1SEBB

Complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
192
Chain Sequence
b'GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Three-dimensional structure of a human class II histocompatibility molecule complexed with superantigen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc ii/peptide/toxin)
total genus 36
structure length 192
sequence length 192
chains with identical sequence F
ec nomenclature
pdb deposition date 1995-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sebB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1sebB01
3IF1B 2ENSA 5DRWB 2AGJL 4X5LA 4X7SL 2CO6B 3T2OA 5KSBA 2BDNH 1E27A 3LV3A 3DPBA 3DI3B 1HNFA 4IS6B 4P9HL 3ZT6A 1ZHBB 2BXYA 2F15A 3LQAL 5DYOB 3ZL4H 1SM3L 3D2UD 3CVIH 1A6PA 4R90H 1SHMA 2MQ0A 3SDDC 3OKLB 5CILH 2G60H 3GK8L 4NT6A 4MD0B 3NPZB 3TESA 3MRPA 3Q48A 1OP5K 5CBAA 5F70A 1CDUA 3GI8L 3TM6A 1FFNB 1MY5A 3HRZA 2RFXA 4K8RL 2COQA 4W68A 5DD1L 4JN1H 1Q72H 1TQBC 2YEZA 1LWRA 2DL2A 4NO5B 3OKDA 3RA7H 1FV1B 3OL2A 4I18A 5CAYB 3NOIA 3ZTNH 5F88A 1N64L 1YEFL 4OLZL 3MRNA 1HHIA 3QUYB 5EU6A 3TA3B 1CGVA 3TIDB 2EDLA 4YFDB 4TNWF 4PJXB 3LEYH 3EOBB 4KK8D 4NCDA 1GHFH 3UX9B 3MLXH 5GJTL 3ULUC 2M26A 3QDMB 1RSFA 3EJZD 1F97A 3MMEA 3VFMA 2B8OT 5IVZA 2OTUA 4NP4L 3ZKXC 3VWJA 1P7KB 4CRPA 2D7NA 3ARQA 2AI0H 2EH7H 1H3WM 5E2JA 1JGUH 3BE1L 1YEHL 4R96B 3UPRB 2CDEB 4Z77B 3GMNB 4U1MB 4LNVA 4LPUA 3BW9A 3I3BA 3MROB 3IRZA 3DX7A 1R3LA 3I6KA 2PNDA 3UEZA 2R69H 2BXZA 4Z78B 3P40A 3ELAT 3DTXA 1FO0B 3O3AA 4LHUD 3DGCR 4L9DA 5HDBF 1U8HA 2QL1A 4R0LB 5IESH 5FYLH 4N9OB 2NXYC 3CVIL 4R90L 5CILL 4BZYA 4ZSOE 3VD5A 3R4DA 4I5BB 4YC2B 5DZLA 3D2UA 1I8KB 4DUWA 5EZJA 2GTWA 2IPKA 3VXRB 4JLRB 4U0QB 3CFEB 2EDNA 4GRMB 4NKOA 3ULVC 4QRQB 5FEBA 1S78C 2CDFB 4MJ6B 2Z31D 4JN1L 1Q72L 2WBWB 3AROA 2D4FA 4OM1H 3RY4A 1O5DT 4LLQB 4FG6C 4UV4H 4NZRL 3TIEA 2H8PB 3QQ3B 2PXYC 1QR1B 1XH3B 2FR4A 4TUJB 4P57A 5AD0B 1YPZF 3FO2B 4OI8A 4KMQA 4XCYB 1IEHA 1JNJA 2DWDA 4XH2B 3IFOA 4O2FA 1ZMYA 4ZUVB 3LEYL 1G0YR 1YECH 1GHFL 3FN0H 5C07B 4NHUB 3MLXL 3QI9B 2HKFH 3G5ZA 3L95A 4M8VA 1HH6B 4NNPH 3HZVA 3BPOC 1Y0LB 2AI0L 3QIBC 2FDBP 5E94A 2EH7L 1JGUL 1EO8H 2C3VA 3NACH 3FTGA 2DQDH 2O5ZH 2CSPA 2NY2D 1K3ZA 4LLWB 4POZC 5J11C 3I50H 5GIRB 3ZE2E 4ZYKB 3Q1SH 4OBRA 3SBWA 4D0DA 4EN3C 3PHQB 2DB8A 5EORH 1N8ZB 4MD5A 4R3SB 5FYLL 5DRXA 4WJ5B 1FGVH 3ZKNC 3QYCA 5CEYB 2P48B 4LHUA 4OZFA 4DEPC 4ZDHB 3PF2A 1FJ1B 2CQVA 4NQDB 2ADGA 1EZVY 3MRGB 1B0GB 4X5WA 3K8MA 1TVBA 3LKSA 4PLNC 2Z4QB 4RX4D 4OM1L 1BP3B 3L3OA 4RAHA 4UV4L 5JXEC 4HWZB 2Z31A 3VFPA 1PG7X 1DN0B 4X7EC 4B7LA 5HGDA 3KLAA 1N3NB 1XCTB 3O2DH 4JFZH 4Y4KB 4U1HA 1T89A 4PJ9B 3FN0L 1QRND 2HKFL 2AK4E 2VLLB 4KRNA 3PP3K 3BIKA 1ZGLA 1KFAH 4Z7UA 5LAXA 1BVLA 3QEHA 4NNPL 1TJHH 2ESVD 2NTFA 3GB7B 3ARZA 3V9FA 1EO8L 3GIVB 2EXWC 2DQDL 5ICXB 2O5ZL 2XTJE 4G6FB 4GG6B 4U6VH 1EJ6A 3Q1SL 3OAZK 4QXWA 3UBXB 1MRCH 3DVNA 3I75B 2QJDA 4M6OH 5D7JC 3BJLA 5EORL 3TV3H 1T3FA 2LTQB 1LP9E 3W9EA 1WIUA 3K80A 3P73B 2XXCB 3ZKQD 32C2A 1RU9H 1FGVL 3JVGC 4PJDF 1R24A 1RAMA 4XCCL 3U0TB 4IRJB 5L2KE 3E3QE 4NN6B 5IQ9A 1G0DA 5GS0C 1YQ2A 2F53E 3VFVA 4MXQD 1FN4B 4HJGB 1N2RB 2HJLA 4XNUH 1CFSB 1HE7A 2Q8BH 1BZQK 1FYTD 4X6EA 5FFLA 1N4XH 4PGDB 3CZFB 3ZDYE 5J8OA 4J3SA 2HRLA 1UB5B 3C60C 2I27N 5D5MB 3T1WA 2Q1EA 3BYTA 1NFDF 4PRNB 4RX4A 3RL1B 1MAML 1EAPB 5CEXA 1WIPA 4JFZL 3TBVB 2JB5L 4MB4A 3CX5J 1JUFA 3LS5L 2Q8AH 3Q3GA 4NQSB 5C8JB 3SKNA 3INUH 1JGDB 1KFAL 1AXTH 5I8EB 4PJHB 1P4LB 1G0XA 3EDEA 1QRNA 2C1OB 1TJHL 2BVPA 2NYYC 3VXME 2GT9B 2D7QA 3RTQB 1JGLH 3GM8A 4K3EH 5CSZA 4F9PA 3MRCB 1T5WA 3IETA 5DQDL 3QDGD 2VITA 4HUUA 2D2OA 1NC2D 4RGNC 2ATPB 2ESVA 4U6VL 1VA9A 3HMXH 1MRCL 4M6OL 3TV3L 4MVBD 5DK0A 2FH8A 2XN9B 4M93C 1SMAA 2O5XH 1EBPA 2V7NB 1RU9L 1WAAF 2Q7YB 5EFIB 3VFTA 4OI7A 1D3CA 1MLCB 3MRBB 5IR1A 3CMOH 4KJYA 4IMLA 3SJVB 3WJJC 1F00I 4GMTH 4A6YB 1DL7H 3OGCA 4LCCB 5FAAA 3SQOH 5IGXL 3FJTA 5IW6A 4BK4A 4EVNA 5DWUH 4U1KB 3DI2B 5F1SA 4XNUL 5GSRB 3QIUD 2Q8BL 3PL6B 4JPVL 1ADQA 1H0DB 1N0XH 2V2XB 3LQZB 1N4XL 2WZPD 5HYEA 3U46B 1HIML 4KTEH 5BZDB 3T0AA 3DVGB 4KQ4H 1KGCE 1ZT4A 4YHKH 1FYTA 2L4OA 1VFMA 4NZDA 3NH7H 2ARWA 4MMXC 2YPLE 3OMZA 4YX2H 3OXSA 2Q8AL 2W1NA 3C5ZC 3PDDA 3INUL 1J0KA 1MIEL 1AXTL 2DM7A 2K7PA 2PKDA 1YPZA 3KHQA 4JREB 4XNZC 3G6JF 3VGAB 2DAVA 1U92B 4P59H 4CW1B 1BGXH 1JGLL 1RY7B 2MKWA 4K3EL 3RWIB 4EJ1C 1ZA6A 5EIIB 1UQSA 1RK1B 2BSSA 4Y88A 2A74A 1G7HB 2R23B 3HMXL 4TVPH 1IGTB 5A1AA 3QDGA 4KAQH 4NNXA 1MCNA 1NC2A 4C4KT 3HR5B 5ESQB 2O5XL 1OAQH 4JFPA 2UZYB 4H0HB 4KK9C 4CMMA 1IGCL 3EO1B 4PTTA 4UINH 1NGYB 2BHUA 3CMOL 3B5TA 1AXIB 1NBYB 3OKNB 4F7EA 1BQSA 2AABH 5HTSA 2APWA 4GMTL 1DL7L 3SQOL 5DWUL 3JUYA 1F6AB 1TMCB 4MA7H 4MD4A 5MHSD 1T1ZA 3P4NA 2D03H 1RVFH 1FO0L 4NUJA 1IGIH 2YUZA 1KSRA 4DKFH 1N0XL 2Q6WB 3VGGA 3H7LA 5ANMA 1YNTA 2BVQB 4KTEL 4AG4H 3QIUA 4U1JA 1FL6B 7CGTA 3GMPA 1E4WH 3NFSH 3ZE1F 1MIMH 4YHKL 2ZOKB 4WHTA 3NH7L 1UGNA 3HG1E 2LVEA 5A2FA 2AXGB 1KPRB 4I18C 4Y89A 4YX2L 3S6CA 5DMKA 4APQB 3PQYB 3AFLA 1INQB 5D70H 1A4JB 2UV3A 1WBXB 1YEGL 1QFOA 1A2YA 2AV1A 3MNWB 1ONQA 2RFXB 4P5KB 3OJMB 5E24E 4PGCA 4P59L 4PJIB 2W9DH 2WWMD 1BGXL 4JG1H 4EEEA 1S7TB 1KYOJ 1NUGA 2XYCA 4LSPL 1AI1H 2BCKB 4PBXA 1DE4A 4P0DA 5GRXG 1FIEA 1LEKA 4E5XA 2LQRA 3HZKA 3VWJC 2CKNA 4TVPL 4IDJH 4L3EE 4LLUB 3FOMB 4KAQL 1XR9A 2R2EB 5I1DB 1OAQL 3F7YA 3TPKA 5KSVA 3SKUD 4N0UE 1P7QD 4Q0XL 4UINL 3C9NB 2AABL 1F8TH 1X3DA 4HIHA 3S96A 3FQTB 4FFVD 4PJEB 3RVUD 4F8QA 4PJ8D 2R2BB 4JO1L 1T1YB 4MA7L 3FOLB 5DR5H 2H26A 1DQQA 4PG2A 3TYGH 2NX5D 2D03L 2VLJD 4G43A 4LOUD 3QEQD 4PJDA 1IGIL 4N5ED 4QHNA 4DKFL 4BKLA 4U1IA 1NBQA 4NQCE 2YRPA 3OR6A 1ZS8A 1H5BA 3DTXB 2NNAA 1BBJA 5HHXH 1TNMA 1UJTA 4J3TA 3L7EB 2AK1H 4WEUD 5T3XL 3WXWH 1NLBH 3NFSL 1MIML 5IM7B 5D1QB 3D3VB 3VI3E 5EC2A 4GW1B 3IVKA 2B2XH 5CWSB 1FNHA 4TPRH 5TDNA 5D70L 2CRMA 1WEJH 1HHHB 2O61B 1KNOB 2A6JA 3RBSA 1GGTA 3EYVB 5F1OB 3P3YA 2EYRB 5JUEH 3IJYB 1CL7I 1JNLH 1NFDA 5C0CE 2W9DL 3PV6A 2DIBA 1MREH 3NVQA 3P9MB 4JG1L 1NGZB 1AI1L 3MA7A 4BM7A 2HKHH 5B4MD 2WBJD 4G7VH 1CE6A 4KK8C 5IKCB 3LMJH 4IDJL 1GCFA 1W0WA 1GGUA 1JN6B 4OFPA 5E00B 3DX6A 3EJZC 3OKMB 5F9WB 1NH6A 1F6FB 4FMFA 4HUWA 2DTMH 4NKDA 43CAA 5EO0A 4JRYD 2KDGA 3SBWC 2NY3D 2A6IB 3AS2A 5CGYD 1F8TL 1JP5A 1P7QA 3B6SB 4X83A 3VFSA 2OMNA 3DX8A 3FRUA 3BZEB 1WAAA 1IJ9A 3ARGD 3BZFA 3V0WH 2UYLB 4IHOA 4PJ8A 3T0EB 3KPSA 1RJLB 1ZOXA 4QHMA 3TEUA 2NX5A 2VLJA 2P8MB 3WXWL 3MA9H 1IC4H 3QEQA 2EYSB 1NLBL 1SEBA 3HB3D 3V6ZA 4NJ9H 5INCB 2AP2A 3QDHA 3WIFA 4POYA 3H9HA 3CDCA 4H5SB 3ISWA 2A2QT 1IGYB 2B2XL 4A6YH 3VFNB 4TPRL 4ODWA 2Z31C 4WUUD 5DS8B 1I85A 1NBZB 2E6QA 4PREA 3RGVB 2FJGA 1JNLL 1FZJA 5FM4A 1U8LB 1T89C 4S1SH 1SY6H 1UFUA 2HT3D 1AP2B 3QXUA 3WBDA 2HKHL 3QIWB 1A3LH 4G7VL 3X3GH 2NW2B 1OP3K 5T1DH 3KXFD 3WE6A 1DUZB 2YRZA 1T5XB 5J4MA 1A6WH 2VLRD 1FRGH 3AXLB 3RWCB 9CGTA 4QHUA 1DP0A 3A67L 3G6JA 5KG9A 2WBJA 3IJSA 4PJ7B 4RISL 2E6PA 4JDZB 1JGEA 1KCVH 2P8LA 1UKSA 2XZAH 4GUPA 2DTML 1JNNH 1OCWH 1TPXB 5MEOA 1DQTA 4OI9A 2ED8A 2NY2C 2VJXA 1QLRB 5IV2A 2NXZD 4JRYA 1FSKC 5CJOH 1A7PH 1LD9B 1OTTD 3AY4A 3L1OH 2KH2B 3L7FB 5IG7A 3FFDB 3V0WL 2R15A 3WHXB 3BH9B 3RWHB 4PUBH 3BP4A 2P43B 1R3HA 3IDXH 5EBMA 4TVPD 3MA9L 1IC4L 1QQDA 4MDIB 3ARGA 1GL4B 5E8NB 4NJ9L 3F12B 1A6TB 3MOQA 5E8EA 4X9GA 5C2UB 4X8JA 4A6YL 2LAGB 1RZKH 2GJ6E 3PGDB 3N0PB 1B0RA 1LEGA 3B3IA 2VABB 3HLAB 3HE6D 2XA8L 2APBA 3GKZA 3WNNA 2FIRT 2EC9U 1UWXK 4WW2B 4WUUA 4S1SL 1SY6L 4I2XB 5HYIA 1GGCH 4M3JA 4BA8A 1R5WA 4M1DH 3GSXB 5GJSH 1A3LL 5J9PA 3KPPA 3X3GL 1PDKA 4I13B 5T1DL 4TTDD 2QQNH 1DBJH 3DVFA 4NO3B 3OHXA 4K7FA 3BO8B 5JDSA 4QOKD 3VXSA 1FRGL 4PR5A 1HZHH 1VPOH 2EO1A 2JJVA 1QPXA 2HYMA 5EU7E 4F9PC 4G3YL 1KCVL 5J1AA 3U36A 4G5ZH 5IB2B 3S5LB 3KXFA 3HUJA 2GK0A 3H2WA 3O81A 3PWPB 3Q3GB 4HG4K 1A6ZB 2XZAL 2OK0H 2VLRA 1JNNL 1OCWL 4WTXA 3SY0A 1A6AA 1OHQA 1P84J 2SEBA 5IJKA 1KIQA 4JY5H 1S7VA 3D39B 3GMLA 4P3DA 2DRUA 2AJUH 3O6LH 1JI2A 1HQ4A 3FHQA 1A7PL 5CJOL 3RL2B 5D7LD 4RMTA 4U1NA 4J12A 5HGHA 3IDXL 1XGQA 1DDHA 4M3KB 1HCVA 4UB0H 5DI8A 3VFTB 3M17B 3VXQB 4YHMH 4JFDB 4PJAB 4P48A 4MXQC 3O4LD 1RZKL 3TLRA 4KGJA 4D9RE 4HKZB 4UAOC 1YJDL 4M8QA 2EDDA 3QDJE 1IGJB 4XPAH 2VXUH 4RBPH 5D2NA 3MRLB 1GRWA 3IDJA 2LE9A 2GCYB 1CXIA 2OYPA 2P42B 2GKIA 5I73B 1KJ2A 1MHCA 3CZJA 2IPUK 3HE6A 4M1DL 3FL7A 5GJSL 3UTTD 4M5ZH 2X7LB 5JPMB 2QQNL 1DBJL 3AB0C 4LIQL 4TN9A 1CYGA 2WINB 1HZHL 2X09A 4G5ZL 5HPOA 5A2IH 2UWEB 3LS4L 4YE4H 3BGFB 4G8IB 4DCQA 4QOKA 4WY7H 4X5XB 3U9UA 4Y5XA 5I6XB 3PWVA 3ZSSA 3R1GH 1ZT7B 3QXAA 2K3TA 4JY5L 3X11A 5GS3A 1WFUA 2AJUL 5SV4A 4C56B 1RUQH 1B6DA 2BMKB 2HVKA 4YK4B 3BWAB 3BT2H 4MVBC 5EDXA 5CEZD 2XY2A 1DFBH 3KPLA 5ENWB 1QEWB 1K4CB 1FL5A 2C26A 2BOBA 1EXUB 3IXTA 5D7LA 3CDGB 4B41A 4UB0L 2XZCH 1AHWA 2VWEE 4YZFF 3K2UH 3OKYA 5ACLA 5H94B 1HWGB 3KR3H 5D7IB 3VXUB 1NJ9A 4GFTB 3WKMH 3VMPA 2E7BA 2F74B 3QIUC 1Y18A 5EOTB 5IIEA 4CUCA 2IAND 3JTTA 4XPAL 2VXUL 4U6HA 2FCBA 2I24N 3T4AB 1I1YA 4XVUD 3ME0A 3O4LA 1T1ZB 1J7VR 4YXHH 5DMIL 3HPLA 5JHDE 4UZGA 2PR4H 3RX8A 3MUGB 3NA9H 1CXLA 3QG6A 4M5ZL 3ES6A 4M7KL 4HLZG 1GH7A 1YN7B 5B3JE 5CZVH 4KV5E 5ABDE 4P5TD 4ZS7H 1Z0NA 2PW1B 4YE4L 3KPOB 4OLUH 4NRYA 3ZHDA 3MRMB 1A2YB 5GGTA 5FECA 4HULB 2OSLA 3GRWH 3PWNA 2ZCLL 5A16B 4LCYB 4ELMB 3P77A 3R1GL 1MRFL 1NUDA 1N6UA 1K2DB 5DLMH 2FX9H 5F7MC 3FO1B 1DVFA 2FX8H 4YDLB 1KACB 3IGAB 5CJXA 3C5SA 4H1LB 5JPNA 1IQDA 1RUQL 5E4EC 1B9ZA 4OBSA 3BT2L 1KIRA 5DJYA 4G8GD 4TNWK 4WFHD 1DFBL 2B20A 8FABB 3MTRA 1X5FA 4DWHA 4DZ8A 1T1XA 5J12C 3NTCH 4PG2C 5IT2L 4HGWA 3MLRH 1E6OH 1YNLH 2XZCL 1CK0H 1EZVX 3K2UL 3RDTB 4U6XA 2HT4D 3MZTA 2MKLC 5FYJE 4U2ZA 5DURD 4PJGB 4HEME 2B1AH 5J6GA 3ULSB 3WFZA 1JHTB 1S8DB 1KBGL 3QDAA 1DQQB 4MAUH 5I19H 4WFGD 2P7TA 1IAKA 3PNWA 1M7IB 2FHFA 4YXHL 5FK9A 5MI0C 3BSZH 5MERB 2PR4L 1NAKH 1H5BB 2IANA 3NA9L 3WFEH 2ZUQC 2YD8A 4PPTA 4G9FD 4NO2B 1MI5B 5CZVL 3RWGA 3QQ9D 5K9KB 4NN5C 1E4XI 3RI5F 1YZZA 5DTFB 2APVA 1FORL 1BREA 2R1YB 2Z9TA 4FFWD 5TDNB 4YDJB 4OLUL 2WWMC 4P5TA 1ZHLB 3VCLA 1MPAH 3S3SA 3PE9A 5JW3H 2JK5B 3GRWL 2VR4A 1E0OB 1NFIB 1N5YL 5B38G 4YNYA 2ZZUT 4XAKE 2FX9L 3UDWA 1Y6KR 4H88H 3OKKA 5GS2H 2FX8L 3MRKA 4RMWA 5T5FH 5C6PB 4HV8A 3T1FA 4X99B 4Z0BH 2CXGA 4WO4D 3RKPA 2X4QB 3FKUS 1W0WB 2HJKB 1BX2B 3MCLL 1OAYH 1WC7A 3G5XA 4G8GA 1AR2A 3RUGE 3U9PL 1E6OL 1YNLL 1CK0L 3KPQA 4FFVC 3G04B 3RVUC 2GTZA 4PJ8C 1HSBA 3B9EA 4BUHA 4V1DD 2B1AL 3RWFB 4LOUC 3H9SD 3W2DH 1PKQB 4N5EC 1VACB 5FKAA 3WO4B 1MJ8H 3DWTA 3C08H 1QFWI 5I19L 4D0BB 3V5HB 4OKDA 3BSZL 1F6LL 4NRXA 1NBVL 1NAKL 4Z0XB 4P23B 1FAIL 2V2TB 3WFEL 1NSNH 5J13B 2R2CA 3PUCA 2FO1A 1I85C 1ACZA 4Y1AE 1NFKA 3SHSA 4QTIH 3OR7B 1QA9A 5BRZE 2MHAA 3ARFD 4RMUA 4ERSH 1AD0B 5C0BB 1G7MB 5MEQB 4PJFE 4G9FA 1BFOB 2ZUXA 3MV7B 5ID1A 1MPAL 2MMXA 4PJBB 4M6AA 1HXYB 1S3KL 1FNGA 5B4MC 2WBJC 4KRLB 4OF3A 1EFXB 1OAKH 4H88L 1XEDA 3LKRA 2D0FA 1EEYA 5T5FL 1CLOH 1L0QA 3M8OH 4NHCH 4PY8J 4Z0BL 5F9AC 2CIKA 4K3GA 1BF8A 1CFBA 2D7PA 4HPYH 3GSNA 3WL9B 4QHUB 3U82B 1GIGH 3OZ9H 4F33A 2VXSH 1U36A 2NY3C 2YC1B 4UNUA 4WO4A 3TP4A 3GNML 5CGYC 2EH8H 3AY4C 3OKOA 5H2BB 3B9AA 4XP1H 5DJXB 3HPJA 2XWBB 5I66B 2WV3A 3W2DL 3ARGC 1UENA 2Q3AA 4WTZG 1MJ8L 1CQKA 3CSYB 1WBZB 4V1DA 1EFQA 1UYWH 1P1ZB 2VXQH 3H9SA 1RJYB 3HB3C 1I8MA 3H6JA 1A64A 4KDTA 4MLSA 3STZB 4QTIL 3MOBH 5GRJH 1UXWB 3H42H 3NMEA 3VE0A 4OZGF 3BAEH 3MRDA 4ERSL 5E8EB 3AU1B 4TUOA 3TO4B 1TDQA 4OM0H 5DJ2A 4NQEB 4U1SA 2XOTA 3OPZH 5F7FA 3ARFA 2GHWB 1B0RB 4OGYL 3NGBB 1MVUB 5HHNA 2HT3C 1OAZH 1J8KA 3GSRB 5LGHH 1OLZA 5FO8A 2ADJA 4ORGA 3NCJH 5BZWA 1TENA 4FQJH 2YHGA 4MNGE 4HHAB 3MRRA 3M8OL 2C1PB 2OR7A 3DRTB 5IJKC 3VXSB 4HPYL 3QNZB 3EJYD 1GIGL 3OZ9L 4PJCF 2F54B 2VXSL 1RUPH 3FB8A 1AJ7L 1CGWA 5GGVY 2VRAA 5DO2C 1S7RB 1UEMA 4XPHH 1RJZB 2NXZC 1WISA 4XP1L 3ZE0E 3CFCH 2QHLA 5I76B 2DKUA 5KANI 3V4PH 2SEBB 2NLJA 1XIWD 1OTTC 4H1LH 4BFIB 4D2NA 4NO0D 4U7KA 2CLZA 2PO6A 3SGEH 4YLQT 1UYWL 3EIFA 5IFAH 3B9KD 3MRFB 4JDTH 3FB6A 4JB9H 1FE8H 1H3PH 5JQHC 2R29L 4M6NH 2JTDA 3PHOB 3MOBL 5GRJL 3H42L 1CLZH 1Q0XH 5D2NC 3QAZC 4XZUB 1U2HA 3SOBH 5EUKB 5HYJD 1VKXB 4JM2B 2R0LH 2UVEA 1JRHL 5I1AB 3ARWA 5JOEA 5L2KD 1FLRH 3HE6C 4JRXB 2CMRH 3OPZL 3EO0A 3L9RA 5ISZB 1PZ5A 1FFOB 2AS5M 2QKIB 5I1LA 1MLBA 2ZUTA 1OAZL 2YA2A 3QUXB 1ITCA 4MCZB 3DVIA 4KFZC 3WUWG 4PRHD 4TTDC 2X05A 3NCJL 3RWDA 2X1PA 5I74C 4Y5XC 4LVNC 2GITA 2EIEA 1U8MA 2AJZB 4I0PB 5KZCD 4OFVA 3O2WH 3DXAB 5BOZG 4FQXD 1RUPL 4DZBB 4L8CA 3NAAH 1HNGA 1OTSD 4OFIA 4L8DA 4HGKC 4XPHL 1K4DB 1T22B 3N1MC 1MCDA 1C08B 1U8KB 3V4PL 3QXAB 2A73A 3QNYB 4MNQE 2DTSA 4AIZB 3NIFF 4G8EA 3L3GB 4OKVA 1AHWC 5CUSL 1NEUA 3LSOA 3NPSB 1XIWA 4CJ1A 4HIEB 3S9DB 1KEGH 4NO0A 5IFAL 2H1PL 4UQ2B 3X14B 4JB9L 4ZAKD 1FE8L 4IDLA 1H3PL 1JWUA 5ADOH 1D7FA 1LNUA 3LKQA 3IXTB 5I8KH 4YQXH 4YPJA 1CLZL 1Q0XL 5EO9B 3SOBL 4LBEA 6FABH 3B9KA 3IS0X 4HFUH 3HE7D 4Z5RB 3MV9E 1P4IH 4KH2A 1FLRL 2CMRL 3H0TB 2DF3A 1WWCA 4L4TD 5DD0H 3QNXA 5HYJA 5DF0A 4R26H 3QJFA 5L2KA 2XKSA 3VG0L 1CGSH 3RNKB 4K23L 1AY1L 1J1PH 4CVWA 2DM4A 3BXNB 1XCQB 1JYNA 5CZXD 2CDGA 2HN7A 5HHPB 3IJHA 3O8XB 4PRHA 1IM9B 4TULH 3IFPA 4Z7WE 2QSVA 5F89A 5CJXC 3CNKA 3NAAL 1UH4A 3HC0B 3KWWB 3SKJH 3FB5A 5FECB 4FQXA 1F02I 5EUOE 3HC3H 3MLTB 3ULUE 3CXDH 1E6JH 4KUCF 5BS0E 2R1XA 4HIIA 4LHQB 3MRQA 1MFDH 5TGBA 5IMOB 1D6EA 4BSWB 1FVDA 3VXMA 1KEGL 1I1FA 5JTWA 1KLFA 2RCSL 1J12A 3QA3A 5CSGA 2JCCF 2EDKA 3T0WA 2P5WE 5ADOL 1FZKB 4O2EA 5I8KL 4FXKA 1H3XA 4IIQB 2E7HA 1Z2KA 1KB9J 6FABL 4HFUL 4Q74A 4ZAKA 1BZ7A 1P4IL 1ZVSB 35C8H 4AZ8A 3K7UA 4XVUC 4ZQKB 3C6LB 5GRWA 5JORA 1A7OH 1Q9KA 3VD9A 3FT2B 3HE7A 4R26L 1X5YA 4Y2DB 4OAWB 3LD8C 2DDQL 4R6UA 4OZGA 4ODVH 4ISVA 4HS3B 4L4TA 4JO4H 1VADA 4LF3B 4K71C 1LO3H 4PTUA 4R2GB 1J1PL 3OX8A 4RMRA 1HHKB 4P2QB 3ULVE 3CAFA 5KBNC 4P5TC 2NW3B 1LQSR 2ITDB 1DLHB 1QP1A 2VZTA 2IAMB 1WZ1H 5DVLA 4Y7MA 1PQZB 1BQHG 1PVHA 3QULA 4L3CA 4TULL 4I48A 3MREB 3UDWC 2IH3A 4M1GL 3GFUA 3UO1L 4MQXD 4PJ5B 3EYSH 4R4FL 3N06B 1RUMH 3S35X 3SKJL 4PY7B 3SE9H 2ARJB 3HC3L 1LO4L 1CR9H 1E6JL 4PJCA 4ENED 1MCWM 4L5FL 3ARED 5SWZD 1MFDL 2OMBA 3N1QC 4L4VE 4YFEA 4U3XA 1V7NL 3MJ9H 1UM6H 4LVOC 3WN5B 4ZUTA 3E2HB 1GGBL 3MCKA 3QQ4B 4HKBB 5JO5A 4XCEA 3RIAF 1A9EA 1MAKA 4JQVA 5TDOB 1G9MH 1BD2D 2HT4C 5EG6C 1VCAA 2EDWA 4JHBA 4QHKJ 5GGVH 5CGMA 2GTZB 1CGTA 3GHBL 1J0YA 1A7OL 4EDXB 4HMDA 3BDYH 3F7RA 2EC8A 1Y6NR 5CJBA 4WI9A 3QFJB 3U7WH 5D2LF 5B38A 4ODVL 5E1AA 1ZLUH 1EGJA 2W59A 4JO4L 1FFPB 1LO3L 1ORQB 2QEJA 3QCVH 3QQ9C 3A6CH 1NCNA 4HD9A 4LRIA 3P30L 5F1IB 43C9A 1XF4B 1XT5A 3MJ6A 2DQUH 2ZUVA 4P2RB 4FFWC 2MHAB 4F58H 2RBLA 1V05A 3EHBD 15C8L 3FRPA 3EYSL 2BNRD 5EZOH 3CC5A 5HVGB 1ZHNB 1RUML 1H8OA 3V4UH 2XWTB 1JHKH 3LN4B 2DLEA 1AIFA 1KXQE 4NN7C 3SE9L 2YMXH 1FNGB 4X7TA 3C09C 1CR9L 1Q0YH 2DQGH 4WO4C 3ZYOA 3WMSA 3MV8E 1DQJA 5FUCC 3NZ8B 1UM6L 2VC2H 4KUCD 1MI5D 1VHPA 1BFVH 4GW5B 3SGEI 3AREA 5SWZA 4PRIB 5DJCB 3K8LA 4WNQA 1CFNB 1JF1A 1BJ1J 1G9ML 3LKOB 2BC4B 3ESUF 1E28B 3U0PB 3PXJA 3BPLB 1C1EH 1VFAB 5TDPA 4OLVH 2X4NA 5I0DA 2HRPH 1JTOA 5KSAD 5DGQA 1BD2A 3BVNB 3S4SB 3VGDA 2DQFB 3BDYL 4Q9RH 3C8KA 4F7MA 3U7WL 5DQJA 1PSKH 2EKSA 5K9OA 5DVNA 4E41E 4RWYL 1JYWA 2X4RB 3P0YH 4YFLF 4LSVH 2CIIA 3QCVL 4ZUWB 4LNRB 4CL7A 3ARFC 1NGXA 3A6CL 4G6AD 5DC0A 3NIDE 5ACZB 4RFOH 2ZUYA 1KPUB 4G8FA 3MYZA 2DQUL 3VWKB 1TZHB 5C0RH 1BVKA 4F58L 1BOGB 2OBGA 3NFNA 2W92A 4GAFB 4PD4K 4ZFOA 3KYAA 3ECBA 3VFOB 1I7UB 1UZ6E 5MENE 1MQKH 5EZOL 4U7SA 4XCNA 1FG2A 4JY4A 5T3ZD 1DLFH 3V4UL 2EEAA 1TETL 4ZSOB 1HHGA 4C57C 2YMXL 1KXVC 2BNRA 3AS3A 4N90E 5L0QC 4JFED 1E4JA 1FC2D 1Q0YL 1RQ5A 2DQGL 3DMMD 4OV5B 1ZT1A 2FWOA 4WTZA 3UTSD 1F4YH 2YD1A 4N68A 5DD6B 4KHTH 1XZ0A 2JIXD 1UKTA 2VC2L 3LEXA 5BCAA 4M7ZB 1Z9SA 4FZ8H 4YO0B 1BFVL 1TZIA 3ZDXF 1EK3A 5LVEA 3GJEA 3QWQB 5LWYH 4XWGH 4RGNE 1M05B 1C1EL 3B8SA 4OLVL 3VFRB 4HX1B 3IDYB 4JFFD 2HRPL 4F3FA 2FLRT 2Y5TA 3O3EB 3TBSB 4R97C 1I7ZA 2IH1B 2JCCA 5K33A 3FN3A 5IFJA 4RQQB 2MOVA 5KSAA 2G9HB 2VLKE 3O6FB 3DSNA 2PO6B 2CUHA 4PV9A 1ETZA 4YDVA 5K9QG 3P0YL 1XF2A 4WWKB 1A1NB 2A77H 4LSVL 2H3NB 3HCVB 3VGBA 4NQXB 4JN2B 4RFOL 3QCTH 4LSQH 3SGDH 2DKSA 5C0RL 4LLMA 2Z92B 4LCUB 3NIGF 4LSTL 3PJSA 4X7FC 2WWKO 4P5MB 1WVZA 1DLFL 3ARBB 1EIBA 4XVSH 3LN9A 4HUXB 4QRSA 3FO9A 2GYSA 1BIIB 2Y7QB 3PP4H 1KF9B 2J8UE 1QOKA 3EGSA 3P11H 4GXUN 3ARXA 1B88A 1F4YL 2BNQE 3AS0A 2HFFA 4KHTL 4JFEA 2FHCA 1IAOB 2P1YA 1U8MB 3DMMA 3PWLB 4FZ8L 3BISA 3G9AB 3UTSA 1MHPH 1P5UA 1QSFD 4FOMA 4KZDH 3O3DB 5E08L 5C09E 3LKNB 1T2QH 2JIXA 5LWYL 4XWGL 4NZUH 1ZTXH 4WI5A 2AV7A 4FZEH 1AQKH 1ZHKB 2RJMA 3EYUH 1XIWC 2W9EH 3BHBB 4GAYA 1P6AB 3FQUA 5HGAB 3P4OA 1U8JB 3KJ6L 3FHAA 4ZUUB 5IVNA 5KSBE 2AK4B 4DAGH 1CFTA 1AGCB 4G8EB 4JFFA 3DYPA 1R3JB 4HIXL 5EU4B 3REVB 3B9KC 5DC9B 4MA3B 1FVCB 1ZKAA 3WUWA 3MGOA 2A77L 2OQJB 5FYKE 1UM5H 1KLUA 2XTJB 2Q76B 3OKEA 5DHVH 1JV5A 3QCTL 4LSQL 2FGZA 4F80A 1U8PA 1N59B 4C54A 5D2LA 5DRNB 3ZSTA 1AGFA 3T0DA 4U0RC 1UACH 4M62H 2APTA 1C5DA 5F7KC 1BZ9A 1LP9B 4N0CC 1A14H 1DCLA 2FSEB 3GGWB 1VGKA 4P3WA 5BXFB 4QF1A 5J0BA 3MLSH 1AC0A 2VKWA 3O41A 5DQ9B 4XVSL 4AK1A 2WIIA 5JDJA 5D1ZB 1MUJB 2GJ6A 4QO1A 3PP4L 2AJYH 3PGCA 3Q6FB 2F53B 3MJ8A 3P11L 5EU6E 2Q7NA 2O5YH 1CLCA 4FQXC 3T3PF 1MCWW 1QBMH 1T0MA 3I02A 3T65B 4WFFD 1D6VH 3C5JA 1KT2B 4KZDL 5IW1A 3ZO0A 4QT5B 5MEPA 3CGTA 4YFLI 4NZUL 1ZTXL 5C6TH 5M95B 3EYUL 3ZT5A 2W9EL 1QSFA 1U58B 3BPCB 5J3HD 3MLWH 4MX7B 3ABZA 3B83A 3FFCD 2D31A 1LE9B 5EH1A 1FZOA 2DS4A 4Q7DA 4M1CD 4ZAKC 2IEPA 4N0RA 1TLKA 4QYOB 1ZA3A 1RJCA 4Y2OA 4B5EA 3RUGF 1JWMA 3U30B 5K9JH 1UM5L 4ZS6D 4BSVB 4IOIA 2NZ9D 3P9LB 3HE7C 5FO9B 3MRJA 3VXOB 4FXKB 4NM8H 1RZJH 2BJMH 2C7UA 2B5IB 2VIRA 4OZ4A 5HVFB 3MJ9A 1XR8B 4AM0B 4G42A 1UACL 4IJ3C 4M62L 4WW1B 3BKCH 1G9EA 3FQNB 1A14L 1LEIB 2QHRH 3MLSL 1OTUD 4WI8A 5JORB 1XGRB 5L2JB 3ROOA 5CIPA 4QHLB 4ONHA 4LSRH 5HJ3B 4JJ5A 5CZXC 2JJSA 1XF1A 1A6UH 4MJIB 4S2SA 4Y5VB 2AJYL 5ID0B 2AERT 3HMWH 4J4PD 5ESVB 4HJ0D 1BJMA 5JW5B 3LAFA 1EA9C 2H2PD 2O5YL 3IU4H 4DTGH 4LFHG 3RI5K 5T1LB 2YOCA 4LVHB 3KS0J 3O9WB 1D6VL 3TJHD 2YR3A 5F93C 5IMLA 1NCBH 1NC4D 2GUOB 3PIQA 5C6TL 1MWAB 2VDNL 4KTYA 1YC8A 5J6HB 3TO2B 4CNIA 1I4FA 2YPLB 3MLWL 5E6IB 3QCUH 4JQVC 3EOYG 1IT9L 1RD6A 2P5EE 3WJLA 2F19H 3QZWA 2GJZB 4MDJB 3GMQA 1B6UA 3V5DA 5IEHB 4XB7A 2A83B 3FFCA 1CD9B 4XBPB 3BP6A 2XKNB 2ADIA 4GRWB 4RNRB 3RPKA 4AENA 1RFDH 5CHNB 1NAMB 2E7CA 1GZQA 2OZ4H 1EO5A 4NM8L 4GRLD 1BQHA 1RZJL 2BJML 4LAJH 3LKPB 4URTB 1MHHA 4U6YA 4GBXB 4LGPB 3EZJB 5ITFB 3BKCL 4HDIB 4PGEA 3GI9H 2QHRL 4UTAH 4LRIC 2VL5A 4TRPH 2DMKA 5IHZB 1T21B 1HSAB 3CIQA 3W5NA 4LSRL 4MGXA 3QJHA 1JHLH 1A6UL 3D25A 3L3KB 5IB1B 4O5LH 2VZ3A 4LPWA 4JPIA 4YHNB 3L3IA 3WFDH 3RGHA 5I15H 3V0AC 1U8IA 1QSZA 2LVCA 4DTGL 4MQXC 4J4PA 5E0QA 4XPGL 3UTQA 5JHLH 3OXRA 3SDCB 3BEVB 4Z7UE 3WS6A 5HDLA 2HLFD 4GG8A 1VENA 1GSMA 4DOHE 1CGUA 3T04D 1OARH 1BFSA 3MXVH 2UZXB 5I75B 4KU1A 3MYJB 1D9KD 3QFDA 3HG1B 4OCMC 1NC4A 4RAVB 4ENEC 1KELL 3AREC 3QCUL 1YY8B 4PP2B 2XPGA 1Q9OB 2F19L 5IVXF 1P9MA 2HFEA 3ROLB 3P0VH 2Q20A 4X6DF 4BZ1H 4JGJA 3R0MA 3OJVC 5F3HB 2PN5A 2ZP0T 4MCYB 1S7UA 1RFDL 2Q3ZA 4QY8B 1G1CA 2ZG1A 1A22B 3GKWH 2OZ4L 1OQOA 3QO0B 4OFDA 4U2YA 5HGBA 2XXMB 4L3EB 1MAJA 3BPNC 5EBLB 1BM3H 3SGDI 1UZ8A 3BJ91 4OZIB 4HK0B 1SYSB 3RZCD 2FJFA 4GRLA 4UTAL 2YUXA 3NABH 4TRPL 4ELKB 1S7SA 3S97C 1DBMH 4N0UB 5E1HB 1X6LA 5E8PB 3GSUB 1SQ2N 5FDWB 2DL9A 1AO7D 2NY1D 3F7VA 3WFCH 2ZSWA 3DRQA 2BVOA 4GKSB 1FL3B 4CVZA 1URLA 3WFDL 4BUGA 5E95B 3G6AA 3ZHKA 1EX0A 1C16B 3EHBC 1G6RA 2QQKL 5EC1B 1ZLWH 1PX4A 3OG6B 3HS0B 4NQCB 3SDAD 1JZ7A 5FO7B 3SCMD 3KPNB 3IDIA 1CD1B 5JHLL 1RIVH 3L3HB 3OJDB 5HHVH 1TIUA 1KJVA 1OARL 2DWEB 3MXVL 2QSTA 1QRNE 1J8HD 4PRBA 4PB0H 2W9LA 4OSUH 1AH1A 4DKAA 5E2UH 4TSCH 4BQ6A 1AE6H 2ESVE 1D9KA 4RFNB 3P0VL 3VRJB 4HGMA 4XNQA 2X4TA 2DICA 4PLKC 4ODBD 5ICZA 4EQ2A 1NGWB 2YSSA 4FNLH 5C0CB 1IBGH 2CRIA 1U93A 3UJTH 1YEJL 2NY7H 1CVRA 5T33H 4O2CB 4P2RD 4F2MB 2DOCA 3U2SA 1TVDA 4S10A 3VDCA 5KSAC 3DX9A 4S1DD 4GXUM 5I18H 1JWSA 3GMRA 1BM3L 4QNPF 5HDBE 2ZWLT 3UAJD 3VW3H 5GRVL 3NABL 4H26B 3RUGA 1HN1A 3C6SA 3HAEG 1LO2H 1DBML 5SX5H 1XGUA 4MJ5A 4C55A 4ETYA 2YPKB 1KJMA 3UZEA 4G6AC 1PW3A 4YDVB 1CVSC 4L29A 5L9DH 4MAYD 5HHQB 2J5LC 1ZVHA 1FYTE 4Q58C 4PRID 1AO7A 4G9DB 5IBTH 4KXZH 1IGMH 2LFGA 4FFZH 2IFGA 3E6HA 3BYYA 5GRUH 4XRCA 1RIVL 4L1DA 4AT6A 1I3GH 1RMFH 1RULH 1YPZE 1OGAD 2J7LA 4UU9B 5HHVL 4RWHA 3SDAA 4MS8D 3SCMA 3DMMC 4PB0L 2IC2A 4GKNA 4OSUL 4P49A 4KROD 5F6IC 1QVOB 5E2UL 3RVXD 4Q6YA 3EOAA 4NQTA 1AE6L 1J8HA 3P9WB 4KKCD 3CFJB 1MH5A 3QUMB 4FNLL 4HXAH 1IBGL 3QDGE 3CH1B 3UJTL 3UC0H 4UMGA 2OXGA 5T33L 2VN7A 4LPTA 5BV7C 1UKQA 4X6FB 1R5IA 4XI5D 4NDMB 3T2NL 1G9NL 2V5MA 1RIHH 2GSIB 2Z93B 1AD9A 5EN2B 1OOAA 3UTOA 1IEBA 2X44D 4GH7B 3PDOA 3VW3L 4OCWH 1LO2L 2X89D 3TYFA 5D96B 1MFBH 3FCTB 3Q5TA 2KPNA 4GRWH 1JGVH 2A1WH 1G7PA 3GJFB 1NAMH 2GSGA 3GSQA 5L9DL 4NOFA 4PBWD 2CLRB 1UB6B 4C59B 3SE4A 3BRDA 5SWQB 1JFQH 1DUYA 5IBTL 5DD5H 1IGML 3W0WD 4FFZL 4Y16B 4X6CF 4K55A 4MAYA 3VXPB 4M02A 5ERWA 3WXVH 3C2AH 4Q9CA 2FO4A 3H9YA 3TT3H 1I3GL 1QPPA 1RULL 1HI6A 2VYRE 2F8XC 3BP5B 4XBGA 1CI5A 1ZV5A 1JYVA 2J8OA 4CADB 4EI5D 4QRRE 2H9GA 1OGAA 4R4BB 1S7XA 3TBTA 1OB1B 3O4OC 1CGYA 4WWKD 3V5KA 1NLDH 3BDXA 4UOW1 5EU7C 5E99L 3ARDB 3UC0L 2I9TA 1W0VA 2OI9C 5E9DE 1MWAL 3NGBC 4OQTH 5F3BA 1F45A 5IVXA 5EULV 1X9QA 3JWOH 4JPWH 1RIHL 1KG0B 2H6PA 3HC4H 1AGEA 4NYLA 4UUJA 1ORSB 4X6DA 1T0NB 1S9WA 1KTLA 5JA8B 2FBJH 3OB0K 5I8OH 3W9DA 4PJDE 3ZLQC 1MFBL 4JKMA 4DVBB 3B2VH 4NC1C 1ZLVK 4X4YA 4ZFFB 1JGVL 2A1WL 4LFHD 5C0JA 5MHSE 1NAML 2X89A 1M6OA 4AEFA 5GSVB 3U6RB 2YK1H 2BX5A 5C0IB 1MY7A 5EU3B 3QXTA 4PIRF 3FONA 4MYWB 5IQ7H 2JJSC 2KKQA 3BUYB 4UDUB 2VDRL 3IB4A 3C2AL 3KYNA 4JFHE 4X4XA 5EO1B 4R7DA 4K9EL 1CDYA 3SE3A 3W0WA 5ESAB 5KS9F 3MFFB 4ZFZA 3V6FB 5HI5D 3HI1A 5AUMA 2E7MA 4GRWF 4O4YH 4HMEA 4N8VA 1QR4A 4LAQH 5FYJU 3QDJB 3CVHB 2YKLH 1UM4H 4NFDA 1Q9LB 1BJ8A 4FHBD 1K8DA 3MO1B 5FXCH 4EI5A 1A7NH 4E0RA 5JIIA 1NLDL 3MGTA 3V7MA 3AS1A 5IWLA 4FXLA 5JR1H 2BNUB 1YMMD 1I9IL 1T1WB 2D4DA 3WJLC 2XQBL 1NQBA 3B43A 5IMLB 4NPYB 2Z91A 1J87A 1RK0B 5J3HC 3JWOL 4JPWL 1P2CB 4U1LA 2YD9A 3DIFA 3HC4L 4DUVA 5C7XH 3I3DA 2AAVA 3EZ8A 3SO3B 4RGMB 2V9TA 5TPWH 2A9MH 3DNKA 2AQ3A 4YR6B 5IHBA 1OLLA 2FBJL 5I8OL 4M1CC 5IBLD 5DVMA 1WAAE 4XXDB 3WNKA 3KJ4C 4FQQB 3B2VL 2XT1B 4RFEB 3HKFA 4ZS6C 3X3FH 4PGBB 2NZ9C 2VQ1A 3DV4A 1MJ7H 4JVPA 3F6IA 1VEOA 4OIIL 3RIAK 2NX5E 4J8RA 2VLJE 4PB9H 2FYYB 3QEQE 4AENB 1JPFA 3GDBA 1UCTA 2YPVH 4D8PA 2YK1L 2VKXA 3V8OA 4N0FA 3SPVB 5IQ7L 1ZGLM 2CXKA 3QG7H 1OTUC 2MPAL 1WTGT 2PW2A 3MNZA 4U6YB 2I07B 2VUOA 2ZNWA 4KI1A 5C86A 3MRIA 4L8BA 2ICWJ 2ERJB 2VL5B 2FBOJ 4LLVB 2NY6B 5SWSD 1AFVH 4UV7H 4ODTH 1IKNA 4J4PC 4XC1L 4JE4B 4O4YL 4P4RA 4HJ0C 5C0AD 1PAMA 4WDIB 4WHDA 2H2PC 3WS6C 3IDMB 4LAQL 3RWJB 4X7CC 1AGBB 2XA3A 3SDDA 4U33A 2YKLL 1UM4L 4P2YA 3IKCA 5DK3A 2XIDA 3TJHC 1KLGB 1A7NL 3G6JE 3O6MH 5JR1L 4V2BA 5JHDB 4MSWA 2ZOLB 4QGTA 2ZJSH 1P9MC 3EFFA 4L9LA 3KYMA 1YDPB 1HH9A 3IAGC 3H3BC 1YMMA 3TNMA 4YPGA 4Z76A 5C7XL 5TPWL 1F3JB 4J1UB 4S1QH 4JRYE 2P8PB 2OLDA 2X70A 1CFQA 2FIKA 3D69B 4L8SB 4LVEA 4M6ML 4HKJB 3TN0B 1HKFA 1EEZA 3WNLA 5IB3B 3QUZD 5HYFA 3QUMH 2V5TA 5FV2A 3R8BB 4LMQI 3S88H 4KI5E 1V5JA 3X3FL 1M4KA 4ZPTA 4QXTB 2CR6A 4GRLC 3WLBB 2YPVL 2Z8RA 4JZNA 1UJ3A 4CDGC 5HYQB 3IKKA 5ICYB 3QH3A 4RIRA 1OM3H 1F4WH 3SN6N 1QBBA 5JW4R 4U1GB 1VFBB 3TC9A 1SJHA 5HI3D 4KXZI 4Y19D 1QRKA 4PY8I 3VXTA 2X2YA 5IB4B 1CICD 5FF6A 3ZE1E 5EPMB 1P69B 1AFVL 4UV7L 4WUUE 1KCLA 5A40E 1HEZB 4ODTL 4RDQG 3KYKH 1U2CA 4CDHA 3GJFH 4LKCA 1J88A 5GGQH 2Z35A 1EJOH 3L3DA 4X6CA 1RZIA 4ZUSB 3RX7A 2VERN 4TSAL 5SWSA 3DV6B 2R1WB 4KVCL 3MFGB 4X6BB 1M7DB 2WP3O 2HLFC 2XACC 3KXFE 1V7MH 2ZJSL 2X4OB 2VLRE 1L6ZA 4JANB 1D9KC 2DQTH 3GBNH 3CFDA 5KVDH 1I8IA 3ILPA 4OZFG 2CD0A 1BBDH 5F6HI 5GGRY 5GGUB 5GRYA 3V6OA 4H25B 5A2LH 5JIPA 1U8OB 1AC6A 2R9HD 4S1QL 3VD7A 2D3VA 3PABB 4JHZA 4WGWB 1NMAH 3QUML 1X5HA 5CP7B 3KPMA 3S88L 1T2XA 1OF2A 4JJHA 3DBXB 3LN5A 4KRPC 4UOW0 3QUZA 5D1XB 4FQHB 3FB7B 3VG9C 2PF6A 1Y6MR 4LHJB 1KPVB 3G6DL 1Z0MA 5GGSY 5C08B 2N7BA 4TVPE 3RZCC 5JOFB 4DW2L 5HHOD 1KV3A 3KYOB 2DQCH 2CRZA 1IAII 5T1MB 2C3GA 1CXHA 4WENB 1NUFA 5EIQA 4UT9H 1JPTH 2IADA 4QXUL 5L6YH 3RNQA 5D2NE 4HF5H 2NY1C 5SV3A 5DRZA 5BOPA 3UJJH 1LVEA 4Y19A 3KYKL 1B4JH 5LGJB 2ICES 4B53A 1SVZA 1EJOL 2KQNA 5F7EH 1CICA 2WUBH 5FGBC 1WF5A 4F57H 2I5YH 3MBED 3SDAC 3P4LA 3SCMC 3MJ7B 5KS9A 4WCYH 1T66D 5EZLA 1V7ML 1R5VB 2YD2A 4QOKE 5IFHH 5DA4A 4Y1AB 2DQTL 3GBNL 5DHYB 1BJ1H 3IDGB 1DQLH 4JFYA 1BBDL 5BRZB 2HA1A 2QQLH 3B9VA 4YHPA 5HY9A 1WWWX 4JG0L 3VRIA 2IALA 4ODXA 5H35A 3HAEA 4PJFB 1KCSH 1NMAL 4Z7VF 5DEGA 3CVHH 5F8QC 1IQWH 1IGFH 2ITCB 5JNYB 3EDJA 4O02H 4RZCA 1TCMA 1Z6JT 1J1OH 2I9LA 1NMBH 4S1DC 3ET9F 4Q2ZA 4CGTA 3D18B 3HN3A 4QRUA 4UNTA 4HH9A 3VD4A 5BJTB 1WCBB 3UAJC 4MA1C 1FFRA 3ZTJH 1KN2H 4N0YH 1ES0B 1IEBB 3GSWB 2EE6A 2DN7A 5C0GB 3SE4C 2HH0H 3B5HA 4N9GB 4P4KD 3VXNB 2PYFB 3L5WB 4UT9L 1JPTL 3QRGL 5L6YL 4GAJL 3O4LE 4HF5L 1QG3A 3D85D 3HHRB 1T04B 4HFWB 4OQTA 5E5RB 5HHOA 1JPST 1ZE3C 3UJJL 2IPTH 4MAYC 1IEAB 3C87A 1U8NA 2DJUA 3VH8B 2EDTA 5F7EL 3U7AA 2WUBL 3KNBA 2UUDH 4HWEH 4WEBH 3TBYA 4PG9A 3F5WA 3JVGA 4NQUA 2VDLH 4F57L 5KSUA 2BSRB 2I5YL 4QCIA 5TE6H 2CKBH 4CVXB 2H41A 2EYTA 2JB6A 1FP5A 4I4WB 3UTTE 4WCYL 4E41A 1IKFH 4FABL 1I1AB 4JKKA 3TZVD 2ED7A 2PCPB 4OF7A 3FT4A 3IAPA 1XF3A 2Y6SD 3MBEA 4BELD 4MS8C 2AXJA 2Z8WC 2FB4H 5IFHL 3NFPB 5F21B 4PRDB 4RMVA 1DQLL 4KROC 4R7NA 3M1BA 1XGTA 1OAUH 3RVXC 2QQLL 2X41A 4JVWA 3DUUB 5H37G 3I6GB 1W72A 4KKCC 2PUQT 2M1KA 1KCSL 4XNMB 3CVHL 1REIA 2ARJQ 1IQWL 5AYQA 1IGFL 4O02L 4JGUA 4IM8A 4X9HA 4LCWD 1J1OL 4XI5C 5GS1B 3TNNB 5HYSB 4KZEH 1MJJB 1NMBL 3EYFB 4WRLA 4NC2B 3BQUD 1K85A 4MNGB 1GC1L 4RDQF 3FQXB 1YY9D 1K8IA 5F7HA 1T20A 1HILA 2LU4A 1G7IA 4KDVA 1Z5LB 1KN2L 4N0YL 4HC1H 3BEWA 4L1HA 1JNHB 3UTZA 1A1OA 2HH0L 4NZJA 5FKPB 4EXKA 3DROA 5ECJE 2R2HA 5FB8B 3TPUB 4AEIH 4Y4FD 1RUAH 4GXVH 2DQIL 1GGIH 3UTPD 3MNVB 2IANE 4PGZA 5GZND 4LLDB 1W2KT 3OF6D 4HWEL 2AGJH 4WEBL 3K8KA 5E2VH 4E42A 3D85A 2VDLL 1CTNA 1J0JA 1BECA 5TE6L 4AEEA 5IB5A 2R8SH 3VFWA 1OAXH 1IKFL 3I3EA 3W39B 3QWOB 2QQQA 5C70A 4ZPVA 3EUUA 1T7VA 2HG5B 1VSCA 5IJVA 1GZPA 4KY1H 3GK8H 2V7HA 3P4MB 2G5BB 4Y5YB 4QRTB 1CBVH 3TZVA 1WZLA 4KJWD 3TCXA 3BGMB 4EI5C 1OAUL 3S37X 4HIJA 3JWDH 4F7CB 3VD3A 3MR9B 4K8RH 4WWKC 1UEYA 1S7WB 5ILTH 4JZOA 4Z7OF 4WFED 4HK3N 2QR0A 1OD9A 5B8CB 3IFNH 3D9AH 4NBXB 4KZEL 1MSPA 2J8UA 4U31A 4G8GE 3DGGA 4UNVA 4WFHE 1P6FA 2J3SA 3K4ZA 3LRSB 4LCWA 1CF8H 1UADC 1U95B 3SKOA 1ACYL 3BQUA 4LDOB 4HC1L 5GJTH 3TVMB 1RZ8B 1D5XB 1F2XK 1NEZG 2Z0BA 5HVWA 4RA3A 1S5IH 3O45B 5D6CB 3P2TA 1M7XA 3QO1B 1UWGH 2V2WA 3HZYA 1RUAL 4GXVL 4ETQA 1GGIL 1KB5B 3CCHB 1F4XH 2IBGA 2AKRA 4DGVH 5ACMA 1CDIA 1J5OL 3DV4B 4GS7C 2ED9A 2GI7A 5FOBA 3FT3A 2E5EA 4OZHB 4WFGE 4J8RB 5E2VL 3WS3B 4MNQB 4Y4FA 1FVEA 4NC0B 1XF5A 3ARDD 4IBLT 2R8SL 2ORBH 3WEXA 1IL1A 1IKNC 3OF6A 1OAXL 5DVOA 2W65B 4PYHA 2QV2A 4NZTL 2EDYA 1DANU 4G9FE 1H15B 1HQRA 2VDPL 4J3WA 4Z7NF 2W60A 4KY1L 4YHIB 3FN9A 1FHGA 3JV0A 5HI5C 4HCRA 1CBVL 2X4SA 3NN8A 4FQ2H 3T3ME 2ZSVB 1FNEA 5FYJL 5CMAA 3JWDL 4WHYH 3MV9B 4G7YH 2CH8A 2X4UA 3PWJB 4L9LC 5DJZB 4QHKI 3ZT7A 4XP9H 2L7JA 1N5AA 5ILTL 4I77L 3UYPA 2ZCHH 1HKLH 3QEUA 5C9JB 4NZRH 1GYAA 3IFNL 3D9AL 4YIQB 5F7WC 2HLAA 5ELIA 1WCQA 2G2RB 4Z7VA 5FUCE 1CF8L 1TQBB 5F9DC 5LCVH 5DEFB 2IG2H 1AQDB 4Z7WB 2DQEH 3O2VL 4MXVF 1XGYL 2X4PB 4WU5B 5IBLC 3REWB 2GFBA 4HUVB 3JTSA 1S5IL 5EBWB 4LLYA 5C0FB 5E2WH 1OVZA 4IRSD 1UJ3C 1U3ZA 1UWGL 2P5ED 4RAUB 4V1DE 1SJEB 4FXGB 2CUMA 3BH8A 4YZFE 3H9SE 1F4XL 4DGVL 1DEDA 5EUOB 4JKPH 4PRPD 4OD2B 1IAMA 3GSVA 3BZ4A 3TCLB 5BS0B 3RVVD 4U3CA 2ORBL 1Q94A 2OL3B 3ZKXB 3H3KA 5D72H 1XMWA 3KS0H 4Z8FH 2P5WB 3VXTB 1A9BA 1WFOA 4WHCA 4Q6IA 3LH2H 2QADD 2IQAB 4FQ2L 3BWUC 1JI1A 2A6KA 3CU1A 3IU3A 1J86A 4G7YL 2EDHA 4LARH 5CD3B 5FGCE 2H32B 1RHHB 5DJAA 1I1RA 2NXYB 4BH7A 4XP9L 3BKYH 4OFYD 3V8CA 5DJ8A 3RQ3A 3DURB 2ZCHL 4R4ND 2C3XA 1HKLL 4NRZB 1D5ZB 3V6OC 4BH8A 4P2OB 1ND0A 1OP5H 1NDMB 4MWFA 4WV1A 3F7QA 4ODUB 2AXFA 1J05B 1D5MB 5EU5A 2NY4D 4K94L 2X40A 5LCVL 1QO3A 2IG2L 3QP3A 4X0KB 2OJEB 3MRHA 2DQEL 3JV4B 1KJ3H 1CD8A 3QUZC 4TNVF 1OGTB 2XWJB 1DEEA 1QYGH 5HGGS 2PXYB 4LASH 5C71A 5E2WL 3S3JA 4I1NB 4AQ1B 1TJGH 2ZNXA 5I8CB 3CFKB 3D0VB 4D94A 5DSCB 3RJQB 3U4AA 5F7NC 4IRSA 4JKPL 5GISL 4UOJA 2P5EA 2HMID 3I6LD 2CJUH 4UQ3A 1MRDH 1WSST 1AXSB 2F5AH 2NY5H 2XFXA 5HI3C 4L4VB 4WU7B 2XNAB 3SDXF 1TJIH 3U7YH 4PRPA 2OTWB 3OAUH 1N6VA 3BPOB 5D72L 3QIBB 3K4DA 4NQVB 1CG9B 1CICC 3FQRA 2PTUA 2BSTA 4FFYH 1CT8A 2VB5A 4Z8FL 2R0KH 4XCCH 4FTVD 5F7DA 1RURH 3LH2L 5J11B 2DYPB 3RNQB 3NZHH 1S9XA 4EN3B 5HPMB 1YA5A 3GSOB 1M1SA 4LARL 2VAAB 5I1IH 5INDB 3T4YB 3BKYL 5I2IB 2VAJA 3KVQA 3EYOA 1M71A 1QBLL 4DEPB 2OXHA 5ETUB 1LGVA 5I1CL 5HXMA 5I1JH 1G7JA 4OFYA 3NBNA 4YDIH 5GRVK 2VQUA 1MAMH 3QUKA 3OG4B 5T1KD 5F9OH 2JB5H 2B4CC 2R9HC 3TBWB 2CKBA 3LS5H 1KJ3L 1Q9WB 4PRAA 4IOSD 4WVRA 5DJDA 1QYGL 4KJPD 3VRIB 4D9LH 5HDQH 4LASL 4LU5H 1YN6B 1IM3A 5IK3B 2Q86A 1TJGL 4K8RD 1L6XA 5FA4B 1ZLWK 4H8WH 1JK8A 5DQDH 1OSZB 1LE5B 4JFXA 4M61A 2CJUL 1CDJA 3MV8B 4DGYH 1MRDL 2F5AL 2NY5L 1RZ7H 3FQWA 1TJIL 3U7YL 1UXSA 4JM4H 2YD6A 3OAUL 2YBRB 2CLVA 4PJ7E 4D0CA 4FFYL 3BD4A 1YMHB 4AEHH 4JAMA 1KEMH 4XGZB 5HYJE 5D9SB 2R0KL 3RWEA 1RURL 4ZTOL 1L9NA 3T8XB 3QPXL 1KB5H 3NZHL 2AJ3B 5IGXH 5D7JB 3MBEC 1U8NB 4FTVA 4CVUA 4Q97A 3OGOE 4XPFH 5I1IL 1BLNB 1RZGB 1AGDB 1P7HL 4PG9B 4EUPB 4FQ1H 1T4KB 1T66C 4F7TA 4JPVH 4PRHE 5D1XD 1EVUA 2P24B 2MQCA 3VJ6B 1T7ZA 2EIBA 4X98B 3G5YB 4YAQB 5I1JL 1HIMH 3MZGB 2VISB 4G80A 4YDIL 5C08D 4NWTH 1J18A 4OUUB 5D4QA 4CN1A 4ZNEA 5HVHC 2C5DC 5IEKA 4X9BA 5F9OL 4AJ0A 5FYKU 4UIMB 1A1MA 1JPGA 2HFGH 1ULVA 4JZJA 2X10A 1B2WH 1IILE 1KIPA 5D71H 1MIEH 1KCKA 2ICEA 4D9LL 4NKMA 5T1KA 3C60B 5HDQL 4LU5L 1QLFA 1XGPB 2OS7A 3IDNB 5MENB 1ZSDA 1HXMB 5B39A 4YBLC 3CPLA 4H8WL 3G5VA 2ICWB 2OP4H 3JV6B 4GW4A 2AXHA 2OR9H 5DJ0A 5C0EB 4EQ3A 4NSKA 4YGVB 1UVQA 4S0TD 5GZOD 1K3IA 3IAQA 4PV8B 4DGYL 1TCRA 2EIDA 4UIKH 1RZ7L 5TH2A 2FJHB 4P4KC 4JM4L 3QWRD 4LEOA 3PWPE 4GKZB 4AEHL 4AH2A 5E56A 5I17B 3BP7B 1KEML 1IGCH 3K1DA 3CFIC 1R0AL 4RGNB 3GMOA 1HK6A 4W4OA 1QSVA 1KB5L 2HVJB 4OZGE 4BFGA 2ATKB 2PYED 4L4TE 3KPRD 1WV7T 1AKJD 4F7PA 5F1NA 4XPFL 3ULUH 4M93B 5GGRA 2JJUA 4MLIA 3IT8D 4Y4HD 1MCLA 1FNLA 1WZKA 1BIHA 4FQ1L 1FO0H 4JY6A 2OL3H 5F72S 3AAZB 3TZVC 3E6FB 5FA3B 2Y6SC 2VLKB 2BOCA 5TQ2H 5IMKB 5FGSA 2N4IA 4CMHC 1D5BB 1G7LB 3WHE1 4OFKA 4OCSH 1FAKT 5E5MA 5HHMD 3K2MC 4NWTL 4ZODA 1B90A 2FZ3B 5KN5A 4UDTB 3D0LB 1CZ8L 5DT1H 5FYLD 2A38A 2VE6A 2GAZA 3L3JB 2VSDA 3GUTB 4MJ4A 4OF8A 2HFGL 5ITBH 1BFTA 3DO7B 1B2WL 4JKLA 2H32H 1YEGH 3O11B 4OZHF 5D71L 5GGSA 4PJCE 3QXDA 3N1FC 2ZCKH 2YD7A 1WBYA 5E8OB 4QRRD 5BVJA 4XMLH 3AGVA 2ID5A 3K3QA 5I16B 2OP4L 3BQUC 3GMMB 4LSPH 3VFUB 2OR9L 5J7CC 1YY9C 1U3HD 1HHJB 2EIZA 3ULVH 4JFQB 5JQ6H 2J8UB 3C5ZB 2VQTA 1LMKA 1BAFH 1S9VB 2BNQB 1X4YA 1S5HA 4OF0A 4UIKL 5E9DD 4XNZB 3CFBB 4JDVB 3PWUB 3UBXG 4BQ8A 3ZDZF 2DLFH 2J6EH 3V0VA 4Y4FC 4Q0XH 5C09B 4C83A 1I3RB 5IMMA 3X12A 4KI5F 5GZNC 1I7TB 3QWRA 3QHFH 5DJ6A 4HKXB 4NCC1 4YEEA 2BY0A 4JR9H 4LK4A 4JO1H 3ULUL 4LSSH 5KSBB 2PYEA 3KPRA 1E27B 4PJXF 2OL3L 3LV3B 1AKJA 5JIHA 2UVFA 2RR3A 5TQ2L 2GJJA 3ILQD 1X5KA 4DGIH 4XAWH 4Y4HA 4OCSL 5T3XH 2X42A 2IBZX 4KJWC 1YQVH 2Y9RT 4JFHD 3V95A 5JLZA 4NT6B 2JELL 5DT1L 3MRPB 2VN4A 4ZO9A 5DK2A 1X4ZA 5ITBL 5CBAB 1NEZA 4M03A 3EAKA 5EIVA 5EWIH 1WJ3A 3L5HA 1EERB 3HRZB 5C92A 2ZCKL 4HWBH 3O3BA 1TVHA 1ZWIA 2YEZB 4XMLL 4DUXA 2P45B 1U8QA 3OKDB 1IC5H 3B9DA 2R56H 4I18B 5SWZE 1JIBA 5CCKH 4QRRA 5F88B 3ULVL 4KGLA 5JQ6L 1EHAA 4YDKH 2KQMA 1BAFL 3MRNB 3NIFE 1HHIB 5EU6B 3L5JA 2V6HA 1U3HA 1BD2E 2Y72A 1BOYA 2DLFL 3WIHH 2J6EL 5DA0B 5E9DA 3MMEB 3VFMB 5IVZB 2OTUB 4LKXA 4NNYA 3VWJB 1NKRA 3QHFL 3EW3B 3ZYZA 5IOPA 3ARDC 4JR9L 4LSSL 4MNHA 5BQ7A 3BW9B 5F9JA 4Q6IC 2BRRL 2FL5A 1ED3A 3DX7B 1R3LB 3I6KB 4P46D 4QRPD 1QSED 1DZBA 1Q94B 3O3AB 1QD0A 1U8HB 4XAWL 4DGIL 4OLEA 3R06A 1A8JH 2HFTA 4TYUA 4WUKL 4QTHA 1YQVL 2F8OA 5F97E 1A9BB 1PYWA 1NL0L 1F11A 4ZXBD 1INEL 3D2UB 2BNRE 3KHOA 3CUPA 4WV1C 25C8L 5EZJB 2GTWB 5EWIL 2IPKB 1F3RB 4NKOB 1DTUA 4EUPH 2F5BH 4HWBL 5DJAB 1RIUL 2PTTA 1IC5L 3WFHA 2BRQA 2NZIA 2R56L 3UPAA 3TIEB 3ZYIA 2K9UA 3CDYA 5GS0H 5CCKL 4G6JH 2FR4B 4I9WD 4YDKL 4P57B 3U4EA 2AXFB 3HZMA 1NDGA 1MI5E 2EKJA 4HZLA 1K5NA 4MQ7A 3A67H 2K7QA 2DWDB 5F1KC 3IFOB 1NANH 4O2FB 1HOCA 4RISH 4IRSC 1CGXA 3WIHL 3MUHL 2JCCE 3T77A 3G5ZB 3L95B 3BKMH 1FZMA 3WV0A 3O2DA 3HZVB 5E94B 5F71A 4KI5D 2C3VB 3RVVC 3FTGB 4WWID 2JKXA 2HTKD 2H2SD 1R3KA 1KTDA 3G08A 4D0DB 3TA3D 3QUYD 3RPIA 1KB9K 1CU4H 2NY0B 4AIOA 3EOTH 3L6FA 2E8ZA 4MD5B 2QADC 3BKJH 5DRXB 4P46A 4QRPA 1QSEA 2A6DA 3I9GH 3KDMA 4LHUB 3QDMD 4OZFB 2ADGB 5T3ZE 4OLYH 4R4NC 4GG6F 1JF6A 1PKQE 2XA8H 3H7BA 1YYMH 4X5WB 4ZXBA 1TVBB 3LKSB 3HR6A 2F5BL 5C0DA 1X7QA 4JFEE 1FNSH 1LK2A 1VB9A 1QZ1A 4LPXA 3L3OB 1K6QH 1S9YA 2Y4SA 3UTSE 5GS0L 2Z31B 2NY4C 4G6JL 3VFPB 5DRWA 3WHE0 4EBQH 3RY6A 3LRGA 5HGDB 3KLAB 4NOBA 4JCLA 5JW4N 4HJJH 4IOFD 5D93C 1ZHBA 4U1HB 4G3YH 5DYOA 3QRFM 3BIKB 3HI6H 1ZGLB 5F7LB 4Z7UB 4JFFE 3VXRD 3OKLA 5LAXB 1BVLB 3BKML 4MD0A 4DOHB 3QEHB 3UCRA 2HMIC 2AEQH 1FIGL 4PD4J 5KVEH 2NTFB 3RZWA 1A7BA 2VR5A 5D5MF 1ZLSH 1QFUL 1FFNA 3MACH 4P2OD 4I0KA 4NO5A 5D2LE 1FV1A 1TTGA 3DVNB 1N6QL 1CU4L 4OGXH 3EOTL 1F2QA 2NY2B 1T3FB 3W9EB 4HK3J 1KUMA 2GY5A 3BKJL 4PJHF 1NMCC 5C07D 32C2B 2VLMD 1FSKB 3GO1H 3QI9D 1R24B 3TA3A 3I9GL 1U3YA 3TIDA 5I71C 4PJXA 1Z9MA 3HMXA 2DI9A 3MV01 3ETBF 5IQ9B 1EBAA 4JCMA 4LCIH 3EOBA 2AEWA 4OLYL 1YJDH 3VFVB 3QDMA 1YYML 3S3PA 2HJLB 4C4KO 3TT1H 3B4NA 1FNSL 1P7KA 4P9HC 1K6QL 4X6EB 4JZJC 4U1GC 3LQAC 3UPRA 1T7YA 2CDEA 4Z77A 3GMNA 5AZ2H 4U1MA 4EBQL 3QIBD 4LIQH 4XP6H 3MROA 2EDRA 5CEXB 4Z78A 5T3XD 4ZFGH 1QSFE 4HJJL 1FO0A 4KJPC 2BY3A 2C4FT 4A2LA 4R0LA 1JUFB 2FLBT 3LS4H 4NQDD 5I1EH 4K8RC 4JEGB 3LHPH 3SKNB 3CLEH 3HI6L 2EDBA 4ZO7A 1S7QA 2E8YA 5EBGA 4ACPA 5CFHA 1ZSDB 2FATH 2X6MA 1QRNB 2AEQL 5KANG 1I8KA 5KVEL 2BVPB 1ZLSL 2I26N 5CSZB 3VXRA 3MACL 3WO3B 4JLRA 4F15C 1T5WB 3IETB 5CINH 3CFEA 4GRMA 2VITB 5DFVD 4EXPX 4HUUB 4QRQA 4NWUH 2CDFA 4MJ6A 1B3JA 4LGSB 4W4OC 2ESVB 3AVEA 4NC1E 2VR9A 4LLQA 1DQMH 4OGXL 4BQBA 2YUWA 4Y4KD 2H8PA 4I8DA 1BWMA 5DK0B 2IMNA 3QQ3A 4XMPH 1QR1A 4PJ9D 1XH3A 4X80H 4TUJA 3QB7C 3FO2A 3GO1L 1NCTA 3KGRA 4K2UH 4XCYA 5IR1B 4KJYB 4IMLB 2WK2A 4XH2A 4M48H 4LCIL 4ZUVA 1CDHA 1JTTA 4OB5H 5C07A 1F58H 3OGCB 4NHUA 5IW6B 4DVRH 3RFZC 4EVNB 2ADFL 5D1XC 1HH6A 5LBSH 3TT1L 5DMIH 4G6FD 1Y0LA 2BOCB 4HS8H 4M7KH 5AZ2L 4KKAD 5FYKL 4UAOB 5J89A 3E8UH 4LLWA 4XP6L 5GIRA 1ZT4B 3T3MF 1E4KA 1FYTB 4WFFE 4ZYKA 5KN5B 4ZFGL 3PHQA 1PG7H 4IRJD 3OXSB 1N8ZA 4R3SA 5I1EL 3LHPL 3ZDXE 4WJ5A 3CLEL 5ISZE 4R9HA 1MCQA 2Y5EA 2ZCLH 4HWUA 2IMMA 1MRFH 1YPZB 3AB0B 1IVLA 4ZDHA 1FJ1A 4QXGH 5F7YC 2FATL 3FFCE 2W38A 4NQDA 5EB9A 3U79A 3MRGA 1ZA6B 5CINL 1UQSB 2BSSB 1EDQA 1B0GA 1MCIA 1AR1D 4NWUL 1DBAH 2A74B 3ZHLA 4DN3H 2NR6D 2Z4QA 5F44A 1DQML 3QDGB 4RGOH 3UBXI 2AQ2A 4HWZA 4NNXB 3DXAE 1NC2B 1DN0A 4XMPL 4JFPB 4X80L 5IT2H 4CMMB 1ZANH 2YD4A 4PJIF 1CQYA 1N3NA 4K2UL 4PTTB 1XCTA 2KZ1B 4Y4KA 2WANA 4M48L 4F7EB 3MPCA 4PJ9A 1ZGLP 1MCCA 3NIGE 4OB5L 4Y4HC 5J1TC 2APXA 2ILLA 1F58L 4DVRL 2VLLA 3QISA 3RTQD 2AEIT 5M94B 4MD4B 1KBGH 1X5GA 5LBSL 3P4NB 2VH5H 4NUJB 4NJAH 1VERA 3DLQR 3GB7A 4UILH 5ANMB 3SGJA 3GIVA 4HS8L 4YEFA 3P0GB 1SJVA 5ICXA 1YNTB 3LIZH 3QIUB 3E8UL 4U1JB 3GMPB 4GG6A 2XN9D 4ZD3H 2YUVA 4WHTB 5CLTA 3UTTA 1C12A 4ZO8A 3UBXA 3I75A 1PG7L 4PJEF 3RVWD 1CIUA 1FORH 5K59F 5DMKB 2DLHA 3SJVD 4ZOCA 1NANI 3S5LG 3P73A 2AV1B 1FG9C 1ONQB 5ALBH 3U0TA 3N85H 4IRJA 1QBAA 1QNZH 4PGCB 3DYMA 1N5YH 4QXGL 1KTKE 1U3HC 3C8DA 5ALCH 4X4ZA 3PL6D 1WZMA 4XP5H 4AY0A 4L4JA 1WWAX 4O58H 1FN4A 2RQ8A 1N2RA 1DBAL 1DE4B 4UI2A 1U42A 1CFSA 1LEKB 4E5XB 4DN3L 3HZKB 3V79C 2G5RA 4PGDA 3CZFA 4RGOL 3MCLH 1XR9B 1UB5A 3H8NA 5IROA 5D5MA 3F7YB 3U9PH 4PRNA 4M43H 5KSVB 3RL1A 1ZANL 1IMHC 2IBBA 5E4EB 3TBVA 4X9IA 3N50A 2VZ1A 3HNSH 4HIHB 3S96B 3F65A 4NQSA 5E6ZA 5IOPB 1LHZA 1JGDA 2R0ZH 5I8EA 4PJHA 2H26B 5BW7A 5J12B 1P4LA 4G43B 3ILQC 2EDOA 2FL5B 2VH5L 3MLVH 4PJDB 4QHNB 5H8DA 4NJAL 4U1IB 4BKLB 2C1OA 1NBVH 3OR6B 1ZS8B 2DI7A 4XC3H 4XBEH 1FAIH 2NNAB 1BBJB 2GT9A 3RTQA 4UILL 4PP1D 3MRCA 3LIZL 4ZD3L 3DARA 2ATPA 1BEYH 2HTLD 3IXAA 5EC2B 3IVKB 1F11B 4DFIA 3T3PE 3RVTD 5MI0B 3HTLX 2XN9A 5I9QC 3F62A 2A6JB 2V7NA 4J3OC 2ZUQB 2Q7YA 5ALBL 5EFIA 2V9RA 1RPQA 3N85L 1MLCA 3MRBA 1A4KA 1NFDB 1QNZL 3RX5A 1S3KH 3CD4A 5ALCL 4NN5B 3SJVA 3PV6B 3BN9D 4D3CH 4A6YA 3EDFA 4XP5L 3MA7B 2E7LA 4O58L 4U1KA 1CE6B 2V17H 1QHPA 3PL6A 1H0DA 3OV6A 3LQZA 1SY6A 2BVEA 3MXWH 3LDBC 3DX6B 4TNVK 3FRPG 3U46A 5CLWA 2E9JA 3VDAA 4APQD 3GNMH 5BZDA 3DVGA 2AJXL 3PQYD 4M43L 4HUWB 5CJQH 4NKDB 43CAB 5EO0B 3MC0A 3U48A 1I3VA 4GQPH 4KKLD 5JW4M 3HNSL 4XVTH 5JOPD 3ARTA 1P7QB 4X4ME 4P46C 2A9NH 3VFSB 1EO7A 2R0ZL 1MJUH 3DX8B 3FRUB 2GQHA 1AO7E 1IC1A 4CW1A 3MLVL 1U92A 5BVPH 3BZFB 4PJ7F 4IHOB 4PJ8B 3KPSB 4XC3L 4XBEL 3RWIA 4QHMB 5EIIA 1RK1A 2NX5B 2VLJB 4K07A 2WMPA 3QBTB 3QEQB 4ZXBC 1ZVYA 4YHYC 5J57B 1SEBB 4OQ1A 1BEYL 3V6ZB 1G7HA 2R23A 3WIFB 1IGTA 3H9HB 2P46B 3T2QA 2JJWA 4ODWB 5DMYA 4OGYH 3ARSA 3RY6C 1J8HE 3WDIA 4PREB 3EO1A 2FJGB 1NGYA 1FZJB 3QFJE 1ADQH 1NBYA 1KCRH 1A7RH 3OKNA 4D3CL 4RCAA 1F6AA 3G9VA 4XPTH 2BHZA 4H1LG 2V17L 3WE6B 1GXEA 4B0MM 4P2RE 2Q6WA 5D1QD 3G6JB 3D3VD 5KG9B 3MXWL 2WBJB 3IJSB 5L88H 1JGEB 2P8LB 1C5BL 1WFNA 1S9KC 2BVQA 1AJ7H 1FL6A 4GUPB 4KKNA 1V3KA 5CJQL 5T5NG 2ZOKA 4FP8H 4WW2F 4OCXH 4KI5C 2VDQH 5MEOB 2AXGA 1KPRA 4APQA 3U4BH 2HTKC 3PQYA 1FC1A 1INQA 3HNTH 1A4JA 2H2SC 4XVTL 5IV2B 1WBXA 1MFEL 4JRYB 3OSKA 2A9NL 4QLRA 3MNWA 2NY3B 4P5KA 1MJUL 3TA3C 3QUYC 1CXEA 4X8XA 4ESKA 4PJIA 5IG7B 5BVPL 1S7TA 3BP4B 5E7BA 4EZMA 4NCC2 1R3HB 2R29H 4LRNH 5EBMB 2BCKA 4PRIE 1YYLL 2WLZA 4XVJH 1QQDB 3ARGB 4R8WL 4LPYA 5FGRA 1JRHH 4LLUA 3FOMA 5KVFH 2JLLA 4X8JB 4QEGA 4LDLB 2R2EA 1OGAE 5I1DA 2OCFD 3NCMA 1LEGB 3B3IB 4M7LT 2Y25A 2D9QB 3GBMH 3X13A 3PV7A 3UZQA 1ERNA 1ADQL 3C9NA 1KCRL 1A7RL 4WUUB 4R0LC 3MJGX 3FQTA 1L9MA 1R5WB 2DBJA 4PJEA 3T0ED 2R2BA 1T1YA 4RA0C 5J9PB 3KPPB 3FOLA 2NY0D 2D7MA 4IOFC 4XPTL 5IVXE 2BDNL 4PJAF 3OHXB 4K7FB 5JDSB 3HI5H 4YC2C 5TF0A 4PR5B 5LKNA 4X6DE 5L88L 4OGZA 3U36B 5J1AB 5D7KD 3L7EA 3ZL4L 3KXFB 3HUJB 2GK0B 5A2JH 2AEPH 2VLRB 5IM7A 4FP8L 4OCXL 5D1QA 3D3VA 1S7QB 3CSGA 2G60L 2VDQL 3DYOA 4Z9KB 4GW1A 3SY0B 3MX0A 1A6AB 5CWSA 3RGVD 3U4BL 1KIQB 4P2OC 1J0IA 3HNTL 1S7VB 1HHHA 2O61A 1KNOA 3GMLB 3EYVA 4P3DB 2EYRA 3IJYA 2WNGA 5CUSH 3VA6A 1DANT 1HQ4B 2WIMA 3QIWD 4HUKB 4U1NB 2NXZB 3RA7L 3P9MA 2H1PH 2UWEF 5F7UA 5HGHB 3QI9C 1NGZA 4LRNL 1XGQB 5E6YA 1DDHB 3W11D 3ZTNL 4XVJL 3W0WE 4Z7QF 5DI8B 1DBKH 5IKCA 3JUZA 1BPVA 3KAAA 5KVFL 1KTRL 5M7QA 1A6VH 1JN6A 5E00A 1OD7A 1RI8A 1DN2A 3MGAA 3OKMA 4XX1E 3K0WA 4M8QB 1E4KC 3GBML 1SMOA 3VG0H 5ADPH 2A6IA 4U3HA 5D2NB 3QAZB 4K23H 3IDJB 1AY1H 1KJ2B 4A2MA 1MHCB 2CO7B 4XMKH 3QXWA 3HE6B 3B6SA 1IZKA 1RHFA 1JJUA 3BZEA 1II4E 4JRWA 5D7IF 4U4BA 3HI5L 2R69L 2UYLA 3T0EA 1MF2H 4P99A 1RJLA 5E4IA 3BFOA 2P8MA 3S34H 5IESL 2EYSA 4DCQB 2AEPL 4JQXA 4QOKB 5I74B 4GAGH 5TE4H 3U9UB 5INCA 4Y5XB 3PWVB 4H5SA 4LVNB 1IGYA 4OF5A 5DFVC 3GZKA 3VFNA 1FCGA 4P9MH 3X11B 3R8QA 4QNPE 4WI6A 5DS8A 1NBZA 3SO5A 3RGVA 2HVKB 5GS2D 4CU8A 4Y4KC 3GRWA 1TNNA 1U8LA 2MSPA 4PJ9C 3KPLB 1FL5B 4I0CC 2RCSH 2BOBB 2BP3A 1AP2A 2EE9A 3QIWA 5D7LB 4O9HH 2NW2A 4MB3A 4ELMF 3PWPD 1DUZA 1DBKL 1KCUH 4Y0GA 1T5XA 1AHWB 3AXLA 3RWCA 1A6VL 4TOYH 1U6AH 4PJ7A 3SGJC 4JDZA 1NJ9B 1YECL 1CL7H 4FMKA 1Y18B 1GGYA 2YRLA 5C2BH 3D39D 5I30H 5IIEB 3JTTB 2A0LD 4U6HB 2DDQH 1I1YB 5ADPL 3O4LB 4KKAC 3HPLB 2LTQC 4OV6F 1QLRA 4XMKL 5T5NF 3VRLF 3QG6B 3NACL 3ES6B 4IRJC 3A6OA 1YMME 1LD9A 3I50L 4NN6C 3L7FA 3FFDA 1NGQH 3WHXA 3BH9A 4PJGF 1MF2L 4M1GH 3RWHA 1C12B 3UTTB 4BQ9A 5KOMC 1MCHA 4JFDD 3UMTA 3UO1H 1H8SA 4W6YB 4MDIA 4R4FH 3S34L 4NRYB 4GAGL 5E8NA 5TE4L 3F12A 1A6TA 2OSLB 3PWNB 5DDHA 3SDYH 3P77B 3DSFH 3K4AA 1AR1C 4P9ML 1LO4H 5IROC 3PGDA 1DVFB 2HWZH 2NR6C 4L5FH 2VABA 3C5SB 3HLAA 5JPNB 1IQDB 1V7NH 1KIRB 5DJYB 4WW2A 1GGBH 4I2XA 2VZSA 3GSXA 2MQ3A 3VU2A 4O9HL 5LXGH 4DZ8B 1T1XB 4LL9A 5BW7C 2OM5A 3B2UD 4HGWB 1KCUL 2PETA 4NO3A 3CXHK 3BO8A 1T7WA 3D48R 3O2DL 4U6XB 4DK3A 4TOYL 3RTQC 1U6AL 3GHBH 4X6CE 5IB2A 2MFNA 3S5LA 3PWPA 1CL7L 5SWSE 3KLSA 5J6GB 1A6ZA 5C2BL 1CE1H 2B39A 5I30L 4LMQE 3QZWG 2R39A 5C0AE 4DQOH 4C56D 4M9PA 2P7TB 1IAKB 3PNWB 5FK9B 3D39A 1H3GA 1CDBA 2IANB 2AJSH 3P30H 3CMGA 3BRFA 1H8NA 4YBQD 3RVWC 3RL2A 2BZDA 3RWGB 2V9QA 5DMGD 1NGQL 3LD8B 1EVTC 3V6OE 3IXAB 15C8H 4LCCC 4K71B 3O3UN 2E7LC 3VXUD 4P5TB 3VCLB 3M17A 3VXQA 3PL6C 4JFDA 3SDYL 5AG9A 1A4KB 4PJAA 3DSFL 4YNYB 4MJIE 2P47B 2RHEA 2HWZL 3OKKB 4HKZA 1T2JA 2DIAA 3MRKB 4HV8B 1IGJA 3W82A 3WNPA 3T1FB 3MRLA 2GCYA 2FECL 5LXGL 1WC7B 3G5XB 4G8GB 4PJBF 2X7LA 5JPMA 1WLHA 4JREC 3VGAC 3KPQB 4Y19E 5DC4B 2WINA 1HSBB 3Q6GH 4LVOB 3L5IA 1HINH 1EEQA 1JRHI 2UWEA 1CE1L 4G8IA 5FKAB 4X5XA 2EO9A 5KS9E 4DQOL 1IE5A 3VFGH 4PP1C 5DURB 4RWYH 1ZT7A 4OD1H 4NRXB 4J2XA 4GRWE 1GOHA 2AJSL 2HTLC 1FFQA 3S98A 4C56A 3ZKMD 1SJXA 2BMKA 3BWAA 3RVTC 1QA9B 1N7MH 5ENWA 1QEWA 1K4CA 1VFUA 1XAUA 3WFBH 4XT1C 1RZKC 1EXUA 3RDTD 5FCSH 3ALXA 4G9FB 3CDGA 1YJDC 5ID1B 1KC5H 3BN9C 1TETH 4NKQB 3OTTA 3RAJH 5DFTA 5H94A 1KJ2H 5D7IA 3VXUA 3LKRB 3ESVF 2F74A 1EEYB 5EOTA 5DD3H 1CDCA 2BVYA 3T4AA 1PY4A 4TTGA 2CIKB 4DKEH 4APQC 4D9QD 1NPUA 3GSNB 4NN7B 3MUGA 2DIJA 4F33B