1SEBD

Complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
234
structure length
206
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKTCMYGGVTEHDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a human class II histocompatibility molecule complexed with superantigen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc ii/peptide/toxin)
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 43
structure length 206
sequence length 234
chains with identical sequence H
ec nomenclature
pdb deposition date 1995-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sebD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sebD02
3BYYB 2XRQD 1YN4A 5ELBA 4RGTA 1DYQA 2IJ0A 1FNWA 1I4PA 1UUPA 1JR0D 1CHQD 1BXTA 2G9HD 1FNUA 3BVMA 2AQ1B 3BYTB 1LT5D 1CQVA 1EU3A 1XTCD 1MD2D 1B44D 3R2IA 1F77A 1TS4A 1BCPB 1ET6A 1SJHD 3MC0B 1YN3A 2RDHA 1B1ZA 1SXTA 1HQRD 5ELDA 4NZLB 2CHBD 4DXGA 1XXGA 1S5BD 4UDUC 2AQ2B 1D5ZC 1LT3D 4RGNA 1V1PA 4O1NA 3R8BA 1KTKA 1LT6D 1TS5A 1BCPF 4RCOA 1LTBD 1L0YB 3BVGA 1JWUD 2NTTA 4L6TB 2O2LD 1LT4D 3BVZA 1CK1A 1PTOB 1EEFD 4OHJA 1RD9D 5ELEA 1JWMD 1PZID 4RH6A 1ESFA 1LTRD 2QEJC 2TSSA 1S5ED 3URYA 5TSSA 1HXYD 1JWSD 2QILA 5I4DA 1I4XA 1SEBD 1T5XD 3W2DA 1PTOH 1EEID 1I4GA 1YN5A 1S5DD 1SE3A 4RGOS 1L0XB 2AQ3B 1PYWD 1LTSD 1RF2D 3EA6A 1LTGD 2WV6D 3R2TA 1LTID 1PRTB 4BWGB 1KLGD 1M4VA 1S5CD 1UNSA 3CHBD 1TY0A 4RFBA 2RDGA 4ZYSA 5FK9C 1SE4A 3EFXD 1STEA 4C56C 1D6EC 1I4QA 2SEBD 1I4HA 2XNAC 4K6LA 1PRTF 5D3DA 3KLSX 3DWAA 1S5FD 1EU4A 1LTAD 1G8ZD 1RCVD 3O13A 1ET9A 1PZKD 5FKAC 1CHPD 1TS3A 1BCPD 3OWEB 1RDPD 1D5XC 1EWCA 1GOZA 4RHRA 3BZDB 1JQYD 1I4RA 1PTOF 1FNVA 3TSSA 1AN8A 1EFID 2XRSD 1PZJD 5ELFA 1ENFA 1KLUD 1V1OA 4DXFA 4L63B 3SEBA 2NTSA 1TS2A 1AW7A 1LTTD 4RGMA 1CT1D 3DWQA 1LLRD 1BCPC 1PRTC 1PTOD 1JCKB 4TSSA 1TY2A 1PRTD 1LO5D 1PTOC 2J4XA 3GP7A 5D3IB 4RHSA 2IPKD 1QILA 4Z9CB 1DJRD 2XN9C 2ICIA 5ELCA 3MFGA 2R61A 3DWPA 1D5MC 2Z8LA 1HTLD 1V1PB 1SE2A 1FGBD 1FD7D 1HA5A 1SJED 1SBBB 3V05A
chains in the Genus database with same CATH superfamily
2PEAA 1NVID 4DAYB 3DDCB 3ZNZB 3L3OC 2EE1A 3A74A 4CDFC 4JOIC 4P16A 1K8GA 4LNKA 4K5WA 1IXRA 2I0QA 2IGDA 2RSNA 4WWNA 4XQNA 1B44D 1F77A 2K14A 4W9EA 1OTCA 4BBNC 3AFQA 1WXMA 1B1ZA 3RZFA 4A75A 1ZYRD 2N78A 3E9IA 2N49A 3KBGA 2ZZPB 1AYFA 5IGDA 3DHHC 1C48A 2HIVA 1A15A 1SFOH 2M0XA 1SYGA 1XJVA 2ZJRA 1ML0D 1VQ4A 4AP4C 1YQBA 1P8LA 3JC66 4HJKA 3HOZB 2M00A 2Q8IB 3J81c 1ESRA 4WWPA 2QCZA 2WFWA 2BS4B 2F0UA 3VDYA 2JY6A 2LY7A 3K7AH 1CA6A 3JVZX 4A90A 3QO2A 1RL2A 5HG2A 4X57B 3HOWG 1VMPA 4K81A 1S5ED 4A3LH 4EFOA 3URYA 3PIPA 2AWTA 3IFDA 1W2BA 3AEBB 3KQ4A 3WALA 2LVPA 2JX5A 3I8ZA 2HCIA 4JCVE 3MTSA 4PYUA 2PYKA 1NI2A 3UDFA 2KJHB 4LFAL 3W9CB 1U4RA 3U4EG 3HUIA 3IVFA 1JE4A 2K33A 2AQ3B 2GMIC 2PMVA 4EOYA 1GJZA 3CCEA 4IUNA 4A3JH 4W9IA 3PLVA 4W9GA 3Q22A 2H4OA 1ASZA 2YVCA 4QIWB 5IP7H 4IFDJ 1K3RA 1XPRA 5AZGA 1B7YB 3A4SC 2EDGA 1GHJA 3ZXRA 1JICA 4BXXH 1F9RA 4EZKA 1II3A 3DM3A 1F1HA 1YX6B 4N9F4 2Z6KC 1QLBB 2R2QA 2L0FA 2A73B 4XWWA 1UE1A 4DV6L 1PRTF 5D14A 3Q69A 1J7CA 1BKBA 4OZBA 1IW7D 2N7EA 3VR6A 5HI1A 1KC8C 4KSLC 5LLIA 3CIRB 3PUVA 3UDIA 4ZUJA 1N36Q 5KYLA 2HJ1A 1CHPD 1G51A 4TQUS 5IP7G 4NPNA 4K6DA 1WTPA 5DPTA 3ZO5B 1BMLC 1I4RA 3DXJC 4IUQA 2WU2B 4FLHA 5IWAL 3E5SA 1XCTL 3K81C 1VQ9A 1PZJD 2JA6G 4PK1A 3Q3MC 2LEKA 1H9SB 2K8CA 3W1SA 1YHAA 4TSSA 5EKLA 4A3FH 2WXRA 5L95C 3J7AV 2K5WA 1TKGA 3FPPA 3E9SA 4PV1C 2INPE 1QILA 4MHEA 3RZDB 4YT0B 1XF5L 3T8MA 2JP1A 3SGIA 1EIHA 3BG3A 4KV2A 1PXUA 2IO0B 5DCNA 4K7WA 3FMCA 3C46A 4TMAB 4C4VA 3KF6A 1X3EA 1L2FA 2EQSA 2N1WA 1DZ1A 1ZE3D 1HZCA 1B2TA 2OF1A 1U5KA 2E6XA 2B3GA 3RT3B 2HT1A 1UUPA 2ES2A 1VDVA 4URKA 1WFQA 3Q8DA 4B3SL 4CHKA 3KW5B 2XK5B 4JW0A 2R2OA 3D32A 2CH4W 2PPHA 3AU4A 4JI0Q 3AECB 3RLNA 1S4ZA 2KVMA 4C3HG 2WXQA 5FO7B 1WGHA 2K52A 2K01A 1EOVA 1FCCC 2C60A 1E1OA 1JALA 1V1PA 4POGA 1PFMA 3R8BA 4OX9L 2F4VQ 3BDCA 3I91A 3ERQA 3QB3A 4IO9A 2Q2UA 1LTBD 1Y1WB 1FPYA 2DAFA 3CWIA 3BVGA 1VQIA 4GN5A 3GTLB 5H1SE 2BDNA 3PUWA 3RZOH 4HKZE 2Y5BB 1FEHA 2K50A 4J15A 4P75A 2G3QB 2KJRA 2ONQA 3L10B 3H91A 1TGZB 4GDLA 3WA0A 4GLAC 1V97A 3I5JC 4C3HH 1UZXB 3HVDA 4REZA 2LI5A 4P74A 2E2JH 1LXDA 1IKLA 3QIJA 1NBFC 2FINB 1F0ZA 2DJFC 4H0LC 4RM8A 4A20A 2JA6H 5C1ZA 1TKEA 1HXYD 4LFAQ 2CJNA 2NVQH 2IW3A 4DAPA 2OWOA 2VUMB 4JLCA 1S5DD 2LS01 1SE3A 4ZKBB 4DAVA 4NJ7A 1EY9A 3JSVB 1PA6A 1XWEA 5LMNW 4DV2L 4ICVA 4IUMB 1YJIA 4NAWB 1FXAA 2VZKD 3QK0A 2JSVX 1WYDA 1LTID 3OOCA 4JI3L 1AEXA 2UXCQ 4OELB 1NDDA 2MP2B 2NVTB 1HR0W 2W9NA 1MHXA 4OXPA 3HKZE 3K5OA 5IWAQ 4ANXA 4KIKB 4J3OD 1EQQA 4BKSD 3QWZB 3ULJA 3IFWB 3VDZA 3H6NA 3AN1A 1I4QA 2EYFA 3C1EA 5HFYA 3RMHA 4L5RC 1GUSA 2EIFA 5GMVA 3FKIH 2NR2A 1VQBA 3KUDB 2A4ZA 2EYHA 2DN8A 3GTMB 1MI0A 2KTFA 4GS3A 3GTQH 1J7BA 1HTOA 2WHIA 2NZOA 2I5MX 1F2RI 4R3DA 3SXHA 3CCRA 1JB7A 3NZSA 1MIUA 3BZDB 5G3LD 4BBNF 4HKQA 1UWVA 1N61A 4JK1C 2L55A 1EY7A 3TMEA 1H8CA 1NUCA 4KJOA 3CCJA 3S1MB 1UGMA 2ZW1A 5LMNQ 2VNUD 1IZ6A 3VYUA 5IKCM 2J42A 1HR0L 1A3UA 2WQYB 3EFUA 2KBNA 4RGMA 4YCWA 3GTKB 5IGBA 3K9OB 4JI0L 2JJQA 3HM6X 1WFYA 5CV4A 1P3QU 1IBLQ 3PZ7A 3WAMA 4XGAB 1GUTA 4RAUC 1ZDXA 3RLOA 2B8GA 5EKKA 1YX5B 2FCMA 3P42A 4HLEA 4X3UA 3TREA 5I9OA 3HOYG 3IAS1 2Q8RE 2F3VA 2L5TA 3TZUA 4E71A 1YI2A 3HG9A 2I2YA 2X6LA 4CJ0B 1KF6B 3TL5A 2KWCA 3K59A 3G4SA 1E24A 2F0QA 4UPAA 2MHJA 2SAKA 1XTDA 4U673 3J7YW 1N62A 2JPHA 3TZDA 1LABA 3LWUA 3S1RH 2UUAQ 2R93H 1FM0D 3N1ZC 2LUMA 2F0WA 3TCAA 3T4AC 2K5VA 1NTGA 3DVGX 1VRAB 5CGKA 5I9PA 2L8JA 1XLOA 4A3JB 5IOCA 1UBQA 2BW2A 4N9TA 4IQZA 3IAM1 3PUZA 3Q3JA 3ZJTA 1N33L 3EQLC 2F03A 1S5BD 2AQ2B 2FCQA 1CI3M 2GA4B 1BDOA 1EY5A 3CC7A 1KAWA 4XYOA 2ZCCA 3CPFA 4NW2A 1WX7A 5COYA 3AXCA 1HNZQ 4LNQA 2KQ4X 1Z47A 2PQAB 1B50A 3Q14C 4G11A 4KVGB 1S1QB 1WE7A 3JSVA 4FJZA 5E1FA 4LJOB 2R92B 3L0OA 3GTGH 1ESFA 1E8ZA 1H9KA 3I4OA 2W54A 1P1AA 4YY3L 1T6BX 3QARA 5DPSA 3PO3B 1BUVT 3VH4B 1C9FA 3LGJA 3NTKA 4A3MG 4NXML 1NCVA 4CDEC 4FXGC 2MRPA 2F0PA 3PIOA 5K36G 2FIDA 4XC2A 1NSNS 1WTOA 4BY1B 2Y3AA 1IBKL 1EYCA 1PTOH 1A62A 1SMXA 4ZAIA 4XQQA 4DV6Q 2WAQB 1HNXQ 1Z6HA 4E6IA 1VZ6A 4NAWA 4EKUA 3NOBA 3MWYW 2UUBQ 1E7VA 4HIKA 2INCC 3ZDMC 2KFJA 2V3NA 2NVYH 1LTGD 4JI6L 1TWHB 4M1UB 3HK0A 4AWJA 1EY4A 3DOWA 5C4XB 1VQKA 3I72A 1KLGD 2KJXA 1Y8RC 3K80C 1SYCA 4KKTA 3AE5B 1VQAA 2RDGA 4ZYSA 3M95A 1ILPA 5AZFA 1K28A 1JE5A 3A8IE 2A6HD 3S9WA 3B1LX 2PO4A 1L0VB 2D0OA 3PSEB 3AI5A 2REXA 4LUVA 2F0EA 3L0WB 4RMAA 1KABA 2PQEA 3DWAA 3AU7A 2LJIA 3DBHB 4GSWA 2ALYB 4O42A 4A93H 3OTOQ 2PE6B 4AOFA 1R4QB 4O2DA 1TWAB 1FL0A 2AWNA 3T16A 2MCNB 3GB1A 1IW7C 4BY7B 4NJCA 1WR6E 1PTOF 1G6PA 5EPKA 2JWUA 2G45B 2JEBI 1XMQL 1RHPA 2XSCA 2LZ6A 3HKSA 5IGFA 3C8YA 1XNRL 5E6PA 1GM5A 2TMPA 3S2DH 2SNMA 4KD4A 2B2YC 2EOTA 2F0OA 2L1BA 1AE3A 2F0DA 4KHZA 4L5TA 1HTPA 2BBCA 2G4DB 2I38A 3JYUA 2EYLA 4IFDG 3NSWA 1JC7A 2A19A 3T1HL 2MX2A 1PTOC 2J4XA 4GOPC 5C44H 1CFMA 1NAPA 1WM3A 1H9RA 5A2QE 2ZNVC 3RPFC 1GUAB 1TJEA 3DWPA 3WWVA 4CBVA 1MJEA 5H92C 2WDVB 3N52A 3CCMA 4HCSA 1SBBB 2EYJA 2HE7A 4IM0A 4ZK9B 2D62A 1F2MA 1IHZA 4EZJA 2YLMA 2EY5A 1EQVA 3UIOB 2B2WA 3H1UA 3RZDH 2E8GA 3W3AA 1YNXA 3CCVA 4UY8C 3PS6A 3RUZA 1D7QA 1WGGA 1C4QA 3RN5A 1XLNA 4FF4A 2BKRB 2JZZA 3IT4B 1OTRB 1TS4A 4YY3Q 1BCPB 5FJ8G 2EKEC 1IYUA 1UELA 3EBEA 3LDZE 5HHDG 4B9WA 1RKNA 3FVQA 3A9JB 3QQ8B 2UWQA 1PDQA 2ZXPA 1LT3D 1UE5A 2Z4IA 2CQOA 1KTKA 1LT6D 1N5XA 3Q3FA 3QHTA 2O5JC 3AE3B 5GADC 2G9DA 4DV1Q 2KTRB 5IYDG 1L0YB 4B3TQ 1C1YB 1V43A 1AE2A 4A93G 2VUMG 5IIFA 1KD1C 4IWOA 2BYFA 1UH6A 3J80E 1XPUA 1L1OC 1QZHA 4RNAA 4V190 3GTQB 1E90A 2IO3B 3N6RA 1VD2A 5JJKA 1BVSA 1E1TA 4HR7B 4JI7L 1YEZA 4ABNA 3FAHA 3NZ3A 3APFA 1K0SA 2N9KA 1P7EA 1BOSA 2A68D 2MA9B 3UE0A 4Y7NH 3DBHI 1TT2A 3FC4A 2EJMA 3K7UC 1UD7A 1XLPA 1PH8A 3CSTA 1J0GA 4K5VA 2M17A 1L2NA 4BBSG 1DGJA 1T9HA 3J81E 4TRDA 1DXMA 4S17A 4BWGB 3M3YH 4JBJA 3KUPA 1ENAA 1YJ9A 2UU7A 3A5UA 2BPSA 4AUQC 2OQ0A 2SDFA 3J7A5 3D6WA 1XMQQ 2DUDA 4GIVA 1UEAB 1SRUA 1Q81C 1E8YA 3VRBB 2Y0SG 3ZJYC 2LSSA 5LMNL 1XX8A 1TZOA 1UWMA 1IUEA 1HR0Q 3EECA 2BVCA 1IYFA 5C4JB 4KSKC 3MXGA 4OZAA 1SMYD 3CCQA 1HPCA 3TEHB 2KQ7A 4ZRJA 3T3NA 3K7AB 1WYWB 3KVFB 4AQYQ 3I55A 1BO0A 1TIFA 2C7HA 2NVXH 2LXJA 1IBMQ 4X3SA 2VS1A 1XPOA 1SMYC 4HN7A 5M3MH 1GNUA 1SDFA 2M1MA 3EFCA 1PFSA 1CKMA 1U9RA 1Y14B 3CKIB 2K6AA 2NVUI 2ZPYA 5LL6S 4A55A 2PLPA 2KN4A 3CMEA 1EFID 3AULA 5MPOA 4JE3B 3ZRCA 1A2UA 4XWTA 3J9CA 1B70B 2EY1A 1B9RA 5AJ3Q 4KLKA 4L63B 4H13C 4ZRQA 3E9HA 2DNCA 2ON8A 1TWHH 2VZAA 5M5YB 3TP6A 2X6GA 1J6QA 1GUGA 4BZAA 5JZEB 5DAUA 4NJ6A 1JOQA 5BO4B 3NELA 4ZYNA 2L0CA 4YHHL 3NVZA 3D6CA 3W5VB 3PUXA 2OQKA 3S1QH 2FHTA 3UIPB 3M4PA 3HM3A 2HHHL 4LF6Q 4B3TL 1A3VA 5IT9E 1TTNA 2OTJA 3MA2B 2D9UA 2KOLA 4FN2A 1X3PA 3RULA 1WOCA 5JOBA 4LF7L 1DONA 4DV5Q 2MH7A 2J0KA 2D3CA 2XGTA 3R2IA 5M5XH 1Y69U 2K75A 3T1HQ 1E2VA 5D7GA 1SJHD 1TWCB 1WI5A 1CTMA 3T53B 5FO8B 3I2ZA 3J7AF 1PQSA 2RDFA 2HDEA 2BWFA 1L1OB 3S24A 3S17H 3RZWC 4DK0A 4YIJA 1D5ZC 2GBKA 2KXJA 4RGNA 1EZ6A 2HQLA 3CU7A 2LFIA 3CF6E 1KH0A 1PYSB 4E3CA 2DZIA 2L4NA 1WR1A 3K57A 2YEPB 3AB5A 1WH3A 2MQHA 2IHFA 2KEEA 1YNND 4L6TB 2O2LD 3HOVG 5DM63 3VYRA 4K2KA 4FXDA 1EYAA 3MEHA 3NXWA 4NPSA 3K5LA 3HOUH 1EO6A 4PZ8A 3PUYA 1E10A 1STAA 1Z9FA 2VL6A 1VQ6A 3GTOH 2N3SA 3DVGY 2JA5B 1O78A 4D2KA 2A5HA 3UQAA 2A68C 1PH9A 5JEAH 4JI4Q 4JL9A 1X55A 4Q5VA 2UXBQ 5JHBA 3GZNI 4MN3A 1FO4A 3APDA 3RMKC 1QOGA 4BBRB 1B8AA 1I3QB 1FXTB 4MGYE 3BK2A 3OW2A 2AHOB 1HNZL 1L4DB 5AFWA 2WXMA 4G50A 4KKUA 2DBYA 2JA9A 1YZ6A 3ZIMA 3M4OB 3ZNID 4CO7A 1FIQA 1WCMG 1T0QC 4DR3Q 3I4NH 4W9CA 3ZGZA 2PVGC 3G6JB 4B3ML 1PGXA 3PV0A 5FLMH 4GOPB 4MGIE 1J19A 1DM0B 4OIJA 4AIMA 2HD5B 1TU2B 1VDZA 3S2HB 2JWZA 4A9AA 3IAYA 1VLBA 2WXIA 2WU5B 3TJPA 5T8IA 3M7NA 4L8JA 2N1VA 2Q2TA 3HFZB 3V60A 4JOIA 4DV0Q 2PI2A 1ASYA 2WDTB 4ID6A 1HTQA 4JI1L 1F52A 3EN2A 2K0PA 3O13A 4A3PA 4C7YA 5IA7A 5E3FA 1GJXA 3H7SA 4JBWA 2E2JB 3I4NG 1GHKA 2MFIA 4QQBX 4J6IA 4WJPA 3DBRI 2GBNA 4F7ZA 2DAJA 3FKYA 5BR8L 3PTFC 1E9MA 1CKNB 1MSGA 4L2YA 5KHQA 3PO3G 3F8TA 4DR1Q 1VQEA 4DF7A 2BCOA 3TS0A 2NPTB 2VQEQ 1V1OA 1VQLA 3SEBA 4FYDA 3ML8A 1LTTD 4IPDA 3RNCC 5LL6X 2M2LA 3L7ZC 3DWQA 4JYAL 3PREA 2NZ1D 1JCKB 4EQNA 1G291 3FRPB 3A56A 5JPMC 1N8RC 3GTLH 3HOZH 2NVTH 3PZ8A 1Q5WB 5D3IB 5IYCG 4KJNA 2MHVA 2KACA 4BOSC 4YHHQ 2XN9C 5M5WH 4A3DH 2L7RA 1I6HH 1B53A 3MXNB 5C0XG 2AUKA 2UXDL 2AL6A 2WXNA 2JF5A 3QC8B 4MACA 1FMAD 2DY8A 1V1PB 1QOHA 1SE2A 4IUUA 1FD6A 4IOIE 4X6AH 3R3OA 2VXWA 2ZJQA 4BVUC 1Y1WG 4X65Q 4XZ4A 2Z6BA 5AJ3L 4DV5L 3DHIC 2MNAA 1WRIA 1BXTA 1I5FA 2KHJA 2RHSB 3FP9A 1RAXA 3ER0A 1EZ8A 4G0NB 3VVWB 3E3XA 1WGRA 4NB3A 1IP9A 1ZEQX 3VR9B 2K5QA 5BMIA 1L7YA 4G57A 1I94Q 3H6MA 5M3MB 3ICEA 4XTCS 4FADA 2WGSA 5HGTA 3A1QA 3V6CB 3VR4A 1K73C 1SAPA 4HJ5A 1PLFA 4BXXG 3CC2A 2IX0A 2KJ6A 1CSQA 1L6UA 3M63B 2AWOA 3PT2B 2D3AA 2Q8TA 5G55A 2DYMA 1EQRA 1SE8A 1RFAA 1YQ3B 4IUVA 3VTUA 4C3IG 4LDTB 5C4HA 2NMQA 4H02A 5D6JB 1LT4D 2WWZA 1PTOB 1BT0A 3L54A 2QA4A 3ZW3A 3AYHB 2L3ZA 3HP3A 1YJJA 2TSSA 4JI8L 4LF9Q 3H7PB 1WX9A 3M4QA 3IXSA 1OXVA 2JZ3B 2VB3X 4POFA 5KEEA 1J5EQ 4DR2L 4EUTA 4RF1A 1ILQA 5I4DA 1G6JA 2JZPA 3IG3A 3I73A 4P71A 1KHIA 3ZNGC 1DOLA 1I35A 2QDBA 3MC8A 1X9NA 2CHXA 3SK8A 2AEHA 4A3FG 1L0XB 2K22A 2OJWA 3MVVA 2QC8A 3NRZA 3RN9C 1T0YA 1V80A 4YSXB 1HCZA 4QF4A 5G3LF 3A4RA 4IWQA 4GKJQ 1NJIC 4YL8A 4IWPA 4DV3Q 4OVUA 5IP9H 5EE3A 1HQMC 2FIFA 1M4VA 2RD0A 3UGBB 3RFZB 4K14A 4IM3A 4ACFA 3QJYA 2W55A 2ZM6L 3J80L 3RN2A 3NQIA 2K7VA 4HTHA 3VYTA 1GC7A 1Y1WH 4QB4A 2PZTA 3S15H 4IW0A 3GS2A 4B3RQ 4K6LA 2F0IA 1TIID 3H9DA 3MEFA 3R7RA 2JXTA 4FULA 3I4MH 1N36L 3OIPA 2NN6I 4QIWE 1QKZA 3P4PB 1IYVA 1WXQA 1KOTA 1WCMB 1ZXIA 2ZVOA 4RHRA 3EJIA 5KNBA 1TWCH 2BDOA 2P5ZX 2WLBA 3ZLZA 1PH2A 3GV3A 5KYIA 2LGIA 1JOKA 4A3MH 2KCNA 3RNUA 5K36H 1VJKA 2D07B 4DXFA 1K83H 4AQ7A 2H5XA 2UUAL 2JA8B 3AQQA 3FKIG 1R4NI 1O7IA 4NMZA 2EYOA 3H15A 2DX5B 2FUHB 3NE5B 1NR2A 4FXCA 3OIQA 4K8JA 2JU6X 3A33B 4JPSA 3ZDTA 1D1KA 4FP5D 4TKOB 1LO5D 2C7NB 1YBYA 2ZXRA 3GP7A 2OEDA 3PV1A 3RI7C 4DXAB 3E56A 4OO1G 3CQZH 2E2IB 1WY8A 4MGZE 1D5MC 1QCBD 2PPBC 1L1OA 2KDBA 3N20C 1SJED 1SE9A 2QIEB 3NPPA 4ZLTF 1DOKA 4X65L 3L13A 5E7NA 5M5YH 3QJZA 2F1MA 4S3SA 1EYDA 5K5PA 3O65B 4WIPA 3TEZA 2MBBB 2IL8A 1JR0D 1WTXA 2XEWA 1WGDA 1CHQD 3LB8C 1WX8A 4WJOA 4BAXA 3BYTB 2YTYA 2KDMA 1WGKA 1TKYA 2QGQA 1EL0A 3KUZA 1STNA 3VUXA 4A3EB 1JJ2A 4XDXA 1UE7A 2FCNA 2A1AA 5CHFA 1AZPA 3QWNA 1JT8A 2Z0SA 5EE0A 4YXDB 4GNXB 4X64L 1V1QA 4HJ9A 3UE1A 4DR2Q 3N32A 3MJWA 2KMAA 4PMWA 3SR6A 3T3OA 4A3OA 1TS5A 3TIXA 1BCPF 4GKKQ 1FJGL 3ZUNA 2HUGA 3ONSA 1DOMA 4OZCA 1SF0A 4DK5A 2DWQA 2KUMA 1NENB 4IC7B 1QF6A 2DY7A 1VS0A 4LF7Q 4ZQ3A 3PF4A 4XDDA 2V4DA 5DLQE 2LHDA 3SFEB 4DDGD 1H95A 4PMBA 2NBWB 4RWSC 4C3JB 1TYGB 2KX3A 2BH2A 4FA6A 3UI3A 1GVPA 3P4SB 1E2WA 4XX5A 5LXIB 1I6VC 2EPBA 2DYOA 2MJEA 3AE9B 3W1GA 4GGQA 1LFDA 4ARCA 4WFN3 4DV0L 2B76B 1AARA 3KJPA 1E0ZA 1Q0WB 5IODA 4DU9A 4DR5Q 3STBD 3DHQA 2JA7G 4CHTB 2WX0A 3L08A 1MBYA 3KLSA 3EIVA 4JC0A 4PZ6A 3JAMi 1MG8A 4N58A 4J6HA 2V3SA 1AP0A 3CC4A 1K8OA 2KKCA 4FF2A 1WXAA 5C4JH 2OEOA 2O6VD 4FXKC 2LUEA 3CHBD 3VAWA 2WXJA 3DM1A 2OHFA 4A3DB 4KDLB 2CWAA 3NQTA 5JVG3 2B39A 2KYWA 1R4NB 2UXBL 1O7ZA 2R93G 1BBWA 3H94A 1F9JA 2VZKB 3P20A 1HUMA 2ZTDA 5D65A 1OEYJ 4W9JA 2VW9A 3A9KB 4ZRPA 4YWLA 1EU4A 2M9VA 1KRSA 1EUVB 4DR6L 3AEFB 3SU8X 4DUZQ 4IOAA 3S1RB 2EZVA 2R93B 4HCPB 4I7ZC 4BKTA 3D8GA 3PGZA 4YSYB 3HKZB 4MZ9A 3BZCA 5AEKB 3UDGA 1YHQA 1EY6A 1XEEA 2MBHA 1R9TB 4B0EA 2C9OA 5BR8Q 3K0YA 2MJDA 5BN4A 4R4CA 1VQPA 1K50A 1FRDA 3NZUA 1VR9A 3CCLA 2LKVA 3DVNV 2NTSA 2JK8A 3ENEA 1MG4A 2J0JA 3P2BA 1P98A 4JV5Q 1CT1D 4XYQA 2XVSA 1LUZA 1TWGH 3KYHC 4IJLA 1EQTA 3WOFA 1KM7A 2V1YA 4GDKB 2NBFA 2WAQE 1J8IA 2F0KA 2Y0SB 2O6VB 2EMTA 4DNRB 1E6EB 1IBLL 1CUKA 3K5NA 3A0JA 4MSQB 2KDIA 3NHEB 3S1MH 2Z8LA 1HZAA 4WJWA 2RR9A 4DFAA 2WS3B 1VF7A 3T51B 4GKKL 1I50H 4MJSA 4C3JG 1WXVA 3MHZA 4H44C 5ELBA 5EAYA 4JWUC 3HEJA 1HZ9A 4XT1B 4NXNL 1K8RB 1V86A 4FBJB 2Q2HA 3BVMA 4IUPA 1NNXA 2LFNA 2K05A 3IL8A 5C4XG 1CMXB 1CQVA 3TP8A 4HSPA 3RNBC 3SHQA 1GPXA 3UDXA 1B3AA 1XTCD 4B3SQ 2PE9A 5TR5A 3IRBA 3K58A 2IO2B 1HNWQ 2O6VA 1FGUA 2RDHA 4LF4Q 1HQRD 4II2B 5DNFA 2CHBD 4NDXA 1WIAA 1OXTA 3NBIA 5C23A 1LACA 2O2VB 2RSOA 5J17A 5KNDA 2H89B 5C3JB 1VZ7A 2HDLA 1U4LA 2JRHA 1JMCA 1QOBA 3NUHB 4TQ1A 2QDLA 3HIZA 5M5XB 2E2HB 3AE4B 1L6VA 4YWKA 1OEYA 5A35A 3JAME 3CPWA 2Z0EB 1DCZA 5GAHC 2PW5A 1JWMD 1PZID 4P72A 3PGEA 2B2VC 3VFKA 1Q90A 1CM9A 5EBCA 3HOXG 3BY4B 3U8ZA 2F0VA 4CKEA 5HKHA 3OPOA 1BQQT 4BBRG 4GNXA 3X23A 2A6HC 3ZXVA 4JI2L 3VRAB 2QILA 1WZ3A 2R7ZH 4IOCA 5EE1A 2B2YA 1EEID 2DZJA 5I2XA 1C3TA 4RGOS 3MFYA 4DR6Q 1OQQA 1IYJB 5G5HA 3KOJA 3ONAB 2E75C 2WKCA 4ZRZA 2BE5C 1V5TA 3HOXH 1UNSA 4ICUA 3T13A 3ZRFA 3A7AB 1E7ZA 4ITKA 2HD3A 5M3MG 3DQVA 5FO9B 1SN8A 1STEA 4AYBG 1D6EC 2CKZB 2MBOA 3GQBA 2GBJA 4I6PA 2WB1G 2SEBD 2D5GA 3IBEA 3CCSA 3KLSX 5C4XH 1YVCA 4MEMA 5FR6A 3VR3A 4BBSH 2NYZD 1RRBA 4DHJD 4PG3A 5A2QL 2JE6I 2YV5A 1TBEA 2HTHA 2K6DB 1WTHA 4XIGS 1Q10A 1EIYB 3K6OA 3M85A 4HCNB 1Q3LA 3JAML 3U7ZA 2N9EB 1ZW7A 4NAMA 4O0AA 2DLBA 1TKWB 4Y7NB 3RD4A 2I5LX 5IE8A 2NN6H 4QGUA 2IGGA 5BYQA 3RD2A 5J18A 1XMOL 1YJNA 4A3GG 4GN3B 1EIGA 3PIO3 1C7YA 3DCGA 1VF5C 4XE0A 2GBRA 1HFGA 3S16H 3W5UB 3NENA 4K7UA 4RHSA 5DEHA 1GUNA 3S2HH 1NEKB 3R93A 2KFKA 3D3RA 4J8QA 3VA7A 2DZKA 4HPMB 3PVLA 2AMCB 4LF6L 4CDCC 1VQOA 1FGBD 2ZPNA 1CZPA 2NB0A 4B9KA 2XRQD 2BQQA 4I65A 3TN2A 3RCZA 1I4PA 4C4VB 2CJOA 1O7YA 2CR5A 4DR7Q 1CZGA 3NWSA 4K0KL 4FJVB 5D94A 2AQ1B 2HDMA 1I3QH 3AMZA 4NY0A 5G5GA 2CQAA 3NJTA 2UU9Q 2AX5A 3A8JE 4LF4L 1G6ZA 3HOUG 4P7IA 1TWFH 2WXFA 1VQFA 3MC0B 3U30A 1N5WA 1EWHA 3M4OH 5IGGA 5C3XA 2F52A 1UAPA 5C5LA 3WDNA 4A3LG 2CW0D 4DXGA 2ATWA 1ACCA 2F0LA 4H2AA 3EUB2 2N8NA 3F2UA 1P9DU 4A3IH 1MFWA 3F2CA 4KI0A 4UP9A 2A6ED 2DHZA 3EVQA 3N3KB 3U7DA 3WAOA 1QVCA 2CHWA 4GXBA 4KX6B 2KAJA 4X3KA 1EWIA 4EQPA 2BE5D 3PQIA 4UAIA 2V9HA 3KH0A 3RR5A 1EEFD 2EVBA 1MGSA 1RFKA 3NS1A 3SE0A 4OHJA 3R7QA 5BMHA 3E0EA 4R1JA 4KN4C 4DUYQ 3U58A 1SROA 2J53A 4GDKA 2XWBB 1C4AA 4C2MH 3QOLA 5C3EG 5FLMG 3L4PA 3GTJH 2DYBA 1X32A 4KY7A 2NN6G 2IGHA 2R7DA 3CRLC 5G2NA 1IL2A 4KKIA 1I4XA 1C0AA 4S0RA 1GAQB 2L15A 1FR3A 1QT9A 1CJEA 1I4GA 3OLMD 2WXPA 3U4ZA 4IDIA 1FJGQ 2Y0SE 2YYZA 1WXSA 3ZQ4A 4WWOA 3DPDA 4IUTA 3Q3NC 3T9LA 5C3WA 2KDEB 1W6JA 1K51A 4LF5L 2RGFA 1IBML 1HUNA 2JXMB 1QVGA 5C3EH 1M94A 3OMGA 4A93B 3VTVA 4W9HA 5M5WB 4GOCA 3M62B 3DMUA 4X3TA 4GMVA 1AWDA 3TDQA 2WP9B 2F4IA 4LJZC 1STYA 1I4HA 5J22A 1RTOA 1XNQL 2C9WB 1OQYA 3KDFA 4NQLB 4ZKCB 2R92H 4C1NK 4RA8A 4HWIB 2IT1A 4A3KH 4A4IA 4KKJA 4C3IH 2Q5WD 3C2PA 5KGUA 4OIKA 2KMMA 5I2YA 3IKJA 2WAQG 2F0FA 3PMFA 2AYOB 2GBMA 1OO9B 1IPGA 3PRPB 2EXZA 5CMDA 4XYCA 5CV7A 2GVAA 1PH7A 1U0LA 2DJGC 5T1IA 2HHHQ 4K8IA 1GKHA 3KFUA 1PDXA 1VMCA 1WZ0A 1Y1VB 1WVLA 4NNJB 1KLUD 4FF1A 2WXHA 3S14B 4DR7L 2DENB 2NVYB 2VQFL 4JYAQ 5ISRA 1MI2A 3MHBA 3P1HA 1WJ6A 2IDYA 4FO2A 4YCVA 4LUZA 4BS9A 1IL8A 1Q7YC 5IYBH 1V8QA 3QOJA 1PRTC 5CORA 5EPLA 3PIP3 3Q23A 3LJ3A 1DOIA 1O80A 4R8IA 3I57A 3M4YA 3VA5A 1WI0A 3KK7A 1PUTA 5HGQA 1E0BA 5BN3A 2R61A 3RNGC 1JQ4A 3S15B 4RM9A 3TMPB 1FVIA 4A3EH 3BDLA 2UUCL 3PO3H 1EF5A 4R9WA 1YHBA 1M90C 2WXOA 3AE2B 1KNAA 4A6QA 3SHLA 1DYQA 1NY4A 3CAMA 3SK6A 4DNTB 3SFDB 5FLXE 4A3JG 1XMOQ 2FAZA 4K5XA 4BY7G 3R66C 2I46A 1WCMH 3V61A 5IT9L 2JT4B 2JN4A 2FE8A 3OJ4B 5IYCH 1HA6A 4C1NI 4FVMA 2PW9A 3AU5A 3U50C 1WSPA 4CKCA 2PVOD 3VQIA 4AJYB 4RG1A 1Q1BA 3KWLA 4ODGA 2KNBA 3L17A 4HJAA 3A9JA 1B9NA 2KHWB 5E6NA 1X65A 1D2BA 1H4RA 2FUG1 2KQSA 5E4XA 1H9JA 1QOAA 3HOWB 3EGRA 2VY3A 4KK7A 1Y8PB 2D2CC 1C76A 1MVKA 2LRUA 2H1EA 3A7LA 2E2IH 2ZT9C 3L2PA 1X6OA 3I4MB 1JROA 2RPQA 2ZNVB 2QEJC 3OHXC 3H3VI 1YNNC 3RUIB 4TVAB 5EKIA 2CFMA 4JI4L 2R6GA 2C5CA 2EY6A 2N55A 5BYRA 3MP9A 2BT6A 3OYYA 2L1AA 1SEBD 3NUCA 4JI7Q 3LX0A 4ZRIA 5NUCA 1G91A 2NCNA 5C6AA 4LMQD 4A3MB 2LHEA 1STBA 1K53A 2JRIB 2RKSA 1GD7A 1ZPSA 1GB1A 2Z9HA 1YNTE 4P6VF 2W3SA 3VYSA 4A3DG 4MJSB 2JUOA 3CF5A 4OVVA 4HVBA 1DOYA 2MO1A 2A5UA 2NVQB 1TY0A 3K8AA 2F3WA 3AE8B 1MKHA 2KHIA 4MTKA 1DGSA 2MP1A 4HRSA 4OL7A 3TRZA 4LW1A 2PIAA 1QJOA 1EWYC 4HMJA 3OG5A 2M19A 3ZNHB 2XNAC 4M0WA 1HRJA 2K8HA 4WJQA 5M3FB 3J81j 1C4PA 2K9XA 1WMHA 3UF8A 1B9MA 1ET9A 1CQFA 3ITPA 3RYTA 4OONA 2WDRB 2WINB 3DBLI 3OWEB 3VR5A 2IX3A 3DBSA 4AQYL 3KYDD 1TWGB 2ASQA 1Q8KA 1PMRA 2IX1A 3U4VA 3U2SC 1KDCA 2MQJA 3GV6A 1V2YA 2BB5A 2ZTEA 4MH0E 2KWDA 4UP7A 3GTMH 5C2TB 1ZYRC 2F0JA 5HURA 3ZTDA 2LD9A 2JSOA 3I4MG 1KRTA 3B9JA 1WD1A 1YNJD 2B2TA 1X3GA 1QNKA 3SR1A 4ALPA 1ZDVA 2QHOA 3BWUD 4HPLB 2WNMA 3GO5A 3TEWA 1TQOA 5EQ0A 2EJFC 2JA5G 1E7UA 2K03A 4Z9CB 2ICIA 2A74C 4IALA 2KO3A 4LFBL 3OMCA 2JVCA 1WTVA 1HTLD 2IY5B 2JA7B 3AEAB 2F3IA 1WM2A 3V05A 4AYBE 1LM8B 3BYYB 1YN4A 4W9DA 1GB4A 5H8YE 1K52A 1CSPA 1HH2P 1PFBA 2K5DA 1FNWA 3M9BA 5GQOA 5DPWA 1G2TA 2F0NA 2FXQA 1IGCA 5JH5C 4KV6A 1LT5D 1SNCA 2KWUB 2KX0A 2XBBC 3AEEB 1FFVA 3NP8A 1CZWA 3PO2B 1YIWA 3HGBA 4DHZE 1I94L 4WJ4A 3ECIA 4NXMQ 4NZLB 4YTNB 3HRZC 4F87A 5C3EB 2ASBA 1LM0A 1KRHA 4DKAC 5BMGA 4C7ZA 1WF9A 3AEGB 2AL3A 1OXSC 4DWFA 1E8WA 2V0GA 3P7JA 4MIUA 4MSMB 4L5SA 2INDC 1A6XA 2N4FA 5I6YA 3QA8A 1MHWC 2BYEA 1JJCB 4LF9L 4GN4B 4RH6A 3BIID 1LTRD 4CKBA 3PHWB 2IY1B 2DNFA 1EFWA 1ZKHA 4LNFA 2N88A 3QR8A 2PZUA 2DZMA 3B08A 1N33Q 1N32Q 4RCNA 5ELOA 3DUZA 3F2BA 2J52A 2GI9A 4HDQA 3KYCD 4DR5L 3KLRA 5L37A 1T5XD 2ZJDA 1M8AA 3APCA 2K39A 1V9JA 3VUYA 2B2UC 3HHMA 4YWGG 3MZ5A 4K3BA 5EPJA 5I6WA 1F2YA 2GB1A 1PYWD 2RF4A 3J80i 2EYMA 1K9MC 2WV6D 5E4WC 3R2TA 4ME3A 1ISNA 1JMLA 4F88A 4OO1H 4KGRA 1PRTB 2WDQB 2KVZA 2QEXA 1NYQA 4JBMA 4LF5Q 5IY0A 3RNAC 4OW0A 2NS5A 4JI8Q 2LXCA 3GE3C 1SR3A 5FK9C 1H9MA 1Q12A 1JJGA 4JPBW 1I7HA 1LYLA 1W6KA 4DHZB 4NQKE 4HROA 3WOEA 5D3DA 2BH8A 2VRRB 4IZ8A 2NUCA 3HZXA 1K8AC 2W82A 4YTMB 1S5FD 4A3GB 1QG7A 3R3MA 1P16A 5CYUA 2BTEA 3I3CA 4KMUC 2RDBC 2CCZA 1JOOA 2PZWA 5JVH3 1P0RA 3I90A 5FKAC 4YSZB 1BCPD 1X3FA 1KDAA 4DV3L 1FXIA 2B8FA 2D11A 3X0WA 1N9WA 3LNNA 1TZ1A 4LF8Q 2XWJB 3D0FA 1X3QA 5C44B 2MW5A 1HZ5A 2BKFA 2LMCA 4KIKA 1T3QA 2IYDB 4Q2JA 5LXHA 2L76A 2D3GA 4BBRH 1KNEA 1ZUD2 2L05A 5CBAE 1EY0A 2OCEA 4B0MA 1LGRA 2BA1A 1XD3B 2B63G 1ZXTA 5IT9c 4F1SA 4ZHOA 2WYQA 2MLBA 3IFTA 1VQ7A 3HOXB 1R4MI 3CXCA 1K8MA 3G71A 4M00A 2IPKD 3OSOA 4HEA1 4DN4M 3QAQA 4V0BA 4EX5A 2HQEA 3MFGA 4FF3A 5AUIA 3TS2A 3BS1A 3H3VC 4N9PA 4DNIA 3N30A 3CRKC 4ANVA 1FD7D 1HA5A 2C5LC 4ZUIA 3HOYB 1WGYA 3VR8B 2WX1A 4HDOA 4LJPB 1F2LA 1EF1A 2EYPA 2HJ8A 1GG3A 2PMZB 2VUMH 3DVNU 4IFDH 2ACZB 1J9OA 4JI5L 5C5MA 3JAMc 4DBGA 2KA7A 1DD2A 1OGWA 1SYDA 2AUJD 2LJ5A 3Q8FA 1T0SC 1QVFA 3H7PA 4OWWB 2H88B 4B08A 2L83A 3CSFA 3I9V1 3TP7A 1Q1EA 2BYTA 1I42A 5IGEA 3C0RB 3W1SC 1HJPA 3Q6SA 5CHWA 5KRUA 4NKLA 4BY1G 1MJDA 4LFCQ 2R7ZG 2BF8B 1VQCA 3WCQA 3L9AX 3CP0A 3KF8A 2WIIB 2YU9B 2KANA 4XT3B 1V8CA 3UQBA 4LNIA 2CS4A 1U4MA 2LXAA 3A8KE 4WAFA 1VQDA 1I6HB 3GDEA 3SDLC 3TQYA 2ID0A 2E5LL 1ROEA 4WJNA 2HCCA 2KC2A 3U9OA 3C19A 1X54A 1ICWA 2WACA 2O2VA 1Q46A 2Z1CA 2B63B 3MXPA 4ZDVA 1U4PA 2HIXA 4WH4A 2YTXA 4R4QA 3QIAA 4PQXA 4R8NA 4DV1L 3NG0A 4KGTA 2KN5A 5LHY1 3Q8BA 3D4WA 3KJOA 2V1CC 5J1ZA 5C44G 1SSOA 4HCEA 1A2TA 2L0TA 1MSHA 3ZKJC 4APVA 1LTLA 4HIOA 1P7FA 1V5OA 1Y56A 2KLCA 1S5CD 1VQMA 4BA1I 2C7MB 4L23A 1UBIA 3NS8A 3P63A 2Q2IA 2OOBB 3QCAA 1N34Q 2WP8J 1E2ZA 1SE4A 2JYOA 4C56C 3M3JA 2NPTA 3A55A 2LMCB 1QZGA 4BFRA 2K32A 4DQOC 4ILWA 2PNRC 1R9TH 4HK2A 2D0PA 4PZ7A 4B6WA 4DUZL 1C79A 3BU2A 4QL5A 3T1YQ 2PQAA 5KIXA 2PW7A 1K83B 4LTUA 1PFNA 1PZKD 3ND9A 1NR4A 1TS3A 4KZCA 3L16A 2QDFA 1STHA 1EWCA 4II3B 2GN5A 1W3SA 2OJRA 1YMHE 4AH6A 4A3BG 1OFFA 2CVRA 1S3OA 4IJHA 4DDID 1E22A 1QB5D 4DK6C 1NMGA 5EJWA 3FILA 4XDCA 5LNK1 2JXXA 1D1IA 1UEBA 4R4IA 1QUQA 2FMCA 5DPRA 4QUFA 4MM3B 1SYEA 4I6NB 1Y8NB 2WKDA 1GUOA 1EYGA 2UU9L 4AJWA 2F0TA 1GXDC 4JV5L 1PVOA 2K5HA 2PMZE 1YIJA 1HNWL 1FFUA 3GZNB 2NWGA 2UXDQ 1XLQA 4CQNA 2RVLA 1WJJA 5FR3A 3H0GH 1PH6A 2RBMA 3KLWA 1E5WA 2F0SA 2R7FA 5FLXL 4LF8L 1SNMA 3JW0X 2CHZA 3Q3OC 1HHVA 3AEVA 2RHQB 3GTJB 3NTHA 2QW7A 4NXNQ 3GTKH 1NBWA 1Y8OB 4PS7A 2EELA 4RGTA 3X3NA 3ZJUA 4A3GH 1B3QA 1WWTA 2MUYA 4G4KA 2G9HD 3SDZA 4PYZA 4YCUA 1EU3A 2HTME 1MD2D 3ULPA 4LNNA 5JJLA 1EY8A 1YNJC 3ULLA 4U68A 2BYVE 4US8A 3UI2A 2K1FA 1YN3A 4M01A 3H0GG 2XIWA 1SXTA 3HKZG 5ELDA 2JQRB 3GOEA 4RKBA 5JXVA 1XXGA 4UDUC 2W3RA 4JI2Q 2PJHA 2LASA 1SIJA 2F0HA 4KHPQ 2Z59B 4C3HB 4C00A 1KQSA 1QNUA 3KF8B 3I70A 4KD3A 4LLGM 5CTRC 1ZGUB 3MC9A 4B95A 4G3XB 3RNFC 4DV2Q 3S16B 5J2RA 3ML9A 4WJ3M 1SNQA 5LMUL 4G7HC 1YOVB 1D4BA 1WJNA 5JHAA 4BBSB 3X3MA 5ELEA 2RA4A 2ICEC 3A1QB 3FPUB 4C3IB 2KWVB 2MEKA 4KY6A 1N34L 4M8MA 2QCPX 3VXWA 4JBKA 2PI2E 2X8XX 2R3ZA 4PS8A 3RZOB 1R7SA 1ENCA 4H7BA 4A3EG 3W2DA 4OEMB 1MPEA 1Z5SB 2D3BA 4LFCL 3ZVVA 4X66L 4OGQC 1Y1VH 3HOVH 2J0TD 4N59A 3TEYA 2ZJPA 1WMHB 3S1NH 2L11A 4A3KG 3BDOA 1JORA 2K3UA 1GC6A 3AEDB 5E6JA 1L5PA 4IPCA 1PH5A 3C3LA 1D8LA 4GZYC 3MTNB 2ZM6Q 2IWHA 4A3CH 3SK5A 2R7ZB 2FCSA 2M0AA 2WXGA 3AH7A 2E5LQ 1PH3A 3NTIA 3DWMA 3DEPA 1SFOB 1YQ4B 2V3PA 2ZW0A 1WYGA 2N9XA 2VQEL 4WQOB 4R4OA 3VUWA 3FHWA 2K4KA 4OO1I 2G1EA 3I7FA 4P1CC 4K3CA 4P73A 1NI3A 3Q8CA 2CH4A 1LTAD 1G8ZD 2KVRA 4DK3C 1ICFB 2J7ZA 2KCTA 3M7GA 3J7ZC 1AFPA 4TV3A 1SLJA 3BK1A 3V62A 4OWXB 4TKNA 4C2MB 1VQGA 4EQOA 3NWTA 3HOZG 4BA2I 4EZLA 4FJYA 1N6ZA 4MDKE 5IO9A 2K25A 4LUOA 4W9KA 1RTNA 2UUCQ 3SVMA 1FNVA 5T1GA 3P75A 3MAQA 5EDSA 1QUQB 3TSSA 1PHJA 2A69C 4HXDA 4FDBA 2VB2X 1VCIA 1UGJA 2B3AA 4I6LB 2R92G 1IGDA 2I1KA 3LXFA 1M1KC 3I4LA 1PTOD 4CDDC 2BB6A 2KENA 3HOWH 1NE3A 1TY2A 2JYTA 2V4IB 4LDTD 3TBIB 3K9PB 3PO0A 4TUUA 1TVXA 5C4ZA 1WTRA 4MTNA 3K0XA 5ELCA 3NBHA 4DGZA 5JEAG 2IO1B 1A5RA 4E74A 1SIFA 4RKLA 2PKOA 3N9YC 5IP4D 5GXGB 1XCQL 5KHOA 4GLVB 1F9QA 3OJ3A 4WURA 1AH9A 4GB9A 2BOSA 4XQJA 4MT5A 5BYSA 1E3PA 3FKIB 3PCOB 4HMIA 2IJ0A 1O7LA 2WB1E 1QE6A 2E2DC 4ZCKA 1YJ1A 1F9PA 4DA2A 4KHVA 2LVOA 4F7XA 5IYBG 4ARIA 1FNUA 3MJ5A 1H9SA 4HJ7A 1QQRA 3I63C 4K2LA 2G5DA 1KFYB 2LRWA 1G2SA 4JI5Q 3J81i 5C0XH 3DEOA 2K6QA 2KTRA 2A69D 4O1NA 2I5HA 1IBKQ 1HNXL 4IFDI 1HE8A 3B2GA 2B2TC 3EHVA 4K7SA 4RCOA 4G7ZC 1JWBD 3SD5A 4AS1A 1Z2MA 2SOBA 4IPGA 1Q82C 1PFDA 1A70A 3SK4A 2AKWB 3U52E 3WIMA 1JWUD 2K5PA 3S2AA 4GKJL 4CYEA 3Q24A 1C8CA 4N6EB 1RD9D 4YTPB 3V3XA 2ZEQA 4IG7B 4A3IB 1Q8IA 1F9SA 5CV8A 3D4RA 5GROA 1I50B 2KOXA 4JIOU 3W1BA 4ASWC 4M8NA 1JWSD 2RCFA 2RMMA 1QOFA 1D3ZA 5EBDA 2KEDA 1SSNA 2Y5CA 1JW9D 4KN7C 1FCLA 1S3SG 1PV4A 3QG1A 4L1BA 2A8VA 4B9XA 2RQXA 2QJLA 5M3FG 3A9KA 3S14H 3MHSD 3PO2H 2KLGA 3DLLA 2UUBL 3FEWX 5IGCA 1T0RC 2RSUA 1EIFA 3EROA 3LYYA 1SNOA 4GDLB 2KCCA 3Q2AC 2KD0A 3F1ZA 1TXYA 3S17B 4RFBA 3KWVA 3W5OA 1ZXHA 1MHHE 2EKIA 4LK1C 3AM9A 4KZ0A 2EMSA 4ULLA 1SYBA 2KK8A 2NZHA 3VTWA 4EE2A 3TBLD 1J5EL 5CBEE 4BY7H 2EXDA 3IT6B 3TP5A 2B2WC 3CMAA 1R4MB 5CX3A 4DV7L 2N7JA 1PYBA 4F8MA 3PO2G 1VZ8A 2E74C 4CJ2C 4X66Q 3CD6A 4ANWA 3VHTC 4CJ1B 2WB1B 4JI6Q 5AUKA 4QJFA 3UINB 3GD7A 2Y5PA 4EEWA 4JWSC 3T56B 2WXLA 5HY6A 3G6EA 4JI3Q 2UXCL 1A3TA 4JX1C 3NK9A 1JQYD 4X62Q 5CC4A 1K0RA 2IY0B 2N7DA 3V2TA 2E3TA 1XNRQ 1S72A 2XRSD 2VQFQ 3KF6B 2CW0C 1Q86C 4A3BB 2O4XA 3P4RB 2PCFB 4DAYA 4HSVA 2CU3A 3CMMB 3B2FA 3S1NB 4GN1A 2X69A 2KMCA 3OAWA 4DV4L 2MGSA 1V9PA 3PRMB 2V4LA 1E8XA 4BKSA 3NEMA 2FNJB 1L0WA 2E2HH 1ONLA 5D2MB 2GVBA 2M4NA 2BWES 3OTOL 2CU1A 1DJRD 5J3BA 1RWSA 3ZJVA 1X1MA 1HZ6A 2RPVA 3GTGB 2D10A 2Z6KA 3AE6B 2N9LA 4G7OC 5IN7A 2SNSA 3ZYYX 1HFNA 5IOIA 5FOBB 3CCUA 2Z4HA 3D31A 1CKNA 1GUWA 1KDBA 1U4AA 1ZP0B 2MJ3A 1IBXB 4DR4Q 2VH1A 1BR9A 4MNOA 1KL9A 4DAMA 1UE6A 5M3FH 2N0SB 2M56B 1WRDB 5CV6A 4MM3A 2IHEA 3ERSX 5LMUQ 3Q6BA 1YJWA 5BN5A 4IKGA 2FBWB 5IP9G 1RM6C 4QAYA 1DOXA 3Q0AA 3H0GB 4K0KQ 4ME5A 2MBEA 5IAAC 3ZTCA 1SB3C 4WRDA 1ET6A 3RLFA 3LWEA 3P4QB 2BS2B 4OWTB 3NBHB 4GU2A 4KGSA 4EGVA 3HOYH 2RCNA 2ZCBA 4IM2A 3I4NB 4CGYB 4UHVA 1RODA 4HJ8A 3AE1B 2J7QB 3E6ZX 4IPHA 2K8BA 4KHPL 3K5MA 4F8CB 1V6EA 1OXXK 2IZVB 4LWCA 2IBIB 1A63A 1BUIC 3OWFA 3ALBA 3NVWA 4Q0FA 3U9SA 3NVYA 2QSDA 2M8SA 4DHJB 5ELNA 1J7AA 4HEDA 3GTPB 1Q1OA 3N1XC 2LWPA 2KZRA 4QUCA 5JPNC 4DUYL 1N63A 2N9PC 5TSSA 2L52A 2I07B 4Y52H 4X64Q 2K1BA 3J81L 2ZVNA 1E7PB 2OT2A 3DWGC 4C3JH 3H3VH 5C0XJ 3GTPH 3GTOB 3AE7B 1LTSD 1RF2D 2JEAI 3EA6A 2JA5H 1XT9B 1TWFB 1IKMA 3PLUA 1KAAA 1J8CA 4B3MQ 4USAA 1KIXA 2MBQA 5GAGC 2QMTA 4LCDE 3KUCB 4LK0M 1YITA 1T5EA 4NP5A 2KDFB 3PRZA 4K1RB 1VQ8A 2MPMA 5JJZA 3EFXD 2EJGC 3HOVB 3AB9A 4HIDA 4HIMA 2PNHA 4W9FA 2JA7H 2YU9H 4DV4Q 1PH1A 2C35B 1OQRA 4MELA 3BJUA 1OXUA 4AYBB 1RJTA 1WJUA 1K3BC 1RCVD 1HZBA 1VQNA 1JWAD 3WAPA 3KDFB 2D2QA 3I3TB 3CW2C 2PTLA 4IURA 5CV9A 3NVVA 4N8FA 1A8VA 2LGSA 5DM73 3A5ZB 4ANUA 4FHJA 2FMMA 4QCLA 1S40A 2ZXOA 1BBXC 4DR1L 3MXNA 2LXKA 4P2CB 4WAAA 4KTAA 3D4DA 4JVZA 1AN8A 4XXEA 1ENFA 3HVZA 4PNYA 4KDIC 1TS2A 1AW7A 1A0IA 2UYZB 4RMFA 4ZOHC 3A54A 1C78A 5CHVC 2E76C 4PMCA 4UP8A 4DV7Q 2Z0DB 1LLRD 4LAAA 1BCPC 1V81A 1WJ4A 5J39A 2LGDA 4MGKE 4BKGA 1X56A 3FDTA 1TR5A 2XK5A 3QX1A 2B2VA 1PRTD 5CR3A 2DGYA 4KKSA 4FNFA 3BINA 2MJ8A 4LFBQ 5FJ8H 1SYFA 2VH2A 1PGBA 2B29A 5JJIA 1V49A 1BBUA 2I1JA 2MP2A 4WQMA 3C1FA 2MSED 4HAEA 2OXPA 5E6OA 4JQWC 1SGHA 3AV8A 3AFPA 2FFKB 4RF0A 1GO3E 1UF0A 4BY1H 2BA0A 2B63H 1SNDA 4QY7A 2OTLA 3PPAA 1LV9A 1C77A 2FJ2A 2O5IC 3S1QB 3J80c 1AZQA 4DK1A 3E0JA 4FHKA 1KJTA 1YD8U 3HRDD 2K04A 2NBVB 3GE8C 4ZRKA 3M3YB 3STBC 1L4ZB 2JQOA 4L5QA 2KHSA 4J1MA 4IN3A 3PSIA 5F2DA 3V96A 2JA8H 2LGXA 4M0WB 4PT5A 1QZEA 5JEAJ 4BOZB 2KCMA 1B4OA 2QKIC 2J0MA 2JA6B 5L83A 2JYEA 4DPGA 5EE9A 5C0XI 2NTTA 4A76A 2QF7A 3BVZA 3ND8A 1CK1A 1Z7TA 2K28A 2YTVA 1XO3A 2LVQA 1EOTA 3CQZB 1NYRA 2ENBA 3NHHA 4KY5A 1R4PB 3B6YA 4A3KB 4A8XC 1MJCA 5FLXc 3G48A 4JG2A 3AMUA 1C9OA 2GRIA 4PS3A 2XTIA 3IHPC 2MO0A 2NVXB 2ZTCA 3N1YC 4M02A 3TEXA 1ZOYB 1LQBA 1XYIA 3ABVB 2DNEA 1N32L 2INNE 2F0GA 1SNPA 4GLXA 1F2ZA 4OX9Q 2F4VL 5IYDH 2KECA 3PZDA 4EQ5A 1YN5A 3NY5A 2L9HA 2X38A 1CKOA 3TUOA 1VQJA 1TT5B 3DBRB 1RLFA 2CKHB 4MH8A 2G4SA 1KXLA 4C80A 4TQ0A 2KT7A 1KLVA 1VQ5A 1VCBA 2K5NA 4A3FB 1HEZE 1N60A 1JRUA 2WXKA 3V6EB 4W9LA 1IBXA 4QMGA 2BS3B 1STGA 4WORA 4LNOA 2A6EC 3HS0C 2BGFA 1QWYA 3G7LA 1EUJA 1TWAH 4GOPA 4P1BC 4B3RL 3F2DA 1JRPA 5EGTA 1XNQQ 3FILB 2GOWA 2L32A 3BZKA 1JB3A 4WWMA 4JI1Q 3PF5A 4A3IG 3MXUA 3WANA 3VH3B 3P1MA 1FYCA 3T1YL 3I56A 3B0AA 2EY2A 3HOUB 2KC1A 5GAEC 1WTWA 2D5DA 1RIPA 2F0MA 5CV5A 2NBUA 1PGAA 4ZHPA 1WTQA 3PHXB 4GLSC 1RDPD 1D5XC 1GOZA 1PH4A 2KFKB 4DR3L 1VQHA 2L00B 3DBLB 2MWSB 2JA8G 1NMFA 4EVOA 1BF4A 4DR4L 4GNXC 1EM7A 1C4CA 1CA5A 5ELFA 3EC8A 2YEPF 4HPPA 4US9A 3W1YA 3DHGC 4YWMA 3OW7A 2CWPA 2KQ3A 1RYJA 2B2UA 1BNZA 5KNCA 1UWXA 3KBXA 1XQQA 3H8HA 3Q8EA 5AZHA 1ZKOA 4M8AA 3VR2A 1Y1VG 3Q8AA 1WE6A 4N8X1 2GLSA 4R4TA 4OVZA 1FRRA 1WD0A 5M9OA 1F2RC 4A3BH 3S2DB 3RNEC 2LGYA 4X62L 4A3CG 4JGHB 4HJGE 2L12A 5JAVA 4I7AA 3H09A 3ETRA
chains in the Genus database with same CATH topology
1NVID 3L3OC 2EE1A 4P16A 4K5WA 2IGDA 2RSNA 4XQNA 1B44D 1F77A 1B1ZA 1ZYRD 3KBGA 1AYFA 5IGDA 1C48A 1A15A 1SYGA 1ML0D 3HOZB 2M00A 2Q8IB 1ESRA 2BS4B 2F0UA 2LY7A 1CA6A 4A90A 3QO2A 5HG2A 1VMPA 1S5ED 3URYA 3KQ4A 3IFDA 3AEBB 2JX5A 3I8ZA 2HCIA 3MTSA 2PYKA 3W9CB 1U4RA 3U4EG 3HUIA 1JE4A 2K33A 2AQ3B 2PMVA 4IUNA 3Q22A 2H4OA 4QIWB 4IFDJ 2EDGA 1GHJA 1JICA 1F9RA 1II3A 1QLBB 2A73B 4XWWA 1PRTF 5D14A 3Q69A 1J7CA 4OZBA 1IW7D 5HI1A 3VR6A 3CIRB 3PUVA 4ZUJA 5KYLA 1CHPD 4TQUS 4K6DA 1WTPA 1BMLC 1I4RA 3DXJC 4IUQA 2WU2B 3E5SA 1XCTL 1PZJD 2LEKA 1H9SB 3W1SA 4TSSA 5EKLA 2WXRA 3J7AV 2K5WA 1TKGA 3FPPA 3E9SA 4PV1C 2INPE 1QILA 4MHEA 3RZDB 4YT0B 1XF5L 2JP1A 1EIHA 3BG3A 1PXUA 3FMCA 3C46A 4TMAB 1DZ1A 1ZE3D 1B2TA 2OF1A 2E6XA 1UUPA 1VDVA 3AECB 1S4ZA 2KVMA 4C3HG 2WXQA 5FO7B 2K01A 1FCCC 1JALA 1V1PA 1PFMA 3R8BA 3BDCA 3I91A 3ERQA 3QB3A 1LTBD 1Y1WB 3CWIA 3BVGA 3GTLB 2BDNA 3PUWA 4HKZE 1FEHA 2ONQA 3H91A 1V97A 3HVDA 4REZA 1IKLA 2FINB 1F0ZA 4H0LC 1TKEA 1HXYD 2CJNA 2IW3A 4DAPA 2VUMB 1S5DD 4DAVA 2LS01 1SE3A 4ZKBB 1EY9A 1XWEA 1YJIA 4NAWB 1FXAA 2VZKD 2JSVX 1LTID 3OOCA 1AEXA 2NVTB 1MHXA 3K5OA 4J3OD 3AN1A 1I4QA 2EYFA 3C1EA 5HFYA 3RMHA 1GUSA 2EYHA 2DN8A 3GTMB 1MI0A 1J7BA 1F2RI 4R3DA 3SXHA 3BZDB 5G3LD 4HKQA 1N61A 4JK1C 2L55A 1EY7A 3TMEA 1NUCA 4KJOA 3S1MB 2ZW1A 2VNUD 3VYUA 2J42A 2WQYB 1A3UA 4RGMA 3GTKB 5IGBA 5CV4A 3PZ7A 1GUTA 4RAUC 1ZDXA 2B8GA 5EKKA 3P42A 4X3UA 5I9OA 3IAS1 2Q8RE 2F3VA 2L5TA 3TZUA 3HG9A 2I2YA 2X6LA 4CJ0B 1KF6B 3K59A 2F0QA 2SAKA 4U673 3J7YW 1N62A 3TZDA 1LABA 3LWUA 1FM0D 2LUMA 2F0WA 3T4AC 1VRAB 5CGKA 5I9PA 1XLOA 4A3JB 5IOCA 2BW2A 3IAM1 4N9TA 4IQZA 3ZJTA 3PUZA 3EQLC 2F03A 1S5BD 2AQ2B 1CI3M 2GA4B 1BDOA 1EY5A 4XYOA 4NW2A 5COYA 2KQ4X 1Z47A 1B50A 5E1FA 2R92B 1ESFA 1H9KA 2W54A 1T6BX 1C9FA 3PO3B 1BUVT 3NTKA 1NCVA 4FXGC 2F0PA 5K36G 1NSNS 1WTOA 4BY1B 2Y3AA 1EYCA 1PTOH 4ZAIA 4XQQA 2WAQB 1Z6HA 4E6IA 1VZ6A 3MWYW 2V3NA 1LTGD 1TWHB 4M1UB 1EY4A 5C4XB 3I72A 1KLGD 2KJXA 1SYCA 4KKTA 3AE5B 2RDGA 4ZYSA 1ILPA 3A8IE 2A6HD 3S9WA 2PO4A 1L0VB 2F0EA 1KABA 2PQEA 3DWAA 3AU7A 2LJIA 4O42A 1R4QB 1TWAB 2AWNA 3T16A 3GB1A 1IW7C 4BY7B 4NJCA 1PTOF 5EPKA 2JWUA 2JEBI 1RHPA 2XSCA 5IGFA 3C8YA 2TMPA 2SNMA 4KD4A 2B2YC 2EOTA 2F0OA 2L1BA 4KHZA 2F0DA 2BBCA 1HTPA 2I38A 2EYLA 4IFDG 3NSWA 1JC7A 1PTOC 2J4XA 1CFMA 1NAPA 1H9RA 5A2QE 3RPFC 1TJEA 3DWPA 4CBVA 5H92C 2WDVB 3N52A 4HCSA 1SBBB 2EYJA 4ZK9B 2D62A 1F2MA 1IHZA 2EY5A 1EQVA 2B2WA 3W3AA 3RUZA 1XLNA 1C4QA 3IT4B 4FF4A 1TS4A 1BCPB 1IYUA 5HHDG 4B9WA 1RKNA 3FVQA 1PDQA 2ZXPA 1LT3D 2Z4IA 1KTKA 1LT6D 1N5XA 2O5JC 3AE3B 2G9DA 1L0YB 1V43A 5IIFA 3J80E 4RNAA 4V190 3GTQB 3N6RA 4HR7B 4ABNA 3FAHA 3NZ3A 2N9KA 1P7EA 1BOSA 2A68D 1TT2A 3FC4A 2EJMA 1XLPA 4K5VA 1DGJA 3J81E 4TRDA 1DXMA 4BWGB 3KUPA 1ENAA 2SDFA 3D6WA 3VRBB 1UEAB 1TZOA 1XX8A 1UWMA 1IUEA 5C4JB 3MXGA 4OZAA 1SMYD 1HPCA 3T3NA 3K7AB 1BO0A 4X3SA 1SMYC 4HN7A 1SDFA 3CKIB 1U9RA 2K6AA 5LL6S 4A55A 2PLPA 2KN4A 1EFID 5MPOA 4JE3B 1A2UA 4XWTA 3J9CA 2EY1A 1B9RA 4L63B 4H13C 4ZRQA 2DNCA 2ON8A 5M5YB 3TP6A 2X6GA 1GUGA 5DAUA 1JOQA 2L0CA 3NVZA 3D6CA 3W5VB 3PUXA 2FHTA 1A3VA 5IT9E 3MA2B 2D9UA 2KOLA 1X3PA 5JOBA 1DONA 2MH7A 3R2IA 1Y69U 1E2VA 5D7GA 1SJHD 1TWCB 5FO8B 1CTMA 3T53B 3J7AF 2HDEA 2RDFA 4DK0A 4YIJA 1D5ZC 4RGNA 1EZ6A 3CU7A 2LFIA 1KH0A 2L4NA 3K57A 2YEPB 3AB5A 2KEEA 1YNND 4L6TB 2O2LD 5DM63 3VYRA 4K2KA 4FXDA 1EYAA 3MEHA 3NXWA 3K5LA 3PUYA 1E10A 1STAA 2JA5B 1O78A 4D2KA 2A5HA 2A68C 5JEAH 4Q5VA 4MN3A 1FO4A 1QOGA 4BBRB 1I3QB 3BK2A 1L4DB 2WXMA 5AFWA 4KKUA 2DBYA 3M4OB 1FIQA 3ZGZA 2PVGC 3G6JB 1PGXA 3PV0A 1DM0B 4OIJA 1TU2B 1VDZA 3S2HB 4A9AA 3IAYA 1VLBA 2WXIA 2WU5B 5T8IA 3M7NA 4L8JA 4ID6A 2K0PA 3O13A 4C7YA 5E3FA 1GJXA 4JBWA 2E2JB 1GHKA 1E9MA 1MSGA 4L2YA 4DF7A 2BCOA 1V1OA 3SEBA 4FYDA 1LTTD 5LL6X 2M2LA 3L7ZC 3DWQA 2NZ1D 1JCKB 4EQNA 1G291 3FRPB 3A56A 5JPMC 3PZ8A 5D3IB 4KJNA 2MHVA 2KACA 2XN9C 2WXNA 1B53A 5C0XG 2AUKA 4MACA 1FMAD 2DY8A 1V1PB 1QOHA 1SE2A 4IUUA 1FD6A 4IOIE 3R3OA 2VXWA 1WRIA 1BXTA 3TEYA 1EZ8A 1ZEQX 3VR9B 2K5QA 5BMIA 4G57A 3H6MA 5M3MB 4XTCS 5HGTA 3VR4A 1SAPA 1PLFA 2IX0A 1L6UA 2AWOA 2Q8TA 2DYMA 1YQ3B 4IUVA 4C3IG 5C4HA 2NMQA 1LT4D 1PTOB 3HP3A 1YJJA 2TSSA 3IXSA 1OXVA 2VB3X 5KEEA 4RF1A 1ILQA 5I4DA 2JZPA 3I73A 1DOLA 2QDBA 2K22A 3SK8A 1L0XB 3NRZA 3MVVA 4YSXB 1HCZA 4QF4A 5G3LF 5EE3A 1HQMC 1M4VA 3RFZB 4K14A 3QJYA 2W55A 3J80L 3NQIA 2K7VA 4HTHA 3VYTA 4QB4A 2PZTA 3GS2A 4K6LA 2F0IA 1TIID 2JXTA 3OIPA 2NN6I 1QKZA 3P4PB 1IYVA 1WXQA 1WCMB 1ZXIA 4RHRA 3EJIA 5KNBA 2BDOA 2WLBA 3GV3A 5KYIA 2LGIA 1JOKA 2KCNA 5K36H 1VJKA 4DXFA 4AQ7A 2JA8B 2EYOA 4NMZA 3NE5B 1NR2A 4FXCA 3OIQA 4K8JA 2JU6X 4JPSA 1D1KA 4FP5D 4TKOB 1LO5D 2ZXRA 3GP7A 2OEDA 3E56A 4OO1G 2E2IB 1D5MC 1QCBD 2PPBC 1SJED 2QIEB 3NPPA 4ZLTF 1DOKA 2F1MA 4S3SA 1EYDA 5K5PA 4WIPA 3TEZA 2IL8A 1JR0D 1WTXA 1CHQD 3LB8C 3BYTB 2KDMA 1WGKA 1TKYA 1EL0A 1STNA 4A3EB 4XDXA 1AZPA 3QWNA 5EE0A 4YXDB 3SR6A 3T3OA 4PMWA 1TS5A 1BCPF 2HUGA 1DOMA 4OZCA 1SF0A 2DWQA 2KUMA 1NENB 1QF6A 2DY7A 4ZQ3A 3SFEB 4XDDA 2V4DA 2LHDA 4PMBA 4RWSC 4C3JB 1TYGB 3UI3A 3P4SB 1E2WA 1I6VC 2EPBA 2DYOA 2MJEA 3AE9B 4ARCA 4WFN3 2B76B 1E0ZA 5IODA 4DU9A 3DHQA 4CHTB 1MBYA 3KLSA 4N58A 4J6HA 1AP0A 1K8OA 4FF2A 2OEOA 4FXKC 3CHBD 2WXJA 3DM1A 2OHFA 4A3DB 3NQTA 5JVG3 2B39A 1O7ZA 3H94A 2VZKB 3P20A 1HUMA 5D65A 4ZRPA 1EU4A 2M9VA 3AEFB 3S1RB 2EZVA 2R93B 4I7ZC 3D8GA 4YSYB 3HKZB 1EY6A 1XEEA 1R9TB 4B0EA 2C9OA 2MJDA 3K0YA 5BN4A 1K50A 1FRDA 1VR9A 2LKVA 2NTSA 1CT1D 4XYQA 2XVSA 3WOFA 1EQTA 4GDKB 2NBFA 1J8IA 2F0KA 2Y0SB 4DNRB 1E6EB 3K5NA 2Z8LA 4WJWA 4DFAA 2WS3B 1VF7A 3T51B 4C3JG 3MHZA 4H44C 5ELBA 4JWUC 3HEJA 4XT1B 3BVMA 4IUPA 2LFNA 3IL8A 2K05A 1GPXA 1CQVA 3TP8A 4HSPA 1B3AA 1XTCD 3K58A 2RDHA 1HQRD 5DNFA 2CHBD 4NDXA 1OXTA 3NBIA 1LACA 2RSOA 5KNDA 2H89B 5C3JB 1VZ7A 2HDLA 1U4LA 1QOBA 3NUHB 5M5XB 2E2HB 3AE4B 1L6VA 5A35A 3JAME 1DCZA 2PW5A 1JWMD 1PZID 2B2VC 1Q90A 1CM9A 5EBCA 2F0VA 4CKEA 3OPOA 1BQQT 2A6HC 3VRAB 2QILA 5EE1A 2B2YA 1EEID 5I2XA 4RGOS 3MFYA 1OQQA 5G5HA 3ONAB 2E75C 2WKCA 4ZRZA 2BE5C 1UNSA 3T13A 3A7AB 4ITKA 5FO9B 1STEA 1D6EC 3GQBA 2SEBD 2D5GA 3KLSX 3VR3A 2NYZD 5A2QL 2JE6I 4XIGS 1Q10A 3K6OA 3M85A 1Q3LA 3JAML 3U7ZA 4NAMA 2DLBA 1TKWB 4Y7NB 3RD4A 2IGGA 2NN6H 5BYQA 3PIO3 1EIGA 1VF5C 4XE0A 1HFGA 3W5UB 4RHSA 5DEHA 1GUNA 1NEKB 3R93A 3D3RA 4J8QA 3VA7A 1FGBD 1CZPA 2NB0A 2XRQD 4I65A 3TN2A 1I4PA 2CJOA 1O7YA 1CZGA 3NWSA 2AQ1B 2HDMA 3AMZA 5G5GA 2CQAA 2AX5A 3A8JE 1G6ZA 2WXFA 3MC0B 1N5WA 1EWHA 5IGGA 5C3XA 1UAPA 5C5LA 3WDNA 2CW0D 4DXGA 1ACCA 2F0LA 4H2AA 3EUB2 3F2UA 4KI0A 2A6ED 3EVQA 4KX6B 2KAJA 4X3KA 4EQPA 2BE5D 4UAIA 1EEFD 2EVBA 1MGSA 1RFKA 3NS1A 3SE0A 4OHJA 5BMHA 4KN4C 2J53A 2XWBB 1C4AA 3QOLA 3L4PA 1X32A 4KY7A 2NN6G 2IGHA 3CRLC 4KKIA 1I4XA 1GAQB 1FR3A 1QT9A 1CJEA 1I4GA 2WXPA 4IDIA 2YYZA 3ZQ4A 4IUTA 5C3WA 1W6JA 1K51A 1HUNA 2JXMB 3OMGA 4A93B 5M5WB 3DMUA 4X3TA 1AWDA 3TDQA 2WP9B 2F4IA 4LJZC 1STYA 1I4HA 5J22A 1RTOA 4ZKCB 4C1NK 4RA8A 2IT1A 4KKJA 2Q5WD 3C2PA 5KGUA 4OIKA 2KMMA 5I2YA 3IKJA 2F0FA 3PMFA 1OO9B 2EXZA 5CMDA 5CV7A 5T1IA 4K8IA 1PDXA 1VMCA 1Y1VB 1WVLA 1KLUD 4FF1A 2WXHA 3S14B 2NVYB 5ISRA 1MI2A 3MHBA 3P1HA 2IDYA 4FO2A 4BS9A 1IL8A 5CORA 1V8QA 3QOJA 1PRTC 5EPLA 3PIP3 3Q23A 1DOIA 1O80A 4R8IA 3I57A 3M4YA 3VA5A 3KK7A 1PUTA 1E0BA 5BN3A 2R61A 1JQ4A 3S15B 3BDLA 4R9WA 2WXOA 3AE2B 1KNAA 4A6QA 3SHLA 1DYQA 3SK6A 4DNTB 3SFDB 5FLXE 4K5XA 2I46A 5IT9L 2FE8A 1HA6A 4C1NI 4FVMA 2PW9A 1WSPA 4CKCA 2PVOD 3VQIA 1Q1BA 3KWLA 4ODGA 1B9NA 1D2BA 2FUG1 5E4XA 1H9JA 1QOAA 3HOWB 3EGRA 4KK7A 1Y8PB 2D2CC 1C76A 1MVKA 2H1EA 3A7LA 2ZT9C 3I4MB 1JROA 2QEJC 3OHXC 1YNNC 5EKIA 2R6GA 2C5CA 2EY6A 2N55A 5BYRA 3MP9A 2BT6A 2L1AA 1SEBD 3NUCA 3LX0A 5NUCA 1G91A 5C6AA 4LMQD 4A3MB 2LHEA 1STBA 1K53A 2RKSA 1ZPSA 1GB1A 1YNTE 4P6VF 2W3SA 3VYSA 1DOYA 2NVQB 1TY0A 2F3WA 3AE8B 2MP1A 4HRSA 4OL7A 2PIAA 1QJOA 1EWYC 4HMJA 2M19A 2XNAC 4M0WA 1HRJA 5M3FB 1C4PA 2K9XA 1B9MA 1ET9A 1CQFA 3ITPA 2WDRB 2WINB 3OWEB 3VR5A 2IX3A 1TWGB 1PMRA 2IX1A 3U2SC 1KDCA 3GV6A 2BB5A 2KWDA 5C2TB 1ZYRC 2F0JA 5HURA 2JSOA 3B9JA 1WD1A 1YNJD 2B2TA 1QNKA 3SR1A 1ZDVA 3BWUD 2WNMA 3GO5A 3TEWA 1TQOA 5EQ0A 2EJFC 2K03A 4Z9CB 2ICIA 2A74C 4IALA 3OMCA 1WTVA 1HTLD 2JA7B 3AEAB 3V05A 3BYYB 1YN4A 1GB4A 5H8YE 1K52A 1PFBA 2K5DA 1FNWA 1G2TA 2F0NA 1IGCA 4KV6A 1LT5D 1SNCA 3AEEB 1FFVA 3NP8A 1CZWA 3PO2B 3HGBA 4NZLB 4YTNB 3HRZC 4F87A 5C3EB 1KRHA 5BMGA 4C7ZA 3AEGB 1OXSC 2V0GA 3P7JA 4MIUA 1A6XA 5I6YA 3BIID 4RH6A 1LTRD 4CKBA 2N88A 2PZUA 4RCNA 3DUZA 2J52A 2GI9A 3KLRA 1T5XD 1M8AA 2B2UC 4YWGG 3MZ5A 5EPJA 5I6WA 1F2YA 2GB1A 1PYWD 2EYMA 4KGRA 2WV6D 5E4WC 3R2TA 1JMLA 4F88A 4OO1H 1PRTB 2WDQB 1NYQA 4OW0A 5FK9C 1H9MA 1Q12A 1I7HA 1W6KA 4HROA 3WOEA 5D3DA 4IZ8A 2NUCA 3HZXA 2W82A 4YTMB 1S5FD 4A3GB 1QG7A 5CYUA 2BTEA 3I3CA 4KMUC 1JOOA 2PZWA 5JVH3 3I90A 5FKAC 4YSZB 1BCPD 1FXIA 1KDAA 2B8FA 3LNNA 2XWJB 1X3QA 5C44B 1HZ5A 2LMCA 1T3QA 4Q2JA 1KNEA 1ZUD2 5CBAE 1EY0A 4B0MA 2BA1A 1ZXTA 4ZHOA 3IFTA 3HOXB 1K8MA 2IPKD 3OSOA 4HEA1 4DN4M 4V0BA 2HQEA 3MFGA 4FF3A 5AUIA 3BS1A 3H3VC 4N9PA 3CRKC 1FD7D 1HA5A 4ZUIA 3HOYB 3VR8B 1F2LA 2EYPA 2PMZB 4IFDH 2ACZB 1J9OA 5C5MA 2KA7A 1DD2A 1SYDA 2AUJD 3Q8FA 2H88B 4B08A 2L83A 3I9V1 2BYTA 3TP7A 1Q1EA 5IGEA 3Q6SA 5KRUA 4NKLA 3WCQA 3L9AX 3KF8A 2WIIB 2YU9B 4XT3B 1V8CA 1U4MA 3A8KE 4WAFA 1I6HB 2ID0A 1ROEA 2HCCA 3U9OA 1ICWA 2WACA 2Z1CA 2B63B 3MXPA 1U4PA 4WH4A 3QIAA 4PQXA 4R8NA 4KGTA 3Q8BA 5LHY1 3D4WA 5J1ZA 1SSOA 4HCEA 1A2TA 1MSHA 1P7FA 1Y56A 1S5CD 4BA1I 4L23A 3P63A 2WP8J 1E2ZA 1SE4A 2JYOA 4C56C 3A55A 2LMCB 2K32A 4DQOC 4ILWA 2PNRC 1C79A 5KIXA 2PW7A 1K83B 4LTUA 1PFNA 1PZKD 3ND9A 1NR4A 1TS3A 1STHA 1EWCA 1YMHE 1OFFA 2CVRA 1QB5D 5EJWA 3FILA 4XDCA 5LNK1 1D1IA 2FMCA 4QUFA 4MM3B 1SYEA 1Y8NB 2WKDA 1GUOA 2F0TA 1GXDC 1FFUA 2NWGA 1XLQA 4CQNA 2RVLA 5FR3A 2RBMA 2F0SA 5FLXL 1SNMA 1HHVA 3GTJB 3NTHA 1Y8OB 2EELA 4RGTA 3X3NA 3ZJUA 1WWTA 2MUYA 4G4KA 2G9HD 3SDZA 1EU3A 2HTME 1MD2D 1EY8A 1YNJC 4U68A 4US8A 3UI2A 1YN3A 2XIWA 1SXTA 5ELDA 2JQRB 4RKBA 5JXVA 1XXGA 4UDUC 2W3RA 1SIJA 2F0HA 4C3HB 1QNUA 3I70A 4KD3A 4LLGM 3S16B 1SNQA 4G7HC 1D4BA 4BBSB 3X3MA 5ELEA 2RA4A 2ICEC 3FPUB 4C3IB 2MEKA 4KY6A 2QCPX 2R3ZA 3RZOB 1R7SA 1ENCA 4H7BA 3W2DA 1MPEA 4OGQC 4N59A 2J0TD 2L11A 2K3UA 3BDOA 1JORA 3AEDB 5E6JA 1L5PA 3C3LA 4GZYC 2IWHA 2M0AA 3SK5A 2R7ZB 2WXGA 3AH7A 3NTIA 3DWMA 3DEPA 1SFOB 1YQ4B 2V3PA 2ZW0A 1WYGA 4OO1I 2G1EA 1NI3A 3Q8CA 1LTAD 1G8ZD 2J7ZA 3M7GA 1AFPA 3BK1A 4C2MB 4EQOA 3NWTA 4BA2I 1RTNA 3SVMA 1FNVA 5T1GA 3P75A 3MAQA 3TSSA 2A69C 2VB2X 1VCIA 1UGJA 1IGDA 3LXFA 3I4LA 1PTOD 2BB6A 1TY2A 2JYTA 2V4IB 3TBIB 3PO0A 1TVXA 5C4ZA 1WTRA 5ELCA 3NBHA 4DGZA 5JEAG 3N9YC 4RKLA 2PKOA 5GXGB 1XCQL 1F9QA 4WURA 2BOSA 4XQJA 4MT5A 5BYSA 3FKIB 4HMIA 2IJ0A 1O7LA 1QE6A 2E2DC 1F9PA 4DA2A 4KHVA 4F7XA 4ARIA 1FNUA 3MJ5A 1H9SA 1QQRA 4K2LA 1KFYB 1G2SA 5C0XH 3DEOA 2A69D 4O1NA 4IFDI 3B2GA 2B2TC 4RCOA 4G7ZC 1JWBD 4AS1A 2SOBA 1PFDA 1A70A 3SK4A 3U52E 1JWUD 2K5PA 3Q24A 1C8CA 4N6EB 1RD9D 4YTPB 3V3XA 4A3IB 1Q8IA 1F9SA 5CV8A 3D4RA 1I50B 1JWSD 2RMMA 1QOFA 5EBDA 2KEDA 1SSNA 2Y5CA 1JW9D 4KN7C 1FCLA 4L1BA 3QG1A 4B9XA 2RQXA 2QJLA 3FEWX 5IGCA 3EROA 3LYYA 1SNOA 4GDLB 2KCCA 3S17B 4RFBA 3KWVA 1ZXHA 1MHHE 2EKIA 4LK1C 3AM9A 4ULLA 1SYBA 4EE2A 5CBEE 3IT6B 3TP5A 2B2WC 2N7JA 4F8MA 1VZ8A 2E74C 4CJ2C 4CJ1B 2WB1B 5AUKA 3GD7A 2Y5PA 4JWSC 3T56B 2WXLA 1A3TA 3NK9A 1JQYD 5CC4A 3V2TA 2E3TA 2XRSD 2CW0C 4A3BB 3P4RB 2O4XA 2PCFB 4DAYA 4HSVA 2CU3A 3B2FA 3S1NB 2X69A 2MGSA 1ONLA 1DJRD 1RWSA 3ZJVA 2RPVA 1HZ6A 3GTGB 3AE6B 2N9LA 4G7OC 2SNSA 3ZYYX 1HFNA 5FOBB 2Z4HA 3D31A 2MJ3A 1GUWA 1KDBA 1ZP0B 1IBXB 1BR9A 2N0SB 2M56B 5CV6A 5BN5A 4IKGA 2FBWB 1RM6C 1DOXA 3Q0AA 3H0GB 4ME5A 1SB3C 4WRDA 1ET6A 3RLFA 3LWEA 3P4QB 2BS2B 4KGSA 4EGVA 3I4NB 4CGYB 1RODA 3AE1B 3E6ZX 3K5MA 1OXXK 1BUIC 3OWFA 3NVWA 4Q0FA 3U9SA 3NVYA 2QSDA 1J7AA 4HEDA 3GTPB 4QUCA 5JPNC 1N63A 5TSSA 2L52A 2I07B 2K1BA 3J81L 1E7PB 2OT2A 3DWGC 5C0XJ 3GTOB 3AE7B 4JX1C 1LTSD 1RF2D 2JEAI 3EA6A 4TQ1A 1TWFB 1IKMA 1KAAA 4USAA 2QMTA 4LK0M 1T5EA 4NP5A 2MPMA 5JJZA 3EFXD 2EJGC 3HOVB 3AB9A 1OQRA 4AYBB 1OXUA 1RJTA 1RCVD 1JWAD 2PTLA 4IURA 5CV9A 3NVVA 5DM73 2FMMA 4QCLA 2ZXOA 1BBXC 3MXNA 4P2CB 4KTAA 3D4DA 1AN8A 4XXEA 1ENFA 3HVZA 4PNYA 1TS2A 1AW7A 4ZOHC 3A54A 1C78A 2E76C 4PMCA 1LLRD 1BCPC 4LAAA 5J39A 3FDTA 1TR5A 2B2VA 5CR3A 1PRTD 4KKSA 4FNFA 2MJ8A 1SYFA 1PGBA 4WQMA 3C1FA 4HAEA 2OXPA 3AV8A 2FFKB 4RF0A 2BA0A 1SNDA 1LV9A 1C77A 2FJ2A 2O5IC 3S1QB 1AZQA 4DK1A 3E0JA 3HRDD 2K04A 3M3YB 1L4ZB 2KHSA 4J1MA 4IN3A 5F2DA 3V96A 4PT5A 5JEAJ 1B4OA 2QKIC 2JA6B 2JYEA 5EE9A 5C0XI 2NTTA 2QF7A 3BVZA 3ND8A 1CK1A 1Z7TA 2K28A 1XO3A 1EOTA 3CQZB 1NYRA 2ENBA 3NHHA 4KY5A 1R4PB 4A3KB 4A8XC 3AMUA 2GRIA 2NVXB 3TEXA 1ZOYB 1XYIA 3ABVB 2DNEA 2INNE 2F0GA 1SNPA 1F2ZA 2KECA 1YN5A 2L9HA 2X38A 3TUOA