1SE7A

Solution structure of the e. coli bacteriophage p1 encoded hot protein: a homologue of the theta subunit of e. coli dna polymerase iii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
MYDWNIAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQLSLQLPKGSDPAYQKDDAVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phage Like It HOT: Solution Structure of the Bacteriophage P1-Encoded HOT Protein, a Homolog of the theta Subunit of E. coli DNA Polymerase III
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Transferase
molecule keywords HOMOLOGUE OF THE THETA SUBUNIT OF DNA POLYMERASE III
total genus 18
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 1se7A00
2IDOB 1SE7A 1DU2A 2XY8B 2AXDS 2AE9A
chains in the Genus database with same CATH superfamily
4EGWA 5FKYA 1XWMA 4QKNA 2PFVA 5IWAT 3DTOA 1D1BA 2YK0A 1OEDC 1Y64B 2XPKA 3AE5A 1HX1B 3RYFE 4NUUA 2BDEA 1QUUA 3TKLB 4X66T 2XQYA 3O1HA 4LFAT 2X68A 3F57A 4YHHT 4I43B 1SA0E 3MA9A 3IHRA 2A9UA 4X1IE 5BMVE 1LRZA 4I4TE 1MMGA 4YT0A 4AQFA 5LHGB 3ZJ1A 3UU3A 2V6YA 2HN2A 1XNRT 4PW8A 3ONXA 3Q5XA 4DV0T 1FJGT 2HH7A 3ESLA 1J1JA 1HNZT 4H9PC 3HL6A 4DBRA 2WDQA 1NEKA 3ETVA 4EOZB 4ADZA 2LRLA 1SUMB 3CQXC 3I0QA 4B3RT 5AQRB 5HYAA 3V5SA 4IGUA 3AAIA 2VQFT 3AE2A 3AVSA 2LSIA 3P4WA 4JEUB 4AISA 1D1AA 1ZV4X 4DV1T 3FB2A 1BR1A 4C90A 3M3ZB 4X1KE 5TAOA 2YU1A 2Q9QA 3P4QA 2YKSA 2CWOA 3FHNA 3OYXA 4H9SE 4ZI2C 5ABFA 2BBHA 1M62A 4HWDA 5AQNB 3F31A 3CKDA 2DL1A 3GA8A 2SPCA 4QX8B 5FYMA 5CA1E 4WNKA 1BR0A 2V5CA 3P4PA 3JADA 4MALA 2H89A 4PNIA 4DR4T 1T98A 2W67A 4BJNA 4AQGA 4IE6A 5EK2A 1G8XA 1W0BA 2V7LA 3VRAA 1UGOA 4X64T 5L3BB 2V26A 1XDOA 2H3RA 1ZKEA 3N9PA 4HFEA 4P0BA 3NWIA 4JLEA 4EIWA 3EHZA 4JI1T 2CXDA 3FXEB 1E7PA 2XAQB 4HEAA 3R6NA 4AXPA 2ZM6T 5L3EB 5L4HA 2X0YA 2XQ7A 3I1AA 4U74A 2L9QA 4QH1A 3UFEA 4B3MT 1X79A 3K8PC 1I6ZA 3AE9A 4H63V 4QH5A 3ZN0B 1ZEEA 3AECA 4U7YA 5LMUT 2WU2A 3C64A 2L3LA 2LKHA 3UQ4A 4YXDA 5AQOB 5CA0E 4LFCT 1N33T 2JMHA 1ZP0A 1I94T 4AKRB 2ZM0A 3S4UA 4O4LE 5HEGA 2DWGA 3HKBE 3UU6A 4ILAA 1BR2A 4L5GA 3FXDB 4K0KT 3KV5A 4QH4A 3KV6A 4ZEYA 4DR7T 1QLBA 3AA6B 3P4RA 2NTXA 4IL9A 4G2AA 3Q5WA 4K0UA 4HGAA 4WBNE 1IJ6A 1V9DA 1SHZC 2CLYC 2WDRA 3F2EA 4HE8A 5HCMA 2JPFA 3UFGA 4JI7T 3N5LA 1YKHB 4TV9E 5AQJB 1O3XA 3OTOT 3ANWA 3K3QC 3VKHA 3PJAA 2YOEA 4NXNT 4L9IA 5AQGB 4U31A 2BG9A 3QK6A 3T8OA 3JC6C 3NZQA 3TLUA 2BG9B 2LJLA 4HFHA 3B57A 2P9BA 2PJQA 2X9HA 3FZHB 3NRYA 3N2GE 3RIUC 2LOPA 3G06A 4EEDA 4EYUA 3NVOA 3RH3A 4KBMB 5LG3A 4DR2T 2KSRA 3LSVA 2XQAA 4YTNA 4CZZB 2EHOD 3UU4A 3RQWA 5HXCA 3AE4A 2KXPB 5GONE 4HWFA 4A97A 4IDNA 1WYCA 3N9QA 5FMNA 2WZIA 2XM2A 1HFAA 3CX7B 5ADXL 5J2UE 5L4EA 1D0YA 4KHZF 1KNZA 5DJQC 4O4HE 3JC6D 1IJ5A 2VWAA 4JI8T 2N2NA 2A72A 4JUYA 3V5UA 4DV4T 2MBGA 4H9RC 3ZSTA 5LBMA 4QXHB 1UCUA 3ZEFB 3ZLIA 4CXWA 1US7B 1UURA 4CI1B 3UUXB 2A2FX 2LOSA 1KK7A 4GK0E 2NP9A 1VRBA 4GK5E 3D0TA 1U5PA 4H63H 2C5KT 2KZ7B 3FZFB 4Z90A 4IDOA 3RIAA 1IZNB 3AE1A 5DABA 4JI6T 2D2SA 4UF0A 2IAKA 1J5WA 3ZC1A 1S94A 1BR4A 3MZKB 5L2LA 2ACXA 2IIUA 3R84B 3LG7A 2W61A 2BG9C 5KX5E 3ZSSA 1MNEA 2R6GF 4Q25A 3ZYKA 2DHRA 1OWAA 3UUBA 4EYYR 4HFBA 5AFUL 3TLVA 5H6QB 4EAHA 4I0UA 2UXCT 4GKJT 4YTPA 4YJ3E 2E2AA 2WMNA 2V7JA 2AE9A 3JAFA 5JDHA 2UUBT 4UV9B 3LBXA 5JR9A 2CMRA 2ODVA 3PE0A 5KXJA 3NZPA 2N9DA 2WM9A 2VK9A 3AAAB 3ZPOA 3RI5A 3AVRA 1XNQT 2MAWA 4TWDA 1HF8A 1EZ3A 2IMLA 4EXTA 2FUPA 4AQFC 5ABHA 4OHFA 2XQ5A 1WYBA 1T8BA 4YSXA 2IHR1 4HN9A 4IE4A 1HNXT 3AXJB 3N2OA 3MXZA 3HKEE 4TZ4C 2NW9A 4JEHB 5DQVA 5LMNT 1MMDA 2Y6XA 3WI3A 3H37A 5JREA 2YN6A 3KV4A 3PUQA 4GIWA 4PFOA 1KNPA 4ILUA 4X1YE 2K5BB 5LJMA 2CE7A 5AQPB 4B6XA 3L3PA 5FNVE 3UU5A 2E9XC 4LMLA 3ZMZB 4ZOLE 3AE6A 4UR9A 3ZT7A 2PBIA 4QHOA 1D1CA 5FY0A 4ZI3D 2FJBA 1WLXA 1X9BA 1LKXA 1W9RA 3AE7A 4U33A 3T1YT 2BS2A 3FZKB 5JVDE 4L0RA 4A5XA 4DV2T 2I0MA 1LVFA 5KMGP 3PUGA 2LEHA 3RRWA 4LF8T 2X67A 1MMNA 3CK6A 3P50A 1XMOT 3CMLA 1UX5A 3LDQB 3N9MA 3O4XE 2DWKA 4FI5A 5EK3A 2DCFA 5LGTB 2V7MA 4MLKA 4ISSA 5JR9C 1JNRA 1H7CA 1FEWA 1YD8G 2IDOB 1UK5A 3GMIA 3NKZA 3QB5K 3NRXA 4XAXB 4DVDA 5HXSA 2B1EA 2VKOA 5JDLA 5HEHA 3O1IA 2CHNA 5LYJE 3T1HT 5A1LA 2CPTA 5L3CB 4LF7T 2VASA 5JRCB 2CXFA 4BA9A 4M1PA 5LJNA 2XY8B 5FVKA 3ZN1B 3CPZA 4KMCA 1YW0A 2BVMA 3E08A 5AQHB 5JDFA 3ZMUB 1NAFA 1Z0PA 1VOMA 3UTKA 3UQ7A 3P4SA 2BKPA 1MMAA 2CM0A 3FZMB 2ES0A 5JRCA 4HFVA 1WCRA 4X5TA 2XQ8A 2YINA 4J2CA 4DV6T 3A8YC 4CN6A 4PJJA 4O2BE 4IL4A 2Q9QB 4U3CA 4FJOA 4OX9T 3OYZA 1IBKT 3ZC0A 2VVNA 3ZCJA 2Q9QD 5JR9B 2LSKA 1OEDE 5IUXA 4HWHA 4E7ZA 3JCFA 4AIUA 4TWHA 3KBUA 1MNDA 2I6HA 2OA5A 4XBFB 3LK2B 1WRDA 4GKKT 1YXRA 4DR3T 2ZMAA 5C3JA 5LGNB 4IE0A 3DJBA 5HXRA 1L0VA 3SFEA 4DR6T 2JQHA 2LHNA 2Y48B 3I9WA 5DQWA 3W15B 4YHJA 5CGMA 3B5MA 4NIQA 4OYJA 1G73A 2HPLA 2WZHA 2C0SA 2XQ3A 1NENA 3PJAJ 4QXBB 2XHEB 5JTGA 3FBLA 2V6YB 5CB4E 2KWHA 4X65T 4DUYT 5EZYE 3BQKA 3BQLA 3EDVA 2IC6A 4ISTA 2WCAA 2D9DA 2WWVA 4OFZA 5EK4A 4UELA 2WSSV 3GN5A 4DUZT 2Q9QC 3KINB 4DIDB 1N34T 2VVSA 4CXXA 4ZZBA 4X20E 2JIWA 2NR4A 1D0XA 2V1DB 3RQUA 3TLSA 5CJ5A 4UVBB 4HTEA 1ZOYA 3ZYMA 1IBMT 2K9AA 2H7VC 3PURA 3QB5A 2KNDA 2G0UA 3LK42 2X9WA 4YSYA 5IHYA 4DO0A 3IBPA 4ZHQE 4JI2T 3ZT5A 3UT5E 3VKGA 1YQ4A 2MYSA 2KINB 3PUYF 5FXXA 2WB5A 2MPKA 2K3WA 2X66A 4H9OC 3J9X1 3RLFF 4HFDA 4ANJA 5AQMB 3N9LA 4LF9T 2UU9T 3CQCB 4O8SA 4CQIA 1N36T 2BVLA 2IUBA 3O9XA 4N78D 1HG2A 2NW7A 2OV9A 5AQSB 3SOLA 2VKHA 4KUMB 3ZT6A 5LXTE 3PV0F 4HWCA 5FY7A 2CBJA 3BK9A 2I59A 2JQ9A 2KWIB 3RYCE 4Z8XA 5HEJA 4YJ2E 4ILBA 4EZ4A 2ZM2A 5HWYA 2J1DG 3GWHA 1T72A 3EAMA 2V5DA 5HEOA 1QSDA 2UXNB 5LA6E 3CIRA 5F5WA 5HWXA 2PG8A 2CEAA 3O1JA 4LFBT 3X1DA 1HX8A 2M67A 2YDSA 3PUXF 4YLHA 2B76A 1KNRA 5E0OA 4ZZCA 3PUAA 5JDMA 4DR5T 2BKOA 3ZMVB 2X9YA 3CQGB 3Q9DA 2KLQA 5FXVA 3Q2MA 4P09A 3A5XA 3FZLB 4KP3C 1HR0T 5CFBA 4YSZA 4LF4T 5AQLB 1U4QA 5J2TE 4CI3B 4JI0T 3N9NA 3AEDA 2JQKA 2DI4A 2WY2A 5LBQB 4IHJE 2HN1A 2W4XA 2YDRA 2ZLYA 3C50A 2W63A 2NTYA 3KV9A 3QOFA 2MTQA 2AXDS 1FIOA 2H7OA 1UUSA 2YDQA 3AE3A 3QC9A 3EI0A 3QNUA 4YTMA 4JYAT 5C8YE 3IA3A 4PK4A 4UV8B 4AQYT 5M4YA 2XQ9A 2UUAT 2LSYA 5C2TA 2BS4A 4CN1A 3RIFA 4C91A 3N9OA 2XSBA 4PAGA 3OBVE 4ZXLA 3CWZB 2QA7A 3N2KE 3SS1A 5HXHA 2UXDT 2VL0A 3AA0B 4AKGA 4IDQA 3AXJA 3PUSA 5AQUB 5FL1A 1WR6A 1OEDA 4NXMT 4KI0F 2LE8A 5L3FB 4PJMA 3OKQA 1MIWA 3RKOA 4ZS3A 3CX8B 4G63A 4WW0A 3RPUA 4JV5T 4CXYA 2XAGB 2C5IT 2GK9A 3H3AA 2E5VA 2CRBA 2HPJA 3PUWF 5FVLA 5FY1A 2IW5B 4KHPT 3HA4A 1T7SA 3HR0A 3KVAA 4PK6A 1OXZA 3LBXB 4YFSA 2HHHT 1KF6A 5J0ZA 4B3ST 4EZHA 1Y01A 3ONJA 4AKIA 1UX4A 4UIGA 3LJCA 4ERRA 2LRKA 5AQIB 3L09A 4NUVA 4EV6A 2F4VT 3MKDA 3ZMSB 2K24A 4MFRA 4ZI7E 1M7KA 2KT9A 2LT3A 2XZEA 3Q5DA 1YQ3A 3OVUA 4UF0B 5JDGA 4IT4A 2M6IA 2IC9A 2ODUA 3AAEB 3K1SA 4ZS2A 5LG4A 2D0TA 3PTRB 2W62A 4NPPA 2L8KA 5AQVB 5LB7B 3RC3A 1HG5A 3E0ZA 4GYSA 3TLTA 5LCYA 4I50E 4ZI3C 2NW8A 3M65A 1E2AA 2XTLA 3RKGA 4LMJA 1LVKA 1VCSA 4AKLA 4BJMA 5LHIB 3MJXA 3RYHE 2K48A 3UUMA 4DNDA 2XSAA 3Q5EA 2LHRA 4DR1T 5ABGA 1KEYA 2BS3A 3EABA 4GOUA 5JH7E 2V8SV 4MBQA 4WBOA 2X0LB 3SRZA 5ETWA 5LGUB 2MOZA 4ILCA 4UVCB 5ABEA 1CHUA 2NWBA 3PUVF 2RA1A 3AEFA 3L39A 3KDSE 1D0ZA 2Z6EA 2E8IA 3KBTA 2FJEA 4TWFA 3L8RA 4HFIA 5AQTB 3VRBA 5L3DB 3KVBA 4PFPA 4EB6E 3EVYA 4HKAA 4B3TT 1FMVA 4PK5A 1HNWT 2WS3A 3ONLC 2BBJA 5LP6E 2EHOA 3RRCA 4EEBA 3H3MA 2JQQA 4QWNB 2NOXA 3RYIE 4HFCA 3WAJA 1XDPA 2UXBT 5LOVE 4AKHA 2CBIA 2UXXB 3AEAA 4Z91A 2X0HA 2W0GA 3FBZA 4X62T 2WP9A 5J1GA 2XM1A 3VR9A 5FXZA 4JI4T 3PDYA 3CVRA 3ZCIA 5JQGE 3K3OA 2CHOA 5L3GB 3J7Yq 3SFDA 4UXNB 5H6RB 1YKEB 4DBQA 2VKJA 2W2UA 4I55E 4AI6A 4TNWA 4H9NC 5HXEA 4LF5T 2FBWA 3SWHA 3U78A 4CN4A 3BQIA 1N32T 1IBLT 2LM2A 3P7IA 1R8IA 3P8CD 4TUYE 2WBLA 4TX5A 3EDUA 2CXLA 2JRKA 3A7MA 3UUNA 5L47A 3B13A 1MIVA 2WQYA 2E9XD 3AA7B 4IE7A 4E7SA 2XQ4A 3ZYLA 2XAFB 2E9XB 2ZM8A 3HKCE 1GQEA 1IAPA 2OLTA 2X9XA 4TN7B 1SE7A 2W66A 4XZCA 3OPCA 3AE8A 1S35A 2DLRA 2LSJA 3RX6A 3UULA 4A56A 5LNKA 1FMWA 2J62A 3WAKA 1W09A 4QX7B 2N1GA 1CUNA 2ACZA 2VB6A 4ZI2D 4TV8E 5AQFB 2VQET 1VCTA 1HCIA 5FL0A 5HAXA 3EUHA 2VL8A 4IE5A 3PU8A 5JDQA 3VHLA 2WU5A 4KX6A 5JDNA 1XMQT 2VURA 2BG9E 3KFWX 2EHOC 2VKDA 3C51A 3I9YA 2QGSA 2CWYA 2CLYB 2A3DA 3C4WA 3E22E 3DP7A 5HEUA 1DU2A 3AA1B 3UU8A 2BKNA 4DMWA 4V1Av 2WWUA 4IIJE 2BZBA 3LK3B 3RC8A 1NWMX 1J5ET 4U2ZA 4DV5T 2XAHB 3VU7H 3AEBA 5HCJA 1WFDA 3HI2A 2KMFA 2QRXA 3ANWB 4F6RC 2RPAA 2V7IA 3RGLA 2UUCT 3GN5B 3PU3A 4MHCA 5FP3A 5IYZE 3ETUA 4DV7T 1HTJF 3MK7C 2XASB 3CX6B 2CA5A 2LM9A 4UEMA 4COFA 1WR0A 5KDMC 4U72A 1HS7A 2WDVA 4JI5T 2JMKA 2E9XA 5FXWA 2E5LT 4U7IA 2FJDA 4O2AE 4DMVA 2LKGA 1E1HB 3ABVA 2C5JA 3NBXX 4QXCB 3ZKRA 4GYRA 3AEGA 2DNXA 4P1NA 2WMOA 3OJAA 2LSGA 1B7TA 3K3NA 3AB3B 3JAEA 2JJ9A 2YU2A 3I0OA 2D5UA 4IREA 2FJAA 1ZHCA 2W00A 2QYWA 3AEEA 3PUZF 4A98A 4CI2B 4JI3T 2XUEA 5AQQB 2RP4A 2Y8DA 4IDPA 3TLWA 3LFMA 3IF8B 5F8PA 3VR8A 5F3JA 5BR8T 4P0AA 2J47A 4JBWF 4BAYB 2X51A 2LLYA 4H9QC 4LF6T 1AJ3A 2WAUA 2XJ7A 1Z8UA 1OEDB 1MIYA 3IEEA 2V7KA 2V6XA 3C98B 1JNZA 4IDZA 4O4JE 2EHOB 4PJLA 3RF1A 3HKDE 4PJNA 3MACA 5AQKB 2PTFA 4OYKA 5ABFB 4DV3T 1XZYA 2CCQA 2M6BA 4TNVA 4UVAB 5LHHB 4O4IE 4LMKA 1W0AA 2H88A 3RIUA 2D0UA 2QVAA 3RHWA 2XAJB 2YEVC 4HWIB 4WYVA 4U2YA 3ZMTB 4ASKA 4F8HA 3U3IA 4OK0A 3C4ZA 3ZJ2A 2XQ6A 4WZXA 3QUJA 1KFYA 4YY3T 3C4XA 2J4GA
chains in the Genus database with same CATH topology
2IDOB 1SE7A 1DU2A 2XY8B 2AXDS 2AE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDO B;  1SE7 A;  1DU2 A;  2XY8 B;  2AXD S;  2AE9 A; 
#chains in the Genus database with same CATH topology
 4EGW A;  5FKY A;  1XWM A;  4QKN A;  2PFV A;  5IWA T;  3DTO A;  1D1B A;  2YK0 A;  1OED C;  1Y64 B;  2XPK A;  3AE5 A;  1HX1 B;  3RYF E;  4NUU A;  2BDE A;  1QUU A;  3TKL B;  4X66 T;  2XQY A;  3O1H A;  4LFA T;  2X68 A;  3F57 A;  4YHH T;  4I43 B;  1SA0 E;  3MA9 A;  3IHR A;  2A9U A;  4X1I E;  5BMV E;  1LRZ A;  4I4T E;  1MMG A;  4YT0 A;  4AQF A;  5LHG B;  3ZJ1 A;  3UU3 A;  2V6Y A;  2HN2 A;  1XNR T;  4PW8 A;  3ONX A;  3Q5X A;  4DV0 T;  1FJG T;  2HH7 A;  3ESL A;  1J1J A;  1HNZ T;  4H9P C;  3HL6 A;  4DBR A;  2WDQ A;  1NEK A;  3ETV A;  4EOZ B;  4ADZ A;  2LRL A;  1SUM B;  3CQX C;  3I0Q A;  4B3R T;  5AQR B;  5HYA A;  3V5S A;  4IGU A;  3AAI A;  2VQF T;  3AE2 A;  3AVS A;  2LSI A;  3P4W A;  4JEU B;  4AIS A;  1D1A A;  1ZV4 X;  4DV1 T;  3FB2 A;  1BR1 A;  4C90 A;  3M3Z B;  4X1K E;  5TAO A;  2YU1 A;  2Q9Q A;  3P4Q A;  2YKS A;  2CWO A;  3FHN A;  3OYX A;  4H9S E;  4ZI2 C;  5ABF A;  2BBH A;  1M62 A;  4HWD A;  5AQN B;  3F31 A;  3CKD A;  2DL1 A;  3GA8 A;  2SPC A;  4QX8 B;  5FYM A;  5CA1 E;  4WNK A;  1BR0 A;  2V5C A;  3P4P A;  3JAD A;  4MAL A;  2H89 A;  4PNI A;  4DR4 T;  1T98 A;  2W67 A;  4BJN A;  4AQG A;  4IE6 A;  5EK2 A;  1G8X A;  1W0B A;  2V7L A;  3VRA A;  1UGO A;  4X64 T;  5L3B B;  2V26 A;  1XDO A;  2H3R A;  1ZKE A;  3N9P A;  4HFE A;  4P0B A;  3NWI A;  4JLE A;  4EIW A;  3EHZ A;  4JI1 T;  2CXD A;  3FXE B;  1E7P A;  2XAQ B;  4HEA A;  3R6N A;  4AXP A;  2ZM6 T;  5L3E B;  5L4H A;  2X0Y A;  2XQ7 A;  3I1A A;  4U74 A;  2L9Q A;  4QH1 A;  3UFE A;  4B3M T;  1X79 A;  3K8P C;  1I6Z A;  3AE9 A;  4H63 V;  4QH5 A;  3ZN0 B;  1ZEE A;  3AEC A;  4U7Y A;  5LMU T;  2WU2 A;  3C64 A;  2L3L A;  2LKH A;  3UQ4 A;  4YXD A;  5AQO B;  5CA0 E;  4LFC T;  1N33 T;  2JMH A;  1ZP0 A;  1I94 T;  4AKR B;  2ZM0 A;  3S4U A;  4O4L E;  5HEG A;  2DWG A;  3HKB E;  3UU6 A;  4ILA A;  1BR2 A;  4L5G A;  3FXD B;  4K0K T;  3KV5 A;  4QH4 A;  3KV6 A;  4ZEY A;  4DR7 T;  1QLB A;  3AA6 B;  3P4R A;  2NTX A;  4IL9 A;  4G2A A;  3Q5W A;  4K0U A;  4HGA A;  4WBN E;  1IJ6 A;  1V9D A;  1SHZ C;  2CLY C;  2WDR A;  3F2E A;  4HE8 A;  5HCM A;  2JPF A;  3UFG A;  4JI7 T;  3N5L A;  1YKH B;  4TV9 E;  5AQJ B;  1O3X A;  3OTO T;  3ANW A;  3K3Q C;  3VKH A;  3PJA A;  2YOE A;  4NXN T;  4L9I A;  5AQG B;  4U31 A;  2BG9 A;  3QK6 A;  3T8O A;  3JC6 C;  3NZQ A;  3TLU A;  2BG9 B;  2LJL A;  4HFH A;  3B57 A;  2P9B A;  2PJQ A;  2X9H A;  3FZH B;  3NRY A;  3N2G E;  3RIU C;  2LOP A;  3G06 A;  4EED A;  4EYU A;  3NVO A;  3RH3 A;  4KBM B;  5LG3 A;  4DR2 T;  2KSR A;  3LSV A;  2XQA A;  4YTN A;  4CZZ B;  2EHO D;  3UU4 A;  3RQW A;  5HXC A;  3AE4 A;  2KXP B;  5GON E;  4HWF A;  4A97 A;  4IDN A;  1WYC A;  3N9Q A;  5FMN A;  2WZI A;  2XM2 A;  1HFA A;  3CX7 B;  5ADX L;  5J2U E;  5L4E A;  1D0Y A;  4KHZ F;  1KNZ A;  5DJQ C;  4O4H E;  3JC6 D;  1IJ5 A;  2VWA A;  4JI8 T;  2N2N A;  2A72 A;  4JUY A;  3V5U A;  4DV4 T;  2MBG A;  4H9R C;  3ZST A;  5LBM A;  4QXH B;  1UCU A;  3ZEF B;  3ZLI A;  4CXW A;  1US7 B;  1UUR A;  4CI1 B;  3UUX B;  2A2F X;  2LOS A;  1KK7 A;  4GK0 E;  2NP9 A;  1VRB A;  4GK5 E;  3D0T A;  1U5P A;  4H63 H;  2C5K T;  2KZ7 B;  3FZF B;  4Z90 A;  4IDO A;  3RIA A;  1IZN B;  3AE1 A;  5DAB A;  4JI6 T;  2D2S A;  4UF0 A;  2IAK A;  1J5W A;  3ZC1 A;  1S94 A;  1BR4 A;  3MZK B;  5L2L A;  2ACX A;  2IIU A;  3R84 B;  3LG7 A;  2W61 A;  2BG9 C;  5KX5 E;  3ZSS A;  1MNE A;  2R6G F;  4Q25 A;  3ZYK A;  2DHR A;  1OWA A;  3UUB A;  4EYY R;  4HFB A;  5AFU L;  3TLV A;  5H6Q B;  4EAH A;  4I0U A;  2UXC T;  4GKJ T;  4YTP A;  4YJ3 E;  2E2A A;  2WMN A;  2V7J A;  2AE9 A;  3JAF A;  5JDH A;  2UUB T;  4UV9 B;  3LBX A;  5JR9 A;  2CMR A;  2ODV A;  3PE0 A;  5KXJ A;  3NZP A;  2N9D A;  2WM9 A;  2VK9 A;  3AAA B;  3ZPO A;  3RI5 A;  3AVR A;  1XNQ T;  2MAW A;  4TWD A;  1HF8 A;  1EZ3 A;  2IML A;  4EXT A;  2FUP A;  4AQF C;  5ABH A;  4OHF A;  2XQ5 A;  1WYB A;  1T8B A;  4YSX A;  2IHR 1;  4HN9 A;  4IE4 A;  1HNX T;  3AXJ B;  3N2O A;  3MXZ A;  3HKE E;  4TZ4 C;  2NW9 A;  4JEH B;  5DQV A;  5LMN T;  1MMD A;  2Y6X A;  3WI3 A;  3H37 A;  5JRE A;  2YN6 A;  3KV4 A;  3PUQ A;  4GIW A;  4PFO A;  1KNP A;  4ILU A;  4X1Y E;  2K5B B;  5LJM A;  2CE7 A;  5AQP B;  4B6X A;  3L3P A;  5FNV E;  3UU5 A;  2E9X C;  4LML A;  3ZMZ B;  4ZOL E;  3AE6 A;  4UR9 A;  3ZT7 A;  2PBI A;  4QHO A;  1D1C A;  5FY0 A;  4ZI3 D;  2FJB A;  1WLX A;  1X9B A;  1LKX A;  1W9R A;  3AE7 A;  4U33 A;  3T1Y T;  2BS2 A;  3FZK B;  5JVD E;  4L0R A;  4A5X A;  4DV2 T;  2I0M A;  1LVF A;  5KMG P;  3PUG A;  2LEH A;  3RRW A;  4LF8 T;  2X67 A;  1MMN A;  3CK6 A;  3P50 A;  1XMO T;  3CML A;  1UX5 A;  3LDQ B;  3N9M A;  3O4X E;  2DWK A;  4FI5 A;  5EK3 A;  2DCF A;  5LGT B;  2V7M A;  4MLK A;  4ISS A;  5JR9 C;  1JNR A;  1H7C A;  1FEW A;  1YD8 G;  2IDO B;  1UK5 A;  3GMI A;  3NKZ A;  3QB5 K;  3NRX A;  4XAX B;  4DVD A;  5HXS A;  2B1E A;  2VKO A;  5JDL A;  5HEH A;  3O1I A;  2CHN A;  5LYJ E;  3T1H T;  5A1L A;  2CPT A;  5L3C B;  4LF7 T;  2VAS A;  5JRC B;  2CXF A;  4BA9 A;  4M1P A;  5LJN A;  2XY8 B;  5FVK A;  3ZN1 B;  3CPZ A;  4KMC A;  1YW0 A;  2BVM A;  3E08 A;  5AQH B;  5JDF A;  3ZMU B;  1NAF A;  1Z0P A;  1VOM A;  3UTK A;  3UQ7 A;  3P4S A;  2BKP A;  1MMA A;  2CM0 A;  3FZM B;  2ES0 A;  5JRC A;  4HFV A;  1WCR A;  4X5T A;  2XQ8 A;  2YIN A;  4J2C A;  4DV6 T;  3A8Y C;  4CN6 A;  4PJJ A;  4O2B E;  4IL4 A;  2Q9Q B;  4U3C A;  4FJO A;  4OX9 T;  3OYZ A;  1IBK T;  3ZC0 A;  2VVN A;  3ZCJ A;  2Q9Q D;  5JR9 B;  2LSK A;  1OED E;  5IUX A;  4HWH A;  4E7Z A;  3JCF A;  4AIU A;  4TWH A;  3KBU A;  1MND A;  2I6H A;  2OA5 A;  4XBF B;  3LK2 B;  1WRD A;  4GKK T;  1YXR A;  4DR3 T;  2ZMA A;  5C3J A;  5LGN B;  4IE0 A;  3DJB A;  5HXR A;  1L0V A;  3SFE A;  4DR6 T;  2JQH A;  2LHN A;  2Y48 B;  3I9W A;  5DQW A;  3W15 B;  4YHJ A;  5CGM A;  3B5M A;  4NIQ A;  4OYJ A;  1G73 A;  2HPL A;  2WZH A;  2C0S A;  2XQ3 A;  1NEN A;  3PJA J;  4QXB B;  2XHE B;  5JTG A;  3FBL A;  2V6Y B;  5CB4 E;  2KWH A;  4X65 T;  4DUY T;  5EZY E;  3BQK A;  3BQL A;  3EDV A;  2IC6 A;  4IST A;  2WCA A;  2D9D A;  2WWV A;  4OFZ A;  5EK4 A;  4UEL A;  2WSS V;  3GN5 A;  4DUZ T;  2Q9Q C;  3KIN B;  4DID B;  1N34 T;  2VVS A;  4CXX A;  4ZZB A;  4X20 E;  2JIW A;  2NR4 A;  1D0X A;  2V1D B;  3RQU A;  3TLS A;  5CJ5 A;  4UVB B;  4HTE A;  1ZOY A;  3ZYM A;  1IBM T;  2K9A A;  2H7V C;  3PUR A;  3QB5 A;  2KND A;  2G0U A;  3LK4 2;  2X9W A;  4YSY A;  5IHY A;  4DO0 A;  3IBP A;  4ZHQ E;  4JI2 T;  3ZT5 A;  3UT5 E;  3VKG A;  1YQ4 A;  2MYS A;  2KIN B;  3PUY F;  5FXX A;  2WB5 A;  2MPK A;  2K3W A;  2X66 A;  4H9O C;  3J9X 1;  3RLF F;  4HFD A;  4ANJ A;  5AQM B;  3N9L A;  4LF9 T;  2UU9 T;  3CQC B;  4O8S A;  4CQI A;  1N36 T;  2BVL A;  2IUB A;  3O9X A;  4N78 D;  1HG2 A;  2NW7 A;  2OV9 A;  5AQS B;  3SOL A;  2VKH A;  4KUM B;  3ZT6 A;  5LXT E;  3PV0 F;  4HWC A;  5FY7 A;  2CBJ A;  3BK9 A;  2I59 A;  2JQ9 A;  2KWI B;  3RYC E;  4Z8X A;  5HEJ A;  4YJ2 E;  4ILB A;  4EZ4 A;  2ZM2 A;  5HWY A;  2J1D G;  3GWH A;  1T72 A;  3EAM A;  2V5D A;  5HEO A;  1QSD A;  2UXN B;  5LA6 E;  3CIR A;  5F5W A;  5HWX A;  2PG8 A;  2CEA A;  3O1J A;  4LFB T;  3X1D A;  1HX8 A;  2M67 A;  2YDS A;  3PUX F;  4YLH A;  2B76 A;  1KNR A;  5E0O A;  4ZZC A;  3PUA A;  5JDM A;  4DR5 T;  2BKO A;  3ZMV B;  2X9Y A;  3CQG B;  3Q9D A;  2KLQ A;  5FXV A;  3Q2M A;  4P09 A;  3A5X A;  3FZL B;  4KP3 C;  1HR0 T;  5CFB A;  4YSZ A;  4LF4 T;  5AQL B;  1U4Q A;  5J2T E;  4CI3 B;  4JI0 T;  3N9N A;  3AED A;  2JQK A;  2DI4 A;  2WY2 A;  5LBQ B;  4IHJ E;  2HN1 A;  2W4X A;  2YDR A;  2ZLY A;  3C50 A;  2W63 A;  2NTY A;  3KV9 A;  3QOF A;  2MTQ A;  2AXD S;  1FIO A;  2H7O A;  1UUS A;  2YDQ A;  3AE3 A;  3QC9 A;  3EI0 A;  3QNU A;  4YTM A;  4JYA T;  5C8Y E;  3IA3 A;  4PK4 A;  4UV8 B;  4AQY T;  5M4Y A;  2XQ9 A;  2UUA T;  2LSY A;  5C2T A;  2BS4 A;  4CN1 A;  3RIF A;  4C91 A;  3N9O A;  2XSB A;  4PAG A;  3OBV E;  4ZXL A;  3CWZ B;  2QA7 A;  3N2K E;  3SS1 A;  5HXH A;  2UXD T;  2VL0 A;  3AA0 B;  4AKG A;  4IDQ A;  3AXJ A;  3PUS A;  5AQU B;  5FL1 A;  1WR6 A;  1OED A;  4NXM T;  4KI0 F;  2LE8 A;  5L3F B;  4PJM A;  3OKQ A;  1MIW A;  3RKO A;  4ZS3 A;  3CX8 B;  4G63 A;  4WW0 A;  3RPU A;  4JV5 T;  4CXY A;  2XAG B;  2C5I T;  2GK9 A;  3H3A A;  2E5V A;  2CRB A;  2HPJ A;  3PUW F;  5FVL A;  5FY1 A;  2IW5 B;  4KHP T;  3HA4 A;  1T7S A;  3HR0 A;  3KVA A;  4PK6 A;  1OXZ A;  3LBX B;  4YFS A;  2HHH T;  1KF6 A;  5J0Z A;  4B3S T;  4EZH A;  1Y01 A;  3ONJ A;  4AKI A;  1UX4 A;  4UIG A;  3LJC A;  4ERR A;  2LRK A;  5AQI B;  3L09 A;  4NUV A;  4EV6 A;  2F4V T;  3MKD A;  3ZMS B;  2K24 A;  4MFR A;  4ZI7 E;  1M7K A;  2KT9 A;  2LT3 A;  2XZE A;  3Q5D A;  1YQ3 A;  3OVU A;  4UF0 B;  5JDG A;  4IT4 A;  2M6I A;  2IC9 A;  2ODU A;  3AAE B;  3K1S A;  4ZS2 A;  5LG4 A;  2D0T A;  3PTR B;  2W62 A;  4NPP A;  2L8K A;  5AQV B;  5LB7 B;  3RC3 A;  1HG5 A;  3E0Z A;  4GYS A;  3TLT A;  5LCY A;  4I50 E;  4ZI3 C;  2NW8 A;  3M65 A;  1E2A A;  2XTL A;  3RKG A;  4LMJ A;  1LVK A;  1VCS A;  4AKL A;  4BJM A;  5LHI B;  3MJX A;  3RYH E;  2K48 A;  3UUM A;  4DND A;  2XSA A;  3Q5E A;  2LHR A;  4DR1 T;  5ABG A;  1KEY A;  2BS3 A;  3EAB A;  4GOU A;  5JH7 E;  2V8S V;  4MBQ A;  4WBO A;  2X0L B;  3SRZ A;  5ETW A;  5LGU B;  2MOZ A;  4ILC A;  4UVC B;  5ABE A;  1CHU A;  2NWB A;  3PUV F;  2RA1 A;  3AEF A;  3L39 A;  3KDS E;  1D0Z A;  2Z6E A;  2E8I A;  3KBT A;  2FJE A;  4TWF A;  3L8R A;  4HFI A;  5AQT B;  3VRB A;  5L3D B;  3KVB A;  4PFP A;  4EB6 E;  3EVY A;  4HKA A;  4B3T T;  1FMV A;  4PK5 A;  1HNW T;  2WS3 A;  3ONL C;  2BBJ A;  5LP6 E;  2EHO A;  3RRC A;  4EEB A;  3H3M A;  2JQQ A;  4QWN B;  2NOX A;  3RYI E;  4HFC A;  3WAJ A;  1XDP A;  2UXB T;  5LOV E;  4AKH A;  2CBI A;  2UXX B;  3AEA A;  4Z91 A;  2X0H A;  2W0G A;  3FBZ A;  4X62 T;  2WP9 A;  5J1G A;  2XM1 A;  3VR9 A;  5FXZ A;  4JI4 T;  3PDY A;  3CVR A;  3ZCI A;  5JQG E;  3K3O A;  2CHO A;  5L3G B;  3J7Y q;  3SFD A;  4UXN B;  5H6R B;  1YKE B;  4DBQ A;  2VKJ A;  2W2U A;  4I55 E;  4AI6 A;  4TNW A;  4H9N C;  5HXE A;  4LF5 T;  2FBW A;  3SWH A;  3U78 A;  4CN4 A;  3BQI A;  1N32 T;  1IBL T;  2LM2 A;  3P7I A;  1R8I A;  3P8C D;  4TUY E;  2WBL A;  4TX5 A;  3EDU A;  2CXL A;  2JRK A;  3A7M A;  3UUN A;  5L47 A;  3B13 A;  1MIV A;  2WQY A;  2E9X D;  3AA7 B;  4IE7 A;  4E7S A;  2XQ4 A;  3ZYL A;  2XAF B;  2E9X B;  2ZM8 A;  3HKC E;  1GQE A;  1IAP A;  2OLT A;  2X9X A;  4TN7 B;  1SE7 A;  2W66 A;  4XZC A;  3OPC A;  3AE8 A;  1S35 A;  2DLR A;  2LSJ A;  3RX6 A;  3UUL A;  4A56 A;  5LNK A;  1FMW A;  2J62 A;  3WAK A;  1W09 A;  4QX7 B;  2N1G A;  1CUN A;  2ACZ A;  2VB6 A;  4ZI2 D;  4TV8 E;  5AQF B;  2VQE T;  1VCT A;  1HCI A;  5FL0 A;  5HAX A;  3EUH A;  2VL8 A;  4IE5 A;  3PU8 A;  5JDQ A;  3VHL A;  2WU5 A;  4KX6 A;  5JDN A;  1XMQ T;  2VUR A;  2BG9 E;  3KFW X;  2EHO C;  2VKD A;  3C51 A;  3I9Y A;  2QGS A;  2CWY A;  2CLY B;  2A3D A;  3C4W A;  3E22 E;  3DP7 A;  5HEU A;  1DU2 A;  3AA1 B;  3UU8 A;  2BKN A;  4DMW A;  4V1A v;  2WWU A;  4IIJ E;  2BZB A;  3LK3 B;  3RC8 A;  1NWM X;  1J5E T;  4U2Z A;  4DV5 T;  2XAH B;  3VU7 H;  3AEB A;  5HCJ A;  1WFD A;  3HI2 A;  2KMF A;  2QRX A;  3ANW B;  4F6R C;  2RPA A;  2V7I A;  3RGL A;  2UUC T;  3GN5 B;  3PU3 A;  4MHC A;  5FP3 A;  5IYZ E;  3ETU A;  4DV7 T;  1HTJ F;  3MK7 C;  2XAS B;  3CX6 B;  2CA5 A;  2LM9 A;  4UEM A;  4COF A;  1WR0 A;  5KDM C;  4U72 A;  1HS7 A;  2WDV A;  4JI5 T;  2JMK A;  2E9X A;  5FXW A;  2E5L T;  4U7I A;  2FJD A;  4O2A E;  4DMV A;  2LKG A;  1E1H B;  3ABV A;  2C5J A;  3NBX X;  4QXC B;  3ZKR A;  4GYR A;  3AEG A;  2DNX A;  4P1N A;  2WMO A;  3OJA A;  2LSG A;  1B7T A;  3K3N A;  3AB3 B;  3JAE A;  2JJ9 A;  2YU2 A;  3I0O A;  2D5U A;  4IRE A;  2FJA A;  1ZHC A;  2W00 A;  2QYW A;  3AEE A;  3PUZ F;  4A98 A;  4CI2 B;  4JI3 T;  2XUE A;  5AQQ B;  2RP4 A;  2Y8D A;  4IDP A;  3TLW A;  3LFM A;  3IF8 B;  5F8P A;  3VR8 A;  5F3J A;  5BR8 T;  4P0A A;  2J47 A;  4JBW F;  4BAY B;  2X51 A;  2LLY A;  4H9Q C;  4LF6 T;  1AJ3 A;  2WAU A;  2XJ7 A;  1Z8U A;  1OED B;  1MIY A;  3IEE A;  2V7K A;  2V6X A;  3C98 B;  1JNZ A;  4IDZ A;  4O4J E;  2EHO B;  4PJL A;  3RF1 A;  3HKD E;  4PJN A;  3MAC A;  5AQK B;  2PTF A;  4OYK A;  5ABF B;  4DV3 T;  1XZY A;  2CCQ A;  2M6B A;  4TNV A;  4UVA B;  5LHH B;  4O4I E;  4LMK A;  1W0A A;  2H88 A;  3RIU A;  2D0U A;  2QVA A;  3RHW A;  2XAJ B;  2YEV C;  4HWI B;  4WYV A;  4U2Y A;  3ZMT B;  4ASK A;  4F8H A;  3U3I A;  4OK0 A;  3C4Z A;  3ZJ2 A;  2XQ6 A;  4WZX A;  3QUJ A;  1KFY A;  4YY3 T;  3C4X A;  2J4G A; 
#chains in the Genus database with same CATH homology
 2IDO B;  1SE7 A;  1DU2 A;  2XY8 B;  2AXD S;  2AE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...