 5H6QB 5LHHB 2LHRA 2UUAT 3RF1A 4BJMA 1JNZA 2WWVA 5ABGA 3MK7C 4H9SE 3VRAA 4DUZT 3N9MA 2E9XC 2CBIA 4B3ST 3AA1B 3L09A 4ZI3D 1LVFA 4UVCB 2X9YA 3AAIA 2WU2A 5TAOA 2IUBA 2CPTA 4JEUB 2OLTA 4ZXLA 2D5UA 1NENA 3HL6A 3LK2B 4BA9A 3K3NA 4HWIB 3D0TA 5AQFB 3HKCE 2RPAA 2UUCT 4C90A 3SWHA 4U7YA 4LFBT 4LMLA 3ZMZB 4X1IE 2DL1A 1R8IA 2KWHA 4GOUA 4X62T 4YTMA 5F8PA 5FL0A 3Q5DA 3CQXC 2MPKA 3FZLB 3O1HA 4YLHA 3M65A 2VQFT 3T1YT 4LFAT 2PJQA 3R84B 4OFZA 5HEGA 4H63V 1O3XA 4IGUA 5FVKA 5JDFA 3ZN0B 2FJEA 1QUUA 3IBPA 2W0GA 2LSKA 2F4VT 3P4QA 2K48A 2HPJA 1N32T 5AQIB 1BR2A 2QVAA 1IJ5A 1HNZT 2XQ3A 3U78A 2BS2A 2A3DA 4U31A 2DHRA 4FJOA 2MAWA 4YT0A 3ZJ2A 2ZM6T 3FXEB 4EZ4A 4CQIA 5HWYA 1LRZA 5L47A 2BG9C 3HKEE 5HWXA 3KBTA 5H6RB 4PAGA 3AEAA 3L8RA 3NBXX 2WMNA 4AKHA 2NR4A 2Y48B 4IDZA 4N78D 4DR7T 2X9WA 1JNRA 3P4RA 3QNUA 4OX9T 1Z0PA 3AA6B 2DWKA 3AE5A 4EIWA 2VKOA 2XQAA 3V5SA 3A5XA 1OEDC 4OYKA 1YQ4A 1GQEA 1WR6A 4EV6A 4ZI7E 5FY0A 3NRYA 1MIWA 4PJLA 5FXZA 3AE1A 1T72A 4ILBA 2WMOA 5JQGE 4Z8XA 5HEOA 4JI1T 2DLRA 5LG3A 5JDHA 4EYYR 1HCIA 4YTPA 1SHZC 3RGLA 4J2CA 3LK3B 1IAPA 2WP9A 2QYWA 4AI6A 2C5JA 4JI8T 1KEYA 4QH5A 2DNXA 5L4EA 1D1AA 1MMAA 2FBWA 1E2AA 3PUZF 3QB5A 4QH1A 3TKLB 4WYVA 3T8OA 2V6XA 4M1PA 4ZI2D 3NRXA 3N9PA 4NUVA 1XZYA 2Y6XA 2CWYA 2V7JA 3L39A 4B3RT 2E9XD 1Y01A 4AQYT 2IHR1 3LDQB 2EHOB 5ABFB 3N9OA 3AEFA 4KMCA 1XMOT 3K1SA 3KFWX 2D0UA 3TLVA 4LMJA 2XY8B 2YKSA 3WAJA 1U5PA 3AAEB 2SPCA 2VQET 2YDQA 4TV8E 5ADXL 2NOXA 4U72A 1UK5A 4HFEA 1ZEEA 2A9UA 4ZS2A 2W67A 5LGTB 5JDNA 2CEAA 2X51A 1MNEA 3AVSA 4IE4A 2CA5A 3VRBA 2LOSA 3TLWA 3G06A 2JPFA 2JMHA 1MMGA 4HWFA 2ACXA 2V1DB 4UELA 5LNKA 2CXLA 4EOZB 4EB6E 4ILCA 1VOMA 4IDPA 4PJNA 1QLBA 2V8SV 3ESLA 4MHCA 4ISTA 3ABVA 3PDYA 4X64T 1N33T 2AE9A 5AQOB 2WU5A 3HKDE 1M62A 2BKOA 4AQFA 4GYSA 5HEJA 5HYAA 4ILUA 3H3MA 5LCYA 4QWNB 3MA9A 2NW9A 2KNDA 5JRCA 1HTJF 4IHJE 4O8SA 4YSZA 3ZSTA 3BQLA 3ZKRA 1FJGT 3CVRA 5AQLB 3ZC1A 4A98A 2XSAA 3UFEA 3ZMSB 3LG7A 3ZMTB 3HR0A 4DV0T 2CM0A 1BR0A 4DR5T 1LKXA 4O4JE 3KV9A 4DR2T 2XZEA 2YDRA 2CHOA 5HEHA 3RIUA 4PK5A 2WY2A 1IZNB 2M6IA 2CE7A 5J2TE 2QA7A 5HXRA 2YN6A 3IA3A 2E9XB 5LBMA 2VKDA 3UU4A 2R6GF 3JCFA 2LRKA 1MIYA 4HEAA 4CI2B 2VB6A 3BQKA 4DMVA 2YDSA 3UUXB 4NIQA 2WDRA 1E7PA 3FXDB 5EK3A 1MMNA 1XDPA 2VURA 3QUJA 3UFGA 3NKZA 4H9PC 3AE2A 3P4PA 1XDOA 4HWDA 3FZMB 2NTYA 4QX7B 2MYSA 3I0QA 2XQ9A 4TWHA 4TNVA 4DIDB 3NZQA 3PUVF 4QXCB 1HF8A 1YD8G 3AE6A 3ZSSA 3EHZA 1HG2A 3KVBA 4QKNA 1NAFA 2WDQA 5AQPB 3VKGA 3VR8A 2E9XA 3AVRA 2X9HA 2I6HA 1MMDA 1OXZA 2UU9T 4QX8B 3LSVA 2WSSV 5JTGA 5HCMA 1XMQT 2IC9A 2X67A 2JQQA 3UU5A 5ABHA 4GKJT 2OA5A 5LHGB 3RC3A 1XNRT 2YINA 4LF6T 3EI0A 2L8KA 4QXHB 1AJ3A 3ZLIA 1W0AA 5HXSA 4FI5A 5JR9C 2XQ4A 5FYMA 4EGWA 2HN1A 3TLUA 2X0LB 2LSYA 3AEDA 4GIWA 5DABA 4C91A 2WQYA 3NZPA 5LJMA 1YQ3A 3AA7B 2VL0A 2WBLA 4HFIA 4A56A 1T8BA 1CUNA 1ZP0A 1WR0A 4PNIA 3ZN1B 5AQKB 5BMVE 3KBUA 5FKYA 3RLFF 2LLYA 2VKJA 3AE7A 3EUHA 2NTXA 2XAJB 4IDOA 2W2UA 4NXMT 2LSJA 2MOZA 3KVAA 5IYZE 1EZ3A 4MBQA 4X20E 3P50A 3ONJA 3N5LA 3P4WA 3SOLA 4CN4A 4AKGA 3RKGA 1DU2A 2E5VA 3PUXF 4O2AE 4KHPT 5FXVA 2LJLA 2CMRA 3AXJB 1KNZA 2Z6EA 4IL9A 5AQJB 2X68A 5HCJA 4KBMB 3B57A 1D0ZA 1WLXA 4UV9B 3GA8A 3P4SA 1US7B 4JBWF 5AQMB 3GWHA 3AEBA 4PK4A 4DBQA 3RQUA 2NW7A 3RYCE 3UT5E 2Q9QC 2H7VC 3B5MA 2K5BB 4IE0A 2ACZA 5LGUB 3JAFA 4U74A 2XSBA 3E22E 1T7SA 4ADZA 3SRZA 5L3CB 2XM1A 2XUEA 3PU8A 2VVNA 4DR4T 2MBGA 3VHLA 4U2YA 1OEDA 3ZYKA 4DMWA 4ZZCA 3AXJA 3CQGB 2IMLA 4G63A 2XM2A 2W63A 1G8XA 2J62A 2W4XA 4YHJA 4LF9T 1QSDA 3PUGA 5L4HA 3Q2MA 5EK4A 3UUBA 4HN9A 4K0UA 4OHFA 2BBJA 2E5LT 3ZT6A 4IT4A 5LGNB 4LF5T 5LHIB 3UU3A 5LMUT 3SFDA 3AAAB 4WBNE 3RRWA 1UUSA 1HR0T 1HG5A 2RP4A 3SS1A 4L0RA 3L3PA 1N36T 4QXBB 3ZT7A 3RPUA 5LBQB 5DJQC 4IREA 3OVUA 2BVLA 4XAXB 4DV3T 3RYHE 1XNQT 1HNWT 3PUWF 1HX1B 2QRXA 2N1GA 2I59A 3QB5K 2XASB 2UUBT 3QOFA 4DR3T 4KX6A 1WRDA 2V5CA 3JADA 3AE3A 2DWGA 5ETWA 2YU1A 2AXDS 4LF4T 5AQGB 3HKBE 2M6BA 5JREA 2BVMA 2V7IA 4E7SA 4YSXA 1G73A 2VVSA 2BBHA 2J4GA 3AE9A 3FBLA 4YJ2E 3PV0F 4CXXA 4UF0A 3OKQA 2B76A 4TUYE 4UVAB 1I6ZA 3P8CD 2UXDT 3ANWA 5LYJE 2LHNA 2CXDA 1BR4A 5FXXA 4UV8B 3ONXA 5CB4E 4TV9E 4ANJA 4WBOA 3H3AA 1NWMX 4O4LE 2IDOB 5FY1A 3C4XA 2E8IA 4WNKA 5JDMA 1UURA 4L9IA 3ZT5A 2CLYB 4H63H 2UXBT 2BG9E 4YTNA 1KFYA 4I43B 3RHWA 4AIUA 5C2TA 2V7LA 3CPZA 2J1DG 3LBXA 4X1YE 3ZEFB 3C98B 5CA0E 4KUMB 5JDQA 3IEEA 4I0UA 2V5DA 4WW0A 3OBVE 4MFRA 1KF6A 1OEDE 5JRCB 2LM9A 3CX8B 4CN6A 3QK6A 2BDEA 5DQWA 1S35A 5LB7B 3ETVA 5JVDE 2WS3A 3I9YA 3JAEA 3S4UA 2YU2A 1UX5A 2Q9QD 4JI7T 1B7TA 2WAUA 1D0XA 4P09A 4DVDA 5FP3A 4CZZB 5AFUL 4QH4A 5IUXA 4H9RC 3J9X1 2IAKA 3JC6C 5AQQB 5ABEA 2Y8DA 3C64A 5HXCA 2CWOA 1H7CA 2ODUA 2H3RA 4ZHQE 4DO0A 4HTEA 2PG8A 4DNDA 2J47A 2VWAA 2C5IT 2KMFA 4U7IA 3DTOA 3PU3A 2WM9A 3PE0A 5AQSB 4UIGA 4TNWA 3RQWA 2XHEB 1ZHCA 3RKOA 3ETUA 4B3TT 2CBJA 2V7MA 4DV4T 4TWFA 1U4QA 5FXWA 3FZFB 1BR1A 4CN1A 3CIRA 5E0OA 4TWDA 3A8YC 4HKAA 5L2LA 4I4TE 3F57A 3GN5B 3EDVA 2EHOC 2NP9A 5FY7A 4F8HA 2D2SA 2H7OA 2KLQA 2W62A 3PUYF 2PBIA 3LFMA 4UVBB 5LOVE 2PTFA 4AQFC 1D1CA 1D0YA 3N2KE 3K8PC 3CK6A 3DJBA 5J0ZA 4IE5A 2CHNA 5LA6E 3ZMVB 4DV6T 4KP3C 4LF8T 1FIOA 3GN5A 2G0UA 2JQKA 2WDVA 1YXRA 5JDGA 4JV5T 4UR9A 2CXFA 3V5UA 3PUQA 5JDLA 2ZM2A 1ZKEA 4GKKT 3VKHA 3HA4A 2JQHA 3AE8A 4MLKA 3MJXA 4YHHT 4OK0A 3SFEA 2IIUA 3UULA 1FMVA 2LE8A 4KHZF 4ZS3A 2LEHA 2BS3A 5AQVB 3OPCA 1IBMT 3N9QA 5AQTB 3ZJ1A 5GONE 4P0AA 4GYRA 4PFOA 1HFAA 2KXPB 1V9DA 4PK6A 3OTOT 3ZC0A 3B13A 1FEWA 2Q9QA 4EXTA 3U3IA 4HWCA 1L0VA 3AA0B 2VK9A 4AKLA 5LP6E 2WWUA 3MZKB 5LXTE 3RI5A 3CWZB 4ERRA 2BG9B 2XQ6A 1VRBA 5BR8T 3T1HT 3Q9DA 3MACA 3A7MA 3LK42 1J5WA 3VU7H 4H9OC 2WB5A 3HI2A 4GK5E 4CI1B 2BZBA 3FBZA 1VCSA 4JLEA 2NW8A 2XTLA 2M67A 4U3CA 3IHRA 1N34T 1OEDB 2ODVA 1WFDA 1I94T 4PFPA 5HXHA 5CGMA 1Y64B 5JH7E 4I55E 1UX4A 4AKIA 2XAGB 2B1EA 3ONLC 3JC6D 4IIJE 4BAYB 2BG9A 3LJCA 3OYXA 4COFA 3RRCA 3EVYA 5F3JA 4JI4T 2XQ5A 1CHUA 4U2ZA 3H37A 3UU6A 3AEEA 5CA1E 3FB2A 1SUMB 4UEMA 2NWBA 4IE6A 4V1Av 4O4IE 5FVLA 4LMKA 4K0KT 5L3DB 1X9BA 1WYCA 5HXEA 3RH3A 1T98A 3C50A 2DI4A 5AQRB 3DP7A 4TX5A 4B6XA 4ZEYA 1HNXT 2C5KT 5KX5E 3BQIA 1IJ6A 1M7KA 2VASA 4NUUA 1XWMA 2XJ7A 3F2EA 4YFSA 2EHOD 3Q5EA 4I50E 2L3LA 3PURA 2LOPA 2MTQA 4DUYT 4A5XA 3MXZA 2DCFA 3PUSA 4H9NC 3E08A 2IC6A 3J7Yq 4QHOA 4YSYA 2GK9A 3RIAA 4HFCA 1OWAA 4EZHA 3X1DA 2WZHA 4JI3T 4HFVA 4DV5T 2FJBA 3KV5A 2CCQA 1NEKA 1S94A 3PJAJ 2VKHA 4JYAT 1VCTA 4U33A 4IE7A 3N9LA 3F31A 2LT3A 4UF0B 3CQCB 3O1IA 1SA0E 5F5WA 3ANWB 2WZIA 5FMNA 2CRBA 4EEDA
chains in the Genus database with same CATH topology
1SE7A 2XY8B 2AXDS 1DU2A 2IDOB 2AE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE7 A;  2XY8 B;  2AXD S;  1DU2 A;  2IDO B;  2AE9 A; 
#chains in the Genus database with same CATH topology
 3WI3 A;  2LSG A;  4CI3 B;  1YKH B;  3ZCJ A;  1UGO A;  3AE4 A;  2LKH A;  2X0H A;  3QC9 A;  4AQG A;  4EEB A;  3CKD A;  4EAH A;  3TLT A;  4HFH A;  4NXN T;  4AIS A;  1D1B A;  4AKR B;  5DQV A;  3AB3 B;  3UUN A;  1KNP A;  2A72 A;  4HGA A;  3K3Q C;  2ZM0 A;  3Q5X A;  4JUY A;  3NVO A;  4Z91 A;  3LBX B;  3PUA A;  2HHH T;  3AEC A;  4P0B A;  5LJN A;  3C4W A;  3O1J A;  2K9A A;  4DR6 T;  2HPL A;  2W00 A;  2E2A A;  3OJA A;  4LF7 T;  2X66 A;  3K3O A;  4L5G A;  2D0T A;  4HFB A;  5AQU B;  5J1G A;  2UXN B;  3FZK B;  3N2O A;  4X66 T;  5CJ5 A;  2UXX B;  3RYI E;  1ZOY A;  1W09 A;  5AQH B;  3ZMU B;  3EDU A;  3R6N A;  2FJD A;  4IDN A;  5HEU A;  2D9D A;  1Z8U A;  3FZH B;  4PJJ A;  3AEG A;  1IBK T;  3ZYM A;  1FMW A;  4JI0 T;  5J2U E;  4XZC A;  4ZOL E;  5FL1 A;  3NWI A;  3RC8 A;  2ZMA A;  2OV9 A;  4KI0 F;  2KZ7 B;  4F6R C;  3KV6 A;  2XQ8 A;  2KT9 A;  3I0O A;  2XQ7 A;  5AQN B;  5L3E B;  3N2G E;  3ZYL A;  2YK0 A;  3TLS A;  4YY3 T;  2HH7 A;  2W61 A;  4HE8 A;  4AXP A;  3WAK A;  2WCA A;  3BK9 A;  2N9D A;  4ZI3 C;  3UQ7 A;  4CXY A;  4ISS A;  5M4Y A;  4ASK A;  3RIF A;  1KNR A;  2V6Y B;  2ZM8 A;  3I9W A;  2H89 A;  2HN2 A;  2YEV C;  4HWH A;  4EYU A;  4CXW A;  1MIV A;  5CFB A;  2PFV A;  1W9R A;  3FHN A;  5L3B B;  3O4X E;  3MKD A;  2JJ9 A;  4PJM A;  2EHO A;  5ABF A;  3CML A;  4DBR A;  2X9X A;  1UCU A;  1IBL T;  4DV1 T;  2V26 A;  4ZZB A;  3GMI A;  4O2B E;  1W0B A;  4GK0 E;  2LSI A;  3CX6 B;  3E0Z A;  1J5E T;  1YW0 A;  3EAM A;  3C4Z A;  4IDQ A;  2XAF B;  4O4H E;  3I1A A;  2JIW A;  4X1K E;  4TZ4 C;  1MND A;  5A1L A;  3KIN B;  2W66 A;  2A2F X;  1HX8 A;  2V6Y A;  2H88 A;  2I0M A;  4UXN B;  1KK7 A;  5KDM C;  4B3M T;  5JR9 B;  4JI6 T;  4X65 T;  4DV7 T;  3IF8 B;  2BS4 A;  3KDS E;  4YXD A;  2QGS A;  2LM2 A;  2FJA A;  2BKN A;  3VR9 A;  2ZLY A;  2X0Y A;  2CLY C;  3CX7 B;  3OYZ A;  2V7K A;  4YJ3 E;  2N2N A;  2XPK A;  2C0S A;  3P7I A;  4MAL A;  5C8Y E;  2ES0 A;  2UXC T;  3UTK A;  4Q25 A;  1J1J A;  4X5T A;  2XAH B;  5FNV E;  4OYJ A;  4JEH B;  3RX6 A;  5KXJ A;  3KV4 A;  5JR9 A;  2LKG A;  4IL4 A;  5EZY E;  5IWA T;  1YKE B;  3UUM A;  3ZCI A;  2JQ9 A;  2BKP A;  4DV2 T;  1WCR A;  5LMN T;  1ZV4 X;  4TN7 B;  3UU8 A;  1HS7 A;  4WZX A;  4G2A A;  2KWI B;  4PW8 A;  2Q9Q B;  3PJA A;  4BJN A;  4XBF B;  1LVK A;  2K3W A;  1X79 A;  5C3J A;  2P9B A;  4NPP A;  4E7Z A;  3ZPO A;  3M3Z B;  3RIU C;  5HAX A;  4A97 A;  4JI2 T;  3O9X A;  2KSR A;  5IHY A;  2L9Q A;  2JRK A;  5KMG P;  2FUP A;  3PTR B;  4ILA A;  2XQY A;  4H9Q C;  5LG4 A;  4DR1 T;  2JMK A;  1SE7 A;  2LRL A;  2XAQ B;  4HFD A;  2VL8 A;  5EK2 A;  3EAB A;  4LFC T;  3UQ4 A;  3N9N A;  3RYF E;  4Z90 A;  3W15 B;  5L3G B;  2YOE A;  3Q5W A;  2IW5 B;  4P1N A;  5L3F B;  4ZI2 C;  1E1H B;  2RA1 A;  1WYB A;  2K24 A;  3C51 A;  4JI5 T;  2KIN B;  5H6Q B;  5LHH B;  2LHR A;  2UUA T;  3RF1 A;  4BJM A;  1JNZ A;  2WWV A;  5ABG A;  3MK7 C;  4H9S E;  3VRA A;  4DUZ T;  3N9M A;  2E9X C;  2CBI A;  4B3S T;  3AA1 B;  3L09 A;  4ZI3 D;  1LVF A;  4UVC B;  2X9Y A;  3AAI A;  2WU2 A;  5TAO A;  2IUB A;  2CPT A;  4JEU B;  2OLT A;  4ZXL A;  2D5U A;  1NEN A;  3HL6 A;  3LK2 B;  4BA9 A;  3K3N A;  4HWI B;  3D0T A;  5AQF B;  3HKC E;  2RPA A;  2UUC T;  4C90 A;  3SWH A;  4U7Y A;  4LFB T;  4LML A;  3ZMZ B;  4X1I E;  2DL1 A;  1R8I A;  2KWH A;  4GOU A;  4X62 T;  4YTM A;  5F8P A;  5FL0 A;  3Q5D A;  3CQX C;  2MPK A;  3FZL B;  3O1H A;  4YLH A;  3M65 A;  2VQF T;  3T1Y T;  4LFA T;  2PJQ A;  3R84 B;  4OFZ A;  5HEG A;  4H63 V;  1O3X A;  4IGU A;  5FVK A;  5JDF A;  3ZN0 B;  2FJE A;  1QUU A;  3IBP A;  2W0G A;  2LSK A;  2F4V T;  3P4Q A;  2K48 A;  2HPJ A;  1N32 T;  5AQI B;  1BR2 A;  2QVA A;  1IJ5 A;  1HNZ T;  2XQ3 A;  3U78 A;  2BS2 A;  2A3D A;  4U31 A;  2DHR A;  4FJO A;  2MAW A;  4YT0 A;  3ZJ2 A;  2ZM6 T;  3FXE B;  4EZ4 A;  4CQI A;  5HWY A;  1LRZ A;  5L47 A;  2BG9 C;  3HKE E;  5HWX A;  3KBT A;  5H6R B;  4PAG A;  3AEA A;  3L8R A;  3NBX X;  2WMN A;  4AKH A;  2NR4 A;  2Y48 B;  4IDZ A;  4N78 D;  4DR7 T;  2X9W A;  1JNR A;  3P4R A;  3QNU A;  4OX9 T;  1Z0P A;  3AA6 B;  2DWK A;  3AE5 A;  4EIW A;  2VKO A;  2XQA A;  3V5S A;  3A5X A;  1OED C;  4OYK A;  1YQ4 A;  1GQE A;  1WR6 A;  4EV6 A;  4ZI7 E;  5FY0 A;  3NRY A;  1MIW A;  4PJL A;  5FXZ A;  3AE1 A;  1T72 A;  4ILB A;  2WMO A;  5JQG E;  4Z8X A;  5HEO A;  4JI1 T;  2DLR A;  5LG3 A;  5JDH A;  4EYY R;  1HCI A;  4YTP A;  1SHZ C;  3RGL A;  4J2C A;  3LK3 B;  1IAP A;  2WP9 A;  2QYW A;  4AI6 A;  2C5J A;  4JI8 T;  1KEY A;  4QH5 A;  2DNX A;  5L4E A;  1D1A A;  1MMA A;  2FBW A;  1E2A A;  3PUZ F;  3QB5 A;  4QH1 A;  3TKL B;  4WYV A;  3T8O A;  2V6X A;  4M1P A;  4ZI2 D;  3NRX A;  3N9P A;  4NUV A;  1XZY A;  2Y6X A;  2CWY A;  2V7J A;  3L39 A;  4B3R T;  2E9X D;  1Y01 A;  4AQY T;  2IHR 1;  3LDQ B;  2EHO B;  5ABF B;  3N9O A;  3AEF A;  4KMC A;  1XMO T;  3K1S A;  3KFW X;  2D0U A;  3TLV A;  4LMJ A;  2XY8 B;  2YKS A;  3WAJ A;  1U5P A;  3AAE B;  2SPC A;  2VQE T;  2YDQ A;  4TV8 E;  5ADX L;  2NOX A;  4U72 A;  1UK5 A;  4HFE A;  1ZEE A;  2A9U A;  4ZS2 A;  2W67 A;  5LGT B;  5JDN A;  2CEA A;  2X51 A;  1MNE A;  3AVS A;  4IE4 A;  2CA5 A;  3VRB A;  2LOS A;  3TLW A;  3G06 A;  2JPF A;  2JMH A;  1MMG A;  4HWF A;  2ACX A;  2V1D B;  4UEL A;  5LNK A;  2CXL A;  4EOZ B;  4EB6 E;  4ILC A;  1VOM A;  4IDP A;  4PJN A;  1QLB A;  2V8S V;  3ESL A;  4MHC A;  4IST A;  3ABV A;  3PDY A;  4X64 T;  1N33 T;  2AE9 A;  5AQO B;  2WU5 A;  3HKD E;  1M62 A;  2BKO A;  4AQF A;  4GYS A;  5HEJ A;  5HYA A;  4ILU A;  3H3M A;  5LCY A;  4QWN B;  3MA9 A;  2NW9 A;  2KND A;  5JRC A;  1HTJ F;  4IHJ E;  4O8S A;  4YSZ A;  3ZST A;  3BQL A;  3ZKR A;  1FJG T;  3CVR A;  5AQL B;  3ZC1 A;  4A98 A;  2XSA A;  3UFE A;  3ZMS B;  3LG7 A;  3ZMT B;  3HR0 A;  4DV0 T;  2CM0 A;  1BR0 A;  4DR5 T;  1LKX A;  4O4J E;  3KV9 A;  4DR2 T;  2XZE A;  2YDR A;  2CHO A;  5HEH A;  3RIU A;  4PK5 A;  2WY2 A;  1IZN B;  2M6I A;  2CE7 A;  5J2T E;  2QA7 A;  5HXR A;  2YN6 A;  3IA3 A;  2E9X B;  5LBM A;  2VKD A;  3UU4 A;  2R6G F;  3JCF A;  2LRK A;  1MIY A;  4HEA A;  4CI2 B;  2VB6 A;  3BQK A;  4DMV A;  2YDS A;  3UUX B;  4NIQ A;  2WDR A;  1E7P A;  3FXD B;  5EK3 A;  1MMN A;  1XDP A;  2VUR A;  3QUJ A;  3UFG A;  3NKZ A;  4H9P C;  3AE2 A;  3P4P A;  1XDO A;  4HWD A;  3FZM B;  2NTY A;  4QX7 B;  2MYS A;  3I0Q A;  2XQ9 A;  4TWH A;  4TNV A;  4DID B;  3NZQ A;  3PUV F;  4QXC B;  1HF8 A;  1YD8 G;  3AE6 A;  3ZSS A;  3EHZ A;  1HG2 A;  3KVB A;  4QKN A;  1NAF A;  2WDQ A;  5AQP B;  3VKG A;  3VR8 A;  2E9X A;  3AVR A;  2X9H A;  2I6H A;  1MMD A;  1OXZ A;  2UU9 T;  4QX8 B;  3LSV A;  2WSS V;  5JTG A;  5HCM A;  1XMQ T;  2IC9 A;  2X67 A;  2JQQ A;  3UU5 A;  5ABH A;  4GKJ T;  2OA5 A;  5LHG B;  3RC3 A;  1XNR T;  2YIN A;  4LF6 T;  3EI0 A;  2L8K A;  4QXH B;  1AJ3 A;  3ZLI A;  1W0A A;  5HXS A;  4FI5 A;  5JR9 C;  2XQ4 A;  5FYM A;  4EGW A;  2HN1 A;  3TLU A;  2X0L B;  2LSY A;  3AED A;  4GIW A;  5DAB A;  4C91 A;  2WQY A;  3NZP A;  5LJM A;  1YQ3 A;  3AA7 B;  2VL0 A;  2WBL A;  4HFI A;  4A56 A;  1T8B A;  1CUN A;  1ZP0 A;  1WR0 A;  4PNI A;  3ZN1 B;  5AQK B;  5BMV E;  3KBU A;  5FKY A;  3RLF F;  2LLY A;  2VKJ A;  3AE7 A;  3EUH A;  2NTX A;  2XAJ B;  4IDO A;  2W2U A;  4NXM T;  2LSJ A;  2MOZ A;  3KVA A;  5IYZ E;  1EZ3 A;  4MBQ A;  4X20 E;  3P50 A;  3ONJ A;  3N5L A;  3P4W A;  3SOL A;  4CN4 A;  4AKG A;  3RKG A;  1DU2 A;  2E5V A;  3PUX F;  4O2A E;  4KHP T;  5FXV A;  2LJL A;  2CMR A;  3AXJ B;  1KNZ A;  2Z6E A;  4IL9 A;  5AQJ B;  2X68 A;  5HCJ A;  4KBM B;  3B57 A;  1D0Z A;  1WLX A;  4UV9 B;  3GA8 A;  3P4S A;  1US7 B;  4JBW F;  5AQM B;  3GWH A;  3AEB A;  4PK4 A;  4DBQ A;  3RQU A;  2NW7 A;  3RYC E;  3UT5 E;  2Q9Q C;  2H7V C;  3B5M A;  2K5B B;  4IE0 A;  2ACZ A;  5LGU B;  3JAF A;  4U74 A;  2XSB A;  3E22 E;  1T7S A;  4ADZ A;  3SRZ A;  5L3C B;  2XM1 A;  2XUE A;  3PU8 A;  2VVN A;  4DR4 T;  2MBG A;  3VHL A;  4U2Y A;  1OED A;  3ZYK A;  4DMW A;  4ZZC A;  3AXJ A;  3CQG B;  2IML A;  4G63 A;  2XM2 A;  2W63 A;  1G8X A;  2J62 A;  2W4X A;  4YHJ A;  4LF9 T;  1QSD A;  3PUG A;  5L4H A;  3Q2M A;  5EK4 A;  3UUB A;  4HN9 A;  4K0U A;  4OHF A;  2BBJ A;  2E5L T;  3ZT6 A;  4IT4 A;  5LGN B;  4LF5 T;  5LHI B;  3UU3 A;  5LMU T;  3SFD A;  3AAA B;  4WBN E;  3RRW A;  1UUS A;  1HR0 T;  1HG5 A;  2RP4 A;  3SS1 A;  4L0R A;  3L3P A;  1N36 T;  4QXB B;  3ZT7 A;  3RPU A;  5LBQ B;  5DJQ C;  4IRE A;  3OVU A;  2BVL A;  4XAX B;  4DV3 T;  3RYH E;  1XNQ T;  1HNW T;  3PUW F;  1HX1 B;  2QRX A;  2N1G A;  2I59 A;  3QB5 K;  2XAS B;  2UUB T;  3QOF A;  4DR3 T;  4KX6 A;  1WRD A;  2V5C A;  3JAD A;  3AE3 A;  2DWG A;  5ETW A;  2YU1 A;  2AXD S;  4LF4 T;  5AQG B;  3HKB E;  2M6B A;  5JRE A;  2BVM A;  2V7I A;  4E7S A;  4YSX A;  1G73 A;  2VVS A;  2BBH A;  2J4G A;  3AE9 A;  3FBL A;  4YJ2 E;  3PV0 F;  4CXX A;  4UF0 A;  3OKQ A;  2B76 A;  4TUY E;  4UVA B;  1I6Z A;  3P8C D;  2UXD T;  3ANW A;  5LYJ E;  2LHN A;  2CXD A;  1BR4 A;  5FXX A;  4UV8 B;  3ONX A;  5CB4 E;  4TV9 E;  4ANJ A;  4WBO A;  3H3A A;  1NWM X;  4O4L E;  2IDO B;  5FY1 A;  3C4X A;  2E8I A;  4WNK A;  5JDM A;  1UUR A;  4L9I A;  3ZT5 A;  2CLY B;  4H63 H;  2UXB T;  2BG9 E;  4YTN A;  1KFY A;  4I43 B;  3RHW A;  4AIU A;  5C2T A;  2V7L A;  3CPZ A;  2J1D G;  3LBX A;  4X1Y E;  3ZEF B;  3C98 B;  5CA0 E;  4KUM B;  5JDQ A;  3IEE A;  4I0U A;  2V5D A;  4WW0 A;  3OBV E;  4MFR A;  1KF6 A;  1OED E;  5JRC B;  2LM9 A;  3CX8 B;  4CN6 A;  3QK6 A;  2BDE A;  5DQW A;  1S35 A;  5LB7 B;  3ETV A;  5JVD E;  2WS3 A;  3I9Y A;  3JAE A;  3S4U A;  2YU2 A;  1UX5 A;  2Q9Q D;  4JI7 T;  1B7T A;  2WAU A;  1D0X A;  4P09 A;  4DVD A;  5FP3 A;  4CZZ B;  5AFU L;  4QH4 A;  5IUX A;  4H9R C;  3J9X 1;  2IAK A;  3JC6 C;  5AQQ B;  5ABE A;  2Y8D A;  3C64 A;  5HXC A;  2CWO A;  1H7C A;  2ODU A;  2H3R A;  4ZHQ E;  4DO0 A;  4HTE A;  2PG8 A;  4DND A;  2J47 A;  2VWA A;  2C5I T;  2KMF A;  4U7I A;  3DTO A;  3PU3 A;  2WM9 A;  3PE0 A;  5AQS B;  4UIG A;  4TNW A;  3RQW A;  2XHE B;  1ZHC A;  3RKO A;  3ETU A;  4B3T T;  2CBJ A;  2V7M A;  4DV4 T;  4TWF A;  1U4Q A;  5FXW A;  3FZF B;  1BR1 A;  4CN1 A;  3CIR A;  5E0O A;  4TWD A;  3A8Y C;  4HKA A;  5L2L A;  4I4T E;  3F57 A;  3GN5 B;  3EDV A;  2EHO C;  2NP9 A;  5FY7 A;  4F8H A;  2D2S A;  2H7O A;  2KLQ A;  2W62 A;  3PUY F;  2PBI A;  3LFM A;  4UVB B;  5LOV E;  2PTF A;  4AQF C;  1D1C A;  1D0Y A;  3N2K E;  3K8P C;  3CK6 A;  3DJB A;  5J0Z A;  4IE5 A;  2CHN A;  5LA6 E;  3ZMV B;  4DV6 T;  4KP3 C;  4LF8 T;  1FIO A;  3GN5 A;  2G0U A;  2JQK A;  2WDV A;  1YXR A;  5JDG A;  4JV5 T;  4UR9 A;  2CXF A;  3V5U A;  3PUQ A;  5JDL A;  2ZM2 A;  1ZKE A;  4GKK T;  3VKH A;  3HA4 A;  2JQH A;  3AE8 A;  4MLK A;  3MJX A;  4YHH T;  4OK0 A;  3SFE A;  2IIU A;  3UUL A;  1FMV A;  2LE8 A;  4KHZ F;  4ZS3 A;  2LEH A;  2BS3 A;  5AQV B;  3OPC A;  1IBM T;  3N9Q A;  5AQT B;  3ZJ1 A;  5GON E;  4P0A A;  4GYR A;  4PFO A;  1HFA A;  2KXP B;  1V9D A;  4PK6 A;  3OTO T;  3ZC0 A;  3B13 A;  1FEW A;  2Q9Q A;  4EXT A;  3U3I A;  4HWC A;  1L0V A;  3AA0 B;  2VK9 A;  4AKL A;  5LP6 E;  2WWU A;  3MZK B;  5LXT E;  3RI5 A;  3CWZ B;  4ERR A;  2BG9 B;  2XQ6 A;  1VRB A;  5BR8 T;  3T1H T;  3Q9D A;  3MAC A;  3A7M A;  3LK4 2;  1J5W A;  3VU7 H;  4H9O C;  2WB5 A;  3HI2 A;  4GK5 E;  4CI1 B;  2BZB A;  3FBZ A;  1VCS A;  4JLE A;  2NW8 A;  2XTL A;  2M67 A;  4U3C A;  3IHR A;  1N34 T;  1OED B;  2ODV A;  1WFD A;  1I94 T;  4PFP A;  5HXH A;  5CGM A;  1Y64 B;  5JH7 E;  4I55 E;  1UX4 A;  4AKI A;  2XAG B;  2B1E A;  3ONL C;  3JC6 D;  4IIJ E;  4BAY B;  2BG9 A;  3LJC A;  3OYX A;  4COF A;  3RRC A;  3EVY A;  5F3J A;  4JI4 T;  2XQ5 A;  1CHU A;  4U2Z A;  3H37 A;  3UU6 A;  3AEE A;  5CA1 E;  3FB2 A;  1SUM B;  4UEM A;  2NWB A;  4IE6 A;  4V1A v;  4O4I E;  5FVL A;  4LMK A;  4K0K T;  5L3D B;  1X9B A;  1WYC A;  5HXE A;  3RH3 A;  1T98 A;  3C50 A;  2DI4 A;  5AQR B;  3DP7 A;  4TX5 A;  4B6X A;  4ZEY A;  1HNX T;  2C5K T;  5KX5 E;  3BQI A;  1IJ6 A;  1M7K A;  2VAS A;  4NUU A;  1XWM A;  2XJ7 A;  3F2E A;  4YFS A;  2EHO D;  3Q5E A;  4I50 E;  2L3L A;  3PUR A;  2LOP A;  2MTQ A;  4DUY T;  4A5X A;  3MXZ A;  2DCF A;  3PUS A;  4H9N C;  3E08 A;  2IC6 A;  3J7Y q;  4QHO A;  4YSY A;  2GK9 A;  3RIA A;  4HFC A;  1OWA A;  4EZH A;  3X1D A;  2WZH A;  4JI3 T;  4HFV A;  4DV5 T;  2FJB A;  3KV5 A;  2CCQ A;  1NEK A;  1S94 A;  3PJA J;  2VKH A;  4JYA T;  1VCT A;  4U33 A;  4IE7 A;  3N9L A;  3F31 A;  2LT3 A;  4UF0 B;  3CQC B;  3O1I A;  1SA0 E;  5F5W A;  3ANW B;  2WZI A;  5FMN A;  2CRB A;  4EED A; 
#chains in the Genus database with same CATH homology
 1SE7 A;  2XY8 B;  2AXD S;  1DU2 A;  2IDO B;  2AE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...