1SEBD

Complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
234
structure length
206
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKTCMYGGVTEHDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Three-dimensional structure of a human class II histocompatibility molecule complexed with superantigen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc ii/peptide/toxin)
total genus 43
structure length 206
sequence length 234
chains with identical sequence H
ec nomenclature
pdb deposition date 1995-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sebD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sebD02
2AQ3B 1LTID 4RGMA 4RHRA 4RFBA 1YN3A 1LT6D 1GOZA 1FNUA 1TS3A 1BCPC 1EEID 1B44D 1UUPA 5ELEA 3TSSA 2IJ0A 1PTOF 1STEA 1TY0A 1JQYD 1S5BD 5FK9C 1KTKA 1D5ZC 1D5MC 1JWUD 1HXYD 1I4GA 1L0XB 1SXTA 1KLUD 1I4PA 1AN8A 4C56C 1TS5A 3BYTB 3SEBA 1RD9D 1DJRD 1KLGD 1BCPB 1TS4A 1CK1A 5ELBA 4NZLB 1ET9A 1PYWD 4L63B 3GP7A 3R2IA 1F77A 2WV6D 1BCPD 3URYA 1YN5A 2R61A 2Z8LA 3MFGA 3KLSX 1RDPD 1EU4A 1LTRD 2IPKD 3R8BA 1BCPF 3BYYB 1JWMD 1PTOH 1EWCA 1MD2D 1LTTD 1V1PA 2SEBD 5ELCA 1JR0D 1RCVD 1SJHD 2XNAC 1RF2D 1TY2A 2XN9C 5TSSA 1EFID 1FNVA 2XRSD 1LLRD 2AQ2B 2RDHA 1LO5D 5ELFA 1S5FD 5D3DA 2RDGA 3CHBD 4DXFA 1JCKB 4Z9CB 3BVGA 4OHJA 1AW7A 4RCOA 1SE4A 1DYQA 1D5XC 1CQVA 1HQRD 3OWEB 4TSSA 1M4VA 1S5ED 2G9HD 4DXGA 3EFXD 1I4XA 1LTAD 1LT3D 1S5CD 1I4QA 1LTSD 5FKAC 1LT5D 3EA6A 1FD7D 2NTSA 3W2DA 1G8ZD 1QILA 2QILA 4K6LA 4RGTA 4RGOS 5I4DA 3DWQA 3DWPA 5ELDA 1S5DD 1T5XD 5D3IB 1V1PB 1SJED 2XRQD 3DWAA 3V05A 4UDUC 4RHSA 2ICIA 1SE2A 1PRTC 2J4XA 3O13A 1HA5A 1PRTF 4RH6A 1V1OA 2TSSA 1FGBD 4RGNA 1HTLD 1SEBD 1PTOC 1SE3A 3R2TA 1CT1D 1CHPD 1EEFD 1UNSA 1B1ZA 1LT4D 1CHQD 2CHBD 2O2LD 4O1NA 1EU3A 1PRTB 3BVZA 1BXTA 4BWGB 1PZJD 4ZYSA 4L6TB 1XXGA 1PRTD 1ENFA 1FNWA 3BVMA 1D6EC 1ESFA 1PTOB 1YN4A 1ET6A 3BZDB 1I4HA 1PZKD 1TS2A 1LTGD 1L0YB 2NTTA 1PTOD 3MC0B 1LTBD 1PZID 1I4RA 2QEJC 1JWSD 2AQ1B 1SBBB 1XTCD
chains in the Genus database with same CATH superfamily
3TEWA 4A3FH 3J81j 1KD1C 1V2YA 2L7RA 4A90A 4JQWC 2XIWA 3TP8A 3A9KA 2XWJB 4KJOA 1XNRL 3NUCA 4A3IH 2JP1A 2JA6H 2FIFA 2N9LA 4J6IA 4C4VB 4C7ZA 3OTOQ 1FFVA 3CAMA 2Z0DB 3L4PA 1NDDA 3KUPA 2VZAA 2DY7A 1ZKHA 5LXHA 1D5ZC 3LX0A 1R4MB 1EWHA 4H02A 4MEMA 1A3TA 3C1FA 3AE6B 2PNRC 1N36Q 3JYUA 2WLBA 1YNJD 4M02A 3DPDA 3PIP3 1WH3A 2O4XA 4X66L 5ELBA 3T1YL 2CU3A 2IDYA 2BKRB 5MPOA 2JU6X 3I90A 3KF6B 5C4XG 1LM8B 1NUCA 1X6OA 3CU7A 4JLCA 1IBMQ 2B29A 4IFDI 3G4SA 3S1NB 1R7SA 3N52A 1GC7A 1IKLA 4CGYB 4KIKA 1VLBA 2CKZB 2IZVB 4NAWA 3QB3A 4JI2Q 1A6XA 4GSWA 5LL6X 1WGDA 5C3JB 3TZDA 2BB5A 2KDBA 2IBIB 1HR0Q 3ZXVA 2EE1A 2E8GA 1WXQA 1ICWA 3UQBA 4C2MB 3E3XA 1FYCA 4USAA 3K5MA 3I70A 2O6VD 2A73B 2V3NA 2WB1E 2GBMA 2KHWB 1LLRD 3D6CA 1X55A 1SB3C 5GMVA 1TWFH 4DV2L 2C7MB 4LF9L 3STBD 4IJHA 4OHJA 2SNMA 1DYQA 3I4MH 1G6ZA 4GKKL 2NBWB 3A9JB 3PUWA 2M4NA 3WAPA 4EE2A 3MWYW 3UDFA 1YEZA 2K75A 4X3TA 2WGSA 1I6HH 3AE5B 3QWZB 3FKIG 5JVG3 1UELA 1PYSB 3UDGA 2M2LA 1D3ZA 2RDFA 2EYMA 3HZXA 4A3EG 4A3DG 3DHHC 3P4SB 3DMUA 5M3FG 1QILA 1CQFA 2R3ZA 5C3EH 3KWLA 1C77A 4YSZB 1FO4A 2DZMA 5ELDA 1VQHA 2CHWA 1SDFA 4KK7A 1RYJA 4YTMB 3UIPB 1W6KA 2ZPNA 4DR1Q 2Y5PA 4LK1C 1FRDA 3GZNB 3FILB 2A1AA 4UDUC 2PI2A 2EY6A 4KKTA 4GLAC 3TS0A 1NENB 3KH0A 3CD6A 2RR9A 3NS1A 4B3ML 3WAOA 2NVYB 5M5YB 3CCLA 4TQ1A 2MO1A 2RMMA 3RLFA 1XPRA 2HD3A 2MNAA 2BYFA 3I9V1 1RTNA 1Q0WB 1WVLA 1I42A 5EPLA 4AQYL 3P4RB 4DV0Q 1NY4A 2V3SA 3BVMA 4ZRPA 5AFWA 3J7YW 2BWFA 2WXHA 4MGYE 4TQUS 4KVGB 3SVMA 3RPFC 2L9HA 1FCLA 1H8CA 1MPEA 3T1HQ 4ZRIA 1C48A 5JEAJ 4KGSA 2PNHA 3PGEA 4J15A 4PT5A 2L1AA 2QEJC 1WZ3A 4DAPA 2KDMA 2PQEA 3UDXA 1E0BA 4A75A 2A4ZA 1EY0A 3C8YA 1LT6D 3EROA 4JI8L 1JRUA 2UU9Q 4OWTB 2ATWA 1IBLL 1EEID 1WXMA 2MW5A 2JXXA 4FN2A 3PO2G 4LFAL 1HA6A 1VDVA 3DUZA 1VRAB 2NCNA 2DAFA 4DK5A 5AUIA 3ZJUA 4IDIA 4MSMB 1XO3A 1GD7A 1YOVB 4B0EA 1XNRQ 1GUGA 1E1TA 1TS5A 1YQBA 4JE3B 1DJRD 2V1YA 3DQVA 1OXVA 4I7AA 4NPNA 1VQKA 1VQBA 3B2GA 2AEHA 2OXPA 1PYBA 3Q3OC 1P3QU 4KHPL 2PKOA 3KLSX 1TWAB 2F3WA 5A2QE 4C3IB 4ZYNA 4NXML 4X66Q 4DR3L 3T1YQ 2FAZA 2JQOA 3KBXA 5C4XH 1KIXA 3RLOA 2WP9B 4KGTA 5T1IA 2ZJPA 2EXZA 3I3CA 4FF2A 1BT0A 3S1QH 1SJHD 4TKOB 5BMGA 1PH1A 1VQLA 4EQOA 2KLCA 2EIFA 2YV5A 1CMXB 1HE8A 3D31A 1VQPA 1C7YA 3LWEA 3BVGA 3KF8A 2M8SA 1SE4A 3HM3A 1Q1OA 3IHPC 1K83H 4FJZA 2PZTA 3VTVA 3ONAB 2E2IH 3EECA 4U673 4WQOB 2NBVB 3MTNB 3PUVA 2EELA 4EX5A 4DV2Q 4IPCA 4LF9Q 3AE2B 1Q8IA 3HOZB 1Y56A 2Q8IB 5C1ZA 4URKA 1LACA 4A3FB 1VQJA 5CGKA 4P72A 2C60A 5BYRA 3NUHB 3W2DA 3QJYA 4DF7A 2JA6B 3FEWX 3HS0C 5JOBA 4A3IB 4GKKQ 1ZXIA 2NR2A 3Q69A 1VQMA 4KTAA 3D4WA 1T5XD 1S4ZA 4JI4L 5D3IB 3VXWA 2WXMA 1CTMA 1GAQB 1WYWB 5AEKB 4L5SA 1JMLA 1DOYA 1Q1BA 4A3DH 2PVGC 2UXCL 1YHAA 2NWGA 5M3FH 1W6JA 3OPOA 3GTJH 1KF6B 4K2KA 4FXKC 4RH6A 4YWGG 4IFDH 2KWUB 3L9AX 2KVRA 2NBUA 3AXCA 4OW0A 1IW7C 3CMEA 1Z5SB 3HVZA 1ACCA 2RSOA 1SE3A 2GB1A 1Z7TA 4HJKA 4Q0FA 4WWMA 3JAMc 1VQOA 1OTRB 1EEFD 1WXAA 3BDOA 4Q5VA 4QF4A 2O2LD 2E75C 2GBJA 4B3MQ 1PZJD 3AB9A 2D10A 4IKGA 1XEEA 4C00A 3IFTA 1FNWA 3PGZA 3BY4B 1FIQA 1ESFA 2J7ZA 2QF7A 1H9SB 1P7EA 1YHQA 2FIDA 1X54A 4IPDA 5E1FA 5GAGC 4GNXA 3BS1A 3M7NA 2KZRA 5JXVA 2ZJQA 1TIFA 4AQYQ 3WOFA 4QQBX 3N9YC 4F1SA 4IO9A 2E5LL 4XZ4A 2O5JC 4ACFA 3Q8DA 3HRZC 1TWFB 3H15A 2L32A 5IKCM 1Z6HA 1GB1A 4A3MG 4GN5A 1WXSA 2PQAB 2UXDL 3DHIC 3JSVA 1H9MA 4LDTB 3I4MB 4ODGA 2IGGA 1OTCA 4W9IA 1EWIA 1Y1WG 1PFSA 2DAJA 2VUMH 2JA8H 3L16A 2WACA 1IHZA 1I6HB 2ZCBA 1J8IA 4JI8Q 4E3CA 5IT9c 5E4XA 1NMFA 4W9KA 4UAIA 1MKHA 2B3GA 1IBLQ 3K8AA 2KX3A 3JAML 1WY8A 1DOXA 4LFAQ 2LJIA 1EQQA 1YX6B 2B8GA 1VDZA 5C3EB 1CK1A 1A70A 1QUQB 1ISNA 2N7JA 1EYAA 3WANA 3JW0X 2KOXA 1KH0A 1ZDVA 3AEGB 3P20A 3Q8FA 4IWOA 2I1JA 2D2QA 2OT2A 4M0WA 1E8WA 1GXDC 4RKBA 1R9TH 4HIMA 2G45B 3S9WA 1ZXHA 1L5PA 2N9KA 2W55A 4DN4M 4LF4L 1STYA 4FXGC 3NE5B 1UBQA 2SEBD 4P2CB 3VR2A 4DKAC 3S1MH 5EPJA 4KHPQ 1OEYA 4NB3A 2LGSA 2XNAC 3E0JA 3B9JA 1UWVA 3UI2A 1EY4A 4NXMQ 4DR3Q 2ZJRA 2SNSA 3IAYA 1LV9A 2RDGA 4UHVA 5JEAH 1JCKB 3CC2A 3IRBA 5IT9L 2ZPYA 4K3CA 4MIUA 4G7HC 2FBWB 4M8MA 3Q8CA 2BDNA 2QKIC 4LFCL 4NY0A 4KI0A 5CV6A 4PZ6A 2A6HC 1FMAD 4HIOA 4LNKA 1I4XA 1VZ6A 1GJZA 2NB0A 4DV1L 4ANXA 3ZLZA 5G3LF 1DCZA 1TXYA 4HJ8A 4DV3L 1VQGA 5LMUL 1XF5L 5G2NA 1WXVA 1XPUA 4DDID 3MP9A 3HKSA 2KFKB 1CI3M 1MSGA 5ELOA 5C3WA 3UI3A 1SJED 4HSPA 3KW5B 1D8LA 1IW7D 3V05A 3MHZA 2KCMA 3DCGA 2OWOA 2K04A 4IFDJ 2N4FA 2XBBC 2PEAA 1WE6A 2DBYA 2XSCA 1RAXA 2QCZA 2WP8J 2TSSA 2LUMA 4OX9L 1EY7A 4JI4Q 2LWPA 2LXCA 1IGDA 2GBRA 5C4HA 3NS8A 2UXCQ 5I2XA 3R2TA 4CDDC 1CZWA 5CTRC 3H7SA 1EYGA 5L95C 1WJNA 2JRHA 4WJ3M 3BVZA 1K53A 3NHHA 2BA0A 1WFQA 4NXNL 3U2SC 1NAPA 1XXGA 3ONSA 5E6OA 5C4XB 2RDBC 1WYGA 1D6EC 3HRDD 4LJPB 1KL9A 1SYEA 1SMYD 4DHZB 5L83A 2LD9A 3H3VC 3J7ZC 2JYEA 2M1MA 4DFAA 1C79A 1V8CA 2ZVOA 5LMNW 3S1QB 2I5HA 1SRUA 4EZJA 2IGDA 5C0XI 4DDGD 1X56A 1I4RA 4ID6A 2AQ3B 2IWHA 3PF4A 3M4OH 3EUB2 4IOCA 2VH1A 4C3JG 3CIRB 3P1MA 2BA1A 1SYDA 3MJ5A 3D3RA 3K7AH 4IM0A 1ICFB 1I5FA 4GXBA 2C9WB 1K83B 3CC4A 1UGJA 2E2IB 1JQYD 3S14H 3PZ8A 4LDTD 1D5MC 4JC0A 3U7DA 2E5LQ 4O0AA 3TREA 3DM1A 4XYOA 2K5NA 2WAQG 2NN6I 1SYCA 1I4PA 3M3JA 4TQ0A 2UXDQ 3CCQA 1V9JA 1Y1WH 1U4AA 2F0OA 3RCZA 2B2UC 4ARIA 1GM5A 5DEHA 2YVCA 4HJ9A 3PHXB 4X62L 4KMUC 1D1KA 3OSOA 3CCMA 3EC8A 4A3DB 1JROA 2K33A 1N61A 1ML0D 5M3FB 3GTJB 4NJ7A 1Y14B 3R66C 1SE8A 4JVZA 1Q10A 2QDFA 4C3HG 3AU5A 3VYSA 4DGZA 4JBJA 1BR9A 1SYFA 1CKOA 5KYIA 2K5DA 2HJ1A 2Z6KC 5ELCA 2OCEA 5EKIA 3RZOH 1TYGB 2JYOA 2FCMA 4MELA 1O7LA 1KNAA 2ZTDA 2DNCA 3G48A 4P71A 2NVQH 1K52A 2FE8A 1YJ1A 2O5IC 2RPVA 3MXNB 4LF4Q 4HPMB 4A4IA 2A6HD 4AIMA 1QVFA 4HXDA 4YXDB 1IP9A 3NBHB 5IGFA 2SAKA 3DVNU 5IA7A 2OQKA 2N0SB 4JL9A 1KJTA 1TR5A 2BT6A 4FULA 4LNIA 1SMXA 1OXUA 1BOSA 4DK6C 1HNZL 3PRPB 2DLBA 2LRUA 1LTAD 4AJWA 2GRIA 2P5ZX 4HKZE 2WXLA 2J7QB 1JB3A 2CH4A 3ND8A 3Q8EA 2PYKA 3K59A 2LGXA 2N55A 4POGA 4K6LA 4LFCQ 2NS5A 4AYBB 3LDZE 4G11A 3PUZA 2MJDA 1PMRA 4QAYA 1WGKA 3GS2A 2VUMB 4DV1Q 4R1JA 2JA8B 3DWAA 1GHKA 4A20A 2H1EA 4DR4L 2XEWA 4DV3Q 2ICIA 2K8HA 3CSTA 4JWSC 5LMUQ 4R8NA 2C5CA 4GOCA 2G3QB 1PFDA 3CW2C 3M3YH 4RG1A 1EUVB 4RMAA 1PRTF 1KNEA 2WIIB 2M9VA 2R7ZH 4LTUA 2CS4A 1AZPA 1EZ6A 1E8XA 5JJZA 4BA2I 2HUGA 5IP9H 4W9LA 4A3CH 4A9AA 2JN4A 4OGQC 1R9TB 4PS7A 1WTRA 1AWDA 5M3MB 4OX9Q 4BBSG 1QVGA 3AE7B 1QNKA 2E74C 5FJ8G 1NR2A 2R92G 4L23A 2WYQA 2VXWA 5CX3A 2KMMA 3S2AA 1VQDA 1HFNA 3S1MB 4WQMA 1I4HA 3K0YA 4FYDA 3W1GA 4K5VA 5CBAE 3SXHA 1JOOA 1WTHA 1I94L 2K3UA 4IUPA 3C1EA 3QA8A 4NXNQ 3T56B 2KAJA 4HMIA 5IP7G 2CJOA 1CFMA 4RHRA 3IXSA 1FNUA 1B9NA 1S3OA 1U0LA 3I91A 1WRIA 3NG0A 1U5KA 1PXUA 1HH2P 2M0AA 3GTMB 1EIFA 3OWFA 2A6ED 1L0WA 4IWPA 1SYBA 5H92C 4B6WA 1YQ3B 4NKLA 3EIVA 1L1OA 4C3JH 2IL8A 3BINA 1EUJA 3PTFC 3RNFC 1K8MA 2KJXA 5IGDA 4LK0M 1DONA 1SNCA 1WGRA 2FINB 1TKGA 3S15H 1OXXK 2JZPA 2BCOA 4DUZL 4JK1C 2KHIA 4ZHPA 3CCRA 3SDZA 1WTQA 5A2QL 2WV6D 3V60A 5IAAC 4Y7NB 1G6JA 3ZRFA 2Q2IA 4A3GB 3TP5A 3VVWB 5E6PA 3HOUB 1CZGA 1XD3B 3ETRA 3U52E 2JUOA 2LGDA 1L0VB 3AE4B 3RD2A 1V1PA 4JOIC 4FO2A 1MD2D 4X62Q 3A9KB 3KYDD 3EQLC 2Q2UA 3KLSA 3E6ZX 4EQPA 5E6JA 1TY2A 1MHXA 4XWTA 4C3HH 5C0XH 2LRWA 4ZHOA 2A19A 2EMSA 4LJOB 2RDHA 2DN8A 4BS9A 1S72A 5JJLA 1WR6E 4A3PA 2KO3A 3APDA 2GMIC 5KNDA 2HT1A 2KVZA 5C23A 4TKNA 4FLHA 4CJ2C 4B3RL 4KZ0A 3VR9B 1WCMG 1XWEA 2K28A 1TT5B 4F7XA 1E3PA 2KQSA 4A3OA 1BBUA 2LFIA 3P4QB 2K1FA 4ZKCB 3GD7A 4DR5L 3BDLA 3M4OB 5GROA 1VCBA 5LMNL 2NN6H 1SNOA 1MHWC 3K7AB 2ZXPA 1PGXA 4I6NB 1F9SA 4KIKB 2D0OA 4IUVA 5I6WA 1HNZQ 4NAWB 5DPWA 2FXQA 2X38A 1A3VA 3S14B 1FGUA 2ICEC 4E6IA 4K14A 2J52A 4XT3B 3RT3B 1WYDA 3NJTA 2XWBB 5K36G 2JT4B 2KQ7A 1XNQL 2BH2A 5BMHA 4D2KA 4HAEA 3OW2A 5M5WH 1GNUA 1WTVA 1ZYRC 1Y1WB 1IGCA 3RZFA 2CW0C 1HTLD 4K0KL 1DOKA 3QQ8B 2MP2A 2JA7G 3SK8A 3DVGY 4B95A 4GU2A 2CWAA 4DR4Q 2HDEA 2L11A 3JAMi 1CHPD 3B6YA 3BU2A 1VQ9A 2Q8TA 3GQBA 3DBLI 1TKEA 4DK3C 2JK8A 4LMQD 4IURA 1JORA 4GZYC 2JZZA 3TZUA 3QARA 5BYSA 1XTDA 2V4LA 1ENCA 4RF1A 3U8ZA 2D5GA 3L0WB 1SNMA 1ET6A 1TS2A 1N33L 3RZOB 4EQNA 3J80E 4KKJA 4K8IA 1F9JA 1WD0A 3HOYG 2N78A 2Z6BA 2K05A 3KFUA 2NVQB 2IY1B 2R2OA 1Q81C 5FJ8H 2I1KA 4JPSA 5FR3A 2R92H 1Y1VB 1YN3A 3M4YA 4G7OC 1P9DU 3TUOA 3I4NG 2GI9A 1TS3A 4KHZA 4DAVA 2K5WA 3H3VI 1YITA 2K5QA 3BK2A 5CV8A 1I94Q 1LTLA 1SF0A 3H6MA 2KFJA 2AKWB 1KTKA 3X23A 3LWUA 4KKSA 5BN4A 2C7HA 1CKNA 1KRTA 1IXRA 2F0HA 2B8FA 1OO9B 3A0JA 3AE3B 5G55A 3F2BA 1UWXA 3I2ZA 1RD9D 1VF7A 4JOIA 4WWOA 1E7PB 3K80C 4WJOA 2JA5G 4BBNF 2I07B 4NZLB 3GP7A 3R2IA 1VD2A 1WR1A 2VB2X 1E8YA 3URYA 4IM3A 4II2B 1B8AA 3CPFA 3NY5A 4BZAA 2RGFA 1ZOYB 2F4VL 2WU2B 3PO3H 1KRHA 3AMZA 4MNOA 1VZ7A 4ZOHC 2K14A 3J80i 3M3YB 3E9SA 4MT5A 2F0GA 2HHHL 3QR8A 4R4OA 4DUZQ 4KV6A 1F2LA 3SFEB 1TWHH 2R7ZB 4GIVA 1YJNA 1QZHA 2Y5BB 1STAA 2DUDA 3MHSD 3E0EA 2D07B 4HIDA 2M56B 2MH7A 2G4SA 3I5JC 4MH8A 4N9TA 4DUYL 1GUAB 4WAAA 5C0XJ 3H0GG 5KHOA 3LYYA 5I9PA 2BVCA 1P7FA 2WX1A 1GJXA 1QZEA 3A56A 4RF0A 1UE7A 3HOVG 5D3DA 4ABNA 1M1KC 4L8JA 1BQQT 5G5GA 2KMAA 3PIO3 1EIHA 4DR7L 3HOWG 2YYZA 1O80A 4IUTA 1RWSA 4FP5D 1J9OA 5CR3A 5EDSA 4OZBA 2AL6A 2ZM6L 1V5OA 1JWBD 2MSED 1NSNS 4S3SA 3KUZA 2KCCA 3QIJA 4LF6L 2RKSA 1X9NA 4K7UA 1D4BA 3KDFA 3ZUNA 1FXIA 1P98A 2DHZA 3GO5A 4YCWA 3H9DA 4B3RQ 3T8MA 3A55A 1YNXA 4A3BH 1N63A 3J7AV 2BS3B 4BVUC 3IBEA 2R2QA 2B3AA 3IAS1 1KLVA 2XRQD 2RA4A 2BBCA 4DR5Q 3N32A 3K6OA 1ZYRD 4ZKBB 2AYOB 4US9A 4A6QA 4C3JB 5LMNQ 2PPHA 3NWTA 2BE5D 2IO1B 4B9XA 2JJQA 2C5LC 3N3KB 3K9PB 2LVOA 4JWUC 3AFQA 4A76A 2JWZA 2PE9A 3VH3B 2KWCA 3W5UB 3L10B 1X1MA 3S15B 1WIAA 4DV5L 4X57B 1K8AC 5M5XH 3KF8B 2OTJA 3Q3FA 1V86A 1SN8A 4DHZE 2WAQB 2F03A 3RMHA 1XNQQ 1E7UA 2IO2B 1B1ZA 1A15A 5BN3A 1FXAA 4ANUA 4X3UA 3AEAB 4QY7A 3AM9A 4K0KQ 1PQSA 4ZLTF 1ZEQX 2E2JH 2JE6I 2VZKD 3RMKC 3H1UA 4MHEA 2W3SA 4OZAA 2M17A 3KK7A 2EKIA 2N7DA 3MC8A 4JYAL 2N8NA 2YEPF 1A3UA 2BGFA 1CUKA 3VA5A 1SLJA 1HCZA 2D3CA 2IHFA 1JT8A 1BMLC 3CPWA 1YNNC 1V1QA 1V81A 2ENBA 1G2SA 3E9IA 3I73A 4HMJA 4EGVA 1XYIA 2PIAA 4KV2A 3DHGC 3EFCA 2DZKA 3H7PA 3RZWC 1N33Q 3VRAB 1O7ZA 3E5SA 1KAWA 2LXKA 3BZCA 2INPE 2Q5WD 3HOYH 5C2TB 1HRJA 1OEYJ 3Q3NC 3WIMA 3TDQA 3GTKH 5L37A 2EYJA 5IYDG 3NENA 2HQEA 1PA6A 3JVZX 2WHIA 1I4GA 3RNCC 3VYRA 4POFA 3VYUA 2RBMA 1PDQA 3SEBA 3ZJVA 2RQXA 3K5NA 4OWWB 2HJ8A 3HK0A 3ZVVA 1DM0B 1HZCA 1XQQA 5AUKA 1XJVA 5CBEE 4YT0B 1AZQA 2KXJA 2Q8RE 2B2WC 1RLFA 1S1QB 2M19A 1H4RA 3F8TA 1FPYA 1ZW7A 3PHWB 4BOZB 3GE8C 4N8X1 4MGKE 2B63G 1EU4A 3EGRA 4OIJA 2JA5H 1UE1A 5LL6S 2FJ2A 3K81C 5HURA 5M5WB 1EYDA 1EIYB 2WS3B 1PVOA 1AYFA 1VR9A 3QOJA 5FLXE 2D3BA 3AFPA 3D6WA 2PPBC 3MXPA 4R4TA 1A2UA 2LKVA 2K5PA 2F4VQ 4GNXC 4XTCS 4TVAB 1C3TA 5LXIB 1FEHA 2FUHB 2K25A 1IBXA 5IY0A 3CWIA 1FNVA 1T0QC 2HHHQ 4AP4C 1N5WA 4XWWA 5KYLA 2WXJA 2JZ3B 4PMBA 2PW7A 2V4IB 4REZA 2MUYA 2Y0SG 2TMPA 4JPBW 5COYA 4IPGA 1QKZA 4DUYQ 1TKYA 2KENA 4AYBE 3H3VH 2K9XA 1WRDB 3Q6SA 1MGSA 3U7ZA 3I4LA 1CSQA 5IYCG 4FF1A 3HOVH 1I4QA 3Q14C 5AZFA 2E2DC 5NUCA 4XDDA 2R92B 4M0WB 2L12A 2JQRB 4X65L 2D0PA 3HOWH 1QOGA 4NAMA 4DR7Q 2QILA 3J9CA 3MHBA 3SK4A 2N9PC 2QDLA 4QCLA 2ZM6Q 1KDBA 5HHDG 3Q8AA 2B2YC 3GV3A 1N32L 1UE5A 2WDVB 4RM9A 2K22A 2F0DA 4IG7B 5LHY1 4LF6Q 1GVPA 1ZGUB 2VY3A 2NZOA 3EN2A 1YJ9A 5G5HA 3DWMA 1V1OA 2RCFA 4OVUA 3VH4B 3IT4B 1F9PA 1QE6A 5E4WC 3GV6A 1YI2A 2WU5B 2DY8A 1CT1D 2DNFA 4GS3A 3A1QA 3PO3B 2CH4W 1G6PA 1ILPA 2N1WA 3APFA 1EF1A 4L6TB 4DV5Q 1QZGA 1YIWA 1RHPA 1TWHB 2F0JA 1JICA 2B2VC 3FKIH 2Q2TA 3H6NA 3RN9C 1LTGD 5E3FA 3ZGZA 1MBYA 4A3EH 2ES2A 3TCAA 3A8JE 1K9MC 2EYLA 3MC0B 2WFWA 3DWPA 1K51A 2IO0B 2PTLA 1VQEA 2EY5A 2XGTA 2EY1A 2SOBA 3RR5A 5IOCA 1LTID 4RGMA 1YBYA 4RFBA 5FO9B 2A74C 3PV1A 2KJ6A 3NELA 4HCEA 4JYAQ 1NYRA 5JHBA 4U68A 3MAQA 4B3TL 2KX0A 3TMEA 3G6EA 3IL8A 3RNEC 2PZUA 2B2WA 1XCTL 3HIZA 1S5BD 1XX8A 1C1YB 4CHKA 1QG7A 3X3MA 1JWUD 4GN4B 1HXYD 2JEAI 4A3LG 2MO0A 4FVMA 1TWGH 1WTPA 3ML9A 4CYEA 1M8AA 2KHJA 1HZAA 1V80A 1IZ6A 3MVVA 4BKGA 3TN2A 4C56C 1UD7A 3J81E 5CHWA 1X3GA 5C4JH 1PH3A 1K0SA 4A3BB 4OXPA 1PYWD 2F0EA 4JV5L 3PPAA 5CYUA 3RZDH 5IYDH 3OYYA 2PVOD 4HPPA 4N9F4 2BQQA 4JIOU 2WINB 1QF6A 4OWXB 4WH4A 4H13C 2F0UA 3VYTA 1J0GA 2Q2HA 2L52A 3MTSA 2MRPA 2DYOA 4HEDA 2QCPX 1VQ7A 3IAM1 3SU8X 2EYHA 3W1BA 2E6XA 1CSPA 2HTME 1I6VC 3B08A 1R4PB 5M5XB 4NDXA 1WX9A 4WJQA 3ZNGC 4DK1A 3QJZA 2B63H 2YTXA 4YHHL 3CRKC 3F2DA 2VNUD 4IUMB 3RNGC 3PO2H 1X3FA 4K5XA 3FDTA 2KQ4X 4TUUA 2E2JB 3TEXA 2B2YA 4G3XB 4F8CB 5J22A 2L4NA 1P16A 4MJSA 1B9RA 4BFRA 3J81i 3OWEB 4TSSA 1S5ED 1WSPA 1ENAA 3TP6A 3IVFA 5D6JB 3T3OA 5IGCA 5EAYA 3IFWB 3NZUA 4AUQC 4JI6L 3EFUA 1E2ZA 5D7GA 1Q12A 3J80c 5FKAC 2J0KA 1JQ4A 1L6UA 1NJIC 1WE7A 3T53B 1PUTA 3W5VB 4FJVB 4FJYA 1RFKA 3TBIB 2CHXA 4DWFA 4APVA 2V3PA 2Z0EB 1T5EA 2MHJA 1VQAA 3QIAA 4LWCA 1P8LA 4OL7A 3HOXG 3GTKB 2UUAL 1KABA 4PQXA 3HUIA 2LZ6A 4X65Q 4M01A 1QT9A 1B53A 3X3NA 2MHVA 2J4XA 2YU9H 1L4ZB 1H9JA 4QIWB 2W3RA 2LASA 2NPTA 2D3GA 5IIFA 2B2VA 5IOIA 1LABA 1STBA 1N32Q 4ZUJA 3DXJC 3HKZG 2LI5A 1QOFA 4ALPA 4IOIE 4BAXA 2NVTH 4X3KA 1MJDA 1S3SG 3X0WA 3GTLH 1R4MI 1WX8A 4ANVA 4DAYB 4CBVA 3DBLB 1EU3A 4M8NA 4L5RC 3TS2A 5CHVC 4GOPC 1T6BX 1YJIA 3VDZA 2QC8A 1XLQA 2PI2E 3J80L 5GXGB 4KKIA 4LF5L 1SNDA 3RNBC 4AWJA 2OTLA 2WDTB 4YWKA 4C1NK 4TMAB 2NTTA 1BUIC 4QB4A 1LTBD 2X69A 4K8JA 2R7FA 1SBBB 1KHIA 5KRUA 3B2FA 3DBRI 4PYZA 3OHXC 4IZ8A 4YSYB 2Z4HA 3MEFA 1ESRA 5LLIA 1BCPC 2MP1A 1B44D 1WI5A 4DNIA 3R7QA 2MJ8A 4KKUA 2EPBA 2L76A 5FLMG 3LNNA 2JXTA 1F2ZA 5FK9C 5HY6A 2K7VA 4RKLA 2RCNA 4EVOA 1HJPA 4B0MA 2OHFA 3OG5A 1KLUD 1JB7A 3EHVA 2J53A 4B3TQ 3HOWB 3NVWA 1EM7A 5ISRA 2LGYA 4GLVB 3IG3A 2I38A 1EY8A 4JBWA 5A35A 1DD2A 4BKTA 2N49A 2KEDA 1X32A 4A3LH 1PGBA 1WMHA 2QJLA 1K50A 2BYTA 4FHKA 2KTRB 2Z8LA 4JX1C 2F0WA 1OXSC 4OIKA 2AHOB 3BDCA 3TEZA 5JH5C 2NMQA 4B3SL 4MM3A 3GDEA 4YTPB 3A74A 4JV5Q 5CMDA 3DLLA 1BCPF 5C5MA 5T8IA 3VR8B 2A68C 3A7LA 2BH8A 4L1BA 4IUNA 1E6EB 1C76A 3NSWA 3S24A 3Q24A 4KD4A 2JY6A 2MBOA 2KNBA 2HDLA 3QOLA 1RF2D 4LUZA 1GO3E 4A3MH 1VQCA 4HIKA 3PZ7A 4BKSA 4A55A 5IGBA 2KHSA 2AQ2B 1L1OB 5ELFA 1NCVA 5BYQA 3CCVA 1YJJA 2KECA 2EOTA 1U4RA 3CRLC 5G3LD 3ULJA 3PIPA 1JOKA 3OOCA 1N8RC 2WXNA 2MQHA 3FKIB 4YHHQ 1LFDA 3PUYA 4BKSD 4A3EB 2JSOA 4PG3A 3M7GA 2DX5B 3EVQA 1L1OC 4IPHA 4OZCA 1NBFC 5M9OA 1YVCA 2D5DA 2DYBA 1FXTB 1LXDA 1C4CA 5J2RA 3S1RH 3KYCD 1YD8U 1B50A 2G1EA 2WXRA 1UEAB 1K8GA 1IKMA 1QOBA 3G7LA 1H9KA 4XT1B 4BBRG 3JC66 1V1PB 4JI6Q 1T3QA 1UGMA 3OMGA 5T1GA 3CMAA 1PH5A 3C46A 1FJGL 4A93G 1GC6A 4HDQA 3J7AF 2HE7A 4GOPA 1TWGB 1IBKL 1PRTC 2WAQE 1T0SC 1R4QB 2ON8A 3I57A 1EZ8A 3NVVA 1KC8C 2EXDA 3W1YA 4ZDVA 2REXA 1XLOA 3ULLA 5C4JB 4F7ZA 1MJCA 1PTOC 3K0XA 3HOXH 2LVPA 2UUAQ 3RZDB 3ZNHB 4ZRQA 3OIPA 4MSQB 1XLNA 3AEDB 1CHQD 1BKBA 4MGZE 4OVZA 3NBIA 4BWGB 2DZIA 1PH9A 3FPPA 3TBLD 3SDLC 1BVSA 1GB4A 1OGWA 1P0RA 3I63C 5DCNA 2HDMA 5GQOA 5KIXA 1T0YA 3OLMD 3RI7C 1U4PA 3KJPA 1STNA 2E76C 4G4KA 2B63B 3QWNA 5FLXc 1NEKB 2EYPA 4DK0A 3PO2B 2IX0A 1SR3A 3P7JA 4P1CC 4LF5Q 1F9QA 4GKJL 5IN7A 1PTOF 4HLEA 1N6ZA 3AULA 4HSVA 3NOBA 3PZDA 4AOFA 3TEYA 5IYBG 2MP2B 3DWGC 1T0RC 4WURA 1H9RA 4DU9A 3PSIA 2ZVNA 3QK0A 2F0FA 2JX5A 5J18A 3C19A 2ZNVC 2K6AA 2Y0SB 4IUQA 2HIXA 2V4DA 3PREA 3U58A 1IPGA 2VL6A 4F8MA 2JEBI 5IO9A 5HG2A 2K5HA 3I3TB 4FA6A 2DYMA 4WAFA 2E3TA 3H91A 1TU2B 3NPPA 2A68D 2K01A 2WDRB 1NR4A 1SNPA 2YU9B 5FLXL 4HRSA 3SFDB 1RKNA 3R8BA 5HGTA 3BYYB 3W9CB 4C3IG 2B2TA 3PV0A 5GAEC 2KLGA 3AEBB 1CKMA 4NNJB 2Z0SA 4WJPA 2AWNA 4K6DA 1R4NI 3HP3A 5I6YA 2KWVB 4B3SQ 3GTLB 2QIEB 4CHTB 4PNYA 4BY7G 5DPSA 1CKNB 5HI1A 4N59A 2FMMA 4DHJD 1HFGA 2L05A 4JG2A 1W2BA 4KJNA 2IY5B 1OQQA 1CQVA 1VQ8A 4Y52H 2M00A 3Q0AA 1KXLA 2X8XX 4W9DA 3ZW3A 4EEWA 4KDLB 5CORA 4HKQA 3GTPH 2OEOA 1GUWA 4PK1A 3M62B 1K3RA 1LTSD 2L15A 3NQTA 1AARA 3EA6A 2MA9B 2Y5CA 1WJ6A 2NTSA 4R3DA 1YIJA 3C3LA 1TVXA 2L0CA 1CZPA 1JJ2A 1J7CA 1V5TA 4C80A 1G51A 2KQ3A 1E22A 4NMZA 2BS2B 1VMPA 2JA6G 3CXCA 4YWLA 1NYQA 3U4EG 3HEJA 5BO4B 1SE2A 4YWMA 5EPKA 1VQ5A 2WXGA 4K3BA 3NTIA 1KDAA 1I3QH 3O13A 5KNCA 3ECIA 4EOYA 2NZHA 3SD5A 4FBJB 2WDQB 3LGJA 4R4CA 4RGNA 4BBRH 1V9PA 3V62A 1SEBD 1PH2A 2O2VA 5C44G 1FJGQ 4A93H 4K7SA 4KHVA 4WFN3 3J81c 4W9HA 2WXKA 1WTWA 1IBKQ 4DPGA 1KAAA 1F9RA 1U4LA 1C9FA 2MBHA 2BTEA 3I8ZA 4M8AA 5AJ3L 4HPLB 2UUBL 3ZDTA 2UU7A 3T51B 4LFBL 3AB5A 2K5VA 1Z9FA 3U4ZA 3Q8BA 1MFWA 2Z9HA 1HNWL 2KMCA 1L0YB 2F0QA 1DGSA 2LVQA 2MLBA 1YNJC 2N88A 2AUKA 1PZID 3SE0A 4A3MB 2YLMA 1EY6A 2QW7A 3PUXA 1XTCD 3PQIA 4EQ5A 2EMTA 1GOZA 4Q2JA 1Y8OB 2FFKB 2PMZB 3SK6A 3ZO5B 1C4QA 1UUPA 2PO4A 4GGQA 4W9CA 4EZKA 4LCDE 1ZE3D 2UXBL 1IL8A 1FR3A 4RMFA 3WA0A 3FC4A 2CWPA 4XDXA 2K32A 2VZKB 2IT1A 1TT2A 3J81L 4LF7L 1BO0A 1MIUA 1PV4A 2XTIA 3PMFA 3I4MG 2KDEB 4C1NI 2KN5A 1OXTA 2VB3X 4GKJQ 1UZXB 4KDIC 3W1SC 2BF8B 3BYTB 1XMQL 5EBCA 1VQIA 3B1LX 4WJWA 3KVFB 4HJAA 3S1RB 1UH6A 2OEDA 4BBNC 5J3BA 4L63B 2J42A 1EWYC 1F77A 4BBSH 1YN5A 4B9KA 1EQTA 3MXGA 1Q5WB 3RLNA 5C3EG 2A5UA 3PRZA 3STBC 3A5UA 2ALYB 4E74A 2KDFB 4W9JA 1UBIA 1WJ4A 4KN7C 3ZNZB 4NW2A 3TQYA 2NZ1D 2D3AA 2K03A 3NZSA 3DHQA 3P1HA 1KDCA 2QDBA 2BYVE 1BF4A 4L2YA 4OVVA 3H7PB 1UE6A 3HOXB 4XC2A 4HVBA 5IP7H 1QVCA 1XT9B 3I7FA 4BOSC 4L5QA 3C2PA 1HUNA 1KM7A 2AL3A 4I7ZC 3PS6A 5EKLA 2KK8A 2XRSD 5JHAA 2CHZA 1ZP0B 4W9FA 4C3IH 3HKZB 1B3AA 3NTKA 3CHBD 2B76B 1DGJA 3MZ5A 3M85A 1G2TA 3IT6B 2X6GA 3GTQH 4QL5A 3PCOB 1KOTA 3PLVA 1HQRD 1RODA 3S2DH 1IYVA 3VRBB 4BY7H 2FCSA 2WQYB 5KHQA 4CQNA 1QQRA 5C4ZA 1S5CD 1AP0A 4G50A 4IC7B 3L3OC 4DA2A 1NVID 2EJFC 3GTOH 3L13A 1FD7D 4HR7B 5LNK1 1NE3A 5CV5A 1RL2A 4QIWE 3AEVA 2Z59B 1EQRA 4RGOS 2DWQA 2W82A 3VUYA 1TQOA 3Q6BA 3Q3MC 4BY1G 5EE0A 3RN5A 3LJ3A 3RNUA 3M4PA 1SSNA 2Y3AA 1KRSA 3ENEA 4HROA 1SFOH 1STGA 3NWSA 3M63B 2F3IA 1FL0A 3T9LA 3VTWA 1N5XA 4KSLC 4ARCA 3T16A 5HGQA 1AE2A 1WF9A 4W9GA 1JMCA 1DZ1A 1PH7A 1FGBD 2MBBB 2V1CC 5KEEA 4S0RA 3DM3A 2WX0A 3F1ZA 2RVLA 5BN5A 2AX5A 3QAQA 3U30A 4LW1A 2OF1A 3VUXA 3ZTCA 2XK5A 2YEPB 1YQ4B 1GUSA 1WD1A 4ZK9B 1N60A 2CHBD 3M95A 1LT4D 4O1NA 2K39A 1KFYB 2WB1G 1RM6C 4NQLB 3OW7A 5C44H 1WCMH 2VH2A 2F0KA 2MFIA 2CU1A 1YN4A 3AI5A 3N1XC 2IW3A 1SSOA 3BZDB 3OJ3A 2DNEA 1FCCC 4HEA1 4XIGS 3PO0A 2CW0D 4XDCA 1RJTA 3KOJA 4QMGA 1Y8RC 5AJ3Q 3W1SA 2UUBQ 1AH9A 2AQ1B 5FO8B 2G5DA 4XQJA 4WWPA 4MTNA 4LFBQ 2I5LX 2LFNA 2FUG1 4OEMB 4F88A 1HNWQ 1AFPA 3DBRB 1X3EA 3TSSA 2EY2A 2O6VA 1E90A 4DBGA 3HHMA 5K36H 4ZQ3A 2QEXA 1TY0A 1BBWA 3GE3C 3RD4A 1TJEA 4NJCA 2F0NA 1B7YB 3GTPB 2ZJDA 3QHTA 2IYDB 3Q23A 2LUEA 4FNFA 3HG9A 2ASQA 1QB5D 1Y8NB 1L0XB 1P1AA 2JA7H 3A1QB 2AUJD 4HWIB 4JI0L 2BWES 4EFOA 2UXBQ 1CA5A 2L55A 1E8ZA 1WTOA 5E6NA 1L4DB 1MG4A 2LMCA 3RNAC 4OONA 3DEPA 2K0PA 3HGBA 1WI0A 2KBNA 5GADC 3K5LA 5E7NA 3Q22A 3DVNV 4TRDA 1Q82C 4LF7Q 1JOQA 4HN7A 2I5MX 4C3HB 1JW9D 4NJ6A 4IQZA 3OIQA 2JYTA 1Q90A 1IYJB 1F2YA 4FXCA 1XMQQ 1L6VA 1J7BA 4CKEA 2DGYA 1I3QB 3HM6X 3P63A 4US8A 4PS3A 2EJMA 3CCJA 1TBEA 1UWMA 1V6EA 4RNAA 4RA8A 4BBRB 1JWMD 1RRBA 4GDLA 1WM2A 4A93B 4IUUA 3ZJTA 3BK1A 4IFDG 2INCC 1RCVD 3A4SC 4JI3L 2NVUI 4IN3A 3I4NH 3E9HA 3AEFB 2V0GA 1SIFA 4HK2A 4MZ9A 3MJWA 3NP8A 3EJIA 3RN2A 2GBKA 4JCVE 2CR5A 2A5HA 2NYZD 4NQKE 3MA2B 3NK9A 4RCOA 2INNE 3UIOB 3VA7A 1D5XC 4UY8C 3W3AA 1D2BA 1M4VA 4GNXB 2YTVA 1E2WA 4DXGA 4R8IA 4XGAB 2KCTA 3A5ZB 1E24A 1XPOA 5J17A 2ZXOA 3KJOA 3CC7A 4I6LB 4UP8A 4GDKA 2UYZB 5AZHA 3MXUA 1EOTA 1ONLA 3DBHI 1K8RB 1VQNA 2JF5A 1E10A 1TWCH 4A3JG 3LB8C 3JSVB 3UGBB 2EZVA 2J0JA 3ERSX 1GKHA 3OJ4B 4AYBG 4X3SA 2C7NB 4JBKA 4O42A 3PRMB 2GVBA 3V61A 3BJUA 1ZXTA 4TV3A 2VUMG 4UP7A 2JA8G 4C4VA 2GN5A 3F2UA 4BY1H 4GLSC 4KD3A 5CV9A 2QMTA 3H0GH 4DV6L 4J8QA 2VQFQ 2CVRA 2L8JA 3AH7A 3TP7A 2LS01 5EE1A 2CFMA 2MEKA 2Z1CA 3UDIA 4YY3L 4BBSB 4X6AH 3KUDB 4HCPB 2ZT9C 4LNOA 4MJSB 3QO2A 1UNSA 4GMVA 1NI2A 5CV7A 4HCNB 5F2DA 5BR8L 4HTHA 2MBEA 4EZLA 4HJ5A 3N20C 4N8FA 1T9HA 2DJFC 1M94A 3KF6A 1H95A 5D94A 1I50H 5M3MG 3DOWA 2N9EB 2WXOA 1QOHA 2F0TA 3KLWA 2PMVA 4M1UB 1XMOL 4IW0A 4P6VF 1TGZB 4N58A 2NVXH 1JRPA 3NXWA 4G57A 2IO3B 1N62A 2KVMA 1EYCA 4J3OD 4QJFA 2SDFA 2N9XA 2N3SA 3P75A 1FFUA 5D2MB 2Y0SE 2KT7A 3L17A 3FMCA 4KSKC 1PFNA 3GTQB 2IJ0A 4JI1L 2H5XA 2NPTB 3O65B 2OJWA 1STEA 4DV4L 3S2DB 5IE8A 3NEMA 4QUCA 5JJIA 4PS8A 2I46A 1WOCA 4BY7B 3AU7A 3CSFA 2W9NA 3MC9A 3ZRCA 1K73C 4XYCA 1GPXA 4V0BA 2EVBA 4DR6L 3I72A 3DBSA 1SXTA 3GTOB 2RD0A 2HQLA 1AN8A 3R93A 1C4PA 3A9JA 3PF5A 1KLGD 3WWVA 1E2VA 5JPMC 2ZW1A 1YNND 2FCNA 1ET9A 2GVAA 2G4DB 2L5TA 4G7ZC 3WAMA 3DVGX 3NZ3A 4R9WA 2AWOA 2ZTCA 1IYUA 4B9WA 1SFOB 1ASYA 1XCQL 3I55A 4ME3A 3ZJYC 2F0VA 2ASBA 4JI0Q 2L3ZA 3A54A 2L00B 4R4QA 1O7YA 4FADA 4A3KG 4M00A 1B3QA 3CF5A 4IJLA 5H8YE 1GUOA 3BG3A 3CCSA 1K8OA 4A3GG 3T4AC 4MN3A 4N6EB 1PTOH 3TL5A 4XXEA 1Q7YC 4CDCC 3L7ZC 4PV1C 3HOUG 5K5PA 2J0MA 3FILA 3KUCB 1UF0A 2RHQB 3ZYYX 4YL8A 5FO7B 3S17H 4WRDA 2K50A 3A7AB 5KGUA 1R4NB 1VMCA 3KBGA 3ABVB 1U9RA 2L0FA 2ZCCA 4AH6A 5IODA 3M4QA 1S5FD 3ERQA 3MEHA 4JI5L 1WCMB 5C44B 4KY6A 4Z9CB 5C3XA 2JRIB 1DOLA 3AV8A 1JJCB 5CC4A 4JI3Q 2CCZA 4H44C 4MGIE 3APCA 4P75A 3EFXD 1F0ZA 1B9MA 1WMHB 1IYFA 1XLPA 2MX2A 2QSDA 3ALBA 4F87A 1DXMA 1LT3D 5IGGA 3L0OA 3G6JB 4UPAA 2ZW0A 3CQZH 5DNFA 2IGHA 2DENB 1LT5D 4MDKE 1WM3A 4DNTB 1VQFA 5IWAL 2C35B 2X6LA 4MM3B 2LGIA 1HTOA 4WJNA 1HTQA 4JW0A 3K7UC 2GBNA 1C4AA 4WWNA 5HKHA 2HIVA 4KN4C 4DV7L 1IUEA 5CV4A 3I4OA 1K3BC 5JPNC 4ICVA 1ZUD2 3S2HH 2FNJB 5I9OA 1A0IA 1A62A 4OELB 1HQMC 2C9OA 1SMYC 2JA7B 1EL0A 4A3JH 1G291 1B70B 1QNUA 2MGSA 3K58A 1JWAD 4CO7A 1SYGA 2ZEQA 1HZ9A 1PGAA 1L2FA 2R93G 1DOMA 4YCUA 3TJPA 1J6QA 2EDGA 3GTGH 2RPQA 2EQSA 1Q3LA 3T3NA 4DXAB 2KN4A 2D9UA 4DV6Q 3M9BA 1YHBA 2K1BA 5EKKA 4ZAIA 5JZEB 1U4MA 1FD6A 1YJWA 5IYCH 3HOYB 1NNXA 2PMZE 4FF3A 4YY3Q 4ZRKA 2F0IA 2WKCA 1TIID 3I4NB 3F2CA 3VAWA 3D8GA 4MACA 3K5OA 5BR8Q 1N34L 1C78A 3VDYA 1A2TA 4GOPB 3Q2AC 1YMHE 5M3MH 1V49A 3FVQA 3TEHB 3TRZA 4HJGE 1WX7A 2ZTEA 1V8QA 2RSUA 5AZGA 4CDFC 1JE4A 4LF8L 4AS1A 1Y1VG 1XMOQ 3ZXRA 3HFZB 2KC2A 1YZ6A 5DM73 4L5TA 2E2HH 5J39A 4QGUA 1C9OA 1OQRA 3ZIMA 4LUVA 2F52A 2JA5B 1ZPSA 2MQJA 3VHTC 5J1ZA 1VQ6A 4JI1Q 1L2NA 4OO1I 4PMCA 1PHJA 3RFZB 1GUTA 4DV4Q 1BCPB 4NP5A 1EQVA 2I0QA 2PE6B 1TWCB 2L1BA 4WORA 3GTMH 1VF5C 1O7IA 4DR6Q 2F0SA 3D4DA 3QG1A 1HZBA 3MFGA 3RUZA 1FVIA 2MWSB 1C0AA 1D1IA 2MCNB 2JA9A 2YTYA 2QHOA 3TMPB 3ZQ4A 4ICUA 1AEXA 4BY1B 3S16H 3NHEB 2CJNA 2LJ5A 3HKZE 5C6AA 3H0GB 4H0LC 3I56A 1TZOA 2UWQA 3P4PB 4PMWA 1EWCA 3SK5A 2D62A 4P1BC 1L7YA 4ZRZA 3HOVB 2R7ZG 2KACA 4P7IA 4A3KH 2F1MA 1AE3A 4MTKA 2KTFA 3N30A 2J0TD 4X64L 4YSXB 4Y7NH 2M0XA 1B2TA 4A3GH 5IP9G 1Q86C 1WJJA 4DXFA 2KJHB 1QJOA 4A3CG 1ILQA 2MJEA 4A8XC 3FAHA 3KLRA 3HOUH 2KD0A 1AW7A 4KY5A 1GUNA 1I50B 4H2AA 5CHFA 2G9HD 4OO1G 3VFKA 2PW5A 3FPUB 1F2RC 2K6QA 2WB1B 2NVXB 2PJHA 4JI5Q 2KJRA 3GB1A 3H8HA 1EFWA 2OJRA 2WXFA 2WXPA 5TR5A 4IALA 1H9SA 4RGTA 4K81A 3QX1A 1HR0W 3QC8B 1NBWA 2G9DA 2KUMA 1J8CA 2QGQA 2H4OA 1SNQA 3GZNI 3OAWA 1VZ8A 3FRPB 3ULPA 1PH4A 3CF6E 4DHJB 4CDEC 3AE9B 5IWAQ 4RWSC 2BB6A 3N6RA 3VTUA 4K5WA 1HA5A 4LJZC 1V43A 3L2PA 2UUCL 3BWUD 2PQAA 4DV7Q 2KKCA 4LUOA 2B2TC 2KCNA 5C5LA 1Z47A 2NBFA 3PIOA 1BBXC 1Y8PB 5JAVA 4KY7A 1WWTA 3U9SA 1HPCA 5I2YA 4H7BA 2W54A 1NMGA 1PRTB 5EBDA 5FOBB 3CKIB 3CP0A 1BXTA 4BXXG 1MI0A 2A6EC 1QUQA 1HNXL 2N1VA 2R93H 1HEZE 4XE0A 1ENFA 3BZKA 1PTOB 3WCQA 1E7ZA 2HCIA 1PDXA 1Z2MA 1F1HA 5EGTA 3SGIA 1W3SA 3N1YC 2ID0A 3ITPA 4P74A 1UEBA 3SHLA 4XYQA 3V2TA 4JI7L 3S17B 3RUIB 4IOAA 1JC7A 2LY7A 3U4VA 3E56A 1Q1EA 4PYUA 2R6GA 4DQOC 2EYOA 3AMUA 1FRRA 2XVSA 5ELEA 3A8KE 1Q8KA 5C0XG 3PLUA 1MSHA 1MI2A 3TIXA 1FM0D 4RCNA 2O2VB 1PLFA 1N34Q 1N9WA 2KWDA 2VS1A 2VQEL 3AE8B 2LHEA 3SR6A 3NQIA 4N9PA 3CQZB 2IY0B 2LXJA 1WJUA 1WZ0A 1Y1VH 2R7DA 4O2DA 2IX3A 4LF8Q 3N1ZC 2KA7A 3UE1A 2WKDA 1J19A 2MBQA 1MJEA 1DOIA 3VR6A 2I2YA 1JE5A 1SROA 2AMCB 2GLSA 3P2BA 2D11A 2HTHA 4FF4A 1BCPD 2NN6G 3A8IE 3L08A 2R61A 4K1RB 3WALA 4DAYA 1VS0A 1ASZA 3S2HB 1E7VA 1RDPD 1QWYA 2F3VA 2F0PA 2NUCA 2ZNVB 4S17A 3ER0A 1F52A 1JALA 4A3JB 2IPKD 2BKFA 1X65A 4LNFA 4EUTA 2KFKA 4G0NB 1VCIA 5DLQE 4PZ7A 1EIGA 2ZZPB 1LTTD 1E1OA 1K28A 1NI3A 3AYHB 3GTGB 1HUMA 1BNZA 1HZ6A 1BDOA 1STHA 2EYFA 5TSSA 2XN9C 3KWVA 1A5RA 3SHQA 4UP9A 4LAAA 4BA1I 3D0FA 3K57A 1WGHA 3AQQA 5IGEA 1A8VA 2FCQA 1TTNA 3HVDA 3FP9A 1LM0A 5FLMH 1J5EL 1MVKA 2LHDA 2WXQA 2BYEA 4KZCA 2ZXRA 4ZUIA 3U50C 1V97A 2CKHB 2EJGC 1M90C 4DR2L 4X64Q 3RYTA 2MJ3A 2JWUA 1RTOA 5DPTA 1PFBA 1WTXA 4EKUA 2N7EA 4KX6B 3VQIA 1G8ZD 3D4RA 4LLGM 2DZJA 2EKEC 2CQAA 4OO1H 3R3MA 4ITKA 3DBHB 3A4RA 3R7RA 1QLBB 1S5DD 2NVTB 4E71A 4J1MA 3VUWA 3OMCA 2L83A 1X3QA 2KTRA 2JXMB 2E2HB 4QUFA 1II3A 1YX5B 2WWZA 4RHSA 2KYWA 1NTGA 3MFYA 4P16A 1D7QA 3ZDMC 1X3PA 3S1NH 1MG8A 2D2CC 2JPHA 3V6CB 4AJYB 2KDIA 2B2UA 4KGRA 5DAUA 5DPRA 2AWTA 5EE9A 1EY5A 2LXAA 3V96A 3ND9A 2KC1A 2ONQA 3R3OA 1VQ4A 1J7AA 4C2MH 1ZKOA 1SIJA 2K8CA 3DDCB 1QCBD 2UUCQ 4NPSA 1K0RA 3RULA 3CCEA 1SE9A 4KLKA 5EQ0A 1UAPA 2A8VA 5HFYA 4ZYSA 3S16B 5JEAG 2MPMA 3HOZG 3WDNA 1PRTD 3UE0A 3ICEA 3PO3G 1A63A 4A3FG 2ACZB 2Z6KA 2FHTA 1LYLA 3L54A 2BDOA 5JJKA 1G91A 1PZKD 1CM9A 4A3IG 2JSVX 3V3XA 1IL2A 3OTOL 3W5OA 4BXXH 1MHHE 1Q46A 1PTOD 2BW2A 4B08A 4A3KB 2OOBB 2PW9A 1PH8A 2BPSA 1JWSD 2OQ0A 3H94A 1HNXQ 1RFAA 2RHSB 4CKBA 2HD5B 3VR4A 1YNTE 3UINB 4I6PA 4K2LA 5EJWA 3IKJA 2PCFB 1N36L 4FXDA 2A69C 4JI7Q 3AU4A 3NVYA 5D65A 3VR3A 4XQQA 4CJ0B 1BUVT 2PZWA 3AEEB 4K7WA 1EOVA 1S40A 1E5WA 3MXNA 1JJGA 3AE1B 4ZRJA 3PT2B 2RSNA 1I7HA 1PFMA 2XK5B 4IWQA 4JGHB 4P73A 4RM8A 4YTNB 3FKYA 3NBHA 1KQSA 1IBML 2F0MA 3KDFB 1OFFA 1GHJA 4ULLA 2DJGC 1EF5A 3GOEA 5KNBA 1TS4A 3VR5A 3JAME 2NVYH 1B4OA 4GLXA 1EY9A 1C8CA 3KQ4A 5M5YH 2VQEQ 2K4KA 4JI2L 3FHWA 4CKCA 2V9HA 2H89B 4ASWC 1LUZA 2LSSA 3AN1A 2F4IA 3U9OA 4FDBA 1HR0L 4A3BG 4HJ7A 3D32A 2KEEA 2Z4IA 1OQYA 3G71A 1LTRD 3UQAA 3ML8A 1WGYA 1WFYA 5IP4D 1PH6A 2RF4A 3CCUA 1VJKA 1LQBA 3WOEA 5GAHC 4LNNA 1JR0D 2O6VB 1HZ5A 1WGGA 4V190 3NRZA 4WJ4A 4ZCKA 4GB9A 5JVH3 1CJEA 1EFID 3DEOA 3KYHC 3AECB 1LO5D 4GN3B 2KANA 2HCCA 5IYBH 2WXIA 5DM63 2R93B 4WIPA 2K52A 1O78A 3ZNID 3P42A 2BS4B 4CJ1B 1CA6A 3Q3JA 2LMCB 2IHEA 2BE5C 2FMCA 5IT9E 2H88B 2VRRB 3B0AA 2IX1A 4MH0E 4C7YA 2QA4A 1E9MA 5D14A 1J5EQ 4DR1L 5ELNA 1E0ZA 4YCVA 3CMMB 3SR1A 3H09A 5H1SE 4ILWA 1Y69U 1GG3A 4AQ7A 4XQNA 2KOLA 3J7A5 1HHVA 4ME5A 3DWQA 5I4DA 4DR2Q 1SGHA 1TZ1A 4YIJA 2WNMA 3BIID 2K6DB 3QCAA 1F2RI 5EE3A 1F2MA 4GDLB 4RAUC 2LEKA 4GN1A 1TWAH 1LGRA 4ANWA 3EBEA 2GOWA 3PVLA 1HTPA 1I35A 1EO6A 2JVCA 1ZDXA 3UF8A 2CQOA 4DV0L 1ROEA 3NTHA 4PZ8A 2PLPA 2F0LA 3C0RB 4DNRB 4JBMA 4W9EA 3V6EB 3T1HL 4R4IA 1SAPA 3ZKJC 4LNQA 3K9OB 4FHJA 2B39A 4J6HA 2GA4B 2BOSA 2K8BA 4XX5A 4GDKB 3PSEB 3ZTDA 1QOAA 4IM2A 2UU9L 3NVZA 2VQFL 2L0TA 4DAMA 4II3B 5FR6A 3IFDA 3T13A 3A33B 2VW9A 1TKWB 4HDOA 1RIPA 3LXFA 4HCSA 5BMIA 1IBXB 2INDC 2A69D 3HOZH 4I65A
chains in the Genus database with same CATH topology
3TEWA 4A90A 2XIWA 3TP8A 2XWJB 4KJOA 2N9LA 3NUCA 2JP1A 1FFVA 3L4PA 3KUPA 2DY7A 1D5ZC 3LX0A 1EWHA 1A3TA 3C1FA 3AE6B 2PNRC 2WLBA 1YNJD 3PIP3 2O4XA 2IDYA 5ELBA 2CU3A 5MPOA 2JU6X 3I90A 1NUCA 3CU7A 4IFDI 3S1NB 1R7SA 3N52A 1IKLA 4CGYB 1VLBA 3QB3A 1A6XA 5LL6X 5C3JB 3TZDA 2BB5A 2EE1A 1WXQA 1ICWA 4C2MB 1FYCA 4USAA 3K5MA 3I70A 2V3NA 2A73B 1LLRD 3D6CA 1SB3C 4OHJA 2SNMA 1DYQA 1G6ZA 3PUWA 4EE2A 3MWYW 4X3TA 3AE5B 5JVG3 2M2LA 2RDFA 2EYMA 3HZXA 3P4SB 3DMUA 1QILA 1CQFA 2R3ZA 3KWLA 4YSZB 1C77A 1FO4A 5ELDA 1SDFA 4KK7A 1RYJA 4YTMB 1W6KA 2Y5PA 4LK1C 1FRDA 3FILB 4UDUC 2EY6A 4KKTA 1NENB 3NS1A 2NVYB 5M5YB 4TQ1A 2RMMA 3RLFA 3I9V1 1RTNA 1WVLA 5EPLA 3P4RB 3BVMA 4ZRPA 5AFWA 3J7YW 2WXHA 4TQUS 3SVMA 3RPFC 2L9HA 1FCLA 1MPEA 1C48A 5JEAJ 4KGSA 4PT5A 2L1AA 2QEJC 4DAPA 2KDMA 2PQEA 1E0BA 1EY0A 3C8YA 1LT6D 3EROA 1EEID 1HA6A 1VDVA 3DUZA 1VRAB 5AUIA 3ZJUA 4IDIA 1XO3A 4B0EA 1GUGA 1TS5A 4JE3B 1DJRD 1OXVA 3B2GA 2OXPA 2PKOA 3KLSX 1TWAB 2F3WA 5A2QE 4C3IB 3KBXA 2WP9B 4KGTA 5T1IA 2EXZA 3I3CA 4FF2A 5BMGA 1SJHD 4TKOB 4EQOA 3D31A 3LWEA 3BVGA 3KF8A 1SE4A 2PZTA 3ONAB 4U673 3PUVA 2EELA 3AE2B 1Q8IA 3HOZB 1Y56A 2Q8IB 1LACA 4A3FB 5CGKA 5BYRA 3NUHB 3W2DA 3QJYA 4DF7A 2JA6B 3FEWX 3HS0C 5JOBA 4A3IB 1ZXIA 3Q69A 4KTAA 3D4WA 1T5XD 1S4ZA 5D3IB 2WXMA 1CTMA 1GAQB 1JMLA 1DOYA 1Q1BA 2PVGC 2NWGA 1W6JA 3OPOA 1KF6B 4K2KA 4FXKC 4RH6A 4YWGG 4IFDH 3L9AX 4OW0A 1IW7C 3HVZA 1ACCA 2RSOA 1SE3A 2GB1A 1Z7TA 4Q0FA 4WWMA 1EEFD 3BDOA 4Q5VA 4QF4A 2O2LD 2E75C 1PZJD 3AB9A 4IKGA 1XEEA 3IFTA 1FNWA 1FIQA 1ESFA 2J7ZA 2QF7A 1H9SB 1P7EA 5E1FA 5JXVA 3BS1A 3M7NA 3WOFA 3N9YC 2O5JC 3HRZC 1TWFB 2L32A 1Z6HA 1H9MA 3I4MB 4ODGA 2IGGA 2WACA 1IHZA 1I6HB 1J8IA 5E4XA 4UAIA 3JAML 1DOXA 2LJIA 2B8GA 1VDZA 5C3EB 1CK1A 1A70A 2N7JA 4C7ZA 1EYAA 1KH0A 1ZDVA 3AEGB 3P20A 3Q8FA 2OT2A 4M0WA 1GXDC 4RKBA 3S9WA 1ZXHA 1L5PA 2N9KA 2W55A 4DN4M 1STYA 4FXGC 3NE5B 2SEBD 4P2CB 3VR2A 5EPJA 2XNAC 3E0JA 3B9JA 3UI2A 1EY4A 2SNSA 3IAYA 1LV9A 2RDGA 5JEAH 1JCKB 5IT9L 4MIUA 4G7HC 2FBWB 3Q8CA 2BDNA 2QKIC 4KI0A 5CV6A 1FMAD 2A6HC 1I4XA 1VZ6A 2NB0A 5G3LF 1DCZA 1XF5L 3MP9A 1CI3M 1MSGA 5C3WA 3UI3A 1SJED 4HSPA 1IW7D 3V05A 3MHZA 2K04A 4IFDJ 2DBYA 2XSCA 2WP8J 2TSSA 2LUMA 1EY7A 1IGDA 5C4HA 5I2XA 3R2TA 1CZWA 3BVZA 1K53A 3NHHA 2BA0A 3U2SC 1NAPA 1XXGA 5C4XB 1WYGA 1D6EC 3HRDD 1SYEA 1SMYD 3H3VC 2JYEA 4DFAA 1C79A 1V8CA 3S1QB 2IGDA 5C0XI 1I4RA 4ID6A 2AQ3B 2IWHA 3EUB2 3CIRB 4C3JG 3P1MA 2BA1A 1SYDA 3MJ5A 3D3RA 1K83B 1UGJA 2E2IB 1JQYD 3PZ8A 1D5MC 3DM1A 4XYOA 2NN6I 1SYCA 1I4PA 4TQ0A 2F0OA 2B2UC 4ARIA 5DEHA 4KMUC 1D1KA 3OSOA 4A3DB 1JROA 2K33A 1N61A 1ML0D 5M3FB 3GTJB 1Q10A 4C3HG 3VYSA 4DGZA 5KYIA 1BR9A 1SYFA 2K5DA 5ELCA 5EKIA 1TYGB 2JYOA 1O7LA 1KNAA 2DNCA 2FE8A 1K52A 2RPVA 2O5IC 2A6HD 5IGFA 2SAKA 2N0SB 1TR5A 2BT6A 1OXUA 1BOSA 2DLBA 1LTAD 2GRIA 4HKZE 2WXLA 1JB3A 3ND8A 3Q8EA 2PYKA 3K59A 2N55A 4K6LA 4AYBB 3PUZA 2MJDA 1PMRA 1WGKA 3GS2A 2VUMB 2JA8B 3DWAA 1GHKA 1GB1A 2H1EA 2ICIA 4JWSC 4R8NA 2C5CA 1PFDA 1PRTF 1KNEA 2WIIB 2M9VA 4LTUA 1AZPA 1EZ6A 5JJZA 4BA2I 2HUGA 4A9AA 4OGQC 1R9TB 1WTRA 1AWDA 5M3MB 3AE7B 1QNKA 2E74C 1NR2A 4L23A 2VXWA 2KMMA 1HFNA 3S1MB 4WQMA 1I4HA 3K0YA 4FYDA 4K5VA 5CBAE 3SXHA 1JOOA 2K3UA 4IUPA 3C1EA 3T56B 2KAJA 4HMIA 2CJOA 1CFMA 4RHRA 3IXSA 1FNUA 1B9NA 3I91A 1WRIA 1PXUA 2M0AA 3GTMB 3OWFA 2A6ED 1SYBA 5H92C 1YQ3B 4NKLA 2IL8A 1K8MA 2KJXA 5IGDA 4LK0M 1DONA 1SNCA 2FINB 1TKGA 2JZPA 1OXXK 2BCOA 4JK1C 4ZHPA 3SDZA 1WTQA 5A2QL 2WV6D 4Y7NB 4A3GB 3TP5A 3HOUB 1CZGA 3ETRA 3U52E 1L0VB 3AE4B 1V1PA 4FO2A 1MD2D 3EQLC 3KLSA 3E6ZX 4EQPA 5E6JA 1TY2A 1MHXA 4XWTA 5C0XH 4ZHOA 2RDHA 2DN8A 4BS9A 5KNDA 4CJ2C 3VR9B 1XWEA 2K28A 4F7XA 2LFIA 3P4QB 4ZKCB 3GD7A 3BDLA 3M4OB 2NN6H 1SNOA 3K7AB 2ZXPA 1PGXA 1F9SA 4IUVA 5I6WA 4NAWB 2X38A 1A3VA 3S14B 2ICEC 4E6IA 4K14A 2J52A 4XT3B 2XWBB 5K36G 5BMHA 4D2KA 4HAEA 1WTVA 1ZYRC 1Y1WB 1IGCA 2CW0C 1HTLD 1DOKA 3SK8A 2HDEA 2L11A 1CHPD 2Q8TA 3GQBA 1TKEA 4LMQD 4IURA 1JORA 4GZYC 3TZUA 5BYSA 4RF1A 1ENCA 2D5GA 1SNMA 1ET6A 1TS2A 3RZOB 4EQNA 3J80E 4KKJA 4K8IA 1WD0A 2NVQB 2K05A 4JPSA 5FR3A 1Y1VB 1YN3A 3M4YA 4G7OC 3TUOA 2GI9A 1TS3A 4KHZA 4DAVA 2K5WA 3BK2A 2K5QA 5CV8A 1SF0A 3H6MA 1KTKA 3LWUA 4KKSA 5BN4A 2F0HA 2B8FA 1OO9B 3AE3B 1UWXA 1RD9D 1VF7A 1E7PB 2I07B 4NZLB 3GP7A 3R2IA 2VB2X 3URYA 1ZOYB 2WU2B 3AMZA 1KRHA 1VZ7A 4ZOHC 3M3YB 3E9SA 4MT5A 2F0GA 4KV6A 1F2LA 3SFEB 2R7ZB 1STAA 2M56B 2MH7A 4MH8A 4N9TA 5C0XJ 3LYYA 5I9PA 1P7FA 1GJXA 3A56A 4RF0A 5D3DA 4ABNA 4L8JA 1BQQT 5G5GA 3PIO3 1EIHA 2YYZA 1O80A 4IUTA 1RWSA 4FP5D 1J9OA 5CR3A 4OZBA 1JWBD 1NSNS 4S3SA 2KCCA 2RKSA 1D4BA 1FXIA 3GO5A 3A55A 1N63A 3J7AV 2BS3B 3IAS1 2XRQD 2RA4A 2BBCA 3K6OA 1ZYRD 4ZKBB 4US9A 4A6QA 4C3JB 3NWTA 2BE5D 4B9XA 4JWUC 3W5UB 3S15B 2WAQB 2F03A 3RMHA 1B1ZA 1A15A 5BN3A 1FXAA 4X3UA 3AEAB 3AM9A 4ZLTF 1ZEQX 2JE6I 2VZKD 4MHEA 2W3SA 4OZAA 3KK7A 2EKIA 2YEPF 1A3UA 3VA5A 1HCZA 1BMLC 1YNNC 2ENBA 1G2SA 3I73A 4HMJA 4EGVA 1XYIA 2PIAA 3VRAB 1O7ZA 3E5SA 2INPE 2Q5WD 5C2TB 1HRJA 3TDQA 2EYJA 2HQEA 1I4GA 3VYRA 3VYUA 2RBMA 1PDQA 3SEBA 3ZJVA 2RQXA 3K5NA 1DM0B 5AUKA 5CBEE 4YT0B 1AZQA 2Q8RE 2B2WC 2M19A 1EU4A 3EGRA 4OIJA 5LL6S 2FJ2A 5HURA 5M5WB 1EYDA 2WS3B 1AYFA 1VR9A 3QOJA 5FLXE 3D6WA 2PPBC 3MXPA 1A2UA 2LKVA 2K5PA 4XTCS 1FEHA 1IBXA 3CWIA 1FNVA 1N5WA 4XWWA 5KYLA 2WXJA 4PMBA 2PW7A 2V4IB 4REZA 2MUYA 2TMPA 5COYA 1QKZA 1TKYA 2K9XA 3U7ZA 3Q6SA 1MGSA 3I4LA 4FF1A 1I4QA 2E2DC 5NUCA 4XDDA 2R92B 2L12A 2JQRB 4NAMA 1QOGA 2QILA 3J9CA 3MHBA 3SK4A 4QCLA 5HHDG 1KDBA 3Q8AA 2B2YC 3GV3A 2WDVB 2K22A 2F0DA 5LHY1 5G5HA 3DWMA 1V1OA 3IT4B 1F9PA 1QE6A 5E4WC 3GV6A 2WU5B 2DY8A 1CT1D 3PO3B 1ILPA 4L6TB 1RHPA 1TWHB 2F0JA 1JICA 2B2VC 1LTGD 5E3FA 3ZGZA 1MBYA 3A8JE 2EYLA 3MC0B 3DWPA 1K51A 2PTLA 2EY5A 2EY1A 2SOBA 5IOCA 1LTID 4RGMA 4RFBA 5FO9B 2A74C 4HCEA 1NYRA 4U68A 3MAQA 3TMEA 3IL8A 2PZUA 2B2WA 1XCTL 1S5BD 1XX8A 1QG7A 3X3MA 1JWUD 1HXYD 2JEAI 4FVMA 1WTPA 1M8AA 3MVVA 3TN2A 4C56C 3J81E 4A3BB 1PYWD 2F0EA 5CYUA 2PVOD 2WINB 1QF6A 4WH4A 4H13C 2F0UA 3VYTA 2L52A 3MTSA 2DYOA 4HEDA 2QCPX 3IAM1 2EYHA 2E6XA 2HTME 1I6VC 1R4PB 5M5XB 4NDXA 4DK1A 2VNUD 3CRKC 2KQ4X 4K5XA 3FDTA 2E2JB 3TEXA 2B2YA 5J22A 2L4NA 1B9RA 4TSSA 3OWEB 1S5ED 1WSPA 1ENAA 3TP6A 3T3OA 5IGCA 1E2ZA 5D7GA 1Q12A 5FKAC 1JQ4A 1L6UA 3W5VB 3T53B 1PUTA 1RFKA 3TBIB 2V3PA 1T5EA 3QIAA 3GTKB 4OL7A 1KABA 4PQXA 3HUIA 1QT9A 1B53A 3X3NA 2MHVA 2J4XA 1L4ZB 2W3RA 1H9JA 4QIWB 5IIFA 2B2VA 1LABA 1STBA 4ZUJA 3DXJC 1QOFA 4IOIE 4X3KA 4CBVA 1EU3A 1YJIA 1T6BX 1XLQA 3J80L 5GXGB 4KKIA 1SNDA 4C1NK 4TMAB 2NTTA 1BUIC 4QB4A 1LTBD 2X69A 4K8JA 1SBBB 5KRUA 3B2FA 3OHXC 4IZ8A 4YSYB 2Z4HA 1ESRA 1BCPC 2MP1A 1B44D 2MJ8A 4KKUA 2EPBA 2JXTA 3LNNA 1F2ZA 5FK9C 2K7VA 4RKLA 4EVOA 4B0MA 2OHFA 1KLUD 2J53A 3HOWB 3NVWA 1EM7A 5ISRA 2I38A 1EY8A 4JBWA 5A35A 1DD2A 2KEDA 1X32A 1PGBA 2QJLA 1K50A 2BYTA 2Z8LA 4JX1C 2F0WA 1OXSC 4OIKA 3BDCA 3TEZA 2NMQA 4YTPB 5CMDA 1BCPF 5C5MA 5T8IA 3VR8B 2A68C 3A7LA 4L1BA 4IUNA 1E6EB 1C76A 3NSWA 3Q24A 4KD4A 2HDLA 3QOLA 1RF2D 4A55A 3PZ7A 5IGBA 2KHSA 2AQ2B 5ELFA 1NCVA 5BYQA 1YJJA 2KECA 2EOTA 1U4RA 3CRLC 5G3LD 2WXNA 1JOKA 3OOCA 3FKIB 3PUYA 4A3EB 2JSOA 3M7GA 3EVQA 4OZCA 5M9OA 2D5DA 1C4CA 1B50A 2G1EA 2WXRA 1UEAB 1IKMA 1QOBA 3G7LA 1H9KA 4XT1B 1T3QA 1V1PB 3OMGA 5T1GA 3C46A 3J7AF 1TWGB 1PRTC 2ON8A 1R4QB 3I57A 1EZ8A 3NVVA 1XLOA 5C4JB 1PTOC 3RZDB 4ZRQA 3OIPA 1XLNA 3AEDB 1CHQD 4OVZA 3NBIA 4BWGB 3FPPA 1GB4A 2HDMA 5KIXA 1U4PA 1STNA 2E76C 4G4KA 2B63B 3QWNA 1NEKB 2EYPA 4DK0A 3PO2B 2IX0A 3P7JA 1F9QA 1PTOF 4HSVA 3TEYA 3DWGC 4WURA 1H9RA 4DU9A 2F0FA 2JX5A 2K6AA 2Y0SB 4IUQA 2V4DA 4F8MA 2JEBI 5HG2A 2DYMA 4WAFA 2E3TA 3H91A 1TU2B 3NPPA 2A68D 2K01A 2WDRB 1NR4A 1SNPA 2YU9B 5FLXL 4HRSA 3SFDB 1RKNA 3R8BA 5HGTA 3BYYB 3W9CB 4C3IG 2B2TA 3PV0A 3AEBB 2AWNA 4K6DA 3HP3A 5I6YA 3GTLB 2QIEB 4CHTB 4PNYA 5HI1A 4N59A 2FMMA 1HFGA 4KJNA 1OQQA 1CQVA 2M00A 3Q0AA 5CORA 4HKQA 2OEOA 1GUWA 1LTSD 3NQTA 3EA6A 2Y5CA 4R3DA 2NTSA 3C3LA 1TVXA 2L0CA 1CZPA 1J7CA 4C80A 2KQ3A 4NMZA 2BS2B 1VMPA 1NYQA 3U4EG 3HEJA 1SE2A 2WXGA 5EPKA 3NTIA 1KDAA 3O13A 5KNCA 2WDQB 4RGNA 1SEBD 4KHVA 4WFN3 2WXKA 1WTWA 1KAAA 1F9RA 1U4LA 1C9FA 2BTEA 3I8ZA 4M8AA 3T51B 3AB5A 3Q8BA 1L0YB 2F0QA 1YNJC 2N88A 2AUKA 1PZID 3SE0A 4A3MB 1EY6A 3PUXA 1XTCD 1GOZA 1Y8OB 2FFKB 2PMZB 3SK6A 1C4QA 1UUPA 2PO4A 1ZE3D 1IL8A 1FR3A 3FC4A 4XDXA 2K32A 2VZKB 2IT1A 1TT2A 3J81L 1BO0A 4H2AA 3PMFA 4C1NI 1OXTA 2VB3X 3BYTB 5EBCA 4WJWA 3S1RB 2OEDA 4L63B 2J42A 1EWYC 1F77A 1YN5A 1EQTA 3MXGA 4KN7C 4NW2A 2NZ1D 2K03A 3DHQA 3P1HA 1KDCA 2QDBA 1BF4A 4L2YA 3HOXB 3C2PA 1HUNA 4I7ZC 5EKLA 2XRSD 1ZP0B 3HKZB 1B3AA 3NTKA 3CHBD 2B76B 1DGJA 3MZ5A 3M85A 1G2TA 3IT6B 2X6GA 1HQRD 1RODA 3VRBB 1IYVA 2WQYB 4CQNA 1QQRA 5C4ZA 1S5CD 1AP0A 3L3OC 4DA2A 1NVID 2EJFC 1FD7D 4HR7B 5LNK1 5CV5A 4RGOS 2DWQA 2W82A 1TQOA 5EE0A 2Y3AA 1SSNA 4HROA 1STGA 3NWSA 1N5XA 4ARCA 3T16A 1DZ1A 1FGBD 5KEEA 5BN5A 2RVLA 2AX5A 2OF1A 2YEPB 1YQ4B 1GUSA 1WD1A 4ZK9B 1N60A 2CHBD 1LT4D 4O1NA 1KFYB 1RM6C 3OW7A 2F0KA 1YN4A 2IW3A 1SSOA 3BZDB 2DNEA 1FCCC 4HEA1 4XIGS 3PO0A 2CW0D 4XDCA 1RJTA 4QMGA 3W1SA 5FO8B 2AQ1B 4XQJA 2LFNA 2FUG1 4F88A 1AFPA 3TSSA 2EY2A 5K36H 4ZQ3A 1TY0A 3RD4A 1TJEA 4NJCA 2F0NA 3GTPB 3Q23A 4FNFA 3HG9A 1QB5D 1Y8NB 1L0XB 2AUJD 1CA5A 2L55A 1WTOA 1L4DB 2LMCA 3DEPA 2K0PA 3HGBA 3K5LA 3Q22A 4TRDA 1JOQA 1JW9D 4HN7A 4C3HB 4IQZA 3OIQA 2JYTA 1Q90A 4FXCA 1F2YA 1L6VA 1J7BA 4CKEA 3P63A 1I3QB 4US8A 2EJMA 1UWMA 4RNAA 4RA8A 4BBRB 1JWMD 4A93B 4IUUA 3ZJTA 3BK1A 4IFDG 1RCVD 4IN3A 2V0GA 3AEFB 3NP8A 3EJIA 2A5HA 2NYZD 3MA2B 3NK9A 4RCOA 2INNE 3VA7A 1D5XC 3W3AA 1D2BA 1M4VA 4R8IA 1E2WA 4DXGA 2ZXOA 3MXUA 1EOTA 1ONLA 1E10A 3LB8C 2EZVA 4X3SA 4O42A 1ZXTA 3F2UA 4GLSC 4KD3A 5CV9A 2QMTA 4J8QA 2CVRA 3AH7A 3TP7A 2LS01 5EE1A 2MEKA 2Z1CA 4BBSB 2ZT9C 3QO2A 1UNSA 5CV7A 5F2DA 4HTHA 2WXOA 1QOHA 2F0TA 2PMVA 4M1UB 4P6VF 4N58A 1JRPA 3NXWA 4G57A 1N62A 2KVMA 1EYCA 4J3OD 2SDFA 3P75A 1FFUA 3FMCA 1PFNA 3GTQB 2IJ0A 1STEA 3S2DB 4QUCA 2I46A 4BY7B 3AU7A 1GPXA 4V0BA 2EVBA 3I72A 1SXTA 3GTOB 1AN8A 3R93A 1C4PA 1KLGD 5JPMC 1E2VA 2ZW1A 1YNND 1ET9A 2L5TA 4G7ZC 3NZ3A 4R9WA 2AWOA 1IYUA 4B9WA 1SFOB 1XCQL 2F0VA 3A54A 1O7YA 5H8YE 1GUOA 3BG3A 1K8OA 4N6EB 3T4AC 4MN3A 1PTOH 4XXEA 3L7ZC 4PV1C 5K5PA 3FILA 3ZYYX 5FO7B 4WRDA 5KGUA 3A7AB 1VMCA 3KBGA 3ABVB 1U9RA 5IODA 1S5FD 3ERQA 3MEHA 5C44B 1WCMB 4KY6A 4Z9CB 5C3XA 1DOLA 3AV8A 5CC4A 4H44C 1F0ZA 3EFXD 1B9MA 1XLPA 2QSDA 4F87A 1DXMA 1LT3D 5IGGA 3G6JB 2ZW0A 5DNFA 2IGHA 1LT5D 4DNTB 2X6LA 4MM3B 2LGIA 1C4AA 4KN4C 1IUEA 5CV4A 5JPNC 1ZUD2 5I9OA 1HQMC 2C9OA 1SMYC 2JA7B 1EL0A 1G291 1QNUA 2MGSA 3K58A 1JWAD 1SYGA 1PGAA 1DOMA 2EDGA 1Q3LA 3T3NA 2KN4A 2D9UA 2K1BA 5EKKA 4ZAIA 1U4MA 1FD6A 3HOYB 4FF3A 2F0IA 2WKCA 1TIID 3I4NB 3D8GA 4MACA 3K5OA 1C78A 1A2TA 1YMHE 3FVQA 4HJGE 1V8QA 4AS1A 1JE4A 5DM73 5J39A 1OQRA 2JA5B 1ZPSA 5J1ZA 4OO1I 4PMCA 3RFZB 1GUTA 1BCPB 4NP5A 1EQVA 1TWCB 2L1BA 4WORA 1VF5C 2F0SA 3D4DA 3QG1A 3MFGA 3RUZA 1D1IA 3ZQ4A 1AEXA 4BY1B 2CJNA 5C6AA 3H0GB 4H0LC 1TZOA 3P4PB 4PMWA 1EWCA 3SK5A 2D62A 4ZRZA 3HOVB 2KACA 2F1MA 4YSXB 2J0TD 1B2TA 2MJEA 4DXFA 1QJOA 1ILQA 4A8XC 3FAHA 3KLRA 1AW7A 4KY5A 1GUNA 1I50B 2G9HD 4OO1G 2PW5A 3FPUB 1F2RC 2WB1B 2NVXB 3GB1A 3H8HA 2WXFA 2WXPA 4IALA 1H9SA 4RGTA 2G9DA 2KUMA 2H4OA 1SNQA 1VZ8A 3FRPB 3AE9B 4RWSC 2BB6A 3N6RA 4K5WA 1HA5A 4LJZC 1V43A 3BWUD 2B2TC 2KCNA 5C5LA 1Z47A 2NBFA 1BBXC 1Y8PB 5JAVA 4KY7A 1WWTA 3U9SA 1HPCA 5I2YA 4H7BA 2W54A 1PRTB 1MI0A 5EBDA 5FOBB 3CKIB 1BXTA 2A6EC 1HEZE 4XE0A 1ENFA 1PTOB 3WCQA 2HCIA 1PDXA 5EGTA 2ID0A 3ITPA 3SHLA 4XYQA 3V2TA 3S17B 1JC7A 2LY7A 3E56A 1Q1EA 2R6GA 4DQOC 2EYOA 3AMUA 1FRRA 2XVSA 5ELEA 3A8KE 5C0XG 1MSHA 1MI2A 1FM0D 4RCNA 1PLFA 2KWDA 3AE8B 2LHEA 3SR6A 3NQIA 4N9PA 3CQZB 2IX3A 2KA7A 2WKDA 1DOIA 2I2YA 3VR6A 4FF4A 1BCPD 2NN6G 3A8IE 2R61A 4DAYA 3S2HB 1RDPD 1QWYA 2F3VA 2F0PA 2NUCA 1JALA 4A3JB 2IPKD 1VCIA 1EIGA 1LTTD 1NI3A 3GTGB 1HUMA 1BNZA 1HZ6A 1BDOA 1STHA 2EYFA 5TSSA 2XN9C 3KWVA 3K57A 4LAAA 4BA1I 5IGEA 3HVDA 1MVKA 2LHDA 2WXQA 2ZXRA 4ZUIA 1V97A 2EJGC 2MJ3A 2JWUA 1RTOA 1PFBA 1WTXA 4KX6B 3VQIA 1G8ZD 3D4RA 4LLGM 2CQAA 4OO1H 4ITKA 1QLBB 1S5DD 2NVTB 4J1MA 3OMCA 2L83A 1X3QA 2JXMB 2E2HB 4QUFA 1II3A 4P16A 4RHSA 3MFYA 1X3PA 2D2CC 4KGRA 2B2UA 5DAUA 5EE9A 1EY5A 3V96A 3ND9A 2ONQA 4YXDB 3R3OA 1J7AA 1ZKOA 1SIJA 1QCBD 5EQ0A 1UAPA 5HFYA 4ZYSA 3S16B 5JEAG 2MPMA 3WDNA 1PRTD 2ACZB 2FHTA 2BDOA 1G91A 1PZKD 1CM9A 2JSVX 3V3XA 1MHHE 1PTOD 2BW2A 4B08A 4A3KB 2PW9A 1JWSD 3H94A 4CKBA 3VR4A 1YNTE 4K2LA 5EJWA 3IKJA 2PCFB 4FXDA 2A69C 3NVYA 5D65A 3VR3A 4XQQA 4CJ0B 1BUVT 2PZWA 3AEEB 3MXNA 3AE1B 2RSNA 1I7HA 1PFMA 4YTNB 3NBHA 2F0MA 1OFFA 1GHJA 4ULLA 5KNBA 1TS4A 3VR5A 3JAME 1C8CA 1B4OA 1EY9A 3KQ4A 4CKCA 2H89B 3AN1A 2F4IA 3U9OA 2KEEA 2Z4IA 1LTRD 1VJKA 3WOEA 1JR0D 1HZ5A 4V190 3NRZA