1SEBD

Complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
234
structure length
206
Chain Sequence
b'SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKTCMYGGVTEHDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Three-dimensional structure of a human class II histocompatibility molecule complexed with superantigen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc ii/peptide/toxin)
total genus 43
structure length 206
sequence length 234
chains with identical sequence H
ec nomenclature
pdb deposition date 1995-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sebD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sebD02
1M4VA 5ELBA 2RDGA 4DXGA 1YN3A 4RH6A 3BVMA 3BYYB 1G8ZD 4RFBA 4DXFA 3EA6A 4RGTA 1S5ED 1PRTF 1JWUD 2QILA 1PRTB 1LT3D 3EFXD 1ET9A 1EFID 5D3DA 1PYWD 3BZDB 1CT1D 5I4DA 1LTSD 1PZJD 1TS5A 5FK9C 1PZKD 1PTOB 4NZLB 1F77A 1SE4A 1LTID 2AQ3B 3SEBA 1HTLD 3MC0B 1YN4A 1RCVD 1SJED 1EEFD 5ELCA 5ELDA 1UUPA 1FNWA 1GOZA 4RGOS 2AQ2B 1I4RA 4ZYSA 1YN5A 1D5ZC 1BXTA 3GP7A 3BVZA 1STEA 2XRSD 1EWCA 1V1OA 4C56C 1AN8A 3DWAA 1HQRD 4OHJA 4Z9CB 1JR0D 3TSSA 1I4XA 2O2LD 1DYQA 1BCPD 1SXTA 3V05A 1LTTD 2WV6D 3BVGA 1D6EC 2XN9C 1CHPD 1LTGD 4RGNA 3W2DA 1AW7A 1UNSA 1KLUD 1LLRD 1EU3A 1SBBB 3CHBD 1MD2D 1EU4A 1SEBD 1L0XB 1B1ZA 1KLGD 2NTSA 1I4GA 2Z8LA 1CK1A 1BCPC 1PZID 1D5MC 1TS3A 1PRTD 1L0YB 2XRQD 1RD9D 3KLSX 4BWGB 1S5BD 1CQVA 1LTBD 1FNUA 1S5FD 2ICIA 3DWPA 2G9HD 2IJ0A 1LTAD 1FD7D 1BCPF 5ELFA 3R2TA 1PTOD 1LT6D 1S5CD 4RHRA 3O13A 1CHQD 4RCOA 1TS2A 2XNAC 4RHSA 3MFGA 1LT5D 1JWMD 1QILA 1I4QA 1JCKB 1PRTC 3URYA 1SJHD 1V1PB 2TSSA 4K6LA 2NTTA 5ELEA 2IPKD 1XTCD 2J4XA 1FNVA 1JQYD 3DWQA 1DJRD 1SE2A 1LO5D 1I4HA 1TS4A 1PTOC 1HXYD 1D5XC 3R8BA 1PTOH 4RGMA 4UDUC 5D3IB 1T5XD 3BYTB 2R61A 1B44D 1ET6A 2SEBD 2QEJC 1FGBD 1LT4D 4L63B 2AQ1B 2CHBD 3OWEB 3R2IA 1S5DD 1BCPB 1ENFA 1PTOF 1EEID 2RDHA 1TY0A 1JWSD 1HA5A 5FKAC 1XXGA 1I4PA 1RDPD 4O1NA 1TY2A 1V1PA 4TSSA 1SE3A 1LTRD 5TSSA 4L6TB 1RF2D 1ESFA 1KTKA
chains in the Genus database with same CATH superfamily
2DGYA 1C7YA 1G91A 2OWOA 1Y56A 1ONLA 2B2YC 3AFPA 1PFSA 3J80c 4C7ZA 4IUUA 3M85A 4XQNA 3ZGZA 1EQTA 4P1CC 3HKSA 2VNUD 3D8GA 3I2ZA 4PQXA 3U9SA 1WX9A 1WXVA 3I4NB 2V3NA 2W82A 3CQZH 2RCFA 1NEKB 4HIDA 2PLPA 2CQOA 4OO1G 1WZ0A 3DHHC 4P16A 3VA7A 2BYTA 1JICA 3OSOA 1K8GA 1PUTA 5BYRA 1NE3A 4CGYB 4US9A 3C19A 1EWHA 2F0NA 2EZVA 5D6JB 4ASWC 1V43A 3JAME 1JMCA 1RCVD 2KEDA 3VYRA 1C78A 2WXRA 3P75A 3NG0A 2MCNB 1Q12A 5C3EH 4BBRB 3LB8C 1IBLL 1ZDVA 2AX5A 3AV8A 2E2JB 3JAML 3I3TB 4FXDA 2Z0EB 4IUQA 1V8CA 2BDOA 3A54A 4G7HC 1WRIA 2IO0B 3QQ8B 1AN8A 1HNZQ 3Q8EA 4A4IA 4WWPA 4LF5Q 3MEFA 4UP8A 2EJFC 4HR7B 3PF4A 2WXFA 1CZPA 3H15A 4JYAQ 1HNWQ 4LNNA 4OWTB 2IGHA 3PUZA 1Y1VH 1ZXTA 4CKEA 5LHY1 1PH9A 4BA2I 2KD0A 5EE9A 2O5IC 3PO2B 1F2YA 2KECA 5KIXA 1WD0A 1GHKA 1VMCA 5C4XH 1RJTA 2F0IA 2WS3B 4FVMA 2FHTA 4I65A 5GADC 1STGA 5G55A 3H91A 1OXTA 4QIWE 1T0YA 2KC2A 5C2TB 3UDFA 2JZPA 3QR8A 3KUDB 2E2DC 5LMNW 3FKIG 3HOVG 1WX8A 1J6QA 2QDFA 2ZNVC 1F9PA 1V6EA 5I6YA 3CMMB 3DHGC 4KZ0A 1IP9A 5JJZA 2G9HD 1N6ZA 1PGAA 3O65B 4UAIA 2JZ3B 4XQJA 4DR3L 3R2TA 3RN9C 4GN5A 3WOFA 1E7UA 4RHRA 4P71A 4M0WA 2SOBA 4DR1L 2OJRA 4ZOHC 4JV5Q 3V2TA 1SN8A 1K50A 4RKBA 2LUEA 1UGJA 2REXA 2V3SA 2VH1A 3RNFC 3NJTA 4DK0A 1V1PB 1TVXA 2HD3A 4BXXG 3JSVA 4HJKA 4XDXA 3CC4A 3MC8A 4XDCA 2XGTA 3QB3A 1VQLA 2WYQA 1ZW7A 3K9PB 3RT3B 3ZW3A 1GNUA 4FA6A 4GN1A 2D3AA 4A3JB 3MP9A 4KDLB 4GSWA 1IYUA 1H8CA 4RGMA 1AP0A 2MWSB 2SEBD 2JA6B 3H7PA 1ISNA 1P16A 3APCA 4U673 3V60A 3ZNID 5EAYA 1LGRA 2VH2A 1PTOF 2KHSA 2K4KA 3HKZE 4C1NI 2EOTA 4IJHA 3NVVA 3TP5A 1IBMQ 1HNXL 3C3LA 2B2YA 4O2DA 3S2AA 4NY0A 4BOSC 2KMCA 3JAMi 3FILA 3ND9A 3QOLA 4XTCS 4HK2A 3DVGX 1E7ZA 1HH2P 4DXGA 4MDKE 1C3TA 3HG9A 1OEYJ 3NOBA 2IZVB 1VQ6A 4RGTA 3J81L 1KD1C 4LTUA 3KUPA 1PRTB 1PDXA 2D5DA 2F0LA 5EQ0A 1IBKQ 2RGFA 4PK1A 2K32A 4C3HH 3STBD 3PV1A 2NN6G 1PYWD 5I4DA 1JMLA 2EKIA 4G50A 3S1MH 2G3QB 1UE1A 2YTXA 3CQZB 3WCQA 4R1JA 2ZJRA 1N5XA 1C79A 4GN4B 3L16A 1HNXQ 1WFQA 4WFN3 1E8WA 3QX1A 1GG3A 1Q8KA 4PZ7A 1VQIA 2CWAA 1BR9A 4KN7C 4JWSC 2M17A 4EX5A 4LJZC 1HEZE 5JHAA 2ASQA 1AZPA 2J52A 3QHTA 3NELA 1E6EB 3MXUA 1QWYA 2B63H 3H1UA 4MSQB 3TCAA 4YWLA 2Z4HA 4TQUS 3Q22A 1L2FA 1BQQT 3V05A 1SYFA 5JEAH 1XO3A 4GOPC 2KWCA 2I1KA 1D6EC 1W3SA 3DBSA 2GN5A 4JI8Q 5KEEA 3FPPA 4WRDA 4RGNA 5BR8L 4IFDH 1C48A 3TBLD 1HFGA 2WB1E 2WAQE 2CWPA 3EGRA 1Y8PB 1MD2D 5M3MH 4XX5A 1HUNA 1EU4A 3FHWA 4YWMA 2JA5G 1CKMA 5IGDA 2KHWB 1U5KA 1S4ZA 4DGZA 3SK5A 4IN3A 1FEHA 2L0FA 2JJQA 4BY7H 5C4JB 5EDSA 3VVWB 2MX2A 1Y1VB 4B9KA 1P9DU 3E3XA 4LFBQ 5KNBA 3EFCA 4IM3A 3I3CA 4A3LH 2Q2TA 2RSOA 1IPGA 2G1EA 4NB3A 2HJ8A 4RAUC 1QOBA 4MN3A 2N8NA 2QC8A 2VW9A 3VYTA 4DV2Q 3VR5A 2BWFA 2MUYA 5J39A 3RPFC 1E8ZA 1TYGB 4M01A 3A9JA 3VR9B 4NXML 1SMXA 4NW2A 2F4VL 4HIKA 4BBSG 1Z47A 5L37A 4A8XC 1YJNA 4MTKA 3P2BA 1K28A 4DUYL 3OOCA 1K53A 1I35A 4C4VA 4KN4C 3CU7A 2Q8TA 4ARCA 3S16H 1SE2A 5GAEC 4BY1B 3NZUA 1LTLA 1ZYRC 2VB3X 3S2DH 2KDMA 2KJXA 4W9CA 2A73B 2LKVA 1T5XD 3LGJA 2D9UA 3CCSA 3OIPA 4WAAA 3AU5A 1R9TB 2MSED 3KUZA 4L63B 1R4MB 3ER0A 1CKOA 4X3SA 5I9OA 4HKQA 2YTYA 2DZJA 1WI0A 3MHSD 2AUKA 3DM3A 5GAHC 1XLQA 3PHWB 3IXSA 1RFKA 2WAQB 3ICEA 1TY0A 3RUZA 1ENAA 4A3IH 4HDOA 4ITKA 1A2UA 3NZ3A 2DZIA 5LXHA 2WU5B 4EZKA 1XPUA 1ZUD2 1E22A 1KC8C 2L32A 2FBWB 3RD2A 1PH7A 1NJIC 3I4MG 3ZJVA 2EYJA 2ZM6Q 4OIJA 2UU9Q 2F4VQ 3C46A 4L6TB 1UELA 2QJLA 5IYCG 3HVZA 3QA8A 2WDTB 3PRZA 4HCPB 1F9QA 5ELBA 3KH0A 3A4SC 2ZTEA 3RNEC 4HAEA 3SXHA 2EYMA 3B6YA 2LUMA 2KJ6A 4DV3L 1CM9A 1K3RA 4B3ML 2E3TA 1B8AA 4DA2A 2H4OA 3TBIB 1CJEA 3HVDA 4M1UB 3H0GG 3M4PA 2WKDA 1II3A 1F77A 1RAXA 2HIVA 1KNEA 2K22A 5IT9E 4HDQA 3VTWA 4C3HB 1DGJA 3DBHI 2MQJA 5IY0A 3HOYH 1C77A 2GBKA 1BXTA 4GDLB 1A63A 2V1CC 1EY8A 3IL8A 4GOPA 3Q3FA 3OTOL 2IO1B 2ON8A 3T1HL 4DR6Q 1YHQA 1NBFC 5CX3A 4AJYB 2V4IB 3GTQH 4F8CB 1UE5A 2K8CA 4JI4L 2BCOA 1VQNA 2PW9A 4WIPA 1EWYC 2MBEA 5K5PA 3MZ5A 3H7PB 2KOXA 1GJZA 3VR8B 2LHEA 3HHMA 1AEXA 4YIJA 4A3MH 3EN2A 2JY6A 2PVGC 5CV4A 3QIAA 4YXDB 3VDYA 4FF2A 4B6WA 2B63B 3M4YA 5IOIA 4DHJD 4RMAA 4F8MA 2LXAA 1S3OA 1Y14B 2FJ2A 3RN2A 2KQ7A 3FILB 1OQYA 2JP1A 3LDZE 4OZAA 1L0WA 2LMCA 1BCPC 1YVCA 1FFVA 3Q3JA 2OCEA 1G2SA 3GTKB 1GHJA 5AZFA 5M3MB 2B39A 3SDZA 1X3QA 4GNXC 3EBEA 4ALPA 3J7AV 2GBRA 2A74C 2BA0A 2ZTCA 3L2PA 1X9NA 1FNUA 4ULLA 3GTLH 3DWPA 2IJ0A 1YNND 5C6AA 4X64L 2L15A 1EY5A 1QVGA 2WXHA 3H94A 2Y0SG 5M9OA 1CUKA 1LUZA 1K0SA 1GC6A 1XCQL 3AEAB 1X6OA 1D3ZA 2RPVA 2A69D 2VL6A 2H89B 4ZUJA 4B3TL 4MGIE 5G2NA 5JAVA 2E76C 4WQMA 5C4ZA 4X62L 1D4BA 5ELEA 4IG7B 4LUVA 2BH8A 2A6EC 4AYBG 2IX0A 4HJ7A 1TWFB 4I7ZC 4PMBA 4XIGS 3DWQA 3HOZG 1R4NI 1ZE3D 1TIFA 3GTOH 5K36H 2I2YA 1W6JA 2LASA 3TEYA 4K14A 3BYTB 3NY5A 4IM2A 3DWGC 2DJFC 1KL9A 4LF6L 1LT4D 2KLCA 2OEDA 5M3FH 5KGUA 1EYGA 1M94A 2PKOA 3S2DB 5M5WH 1P7EA 2JRHA 3G6JB 2N88A 2N4FA 3CC7A 4H44C 5E4XA 3OW2A 2AMCB 2N9KA 5BMGA 3I4NG 1PH2A 1FCCC 2BE5C 4O1NA 1BO0A 2UU7A 3J81c 2IHEA 4N9PA 4XYQA 4G57A 5E7NA 3TS0A 2K28A 3EFUA 2IGDA 3ZLZA 5IOCA 2JF5A 2ZW1A 2FCSA 3I56A 5L95C 1XMOQ 4RFBA 3A7LA 2NYZD 3WDNA 2BW2A 1WXAA 1HUMA 3D4DA 2K7VA 1VDVA 4K3BA 4M8AA 4BBRG 3MXGA 2X8XX 1WSPA 2IWHA 1AZQA 1RIPA 2KLGA 4A75A 1QVCA 5D3DA 1GUGA 2JU6X 3S1NB 1CT1D 4B95A 2INNE 3TN2A 5JVH3 3IFDA 3A8KE 4JC0A 1EWIA 3K5OA 2QEXA 1M1KC 1CSQA 4EKUA 3FDTA 1XNQL 1J9OA 1E0BA 4FP5D 1OQRA 2KZRA 3SGIA 5ELDA 2VY3A 5A2QE 1NYRA 2BKRB 1J8CA 1PFNA 1FNWA 1X3FA 4KK7A 2BB5A 4EZLA 3AXCA 1QUQA 4KKTA 5AJ3L 2GMIC 1AYFA 4IUVA 2GBJA 3MAQA 4KD3A 3PO2G 5DM73 2KMMA 3I63C 3TMPB 4JPBW 5FOBB 1JB7A 1N63A 3RMKC 3HOYB 4EE2A 2E5LQ 2KMAA 2AUJD 3E56A 1SXTA 4ID6A 4W9HA 4A90A 4LFAQ 4H7BA 3C0RB 4DV5Q 2WV6D 3BVGA 2B2WC 3L0OA 1YJJA 5E1FA 3R7RA 3GTQB 4UP9A 3AE6B 3T3OA 1UE6A 2F0TA 3GDEA 1OGWA 3IHPC 4A3GB 1B3AA 1DOKA 1F1HA 3G7LA 1KLGD 1WIAA 4WURA 1DCZA 1U4MA 4MM3B 5CV6A 3CF6E 1QNUA 2E2HH 1HQMC 1CA5A 3BY4B 2A6HC 1B70B 1F2LA 3SR1A 5HHDG 2KANA 2UUCQ 1N32Q 1SF0A 5IP9H 5AJ3Q 3K7AH 2KYWA 2FFKB 2OQ0A 4YSYB 2FIDA 1HTOA 3DPDA 2PI2A 2Y5CA 5MPOA 1HZ9A 4OIKA 1A3VA 2XK5B 4KV2A 4MNOA 4A3JG 4KHVA 4RCOA 2K1BA 1XLOA 4WWOA 3UDIA 4DNIA 2JA6G 4GLAC 1VQGA 2EYFA 2K8BA 5C0XJ 1UBQA 3B2FA 1QJOA 4ZHOA 1WGKA 3AE1B 4GU2A 1MHXA 1ENCA 3AU4A 4GOPB 4NJ7A 2BH2A 4L1BA 1V81A 2B2TC 2FUG1 4YTNB 3HOXH 2WHIA 2EKEC 2HUGA 2R61A 2CJNA 1B7YB 1H95A 4LF9Q 3AEGB 4NAWA 3UDGA 2F0GA 1ZKHA 4LNFA 3V6CB 4FYDA 1I6VC 4A3EH 1IBXB 2F3IA 2RDHA 1WMHA 1HHVA 2CHXA 2K8HA 1SAPA 5F2DA 3GTGH 5M3FB 3S17H 2R6GA 4A3FH 1W2BA 3UI3A 5J18A 5JHBA 4QF4A 1WR6E 1T5EA 4LDTD 2FUHB 5AZGA 2JA9A 3PIPA 4ZKBB 5TSSA 1E5WA 3DOWA 4H02A 3VR4A 1SMYD 3VHTC 2A68D 5C0XG 2A8VA 3T8MA 3I4OA 3BWUD 4ACFA 1YNTE 2HQEA 2DX5B 3FKYA 1HZ6A 2VQEL 4NDXA 4DBGA 1Y1WB 1N9WA 3S14H 3TIXA 3L4PA 1EZ6A 4HSPA 2F1MA 3J80i 3RZFA 2EMTA 1OXUA 4Q2JA 5EE1A 1E90A 1PQSA 4DQOC 4WJOA 3SU8X 4C2MH 1S3SG 1J0GA 3MC0B 1C76A 1QE6A 1YN4A 3PF5A 3PHXB 5ELCA 3PUXA 2DY8A 2R7FA 4DV6L 2CKHB 3KBXA 4GN3B 1J7CA 3ECIA 3SHLA 3HKZG 4LW1A 4URKA 4GS3A 1WZ3A 2NMQA 1JC7A 2B2WA 4R9WA 4PZ8A 1DM0B 4GLVB 4C1NK 2AYOB 2GI9A 3I5JC 1FFUA 2BYEA 5CHFA 4OWXB 1E3PA 1DYQA 2JE6I 1J19A 3CW2C 2KQ4X 1Y1VG 4ZRPA 4FF3A 4F1SA 4JI2Q 2VZAA 1UH6A 3RUIB 4EQOA 2PMVA 4M8NA 3AE5B 2CKZB 1JJCB 4RM8A 3OMCA 5E6PA 3DWMA 2W3RA 2MPMA 3NUCA 1N33Q 1ASYA 1DOIA 2LGIA 4A93H 3TEWA 1TWHB 2SNSA 3A5ZB 1J7BA 2N0SB 1NBWA 1I50H 1I3QH 4X66L 3GTJH 1WVLA 2I5MX 4KV6A 4XQQA 4DV6Q 2NVQH 1KJTA 1WJUA 1TS3A 1RKNA 4U68A 2Y0SE 1VZ7A 3EHVA 5CYUA 4IOIE 1SIJA 4AS1A 1IYJB 1S5FD 1VS0A 4OZCA 5M5XH 2E2HB 2VZKB 2INDC 2LXCA 4F7XA 4BY1G 3H3VI 2KNBA 4KHPL 2AEHA 2MLBA 2N3SA 4AYBE 4GZYC 3ZDTA 2NUCA 2VQFL 4M02A 4XXEA 1FL0A 2DY7A 2B2TA 4XWTA 1QILA 1I4QA 2PCFB 5E4WC 3TEXA 3CD6A 2EPBA 1VCIA 2NTTA 3ULLA 1VQKA 1WTOA 4IUMB 1SYEA 3AN1A 2YYZA 3P4SB 1TS4A 4DXAB 3Q14C 2WAQG 3PQIA 5JXVA 4PG3A 2JA8B 2MP2A 4L5RC 4GDKA 3TZUA 5LMNQ 1Q7YC 2W9NA 3HM6X 3PIP3 3MTNB 3WA0A 3DEOA 1GAQB 2X38A 4DUZL 1PGBA 3AEBB 3AH7A 3BJUA 3APFA 3MEHA 4C3JH 4TKNA 2JVCA 1BCPB 2ZPYA 1UAPA 1E24A 1TWAH 2KJRA 4A76A 4JBMA 1EIFA 1SLJA 3M95A 4GLSC 1K3BC 4OO1I 2KUMA 2OHFA 1X1MA 4GNXB 4S17A 3N1YC 2VB2X 4XYOA 1TY2A 4ME5A 4IWOA 3ZJUA 1R4QB 3RZOB 1V9JA 1V49A 2M1MA 4IM0A 2Z9HA 4K5WA 4JI6L 4HCNB 4JBWA 2E74C 4EQPA 2F0DA 3T56B 3UQAA 4POGA 2PW5A 2NVYB 4DNTB 3J7A5 3GTGB 2UXDL 3S17B 1YNJC 2LJIA 4C3HG 4GLXA 2F4IA 5LLIA 2HT1A 1K52A 1NTGA 4FO2A 4JI7L 1X3GA 4KKIA 1ET9A 1YHBA 1Q5WB 4K0KQ 1HTQA 4FJYA 1SYGA 3DVNU 2IX3A 3K57A 2N9PC 3DHIC 2LSSA 3VXWA 2K6DB 1EQVA 1VQ7A 4A3DG 1LTID 1VQBA 3CMAA 1XMQQ 1TR5A 4IOAA 2WXIA 4A3OA 1R4PB 2DNCA 1S72A 1TBEA 2RVLA 1DD2A 1CFMA 2RDBC 3MHBA 4FDBA 1X55A 2WDVB 5G5GA 3ULPA 5IYDH 4TQ0A 3PSEB 4C2MB 3QJYA 1M8AA 1Y8NB 2B63G 4CQNA 1WYWB 5GMVA 3UIOB 4MZ9A 3H3VC 1WX7A 2WLBA 1GUNA 1XF5L 3CCEA 1B2TA 4NAWB 3PUVA 2O2LD 2R2OA 1A2TA 4DWFA 2K5DA 3QC8B 4G11A 4JI7Q 5M3MG 2PVOD 1LTGD 1WMHB 1HZAA 1V5TA 2QMTA 4K1RB 1EU3A 1SBBB 1T6BX 2YVCA 1DOXA 2PNRC 5IWAQ 1SEBD 1F2RI 1UWXA 2YV5A 5JH5C 1E0ZA 2IY1B 1XTDA 3Q24A 3M3YH 4A3LG 2AWTA 4DV1Q 1TU2B 1G51A 3QIJA 4AQYL 1SIFA 1TGZB 4LF4Q 4HJ8A 4FN2A 1B3QA 5I2YA 2EYHA 2VXWA 4WWMA 4C3IG 2F0WA 1K73C 1VQ8A 2PQAA 3IKJA 3RNUA 3IVFA 1NI3A 3DCGA 3ZNZB 2O5JC 3GTJB 3H6NA 3P1MA 2JA7B 5DEHA 2V4DA 1S5CD 2O6VB 3D4RA 1CHQD 4PS3A 1TS2A 1JRUA 2AL6A 2YU9H 5CV9A 5M5XB 1BBWA 2LVQA 3N30A 1GVPA 5A35A 4RKLA 1QG7A 1SJHD 4CDCC 2WKCA 1NR4A 3ZQ4A 5HKHA 5AZHA 1LXDA 3CF5A 3H6MA 4JQWC 3OG5A 2A1AA 5J1ZA 1VQMA 3ZNHB 2GRIA 4ICVA 4AH6A 1SGHA 2XEWA 4ICUA 1IBLQ 1GB1A 5IGCA 3HOUB 1U4AA 2KK8A 1KFYB 5ELNA 4K5VA 4ME3A 1AH9A 3I57A 1FGBD 3GV3A 1GD7A 3T9LA 1VQDA 1WJJA 3D0FA 4KIKA 4WAFA 5ISRA 2NB0A 2ZJQA 4AOFA 4CDFC 3VAWA 4FULA 3AEEB 1QZEA 2WFWA 4P2CB 5HGQA 2BT6A 3HK0A 3AQQA 4ZRJA 3EECA 3E9SA 1JWAD 1XLNA 5FR6A 3S2HH 2MEKA 3M7NA 5J17A 4PMWA 3NZSA 2CCZA 2Y5BB 3RNBC 1SE3A 3V61A 1VQEA 3R3OA 2ACZB 1L2NA 3NHEB 4X6AH 3PREA 1RF2D 1TWAB 4BVUC 4LNQA 1M4VA 4W9IA 5IKCM 1WTHA 3I4LA 2DYOA 1GC7A 2PYKA 2R92B 2IW3A 2NBVB 2YEPB 4NAMA 1NUCA 4ANVA 3L17A 2IYDB 3HIZA 2WNMA 4PYZA 3E9HA 4UHVA 4IO9A 3FP9A 2X6GA 1KRTA 5CBAE 2O4XA 5T1GA 2R7DA 2QKIC 4N8FA 3VTUA 3H09A 3F2BA 4DR3Q 1PVOA 3HOYG 1JB3A 1HTLD 1K8MA 3B2GA 4MJSA 3TUOA 3X23A 2L4NA 1NR2A 4S3SA 4DR1Q 3CCLA 1SSNA 3VYSA 2MO1A 4KKSA 2LHDA 1D5ZC 1UWVA 2J0TD 3N1XC 1ZPSA 3J81E 4JCVE 2HCIA 4C56C 1EYCA 1TXYA 2MP2B 5EKIA 3TQYA 2HDLA 2J0KA 3CXCA 4A3GG 1FIQA 2INPE 3HFZB 3EC8A 2M2LA 1EUJA 3ZNGC 1E10A 1IXRA 3TSSA 1EZ8A 1ZP0B 2KDIA 5DPRA 5L83A 2K5HA 4RG1A 4TRDA 1VQ4A 1J7AA 4Q0FA 2C9OA 2EDGA 4CJ0B 2RSUA 1WOCA 3AU7A 4YHHL 3IT6B 4BFRA 2MQHA 2I0QA 2IL8A 4JPSA 3AE8B 3U52E 3U4EG 4ZUIA 1EIGA 2X6LA 1PXUA 4K8IA 3CC2A 1VZ6A 3ZRFA 3Q3OC 5KYIA 2NWGA 2K6QA 3FEWX 1TZ1A 1CKNA 1BUIC 5FLMH 4JK1C 2B76B 2KFKA 5C3EB 1I6HH 2KJHB 3H3VH 3M3YB 4JI3L 2K04A 1BCPF 2OOBB 1O7LA 1PTOD 3LWEA 3RMHA 3VRBB 2NBUA 5DAUA 5DPTA 1G6ZA 1L6UA 2KX3A 3PT2B 4QGUA 2XBBC 3KF6B 2ZXPA 1GUWA 3B0AA 2GVBA 2BA1A 4CHKA 3NQIA 2QA4A 1JE4A 3NSWA 3Q6SA 4LF8L 4K8JA 3T53B 1FJGL 3LJ3A 5JJKA 2ZZPB 4A3CG 1O7YA 2LVOA 1R7SA 3HM3A 2YU9B 1L4ZB 5C5MA 1LO5D 1XX8A 3DHQA 5IP7G 1WJNA 3J9CA 3AULA 3A5UA 2Y5PA 1AE2A 3CCQA 5M3FG 5HG2A 4UDUC 1MFWA 2EXDA 4KI0A 4X3UA 5C4XB 4A20A 1ZEQX 3CMEA 4YTMB 1WGGA 4QUCA 4DV7L 1WD1A 3S1RH 1IW7D 3Q8AA 4J6IA 2RF4A 3PSIA 2M4NA 1ENFA 2CFMA 2Q2IA 4OO1H 1ILPA 1K9MC 1YQBA 2ATWA 2LVPA 3ZJTA 4DN4M 2N7EA 5KRUA 4V190 2D3CA 2PZTA 1Y1WG 3Q2AC 1RDPD 2J7QB 2A19A 5BR8Q 3PZ8A 4AP4C 3D31A 3SK8A 1ICWA 3VUYA 3M3JA 1KTKA 3ZJYC 1KDAA 4RH6A 2OTJA 2L3ZA 4FHJA 2BTEA 3J81i 2QIEB 1P8LA 2PQAB 2V1YA 1PA6A 3LNNA 4V0BA 2CU1A 2JN4A 3DM1A 4FXKC 5G3LF 1HRJA 3GV6A 2I5HA 5KNCA 3MHZA 4FHKA 1SNPA 4OEMB 3OIQA 4H13C 3K7UC 2KT7A 4JI1L 4K3CA 2PZWA 2RA4A 5IYBG 2VS1A 4NZLB 1SE4A 2JWZA 2E75C 3U50C 4W9KA 1HZ5A 4LJPB 3M4QA 4N9TA 1NMFA 1TKEA 4DDID 2KACA 4NXMQ 1GM5A 3CCVA 1VJKA 4NQLB 3U30A 3GP7A 2GBNA 3STBC 1Q82C 3P7JA 1KAAA 4YCWA 4DUYQ 4FNFA 5KHQA 3DWAA 4Z9CB 1V1QA 1VF5C 4II3B 4IW0A 1HR0L 3HOVH 3V96A 2KDEB 2WXMA 5HI1A 2Q8IB 1QLBB 4KIKB 3RNAC 1D8LA 1KDBA 4NPSA 2C9WB 1JW9D 1HE8A 4KY5A 3KYHC 1A5RA 3V6EB 4NMZA 3W9CB 1CHPD 4QY7A 4AIMA 3X3NA 2FE8A 3QWZB 4M0WB 1KLUD 4NNJB 2AWOA 4A55A 1WE6A 2DYBA 3EUB2 3HOWH 1YJIA 2G4DB 2B2VA 2NPTA 4HJ9A 1QOAA 3TEZA 4LK0M 1QNKA 3PRMB 4PYUA 3I72A 3KQ4A 2EY5A 4KGTA 3JSVB 1I94L 3BZKA 5FJ8H 3FRPB 2EJMA 2JQRB 3K0XA 3BG3A 5EE3A 4BXXH 2K5NA 2RCNA 4JI0L 2VUMH 4GKJL 3CWIA 1WI5A 3TDQA 4CKBA 3S1MB 2K39A 4HPMB 3RCZA 3WAPA 3KLSX 2EY1A 3KBGA 4CJ1B 2C5CA 1G291 4J15A 2LFIA 5G3LD 4O42A 1JRPA 5M5YH 3K81C 2MA9B 2VRRB 4QAYA 4B0MA 2L9HA 2K03A 4WJPA 3WALA 2I07B 1P7FA 4LUZA 5J3BA 4DV3Q 2K0PA 3O13A 5JPMC 4B3MQ 2JA8G 3K6OA 3MA2B 1ESRA 2PW7A 2WACA 1I6HB 1L1OC 1UGMA 3K9OB 2L0CA 2NZ1D 4BKSD 2L0TA 1JQ4A 1OEYA 5IAAC 3ZIMA 3Q8FA 1XTCD 1YNXA 2K1FA 3I90A 3LWUA 4LF7L 2ZCBA 4PV1C 4KY7A 3ETRA 2K5VA 4OX9L 1P0RA 4WJNA 4LMQD 2YEPF 1EL0A 2O6VD 1N5WA 4DV0L 3NRZA 3HZXA 3OTOQ 1V2YA 1MVKA 3RFZB 4ZK9B 1MSHA 3T1HQ 2CHBD 2OQKA 4BY7B 2KO3A 3PO3H 4L5TA 1OTRB 3P4RB 4JI4Q 4B0EA 4YCUA 3S9WA 4AQ7A 2MJ3A 3AMZA 1JWBD 4TMAB 3ZYYX 1EEID 2K05A 1WXMA 3BK2A 1RHPA 4RM9A 1BBUA 4J1MA 1MSGA 4IPDA 4ZQ3A 3TMEA 5FLXE 2G45B 1WXSA 4TSSA 1OQQA 3A0JA 1XPOA 4B3SL 3QAQA 2F0JA 2BS4B 3PGEA 2L11A 2BYVE 3SHQA 5FLXL 4YWKA 3S15H 3FMCA 2ES2A 4R4OA 2AKWB 1Q90A 1STNA 3X0WA 4DK1A 2G9DA 4JLCA 2NZOA 1PRTF 2KFKB 1GO3E 1PFMA 1QVFA 1MJDA 5CV7A 2CW0D 4J8QA 1BKBA 1EFID 4DHZB 4QJFA 1U4RA 1SSOA 4J6HA 3S16B 1SDFA 3F1ZA 2HTME 1YMHE 2PZUA 4G3XB 4LNKA 4NPNA 1PZJD 4EUTA 1TS5A 3NHHA 3E6ZX 4BZAA 2FCQA 4PS8A 2BGFA 4X64Q 4GXBA 2M9VA 1KABA 5HY6A 3ZTCA 2I46A 2KFJA 4HPLB 2J0JA 4HVBA 3SK4A 2ZNVB 3IAM1 4USAA 4RCNA 3GE8C 1FGUA 4CDDC 4BAXA 5H1SE 4GKKL 4NP5A 3A8IE 4NJCA 4B3TQ 2D5GA 4PMCA 1CI3M 4A3BH 2WXPA 5G5HA 4X62Q 4JG2A 1T0RC 4B3SQ 5C23A 3TJPA 2E8GA 4JBJA 4A3IB 2KA7A 2UUAL 3NUHB 2BYFA 2INCC 3SR6A 2I1JA 1HA6A 4IPGA 2HQLA 1GUAB 3P4PB 4KGRA 4LF6Q 1IKMA 4K7WA 5TR5A 2EIFA 3A9JB 3ZVVA 3NBHA 1LLRD 1QT9A 4X3KA 4LFCL 1KIXA 3VR6A 3TL5A 4PNYA 3G48A 4AUQC 3CPFA 1EY4A 2JA7G 1FR3A 4BBSH 1QZHA 4L5QA 4C4VB 1CK1A 1UEAB 4ZCKA 1GJXA 2NCNA 2W55A 4YL8A 4B3RL 2Q5WD 5GROA 1RWSA 4ANXA 3J81j 1SYCA 3W1BA 3HOWB 4ZYNA 1X54A 3MXNA 2HD5B 1XPRA 1PRTD 3H7SA 3L3OC 4JW0A 2C5LC 4WORA 4JI5L 1VQ5A 1CQVA 1HZBA 2MJDA 2WU2B 4CDEC 1L1OA 3KVFB 1LTAD 1SYBA 2F0UA 3AE3B 5H92C 5BYSA 2JRIB 2L83A 3KOJA 2HHHL 1YJWA 2JYEA 2VUMB 2CVRA 4R8IA 1A8VA 1HR0W 2JZZA 2YLMA 3A1QA 4E71A 3MVVA 4NXNL 2MHJA 3PTFC 3I55A 1PH4A 1VQHA 3HOUG 5CTRC 1EY0A 2O2VA 1LT5D 1N62A 1IYFA 3NWTA 2PE6B 5D14A 4F87A 2NBWB 4DR7L 3N6RA 2TSSA 4K2LA 4A3MB 1WWTA 5E6JA 1EQRA 2HCCA 1N61A 2CS4A 2DENB 3GOEA 1N34L 1YNNC 3VR2A 1JQYD 1XNQQ 3Q0AA 3I4MH 3W3AA 1PFDA 2PMZE 2MJ8A 3KLWA 1N60A 5IYCH 4BBNC 4POFA 2MP1A 1PTOH 2ZJDA 1WE7A 2A69C 3NEMA 4IZ8A 5C0XI 1WGRA 4C00A 3MTSA 3Q8CA 3F2UA 5JPNC 1XYIA 2PEAA 2NR2A 3OWEB 4Q5VA 4JI5Q 4C80A 4HN7A 4XT1B 4X3TA 3G71A 1MG8A 2KVRA 2MW5A 4HMJA 2R92G 1DONA 2BPSA 2NPTB 2K3UA 3AB9A 2RPQA 5EPKA 5FR3A 3KF8A 3D4WA 5EKKA 2XVSA 3GTLB 2H88B 1I4PA 3FC4A 3R93A 3PO3B 4HSVA 3PPAA 3R66C 1LTRD 1IYVA 4GGQA 4GOCA 2WWZA 2BF8B 4FADA 5H8YE 1YHAA 2L5TA 4DR7Q 4R4CA 4CYEA 1C4QA 3MFYA 2K75A 4EVOA 3BYYB 1X65A 2SAKA 4LLGM 3TEHB 2RHQB 1S5ED 1UEBA 4G0NB 1LT3D 1QOGA 1TKYA 2K50A 2F0VA 3S15B 2K9XA 2M19A 5I6WA 3BZDB 1N8RC 3VR3A 1MHWC 3GTOB 1KAWA 4JX1C 5LMUL 1GB4A 4QL5A 1YQ4B 4DDGD 4DR5L 2TMPA 1PV4A 1HTPA 4X65L 3ONAB 1PHJA 3IAYA 3GTPH 3DVGY 2CHZA 4HPPA 5CV5A 5M5WB 3A56A 2LMCB 2F0EA 5DPWA 2OF1A 2MGSA 1WR1A 2BQQA 2PMZB 2C7HA 2K5WA 3HRZC 4IALA 3HRDD 1CMXB 3BK1A 2BB6A 2HDMA 2Z0SA 4A3BB 4KHZA 1L7YA 2CHWA 5DNFA 3A7AB 4IPHA 2HIXA 5COYA 1B53A 2UYZB 4II2B 1Q1BA 4J3OD 4G7OC 1SR3A 5IGBA 3N20C 1AW7A 5BN3A 3L7ZC 1AE3A 4DV4L 1I7HA 3CHBD 4EOYA 1XEEA 5C3EG 4R4QA 2MNAA 2EE1A 2W3SA 1HPCA 2R7ZH 3K5LA 2K25A 2WXLA 3IBEA 3VUXA 1E8XA 2DZMA 1TWCH 1SE8A 2KQ3A 5C3WA 3HOZH 4R4IA 3UQBA 4R3DA 1LV9A 4XT3B 5C44H 3TREA 3I7FA 2KCCA 2L7RA 3CSTA 3ERQA 1WM3A 1Y8RC 5FO8B 2DAFA 5BN4A 1CA6A 4ZAIA 3OYYA 1N36L 4DAPA 3LYYA 3HS0C 2VQEQ 3M63B 2Z6BA 1STBA 2P5ZX 1LACA 1EY9A 3NTHA 2UWQA 5AUKA 3W1YA 2DN8A 5CGKA 2EYOA 2AL3A 4ZLTF 3DBLI 3C1EA 3N3KB 5C4XG 1Q1OA 1KH0A 2WQYB 1YBYA 5LL6X 3D3RA 1EOTA 1JCKB 1VQFA 1RTNA 5JJIA 2QDLA 1QKZA 2ZXRA 4DV4Q 1YITA 2V4LA 2WXJA 1TJEA 2MBHA 3I4NH 4DR4L 2RR9A 2ID0A 3KDFA 2D2CC 1FXAA 1PDQA 2B8FA 4R8NA 1DJRD 3DLLA 1NVID 3Q3NC 1I4HA 3BZCA 3W5OA 3NVYA 2ICEC 3GZNI 3AB5A 3CCJA 1TKWB 2AHOB 2DJGC 3RR5A 1KOTA 2WXNA 2KTFA 4ODGA 1L4DB 3M4OH 2DUDA 4W9DA 5GQOA 2KBNA 2SDFA 2PI2E 2E2IH 3PLUA 2NVTH 4L5SA 1VRAB 2M0XA 1EY7A 2QHOA 5HFYA 3H9DA 2L8JA 2IY0B 3KK7A 1D1KA 2RSNA 3QG1A 2LGDA 3K7AB 5FLXc 1H9JA 1HZCA 3K58A 4QB4A 1PYSB 1X3EA 1V1PA 1TTNA 1MG4A 4EZJA 3GTMH 4DK5A 1TQOA 2LWPA 1STEA 4OONA 1NSNS 1QUQB 3JC66 4P1BC 1YN3A 3MXNB 4HKZE 1G8ZD 1BMLC 3N9YC 3H8HA 3AEDB 3NS8A 4X66Q 1L1OB 2F0MA 3PMFA 3G4SA 2JXMB 1ML0D 2M56B 3WAMA 1T0QC 4YT0B 3U7DA 4IQZA 1E2VA 4CKCA 4XWWA 4KY6A 1L6VA 1YX6B 1KDCA 3IRBA 3P20A 5JVG3 3HOXB 2NBFA 1SMYC 2A68C 2B3AA 1D1IA 4KHPQ 2WXKA 4HJ5A 1K83H 2DNEA 2LRWA 3DEPA 2VQFQ 2LGXA 2IBIB 1FPYA 4MGZE 1H9RA 4ZYSA 1I4RA 4A3EB 2RMMA 4XE0A 1EWCA 1DOMA 5JEAJ 5EPJA 2V3PA 3NS1A 4HJAA 2ZVOA 4A3FB 1B9MA 2QGQA 4IFDJ 3KJPA 4MH8A 3ZTDA 1JE5A 3AE4B 4QCLA 2WDQB 3VTVA 3TP8A 4Y7NH 2KX0A 1OXSC 4L2YA 1LTTD 1ZXHA 3DDCB 1AARA 4DUZQ 3I8ZA 1EF1A 2OEOA 2D62A 4FJZA 3U8ZA 4W9JA 4K7SA 3T3NA 3KF8B 5C5LA 4ABNA 2HE7A 5CBEE 1Q1EA 3M9BA 4CJ2C 2ZXOA 3S14B 1A70A 1WTXA 2EMSA 2N7JA 5BO4B 5D94A 2JA6H 3SDLC 2B3GA 3IG3A 4B08A 2ZEQA 4L23A 1D5MC 1RRBA 5FLMG 1STAA 3NK9A 3U4VA 4YWGG 5C3JB 2IHFA 2HJ1A 5EE0A 4UY8C 1FXTB 3DBHB 1RD9D 1MJEA 4LUOA 4KD4A 4JI6Q 2R7ZB 3IFTA 5JEAG 4XC2A 2UXDQ 3A4RA 2JEBI 3K80C 1X56A 5IA7A 4IFDG 2WXQA 1FCLA 3HOZB 2B8GA 3K8AA 4RNAA 5DLQE 2WIIB 3SD5A 1NY4A 1VQOA 1MBYA 4XYCA 5DPSA 3W1SA 1GPXA 5C44B 2Y3AA 4I7AA 3UI2A 3RZDH 5IN7A 2F0HA 1EQQA 5I2XA 4BY7G 3EVQA 2Z0DB 2Z6KA 1YZ6A 1HNZL 1SNOA 4ARIA 3QJZA 2K52A 2F52A 4LF5L 1QB5D 1WYGA 4EEWA 2IDYA 5C0XH 1ILQA 4TVAB 4I6PA 3W5VB 4M00A 2KCNA 5IO9A 3WIMA 4JYAL 1HNWL 4A93B 1EUVB 2AQ1B 2MFIA 5KNDA 1I50B 1I3QB 1Q3LA 2NVQB 4G7ZC 4YY3L 4MSMB 1C8CA 3M7GA 4KSKC 5DCNA 3MC9A 1C9OA 3M4OB 1M90C 1JWSD 2XSCA 4HTHA 4N59A 2E2IB 4RMFA 2MBQA 2NVTB 1LFDA 4DHJB 3IFWB 4H0LC 2XWBB 2RBMA 3NBIA 3OLMD 2CH4A 2JUOA 4K7UA 4OGQC 1PH5A 4EQNA 2IGGA 4B9XA 2N55A 1QQRA 2JQOA 2GVAA 3HP3A 3EA6A 2WX1A 4EFOA 1QZGA 3GTMB 3BDLA 1JWUD 3A74A 2FNJB 2EELA 4AQYQ 2WINB 3BIID 3EFXD 4JV5L 1R4NB 4DU9A 3T1YL 1QCBD 3GD7A 5C4JH 4A3IG 4XGAB 4A3KH 1WCMH 2ASBA 1K0RA 1PZKD 2K5QA 4YY3Q 1IGCA 2RDFA 1KF6B 3KUCB 1UBIA 2I5LX 2NN6I 1C4CA 1J8IA 3PGZA 2KC1A 2KEEA 2BS2B 4C3JB 4ZRKA 3KDFB 4RGOS 5JZEB 3NXWA 3VYUA 3V3XA 2GOWA 2B29A 1P3QU 2J0MA 4NJ6A 4TUUA 2V0GA 5LXIB 4MACA 3RD4A 2R93H 1K83B 3UDXA 4P74A 5T1IA 5IODA 2GBMA 1WH3A 1JR0D 2FMCA 1FRRA 3U4ZA 5JJLA 1J5EL 1PMRA 1RTOA 2Q8RE 1IBML 3HOWG 2XN9C 2HTHA 4KGSA 4XZ4A 2GLSA 1EF5A 1A15A 5EBDA 1KQSA 4BY1H 1F2RC 3T1YQ 1Q10A 4JGHB 1H9KA 1BBXC 2KQSA 3K5MA 1ICFB 1WXQA 3B08A 3U2SC 3DQVA 5FJ8G 2LXJA 4Y7NB 3BDOA 1G6JA 1PFBA 5CV8A 3UE0A 3CAMA 1R9TH 2VUMG 4W9EA 2Z8LA 4GDLA 1SNDA 2SNMA 3PUYA 1BNZA 3QOJA 3DBRI 2ALYB 1IBKL 3PVLA 2QF7A 1VQ9A 2JEAI 2BWES 4GDKB 5BYQA 5CMDA 1Y8OB 4A3MG 1T0SC 4XDDA 1WJ6A 1T3QA 1SNQA 3OAWA 4WJ4A 1XNRL 5ELFA 1ZYRD 1NYQA 3GB1A 2PO4A 1NCVA 1J5EQ 5LNK1 2K33A 1UZXB 3MWYW 1ZOYB 3ND8A 4OL7A 4OVUA 1CTMA 4AJWA 3RLNA 4HIOA 1YJ1A 2JWUA 1WTPA 3ALBA 2BOSA 4HCSA 2YTVA 3URYA 3K5NA 3CSFA 4YSXB 1BDOA 1V8QA 2LFNA 5E3FA 2IO2B 3VA5A 2M00A 4I6NB 4QIWB 2D11A 2FINB 4IUNA 3P63A 2NS5A 1C4AA 3RZDB 1D5XC 4OELB 2FCMA 2B2VC 3J7AF 3PIOA 4JL9A 3PO3G 1JOKA 3NTKA 5IGFA 1DXMA 1ET6A 4JI8L 1IL2A 2W54A 2QEJC 2Z4IA 3F2DA 1F2ZA 3KYDD 3P1HA 3EROA 1F9RA 1XQQA 3C2PA 2WP8J 3FAHA 1S5DD 1SYDA 2N49A 2WGSA 2RD0A 5CHVC 4MEMA 3KWVA 1O80A 5BN5A 1XNRQ 4DNRB 1V97A 1UWMA 2CR5A 1JROA 4CHTB 1KM7A 4LCDE 4LAAA 2ENBA 4O0AA 4KJNA 2A4ZA 2N9EB 1KHIA 1ZGUB 4A3DH 4YHHQ 2JT4B 3PV0A 1W6KA 5IGEA 4LFBL 1SRUA 3A55A 2MBOA 3R3MA 1FO4A 5BMHA 5K36G 5AEKB 1C1YB 1Q0WB 1P1AA 2IT1A 1U0LA 1AFPA 4KX6B 4DV2L 2KDBA 2MBBB 2VZKD 3S1QH 2Q2HA 4RF0A 3ABVB 3F2CA 3K59A 5J2RA 3PLVA 2LRUA 1E7VA 3N1ZC 1DZ1A 3ML9A 1SNMA 2C35B 1C0AA 3HKZB 1V86A 3GTKH 1F0ZA 3B9JA 4JI3Q 2D07B 2WDRB 2ZJPA 1XJVA 1JALA 1FD6A 3QARA 4B9WA 1GKHA 3OW7A 4A3BG 3GO5A 1TWGH 3NE5B 1K8AC 2KHIA 1B9NA 4P72A 4WJWA 3CCUA 2AQ2B 1JORA 4A3KB 1O78A 1WCMB 3BVZA 4DR2L 2BS3B 4W9LA 1V1OA 3JYUA 3RI7C 1YI2A 5C3XA 4LF8Q 3RLFA 1NNXA 1FJGQ 2DWQA 1Z7TA 1YEZA 1VCBA 1WGYA 3S2HB 4OHJA 2HDEA 2KN5A 4CBVA 2MO0A 3TP6A 2LI5A 1BCPD 5CR3A 4C3IH 1MI0A 1VQCA 3KLSA 2F0OA 3I9V1 1MI2A 1TWFH 2Q2UA 2F0PA 4MTNA 2R93B 4EGVA 4DV7Q 4ZHPA 4ZDVA 2UU9L 3TP7A 1I5FA 2ZM6L 2WXGA 4E3CA 5IP4D 1NAPA 4GIVA 4IC7B 4DFAA 3VH3B 3OHXC 4D2KA 1L0XB 4CO7A 2NTSA 4KMUC 3NVZA 4EQ5A 2C7NB 1I4GA 1V9PA 1C9FA 3W1GA 4LDTB 4WJQA 4DAYA 1OTCA 3ZO5B 4L8JA 1MJCA 3Q8DA 2EY2A 1L0YB 4DR2Q 1Q81C 3CPWA 1EIYB 1E7PB 4OW0A 2A6ED 3DUZA 2N1VA 2DYMA 1IKLA 2JSOA 2QCPX 3G6EA 3FKIH 1FD7D 1E8YA 3BS1A 3SE0A 2LD9A 2R3ZA 1LT6D 3S24A 1PH6A 1UF0A 1YOVB 1QF6A 1IHZA 1UE7A 2PNHA 3PIO3 2WB1B 1Z2MA 4P75A 1FRDA 3ZXRA 1OXVA 5HGTA 2FXQA 3Q23A 4DAMA 5GAGC 1F9JA 4DK6C 3WAOA 4JI1Q 1EM7A 1VF7A 2DHZA 2OT2A 4MM3A 4DR6L 3PZ7A 2IPKD 2J4XA 3OWFA 1F52A 3DVNV 3DBLB 3VUWA 5IP9G 3S1NH 3L08A 1DOLA 1PTOC 4HRSA 2BE5D 4E74A 3AEVA 2K5PA 3ML8A 1SFOH 2OTLA 5D3IB 1BF4A 1XT9B 1B44D 2BDNA 2JXXA 4ZRIA 2KCMA 2PPHA 2M0AA 4K5XA 2XK5A 4DK3C 4DPGA 3GZNB 4GMVA 4DHZE 2RHSB 1HR0Q 2V9HA 3JAMc 4BBNF 4G4KA 4KTAA 1X32A 3PS6A 3HUIA 1DGSA 2ZT9C 4DKAC 4ZRZA 4MJSB 2KN4A 2A5UA 2ZW0A 2IX1A 5AUIA 2D0PA 4A3PA 2K01A 4IUPA 4PZ6A 1WGDA 4IPCA 5IT9L 1ESFA 2IY5B 5EBCA 1TKGA 5KHOA 2RDGA 3HOXG 3RULA 1IW7C 4FF1A 3BVMA 5CORA 4I6LB 2UXBL 1ASZA 1I94Q 5FO7B 1V80A 1I42A 3L0WB 4A3DB 1LABA 5NUCA 3MJWA 3UE1A 2LS01 3CCRA 4JI0Q 1AWDA 2QILA 4GKJQ 1VD2A 4N9F4 3ZRCA 4A3GH 4WH4A 4HXDA 3UIPB 2L1AA 4A3EG 5CC4A 3IT4B 3Q8BA 3W5UB 2N9XA 1VLBA 3KWLA 3RZWC 1L0VB 3F8TA 1IBXA 3ITPA 4RF1A 3KJOA 1Q8IA 1H9SA 1ACCA 4IKGA 1F9SA 3S1QB 2JYOA 4A3FG 4IUTA 1WFYA 3SFDB 1A0IA 1VQAA 2NN6H 1CZWA 3BINA 2A5HA 2MRPA 3JVZX 1MIUA 3S1RB 4IWPA 3I73A 4N8X1 3UINB 3T13A 2KWDA 2DNFA 4E6IA 4WWNA 2L05A 3UGBB 3MJ5A 2NVUI 4TKOB 3AE2B 3PZDA 2ZTDA 2G5DA 3MXPA 3P42A 1MKHA 1B4OA 1CKNB 2KWUB 3M62B 1HQRD 1TWGB 1PH3A 1S40A 2GA4B 2L12A 4LF7Q 2UXBQ 2G4SA 3IAS1 3SFEB 2A6HD 3BDCA 2D2QA 2CH4W 4RWSC 2FCNA 1PYBA 4OX9Q 1MGSA 2F3WA 4GB9A 4DV0Q 4FXCA 5D2MB 2BBCA 1TT5B 3RNGC 3AE9B 1PGXA 5IE8A 2R7ZG 4HROA 3A33B 3Q3MC 4C3IB 2EVBA 3OJ3A 3A9KA 3L54A 2DZKA 2RQXA 3NP8A 1XMOL 3PO0A 3L13A 1SB3C 1E2WA 1FYCA 1PZID 2JA5H 5CHWA 3I70A 2NVXH 5C44G 4A3CH 2L00B 3UF8A 4HEA1 3AMUA 3E9IA 3D32A 3QK0A 3SVMA 5IP7H 2LZ6A 1S5BD 3Q69A 4ZRQA 4LNOA 1MHHE 4NQKE 1G6PA 1RODA 4IJLA 1VDZA 2DBYA 3AEFB 1EYDA 1EOVA 2D3GA 5I9PA 1ZDXA 1H4RA 4KDIC 1KNAA 2JSVX 1WF9A 2N1WA 2J7ZA 2NZHA 3GS2A 3RYTA 3OJ4B 1YQ3B 2H5XA 2I38A 1HJPA 1TT2A 3FKIB 3HOVB 4A93G 1NENB 1WJ4A 1LM0A 1WGHA 4K6LA 1Y1WH 1Q46A 1WTWA 5D7GA 3HGBA 3WOEA 1GUOA 1HCZA 1IUEA 4MIUA 2PIAA 5E6OA 4H2AA 4MT5A 3P4QB 1STHA 1SNCA 2E5LL 4GKKQ 1K51A 2B2UC 4LFAL 3U7ZA 4DV5L 3LX0A 2KAJA 1JJGA 2UUAQ 4W9FA 1RM6C 2C7MB 1ZKOA 2LY7A 2PJHA 5C4HA 2L52A 3KW5B 1SFOB 1ZXIA 1Y69U 1FMAD 2EJGC 1EY6A 1HA5A 1B9RA 5IYBH 1T9HA 5M5YB 1KLVA 4FF4A 4IWQA 4ANUA 3LXFA 2UUCL 1N32L 3AE7B 2GB1A 3T4AC 3E0JA 1JJ2A 3FVQA 4LFCQ 2PE9A 2UUBL 2X69A 4DAYB 5A2QL 2PPBC 2L76A 2EYLA 1PLFA 4DXFA 1BUVT 3AFQA 3TZDA 1QOHA 3CCMA 3ONSA 4B3RQ 4IURA 3J80E 4C3JG 2OXPA 2LEKA 3E0EA 3ZUNA 3ULJA 4QMGA 1X3PA 3VQIA 1WY8A 1TWHH 1LTSD 5FO9B 1ROEA 1WRDB 3J80L 3B1LX 5FK9C 4FJVB 2KOLA 2FMMA 3U58A 3K0YA 2HHHQ 3SEBA 3TS2A 1H9MA 1LYLA 4ZKCB 4GNXA 4P73A 4NXNQ 1SJED 1EEFD 2FIFA 3H0GH 2EXZA 1JOOA 2QCZA 1Z9FA 1EYAA 4R4TA 1BT0A 1YN5A 1EO6A 4JWUC 4YSZB 1WTRA 2XRSD 2CW0C 4LWCA 5EJWA 4MELA 4LF9L 2M8SA 3RNCC 2UUBQ 1K8OA 1N34Q 1E2ZA 3RN5A 1RFAA 4WJ3M 3GQBA 1E1TA 3ERSX 3WANA 3FPUB 2Z59B 4OXPA 3AYHB 2N9LA 1O7IA 1XLPA 4UPAA 1UNSA 2D10A 2KVZA 2JA8H 4P7IA 2KTRA 2DLBA 2QDBA 4MHEA 3CP0A 5IYDG 2LJ5A 4HJGE 1B1ZA 3NWSA 4BKTA 2K6AA 1A6XA 2ONQA 1TIID 2EY6A 1OXXK 2D0OA 4ILWA 2KWVB 1F2MA 3AM9A 4UP7A 2J53A 4US8A 3V62A 4HCEA 3ZDMC 2XRQD 1VQPA 2WP9B 1GUSA 4K6DA 3WWVA 1Z5SB 1LTBD 2ICIA 1P98A 4WQOB 2LGSA 1KRHA 3DBRB 2JA5B 1EFWA 3RZOH 2NVXB 3VRAB 3JW0X 3SK6A 1LM8B 3GE3C 3ZXVA 3CIRB 1H9SB 4JVZA 1YD8U 4RHSA 4FBJB 2KVMA 3MFGA 2NVYH 1GXDC 3U9OA 3C8YA 1OO9B 2B2UA 4AWJA 4IOCA 1PRTC 4KSLC 2LXKA 3OMGA 2LGYA 1DOYA 2QW7A 4JOIC 4KJOA 5LMUQ 2EYPA 3KYCD 4DR5Q 2Z1CA 1FNVA 1IL8A 1BOSA 4BKSA 1HFNA 2UXCL 4X65Q 1R4MI 3NQTA 1D7QA 1HXYD 4APVA 3D6WA 3R8BA 4HLEA 2JPHA 4YCVA 4BKGA 3NTIA 2MHVA 3N52A 4REZA 3N32A 4JI2L 4P6VF 1B50A 5ELOA 4BBSB 4A9AA 1CQFA 5EGTA 4BA1I 3X3MA 3DMUA 3R2IA 2O6VA 3CKIB 3CRKC 3PRPB 1YNJD 5IT9c 1N33L 4DAVA 1D2BA 1OFFA 5BMIA 2CQAA 4KVGB 5FKAC 3A9KB 1XXGA 1WTVA 2KENA 3L9AX 1XWEA 4RA8A 1E9MA 1K8RB 4S0RA 3D6CA 5LL6S 2N7DA 2C60A 5EPLA 3BU2A 3ZKJC 3R7QA 3W1SC 2D3BA 1CSPA 4N58A 2XIWA 2E6XA 3NENA 3QWNA 4KKUA 1SE9A 4W9GA 2F0KA 2UXCQ 1NI2A 3AI5A 1GUTA 1SROA 1IGDA 4KZCA 4OZBA 1U4LA 1RYJA 1XD3B 1TZOA 4PT5A 2PQEA 2R2QA 4KKJA 5E6NA 4A3KG 1WCMG 1FM0D 2Z6KC 5HURA 1MPEA 1Q86C 2KHJA 2L1BA 3EJIA 3I4MB 2CJOA 4BBRH 3E5SA 5DM63 4KLKA 1VR9A 1XCTL 2H1EA 3T51B 2ZCCA 4M8MA 1YX5B 2E2JH 3NBHB 4K2KA 1PTOB 3QO2A 1WYDA 1N36Q 2AQ3B 2KDFB 2JX5A 1IZ6A 4HIMA 3A8JE 1UUPA 5EKLA 1GOZA 4Y52H 2F0QA 4FXGC 5AFWA 2R93G 4PS7A 3T16A 4DF7A 1KRSA 5LMNL 2JA7H 2XTIA 3EQLC 4MGKE 4ANWA 5D65A 4MGYE 4DR4Q 2BKFA 3J7YW 1FXIA 3APDA 3H0GB 2F03A 4F88A 1QOFA 2CU3A 1I4XA 1FVIA 4OVZA 3PUWA 1G2TA 3DXJC 4JBKA 3PO2H 3KFUA 1STYA 4JIOU 4BOZB 1E1OA 3CRLC 5JOBA 1WTQA 1YIWA 2KKCA 2PTLA 3A1QB 4X57B 2F0SA 1PH8A 3W2DA 2WXOA 2JXTA 4TQ1A 3C1FA 1U9RA 4IFDI 2O2VB 3J7ZC 2QSDA 1RL2A 5IGGA 4F7ZA 3HOUH 4LK1C 3QCAA 5KYLA 1BVSA 4OWWB 2F3VA 4LNIA 2EQSA 2WB1G 2WX0A 2ZPNA 1V5OA 2L55A 4BWGB 4K0KL 1RLFA 1EIHA 4QUFA 3GTPB 4FLHA 3NVWA 1U4PA 1NMGA 4LJOB 4JOIA 1XMQL 2MH7A 4MH0E 4OVVA 2IO3B 4QQBX 3HEJA 2XNAC 1YJ9A 1JWMD 2N78A 4A3JH 3I91A 2R92H 2JK8A 3KLRA 4C7YA 2K14A 4A6QA 4HEDA 1WM2A 1VZ8A 4BS9A 2KXJA 1VMPA 4YTPB 4TV3A 2Y0SB 1L5PA 3TRZA 4N6EB 3VDZA 3RLOA 2ZVNA 1UD7A 4IDIA 4K81A 1CZGA 2BVCA 3NPPA 2FAZA 2JYTA 1LQBA 2MJEA 3Q6BA 1VQJA 1JOQA 1KXLA 3PCOB 4HWIB 3ENEA 1TWCB 2F0FA 2XWJB 4JE3B 5T8IA 4AYBB 4NKLA 5IWAL 1C4PA 1O7ZA 2DAJA 1A62A 2RKSA 3AECB 2AWNA 3EIVA 3KF6A 5C1ZA 1S1QB 5J22A 1A3TA 1YIJA 2KTRB 1Z6HA 2OJWA 3VH4B 2J42A 4HMIA 4DV1L 3L10B 5IIFA 5GXGB 3VFKA 1PH1A 4LF4L 3OPOA 1A3UA 1JT8A 2KCTA 1NDDA
chains in the Genus database with same CATH topology
1G91A 1Y56A 1ONLA 2B2YC 4C7ZA 3ZGZA 1F0ZA 4IUUA 3M85A 4XQNA 1EQTA 2VNUD 3D8GA 4PQXA 3U9SA 3I4NB 2V3NA 2W82A 1NEKB 2PLPA 4OO1G 4P16A 3VA7A 2BYTA 1JICA 3OSOA 1PUTA 5BYRA 4CGYB 4US9A 1EWHA 2F0NA 2EZVA 1V43A 3JAME 2WXRA 1RCVD 2KEDA 3VYRA 1C78A 3P75A 1Q12A 4BBRB 3LB8C 1ZDVA 2AX5A 3AV8A 2E2JB 3JAML 4FXDA 4IUQA 1V8CA 2BDOA 3A54A 4G7HC 1WRIA 1AN8A 3Q8EA 2EJFC 4HR7B 2WXFA 1CZPA 2IGHA 3PUZA 1ZXTA 4CKEA 5LHY1 4BA2I 5EE9A 2O5IC 3PO2B 1F2YA 2KECA 5KIXA 1WD0A 1GHKA 1VMCA 1RJTA 2F0IA 2WS3B 4FVMA 2FHTA 4I65A 1STGA 3H91A 1OXTA 5C2TB 2JZPA 2E2DC 1F9PA 5I6YA 5JJZA 2G9HD 1PGAA 4UAIA 4XQJA 3R2TA 3WOFA 4RHRA 4ZOHC 4M0WA 2SOBA 1K50A 3V2TA 4RKBA 1UGJA 4DK0A 1V1PB 1TVXA 4XDXA 4XDCA 3QB3A 4A3JB 3MP9A 1IYUA 4RGMA 1AP0A 2SEBD 2JA6B 4U673 1PTOF 2KHSA 4C1NI 2EOTA 3NVVA 3TP5A 3C3LA 2B2YA 3FILA 3ND9A 3QOLA 4XTCS 4DXGA 3HG9A 4RGTA 3J81L 4LTUA 3KUPA 1PRTB 1PDXA 2D5DA 2F0LA 5EQ0A 2K32A 2NN6G 1PYWD 5I4DA 1JMLA 2EKIA 3CQZB 3WCQA 1N5XA 1C79A 4WFN3 1BR9A 4KN7C 4JWSC 4LJZC 1HEZE 1AZPA 2J52A 1E6EB 3MXUA 1QWYA 2Z4HA 4TQUS 3Q22A 1BQQT 3V05A 1SYFA 5JEAH 1XO3A 1D6EC 5KEEA 3FPPA 4WRDA 4RGNA 4IFDH 1C48A 1HFGA 3EGRA 1Y8PB 1MD2D 1HUNA 1EU4A 5IGDA 4DGZA 1S4ZA 1FEHA 3SK5A 4IN3A 5C4JB 1Y1VB 5KNBA 3I3CA 2RSOA 2G1EA 4RAUC 1QOBA 4MN3A 3VYTA 3VR5A 2MUYA 5J39A 3RPFC 1TYGB 3VR9B 4NW2A 1Z47A 4A8XC 1K53A 3OOCA 4KN4C 3CU7A 2Q8TA 4ARCA 1SE2A 4BY1B 1ZYRC 2VB3X 2KDMA 2KJXA 2A73B 2LKVA 1T5XD 2D9UA 3OIPA 1R9TB 4L63B 4X3SA 5I9OA 4HKQA 2AUKA 1XLQA 3IXSA 1RFKA 2WAQB 1TY0A 3RUZA 1ENAA 4ITKA 1A2UA 3NZ3A 2WU5B 1ZUD2 2L32A 2FBWB 3ZJVA 2EYJA 4OIJA 2QJLA 3HVZA 3C46A 4L6TB 1F9QA 5ELBA 4HAEA 3SXHA 2EYMA 2LUMA 1CM9A 2E3TA 4DA2A 2H4OA 3TBIB 1CJEA 3HVDA 4M1UB 2WKDA 1II3A 1F77A 1KNEA 2K22A 5IT9E 4C3HB 1DGJA 1C77A 1BXTA 4GDLB 1EY8A 3IL8A 2ON8A 2V4IB 2BCOA 2PW9A 4WIPA 1EWYC 5K5PA 3MZ5A 3VR8B 2LHEA 1AEXA 4YIJA 2PVGC 5CV4A 3QIAA 4YXDB 4FF2A 2B63B 3M4YA 4F8MA 2FJ2A 3FILB 2JP1A 4OZAA 2LMCA 1BCPC 1FFVA 1G2SA 3GTKB 1GHJA 5M3MB 2B39A 3SDZA 1X3QA 3J7AV 2A74C 2BA0A 1FNUA 4ULLA 3DWPA 2IJ0A 1YNND 5C6AA 2WXHA 1EY5A 3H94A 5M9OA 1XCQL 3AEAB 2RPVA 2A69D 2H89B 4ZUJA 5JAVA 2E76C 4WQMA 5C4ZA 1D4BA 5ELEA 2A6EC 2IX0A 1TWFB 4I7ZC 4PMBA 4XIGS 3DWQA 1ZE3D 5K36H 2I2YA 1W6JA 3TEYA 4K14A 3BYTB 3DWGC 1LT4D 2OEDA 5KGUA 2PKOA 3S2DB 1P7EA 3G6JB 2N88A 4H44C 5E4XA 2N9KA 5BMGA 1FCCC 2BE5C 4O1NA 1BO0A 4N9PA 4XYQA 4G57A 2K28A 2IGDA 5IOCA 2ZW1A 4RFBA 3A7LA 2NYZD 3WDNA 2BW2A 1HUMA 3D4DA 2K7VA 1VDVA 4M8AA 3MXGA 1WSPA 2IWHA 1AZQA 2JU6X 5D3DA 1GUGA 3S1NB 1CT1D 2INNE 3TN2A 5JVH3 3IFDA 3A8KE 3K5OA 3FDTA 1J9OA 1E0BA 4FP5D 1OQRA 5ELDA 1NYRA 5A2QE 1PFNA 1FNWA 4KK7A 2BB5A 4KKTA 1AYFA 4IUVA 3MAQA 4KD3A 5DM73 2KMMA 5FOBB 1N63A 3HOYB 4EE2A 2AUJD 3E56A 1SXTA 4ID6A 4A90A 4H7BA 2WV6D 3BVGA 2B2WC 1YJJA 5E1FA 3GTQB 3AE6B 3T3OA 2F0TA 4A3GB 1B3AA 1DOKA 3G7LA 1KLGD 4WURA 1DCZA 1U4MA 4MM3B 5CV6A 1QNUA 1HQMC 1CA5A 2A6HC 1F2LA 3SR1A 5HHDG 1SF0A 2FFKB 4YSYB 5MPOA 2Y5CA 4OIKA 1A3VA 4KHVA 4RCOA 2K1BA 1XLOA 2EYFA 5C0XJ 3B2FA 1QJOA 4ZHOA 1WGKA 3AE1B 1MHXA 1ENCA 4L1BA 2B2TC 2FUG1 4YTNB 2HUGA 2R61A 2CJNA 3AEGB 2F0GA 4FYDA 1I6VC 1IBXB 2RDHA 1HHVA 1SAPA 5F2DA 5M3FB 3UI3A 2R6GA 4QF4A 1T5EA 4ZKBB 5TSSA 3VR4A 1SMYD 2A68D 5C0XG 3BWUD 1YNTE 2HQEA 1HZ6A 4NDXA 1Y1WB 3L4PA 1EZ6A 4HSPA 2F1MA 1OXUA 4Q2JA 5EE1A 4DQOC 3MC0B 1C76A 1QE6A 1YN4A 5ELCA 3PUXA 2DY8A 3KBXA 1J7CA 3SHLA 2NMQA 1JC7A 2B2WA 4R9WA 1DM0B 4C1NK 2GI9A 1FFUA 1DYQA 2JE6I 2KQ4X 4ZRPA 4FF3A 4EQOA 2PMVA 3AE5B 3OMCA 3DWMA 2W3RA 2MPMA 3NUCA 1DOIA 2LGIA 3TEWA 1TWHB 2SNSA 1J7BA 2N0SB 1WVLA 4KV6A 4XQQA 1TS3A 1RKNA 4U68A 1VZ7A 5CYUA 4IOIE 1SIJA 4AS1A 1S5FD 4OZCA 2E2HB 2VZKB 4F7XA 4GZYC 2NUCA 4XXEA 2DY7A 2B2TA 4XWTA 1QILA 1I4QA 2PCFB 5E4WC 3TEXA 2EPBA 1VCIA 2NTTA 1WTOA 1SYEA 3AN1A 2YYZA 3P4SB 1TS4A 5JXVA 2JA8B 3TZUA 3PIP3 3DEOA 1GAQB 2X38A 1PGBA 3AEBB 3AH7A 3MEHA 1BCPB 1UAPA 4GLSC 4OO1I 2KUMA 2OHFA 2VB2X 4XYOA 1TY2A 4ME5A 3ZJUA 1R4QB 3RZOB 4K5WA 4JBWA 2E74C 4EQPA 2F0DA 3T56B 2PW5A 2NVYB 4DNTB 3GTGB 3S17B 1YNJC 2LJIA 4C3HG 2F4IA 1K52A 4FO2A 4KKIA 1ET9A 1SYGA 2IX3A 3K57A 1EQVA 1LTID 1TR5A 2WXIA 1R4PB 2DNCA 2RVLA 1DD2A 1CFMA 3MHBA 2WDVB 5G5GA 4TQ0A 4C2MB 3QJYA 1M8AA 1Y8NB 4CQNA 3H3VC 2WLBA 1GUNA 1XF5L 1B2TA 4NAWB 3PUVA 2O2LD 1A2TA 2K5DA 2PVOD 1LTGD 2QMTA 1EU3A 1SBBB 1T6BX 1DOXA 2PNRC 1SEBD 1F2RI 1UWXA 1E0ZA 3Q24A 1TU2B 5I2YA 2EYHA 2VXWA 4WWMA 4C3IG 2F0WA 3IKJA 1NI3A 2O5JC 3GTJB 3P1MA 2JA7B 5DEHA 2V4DA 1S5CD 3D4RA 1CHQD 1TS2A 5CV9A 5M5XB 5A35A 4RKLA 1QG7A 1SJHD 2WKCA 1NR4A 3ZQ4A 3H6MA 5J1ZA 2GRIA 1GB1A 5IGCA 3HOUB 1KFYB 4K5VA 3I57A 1FGBD 3GV3A 4WAFA 5ISRA 2NB0A 3AEEB 4P2CB 2BT6A 3E9SA 1JWAD 1XLNA 2MEKA 3M7NA 4PMWA 1SE3A 3R3OA 2ACZB 1RF2D 1TWAB 1M4VA 3I4LA 2DYOA 2PYKA 2R92B 2IW3A 2YEPB 4NAMA 1NUCA 2WNMA 2X6GA 5CBAE 2O4XA 5T1GA 2QKIC 3H09A 1JB3A 1HTLD 1K8MA 3B2GA 3TUOA 2L4NA 1NR2A 4S3SA 1SSNA 3VYSA 4KKSA 2LHDA 1D5ZC 2J0TD 1ZPSA 3J81E 2HCIA 4C56C 1EYCA 5EKIA 2HDLA 1FIQA 2INPE 2M2LA 1E10A 3TSSA 1EZ8A 1ZP0B 4TRDA 1J7AA 4Q0FA 2C9OA 2EDGA 4CJ0B 3AU7A 3IT6B 2IL8A 4JPSA 3AE8B 3U52E 3U4EG 4ZUIA 1EIGA 2X6LA 1PXUA 4K8IA 1VZ6A 5KYIA 2NWGA 3FEWX 1BUIC 4JK1C 2B76B 5C3EB 3M3YB 2K04A 1BCPF 1O7LA 1PTOD 3LWEA 3RMHA 3VRBB 5DAUA 1G6ZA 1L6UA 2ZXPA 1GUWA 2BA1A 3NQIA 1JE4A 3NSWA 3Q6SA 4K8JA 3T53B 1O7YA 1R7SA 2YU9B 1L4ZB 5C5MA 1LO5D 1XX8A 3DHQA 3J9CA 2Y5PA 5HG2A 4UDUC 4KI0A 4X3UA 5C4XB 1ZEQX 4YTMB 4QUCA 1WD1A 1IW7D 3Q8AA 1ENFA 4OO1H 1ILPA 3ZJTA 4DN4M 5KRUA 4V190 2PZTA 1RDPD 3PZ8A 3D31A 3SK8A 1ICWA 1KTKA 1KDAA 4RH6A 2BTEA 2QIEB 3LNNA 4V0BA 3DM1A 4FXKC 5G3LF 1HRJA 5KNCA 3GV6A 3MHZA 1SNPA 3OIQA 4H13C 2PZWA 2RA4A 4NZLB 1SE4A 2E75C 1HZ5A 4N9TA 1TKEA 2KACA 1VJKA 3GP7A 3P7JA 1KAAA 4FNFA 3DWAA 4Z9CB 1VF5C 5HI1A 3V96A 2WXMA 3W9CB 2Q8IB 1QLBB 1KDBA 1JW9D 4KY5A 4NMZA 1CHPD 2FE8A 3X3NA 4A55A 1KLUD 2AWOA 3EUB2 1YJIA 2B2VA 3TEZA 1QOAA 4LK0M 1QNKA 3I72A 3KQ4A 2EY5A 4KGTA 2JQRB 3FRPB 2EJMA 3BG3A 5EE3A 3CWIA 3S1MB 3TDQA 4CKBA 3KLSX 2EY1A 3KBGA 4CJ1B 2C5CA 1G291 2LFIA 5G3LD 4O42A 1JRPA 4B0MA 2L9HA 2K03A 2I07B 1P7FA 2K0PA 3O13A 5JPMC 3K6OA 3MA2B 1ESRA 2PW7A 2WACA 1I6HB 2L0CA 2NZ1D 1JQ4A 3Q8FA 1XTCD 3I90A 3LWUA 4PV1C 4KY7A 3ETRA 4LMQD 2YEPF 1EL0A 1N5WA 3NRZA 3HZXA 3RFZB 1MVKA 4ZK9B 1MSHA 2CHBD 4BY7B 3P4RB 4B0EA 3S9WA 4AQ7A 2MJ3A 3AMZA 1JWBD 4TMAB 3ZYYX 1EEID 2K05A 3BK2A 1RHPA 4J1MA 1MSGA 4ZQ3A 3TMEA 5FLXE 4TSSA 1OQQA 2F0JA 2BS4B 2L11A 5FLXL 3FMCA 1Q90A 1STNA 4DK1A 2G9DA 1PRTF 1PFMA 5CV7A 2CW0D 4J8QA 1EFID 1U4RA 1SSOA 4J6HA 3S16B 1SDFA 2HTME 1YMHE 2PZUA 1PZJD 1TS5A 3NHHA 3E6ZX 2M9VA 1KABA 2I46A 3SK4A 3IAM1 4USAA 4RCNA 4NP5A 3A8IE 4NJCA 2D5GA 4PMCA 1CI3M 2WXPA 5G5HA 4A3IB 2KA7A 3NUHB 3SR6A 1HA6A 3P4PB 4KGRA 1IKMA 3NBHA 1LLRD 1QT9A 4X3KA 3VR6A 4PNYA 1EY4A 1FR3A 1CK1A 1UEAB 1GJXA 2W55A 2Q5WD 1RWSA 1SYCA 3HOWB 3MXNA 1PRTD 3L3OC 4WORA 2WU2B 1CQVA 2MJDA 1LTAD 1SYBA 2F0UA 3AE3B 5H92C 5BYSA 2L83A 2JYEA 2VUMB 2CVRA 4R8IA 3MVVA 1EY0A 1LT5D 1N62A 3NWTA 5D14A 4F87A 5E6JA 3N6RA 2TSSA 4K2LA 4A3MB 1WWTA 1N61A 2HCCA 1YNNC 3VR2A 1JQYD 3Q0AA 3W3AA 1PFDA 2MJ8A 1N60A 2MP1A 1PTOH 2A69C 4IZ8A 5C0XI 3MTSA 3Q8CA 3F2UA 5JPNC 1XYIA 3OWEB 4Q5VA 4C80A 4HN7A 4XT1B 4X3TA 4HMJA 1DONA 2K3UA 3AB9A 5FR3A 5EPKA 3KF8A 3D4WA 5EKKA 2XVSA 3GTLB 2H88B 1I4PA 3FC4A 3R93A 3PO3B 4HSVA 1LTRD 1IYVA 5H8YE 2L5TA 1C4QA 3MFYA 4EVOA 3BYYB 2SAKA 4LLGM 1S5ED 1LT3D 1QOGA 1TKYA 2F0VA 3S15B 2K9XA 2M19A 5I6WA 3BZDB 3VR3A 3GTOB 4JX1C 1GB4A 1YQ4B 2TMPA 1HTPA 3ONAB 3IAYA 5CV5A 5M5WB 3A56A 2LMCB 2F0EA 2OF1A 2MGSA 2PMZB 2K5WA 3HRZC 4IALA 3HRDD 3BK1A 2BB6A 2HDMA 4A3BB 4KHZA 5DNFA 3A7AB 5COYA 1B53A 1Q1BA 4J3OD 4G7OC 5IGBA 1AW7A 5BN3A 3L7ZC 1I7HA 3CHBD 1XEEA 2EE1A 2W3SA 1HPCA 3K5LA 2WXLA 2KQ3A 5C3WA 4R3DA 1LV9A 4XT3B 2KCCA 3ERQA 5FO8B 3LYYA 5BN4A 1CA6A 4ZAIA 4DAPA 3HS0C 1STBA 1LACA 1EY9A 3NTHA 5AUKA 2DN8A 5CGKA 2EYOA 4ZLTF 3C1EA 1KH0A 2WQYB 5LL6X 1EOTA 1JCKB 3D3RA 1QKZA 1RTNA 2WXJA 2ZXRA 1TJEA 2ID0A 2D2CC 1FXAA 1PDQA 2B8FA 4R8NA 1DJRD 1NVID 1I4HA 3NVYA 2ICEC 3AB5A 1TKWB 2WXNA 4ODGA 1L4DB 2SDFA 1VRAB 5HFYA 1EY7A 3KK7A 1D1KA 2RSNA 3QG1A 3K7AB 1H9JA 3K58A 4QB4A 1V1PA 1TQOA 1STEA 1NSNS 1YN3A 4HKZE 1G8ZD 1BMLC 3N9YC 3H8HA 3AEDB 2F0MA 3PMFA 2M56B 2JXMB 1ML0D 4YT0B 4IQZA 1E2VA 4CKCA 4XWWA 4KY6A 1L6VA 1KDCA 3P20A 5JVG3 3HOXB 1SMYC 2NBFA 2A68C 1D1IA 2WXKA 2DNEA 3DEPA 1H9RA 4ZYSA 1I4RA 4A3EB 2RMMA 4XE0A 1EWCA 1DOMA 5JEAJ 5EPJA 2V3PA 3NS1A 4A3FB 1B9MA 4IFDJ 4MH8A 3AE4B 4QCLA 2WDQB 3TP8A 1OXSC 4L2YA 1LTTD 1ZXHA 3I8ZA 2OEOA 2D62A 3T3NA 5C5LA 4ABNA 5CBEE 1Q1EA 4CJ2C 3S14B 2ZXOA 1A70A 4US8A 1WTXA 2N7JA 4B08A 4L23A 1D5MC 1STAA 3NK9A 5C3JB 4YWGG 5EE0A 1RD9D 4KD4A 2R7ZB 3IFTA 5JEAG 2JEBI 4IFDG 2WXQA 1FCLA 3HOZB 2B8GA 4RNAA 2WIIB 3W1SA 1GPXA 1MBYA 5C44B 2Y3AA 3UI2A 2F0HA 5I2XA 3EVQA 1SNOA 4ARIA 1QB5D 1WYGA 2IDYA 5C0XH 1ILQA 3W5VB 2KCNA 4A93B 2AQ1B 5KNDA 1I50B 1I3QB 1Q3LA 2NVQB 4G7ZC 1C8CA 3M7GA 3M4OB 1JWSD 2XSCA 4HTHA 4N59A 2E2IB 2NVTB 4H0LC 2XWBB 2RBMA 3NBIA 4OGQC 4EQNA 2IGGA 4B9XA 2N55A 1QQRA 3HP3A 3EA6A 3GTMB 3BDLA 1JWUD 2EELA 2WINB 3BIID 3EFXD 4DU9A 1QCBD 3GD7A 1PZKD 2K5QA 1IGCA 1KF6B 2RDFA 2NN6I 1C4CA 1J8IA 2KEEA 2BS2B 4C3JB 4RGOS 3NXWA 3VYUA 3V3XA 2V0GA 4MACA 3RD4A 1K83B 5IODA 5T1IA 1JR0D 2FMCA 1FRRA 1PMRA 1RTOA 2Q8RE 2XN9C 4KGSA 1A15A 5EBDA 1F2RC 1Q10A 1H9KA 1BBXC 3K5MA 1WXQA 3U2SC 4Y7NB 3BDOA 1PFBA 5CV8A 2Z8LA 1SNDA 2SNMA 3PUYA 1BNZA 3QOJA 2QF7A 2JEAI 4GDKB 5BYQA 5CMDA 1Y8OB 4XDDA 1T3QA 1SNQA 5ELFA 1ZYRD 1NYQA 3GB1A 2PO4A 1NCVA 5LNK1 2K33A 1ZOYB 3MWYW 3ND8A 4OL7A 1CTMA 2JWUA 1WTPA 2BOSA 4HCSA 3URYA 3K5NA 4YSXB 1BDOA 1V8QA 2LFNA 5E3FA 3VA5A 2M00A 4QIWB 2FINB 4IUNA 3P63A 1C4AA 3RZDB 1D5XC 2B2VC 3J7AF 1JOKA 3NTKA 5IGFA 1DXMA 1ET6A 2W54A 2QEJC 2Z4IA 1F2ZA 3P1HA 3EROA 1F9RA 3C2PA 2WP8J 3FAHA 1S5DD 1SYDA 3KWVA 1O80A 5BN5A 4DNRB 1V97A 1UWMA 1JROA 4CHTB 4LAAA 2ENBA 4KJNA 3PV0A 1W6KA 5IGEA 3A55A 1FO4A 5BMHA 5K36G 2IT1A 1AFPA 4KX6B 2VZKD 4RF0A 3ABVB 3K59A 1DZ1A 1SNMA 3HKZB 3B9JA 2WDRB 1JALA 1FD6A 4B9WA 3OW7A 3GO5A 3NE5B 1B9NA 4WJWA 2AQ2B 1JORA 4A3KB 1O78A 1WCMB 3BVZA 2BS3B 1V1OA 2DWQA 5C3XA 3RLFA 1Z7TA 3S2HB 4OHJA 2HDEA 4CBVA 3TP6A 1BCPD 5CR3A 1MI0A 3KLSA 2F0OA 3I9V1 1MI2A 2R93B 2F0PA 4EGVA 4ZHPA 3TP7A 2WXGA 1NAPA 4DFAA 3OHXC 4D2KA 1L0XB 2NTSA 4KMUC 3NVZA 1I4GA 1C9FA 4DAYA 4L8JA 2EY2A 1L0YB 1E7PB 4OW0A 2A6ED 3DUZA 2DYMA 1IKLA 2JSOA 2QCPX 1FD7D 3BS1A 3SE0A 2R3ZA 1LT6D 1QF6A 1IHZA 3PIO3 2WB1B 1FRDA 1OXVA 5HGTA 3Q23A 1EM7A 1VF7A 2OT2A 3PZ7A 2IPKD 2J4XA 3OWFA 1DOLA 1PTOC 4HRSA 2BE5D 2K5PA 5D3IB 1BF4A 1B44D 2BDNA 2M0AA 4K5XA 4G4KA 4KTAA 1X32A 3HUIA 2ZT9C 4ZRZA 2KN4A 2ZW0A 2IX1A 5AUIA 2K01A 4IUPA 5IT9L 1ESFA 5EBCA 1TKGA 2RDGA 1IW7C 4FF1A 3BVMA 5CORA 5FO7B 4A3DB 1LABA 5NUCA 2LS01 1AWDA 2QILA 4WH4A 2L1AA 3IT4B 5CC4A 3Q8BA 3W5UB 1VLBA 3KWLA 1L0VB 1IBXA 3ITPA 4RF1A 1Q8IA 1H9SA 1ACCA 4IKGA 1F9SA 3S1QB 2JYOA 4IUTA 3SFDB 2NN6H 1CZWA 2A5HA 3S1RB 3I73A 3T13A 2KWDA 4E6IA 3MJ5A 4TKOB 3AE2B 3MXPA 3P42A 1B4OA 1HQRD 1TWGB 2GA4B 2L12A 3IAS1 3SFEB 2A6HD 3BDCA 4RWSC 1MGSA 2F3WA 4FXCA 2BBCA 3AE9B 1PGXA 4HROA 4C3IB 2EVBA 2RQXA 3NP8A 3PO0A 1SB3C 1E2WA 1FYCA 1PZID 3I70A 4HEA1 3AMUA 3SVMA 3Q69A 1S5BD 4ZRQA 1MHHE 1RODA 1VDZA 2DBYA 3AEFB 1EYDA 5I9PA 1ZDXA 1KNAA 2JSVX 2J7ZA 3GS2A 1YQ3B 2I38A 1TT2A 3FKIB 3HOVB 1NENB 4K6LA 1WTWA 5D7GA 3HGBA 3WOEA 1GUOA 1HCZA 1IUEA 4MIUA 2PIAA 4H2AA 4MT5A 3P4QB 1STHA 1SNCA 1K51A 2B2UC 3U7ZA 3LX0A 2KAJA 1RM6C 1ZKOA 2LY7A 5C4HA 2L52A 1SFOB 1ZXIA 1Y69U 1FMAD 2EJGC 1EY6A 1HA5A 1B9RA 5M5YB 4FF4A 3LXFA 3AE7B 2GB1A 3T4AC 3E0JA 3FVQA 2X69A 5A2QL 2PPBC 2EYLA 1PLFA 4DXFA 1BUVT 3TZDA 1QOHA 4IURA 3J80E 4C3JG 2OXPA 2LEKA 4QMGA 1X3PA 3VQIA 1LTSD 5FO9B 1ROEA 3J80L 5FK9C 2KOLA 2FMMA 3K0YA 3SEBA 1H9MA 4ZKCB 1SJED 1EEFD 2EXZA 1JOOA 1EYAA 1YN5A 4YSZB 4JWUC 1WTRA 2XRSD 2CW0C 5EJWA 1K8OA 1E2ZA 3GQBA 3FPUB 2N9LA 1XLPA 1UNSA 2DLBA 2QDBA 4MHEA 4HJGE 1B1ZA 3NWSA 2K6AA 1A6XA 2ONQA 1TIID 2EY6A 1OXXK 4ILWA 1F2MA 3AM9A 2J53A 4HCEA 2XRQD 2WP9B 1GUSA 4K6DA 1LTBD 2ICIA 1KRHA 2JA5B 2NVXB 3VRAB 3SK6A 3CIRB 1H9SB 4RHSA 2KVMA 3MFGA 1GXDC 3U9OA 3C8YA 1OO9B 2B2UA 1PRTC 3OMGA 1DOYA 4KJOA 2EYPA 2Z1CA 1FNVA 1IL8A 1BOSA 1HFNA 3NQTA 1HXYD 3D6WA 3R8BA 3NTIA 2MHVA 3N52A 4REZA 4P6VF 1B50A 4BBSB 4A9AA 1CQFA 5EGTA 4BA1I 3X3MA 3DMUA 3R2IA 3CKIB 3CRKC 1YNJD 1OFFA 4DAVA 1D2BA 5BMIA 2CQAA 5FKAC 1XXGA 1WTVA 3L9AX 1XWEA 4RA8A 1E9MA 3D6CA 5LL6S 5EPLA 4N58A 2XIWA 2E6XA 4KKUA 3QWNA 2F0KA 4OZBA 1GUTA 1IGDA 1U4LA 1RYJA 1TZOA 4PT5A 2PQEA 4KKJA 1FM0D 1MPEA 5HURA 2L1BA 3I4MB 3EJIA 2CJOA 5DM63 3E5SA 1XCTL 1VR9A 2H1EA 3T51B 4K2KA 1PTOB 3QO2A 2AQ3B 2JX5A 3A8JE 1UUPA 5EKLA 1GOZA 2F0QA 4FXGC 5AFWA 3T16A 4DF7A 3EQLC 5D65A 3J7YW 1FXIA 3H0GB 2F03A 4F88A 1QOFA 2CU3A 1I4XA 4OVZA