1SEBD

Complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
234
structure length
206
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKTCMYGGVTEHDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a human class II histocompatibility molecule complexed with superantigen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc ii/peptide/toxin)
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 43
structure length 206
sequence length 234
chains with identical sequence H
ec nomenclature
pdb deposition date 1995-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sebD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sebD02
1RDPD 4RGMA 5TSSA 1LTTD 4DXFA 3DWQA 1RCVD 4RGOS 1BCPB 1JR0D 1EWCA 1CK1A 1LO5D 3URYA 1D5ZC 1B1ZA 1TS5A 5D3DA 1SJED 1D5XC 1LTID 3OWEB 5ELCA 3GP7A 2AQ1B 1XTCD 1ESFA 1LT6D 1LTAD 1I4GA 1YN3A 1JQYD 1S5CD 3BVGA 2WV6D 2J4XA 1PTOB 3DWAA 4OHJA 1HXYD 1CHPD 5FK9C 1LTBD 5ELFA 1JCKB 1DJRD 1SBBB 4RFBA 1LTGD 1SEBD 1TY2A 1KLGD 1S5BD 3EFXD 1BCPD 1V1PB 5ELEA 1L0YB 2R61A 1FNUA 2SEBD 2Z8LA 2IJ0A 2QEJC 1PZID 2QILA 1PRTD 1ET6A 1PRTF 1STEA 1PTOF 2TSSA 1PTOD 4BWGB 2XRQD 4C56C 3KLSX 1FD7D 4RCOA 1LT5D 1HQRD 1PTOH 2G9HD 2XRSD 1JWSD 1BXTA 1B44D 1EFID 1FNWA 2NTTA 5ELBA 1BCPC 1XXGA 1JWUD 1I4HA 1M4VA 3MC0B 1LT3D 1PZJD 3R2IA 2XNAC 1PRTB 1I4PA 1ENFA 3DWPA 1S5DD 1I4QA 1EU4A 1GOZA 1I4RA 1RD9D 1CQVA 3BVZA 5FKAC 1EEID 1JWMD 2AQ2B 1S5FD 1HTLD 1LT4D 1AN8A 3R2TA 2ICIA 1SJHD 4Z9CB 1SE4A 4RH6A 1D5MC 1UNSA 2CHBD 3BVMA 1F77A 3BYYB 1FNVA 4L6TB 1SE3A 1I4XA 1PTOC 4RHSA 4NZLB 2XN9C 3W2DA 1QILA 3R8BA 4RGNA 3BZDB 3V05A 1ET9A 3TSSA 1KTKA 1HA5A 1S5ED 1EEFD 4O1NA 1KLUD 1EU3A 1BCPF 1PZKD 1D6EC 1UUPA 5ELDA 5I4DA 4TSSA 2NTSA 3CHBD 3EA6A 1SE2A 1V1OA 1PYWD 4K6LA 4RGTA 1YN5A 1RF2D 4RHRA 1TY0A 2RDHA 1G8ZD 2O2LD 3SEBA 1FGBD 1T5XD 1AW7A 4DXGA 1YN4A 1CHQD 4UDUC 1LTSD 2IPKD 1L0XB 4L63B 1V1PA 1CT1D 1MD2D 4ZYSA 1TS2A 1TS3A 1LTRD 3O13A 1DYQA 3BYTB 3MFGA 5D3IB 2RDGA 1TS4A 1PRTC 1LLRD 1SXTA 2AQ3B
chains in the Genus database with same CATH superfamily
4DXFA 2IZVB 1XD3B 2NUCA 4CKCA 3I2ZA 5GMVA 2F03A 2A6EC 2BS2B 1CK1A 2VH1A 2ZCBA 4DGZA 4FXCA 3PSEB 3KUZA 3NBIA 3ND9A 1WTWA 1SNPA 2D9UA 1E1TA 1ESFA 3S15H 4OL7A 3U58A 1X3PA 4GKKL 3J80L 4MDKE 5E6JA 1JQYD 2OHFA 2ZXRA 4I6PA 4P74A 5J2RA 4OO1H 2DX5B 3L0OA 1V6EA 1NMFA 3LGJA 3HRZC 1R4PB 4JBMA 3Q3JA 4RAUC 1JCKB 4EQ5A 1NTGA 3GZNB 2WP9B 2B2UC 4HKZE 1PUTA 2HTHA 4FF4A 1HZCA 1S5BD 2PZWA 4DUZL 3X23A 4K6DA 3HOXB 3NTHA 4UY8C 3G71A 3CWIA 5GQOA 3W9CB 3PUYA 2MBEA 1E1OA 2RMMA 2IT1A 3RUIB 2ZXPA 1JT8A 2WDTB 3PZ8A 3IFWB 3NZUA 1ILPA 4BOSC 1HQRD 2KQSA 5IWAL 4ZRZA 4DV2L 2NR2A 2WB1E 1NJIC 1C9FA 2UUBQ 1MFWA 4LK0M 1QNUA 4BBRH 3ZTCA 4DV4L 1M4VA 2NN6H 5DPTA 3U4VA 1PZJD 1Q3LA 3A8JE 4N9PA 4IQZA 2AUJD 5DEHA 4KIKB 4QQBX 4WWOA 5CYUA 1Z5SB 5IGBA 2VQEQ 4JI4Q 1JE5A 1K0RA 2E5LL 1C4PA 2XK5B 5E1FA 5C5MA 2JZ3B 1TU2B 4YWGG 5IOCA 4X66L 2NYZD 4GLVB 1G2TA 3H7PB 1LM0A 4KGTA 2ICIA 3GTLB 4MGKE 1XYIA 4JC0A 3EBEA 2HCCA 4XYQA 3DHQA 2B2YC 4E3CA 1XEEA 1FNVA 1R4MI 1MI0A 2JWUA 4USAA 3ZDTA 4BKTA 2PYKA 1X1MA 2HD5B 3R8BA 3I72A 2YEPF 1WM2A 5FO7B 2MLBA 3H7SA 3PF5A 1WJ4A 5E7NA 3FDTA 1GUAB 4IUMB 4JI7Q 1H9SB 1EF5A 2EYJA 1V1QA 2RSOA 3VUYA 4XDXA 3ML8A 1TWGB 2NVYH 4JI3L 2KTRB 2XSCA 4G7HC 1GUNA 3AU4A 2DHZA 3RNCC 1KJTA 1UWMA 3EA6A 4G7ZC 1YN5A 2CKHB 2MH7A 4JGHB 2A69D 1ZGUB 3RT3B 1O80A 2B63G 2PPBC 2EY6A 4JI8Q 3OJ4B 2KJ6A 1FGBD 2WINB 1STGA 5HI1A 3VQIA 1CSPA 1YX5B 2EYFA 2R92H 4OW0A 3RZDH 3PF4A 1Y8OB 2X8XX 4KHPQ 4QY7A 1CKMA 1P98A 3P4PB 1C0AA 1SYEA 2F0KA 2WXFA 1DYQA 3Q22A 1WX8A 4M8NA 3M4OB 1R4NI 3GE8C 2IY0B 5GROA 4TRDA 2N78A 2MRPA 2PQEA 2LGXA 1LTTD 2K03A 2F0FA 5CV9A 1EUVB 2KYWA 3U8ZA 2YV5A 3CD6A 1YMHE 4KJOA 3CCLA 1JR0D 3QQ8B 3QK0A 4EGVA 1XMOQ 2N7EA 2LFIA 2LHDA 4NPSA 1FFVA 3R3MA 4B6WA 5BR8Q 3DM1A 2AQ1B 3HOVH 4YTMB 3OIPA 2CJNA 2PO4A 2L1AA 4A3MG 2FE8A 1ZDXA 5IODA 2BYVE 3KFUA 1ROEA 1PMRA 3GO5A 4OO1I 2WXOA 2GVAA 4R3DA 4MM3A 1PTOB 1XCTL 4ZRIA 1D4BA 5C3JB 2V3NA 3AE9B 1YD8U 1OXVA 3U9SA 4C3IH 4X3SA 4A3GH 4IM0A 1VQBA 4MHEA 5LL6X 2KHIA 2ICEC 1BVSA 2F3WA 2JSOA 4G57A 5L37A 1CJEA 1E8ZA 1QZEA 2LUEA 1KXLA 4NXNL 2WLBA 2BH8A 1UWVA 4DR2L 1UBIA 4FF2A 3SDLC 1N34Q 4WQMA 1C78A 2NZOA 3AEAB 2WX0A 2O2VB 4HTHA 4DV5L 3P1HA 3GV3A 1VQ9A 4I6LB 1NENB 1ZOYB 4OONA 5EBDA 3PIP3 3NWTA 1XLPA 4HMIA 2ZJPA 2B63H 4TQUS 4RA8A 3G6JB 2MQJA 4ARCA 5I9OA 4AJYB 3K5NA 1GUTA 2J42A 1YITA 1FO4A 4K2LA 2AHOB 4LF7L 1I4HA 1E0ZA 5BYSA 4F8MA 1WZ0A 1HA6A 3CCEA 3HOYG 3R7QA 2NBUA 1DXMA 2QDBA 3RLNA 5H92C 3JC66 1I4RA 4IWPA 4DN4M 1RD9D 4HSVA 4IFDG 3HOWG 3AE1B 4C7ZA 1C9OA 1HFGA 1QF6A 3JSVB 1WGYA 3U7ZA 1ILQA 1AN8A 4JI0Q 3M95A 5EGTA 2IO2B 3HVDA 2LEKA 1EY4A 4IOIE 1HE8A 2Z1CA 2WXHA 4Z9CB 2C9WB 1JOKA 3GTGH 1WMHA 4A3FH 2K8BA 3BYYB 1QB5D 1S4ZA 5K36G 4NP5A 2VRRB 4K14A 1WTXA 1Q1OA 4IUVA 1MJCA 3S9WA 4L8JA 1K8MA 5J22A 3M3YH 2M00A 1HR0L 2PPHA 1HQMC 1KTKA 4CDFC 2PCFB 5IO9A 5IAAC 3CCRA 1YNXA 2MHVA 1KLUD 1N33Q 4HN7A 1BCPF 3Q24A 1UF0A 1PYBA 4JI5L 4A3GG 2RF4A 1S40A 2INNE 2NVQH 3LXFA 1DOKA 2L11A 1N32L 3JW0X 1W3SA 1DGSA 1PYWD 4QCLA 5GAGC 1QOFA 2J0KA 1BF4A 2L0FA 4KKJA 1G8ZD 2KEEA 4DR3Q 1IBML 1B9RA 1GUSA 4IALA 3J81E 4A3LH 4LMQD 1DM0B 5HGQA 2F3IA 3NTKA 4GN3B 1VQ4A 2LXCA 4IUNA 4A3EH 1F2YA 2CU3A 4II3B 3WWVA 3E9HA 5EE1A 3EHVA 1KHIA 1XO3A 2YYZA 1C7YA 3A1QA 1PH5A 3QCAA 2N9EB 3CSTA 4EZLA 2KCNA 1E7ZA 3DWQA 1XMQQ 3BK1A 4NAMA 3IT4B 1VR9A 1V9JA 3QX1A 4XQJA 3NS1A 5EE0A 1EWCA 1LO5D 3V96A 3I5JC 3PIOA 4BBSH 5ELCA 5IP7G 4K1RB 1PDQA 1NI2A 3HOWH 4MJSA 4OELB 1NSNS 1I4GA 1WRDB 4ILWA 2GI9A 3RPFC 2LKVA 1KD1C 1WTQA 1QVCA 2NBFA 4HDOA 3IT6B 3TP7A 1TYGB 5JJLA 1A2UA 2PI2A 2GOWA 4DV7L 1Y1WB 3VH4B 1A70A 1HPCA 2PTLA 4A3KG 3A9JB 3AMUA 1FJGQ 3Q69A 4GNXC 1LM8B 1JW9D 1HCZA 1YNJC 4GLXA 2JN4A 2M0AA 3TRZA 2ID0A 4HPMB 2DJGC 5L83A 4K5VA 3ENEA 1Q7YC 5M9OA 4EOYA 4E74A 1ZYRC 2QEJC 3S1NB 3ONAB 1SN8A 2HDLA 5AFWA 4BWGB 2GMIC 1VMCA 3J7AF 1G6ZA 2PVOD 3K7UC 3NSWA 1XQQA 3B9JA 1EUJA 3VFKA 1BXTA 1VQ6A 1EOTA 2AWTA 4X64L 2Q2UA 4DV4Q 3C1FA 3BU2A 4KIKA 1FXAA 1J7CA 1H9JA 4JI3Q 4PK1A 4A3LG 2N1WA 3A0JA 2PMZB 1F2LA 2WXMA 2XNAC 2UXBQ 5LL6S 4TVAB 3TZUA 4OZCA 1XNRQ 4JI1L 3SR1A 1JOOA 1RAXA 3ZNZB 1XPRA 1WCMG 1HTOA 1Q46A 4X3TA 2Z4HA 3BVZA 4M01A 1P7EA 2RDBC 4FJZA 1F9PA 1XPUA 4C3JH 1WRIA 4WWNA 4DK3C 1VDVA 4BBSG 3KUPA 1UNSA 2B39A 2FCMA 1HFNA 2C5CA 1UEBA 1GHJA 1K50A 1WD1A 2Z0DB 4A3CH 4WJOA 3ECIA 3ULLA 2WXJA 4NZLB 3V3XA 3VVWB 3V05A 5JHAA 3L10B 4K3CA 5C4JH 1B53A 4IPGA 1DOIA 3TS2A 3CC4A 2PEAA 3GTKB 4O1NA 1TKGA 2K05A 3APCA 3BDLA 2AMCB 1VQLA 2RD0A 4ZOHC 3I70A 3DHGC 3RI7C 1WOCA 4KDLB 4FA6A 3B2GA 5C3WA 3H3VH 2RSUA 2AWOA 1DOLA 1WTOA 4RGTA 2KCCA 4NXML 4M0WA 3S1QH 5EQ0A 2KNBA 3FPPA 4DUYQ 4A90A 3SEBA 1WXQA 3QJZA 4DPGA 1ICWA 3FRPB 5IT9L 3MWYW 1BBUA 4JI4L 1ENCA 2BWES 2BE5D 2HJ8A 4ZCKA 3AI5A 2L0CA 4DK1A 4L63B 3TEHB 2KVMA 4YTPB 1P0RA 3P4QB 4N8FA 2QA4A 3RNGC 4C7YA 3KH0A 1PYSB 4ANWA 2L00B 1MSGA 2EE1A 3DWMA 4C4VB 1NMGA 4W9LA 2B8FA 4G0NB 2BYTA 1J0GA 3AE6B 1AE2A 1XLQA 3ZJUA 2JA7H 3KDFA 4GN1A 5D3DA 2KECA 5C4XH 1LTID 2NCNA 3Q0AA 4UP8A 1NYRA 2K01A 4LF7Q 4DR4L 2CFMA 5DLQE 1RM6C 1HNZQ 2K50A 3D6CA 4DUZQ 4GOPA 3P2BA 5DPRA 1CZGA 2SNSA 2LRUA 1YIJA 3VA7A 2VB3X 1B2TA 3KF6B 3IFTA 3W5UB 2F0VA 4ZKCB 1SBBB 5IIFA 2K1BA 2ZJDA 3AE3B 3A54A 3TEZA 4GIVA 1D7QA 3M9BA 3ML9A 2F0SA 3H94A 1V1PB 4PZ6A 3J80c 5IT9E 3FKIB 2E3TA 4JI6L 3SGIA 2E2JB 5JJKA 4YIJA 4H7BA 1I50H 3ULPA 2ZNVC 2B2UA 3DLLA 4A3KB 2OCEA 3MFYA 1U4RA 1VDZA 3A56A 4C1NI 1O7YA 2OTLA 4GSWA 4HCPB 2KFKB 1DONA 1E7VA 4CYEA 5DM63 3HOZG 4FYDA 3KQ4A 1B44D 2B2VA 4JPBW 1UEAB 1XXGA 1UD7A 2RGFA 1QQRA 1KLVA 3ER0A 5JEAJ 2PLPA 3AFPA 4UP7A 1IW7D 3U7DA 3BJUA 3HOUG 1A62A 4M1UB 5IYCG 2UXCQ 1ENFA 2E75C 1TWCB 4ICVA 1VRAB 1G51A 4KKSA 3VXWA 4FO2A 4N59A 5H1SE 2AKWB 3KWLA 1E0BA 3QG1A 3MC8A 1FIQA 1WMHB 4RKBA 1WR6E 2K6AA 2NVUI 3AM9A 3QO2A 2OWOA 1A5RA 2I5LX 4X6AH 1LT4D 1RJTA 4BY1G 2N0SB 4LDTD 2OEOA 4OO1G 4N9F4 1F9RA 1XTDA 5EKIA 4QIWE 1Z9FA 2AL6A 4GMVA 3S1QB 1WJUA 2IY1B 4FADA 3U9OA 2BGFA 2BA1A 4XTCS 3W2DA 5C0XJ 2R3ZA 2MBQA 1H9SA 3F2BA 3MVVA 1EY7A 4LFCL 2J52A 4FXDA 4ZQ3A 3AEDB 1U4LA 5ELNA 5JVH3 5FLXE 1JRUA 5J3BA 1F9QA 3H1UA 3ZJVA 4YCVA 3B08A 3OLMD 3AE2B 1M1KC 3H3VI 5DNFA 2MP1A 1W6JA 3I73A 2K5DA 5JH5C 3CSFA 4RHRA 3RULA 5IE8A 4TKNA 3CCVA 3D3RA 1B50A 1WM3A 4WJQA 1Q90A 1B9MA 1BBWA 1QOHA 4DNRB 5IGGA 5FLXL 4IO9A 2KLGA 3X3MA 2WYQA 2EELA 4JW0A 1R9TB 2BOSA 2VL6A 2KHWB 4LFAQ 1MHXA 2NPTB 3DUZA 4A75A 2I5HA 3A5UA 3OW7A 2HIVA 4DR1Q 2NS5A 4K8IA 4LF4Q 3J80i 5A35A 1E6EB 2I38A 2ENBA 1JC7A 1M94A 4CDCC 1QVFA 3BYTB 3D0FA 3MFGA 3TMEA 1U0LA 3RZOH 1WE7A 1ZE3D 4YSYB 4IFDI 1N60A 2LASA 3Q8AA 4RGOS 3A8IE 3E56A 1BCPB 2EJMA 2MSED 2OF1A 4PZ7A 3J80E 1SSNA 1IXRA 1QUQB 2CWAA 1EQVA 5GAHC 4BY7G 2JA5B 3N6RA 3HZXA 1N33L 3OPOA 2KMMA 3N52A 4G7OC 3PO0A 1YNNC 3RNUA 3VR5A 2PMZE 4JIOU 1I5FA 1XLOA 3R66C 1IYFA 3BS1A 1WI5A 3EJIA 2JU6X 3J81c 2K1FA 1HZ9A 4Y7NB 1L1OA 1NBWA 1LTGD 1PA6A 2BW2A 4A3IB 3S1MH 1GNUA 4R4CA 1G6PA 2Y0SE 4EEWA 3VR3A 2F0DA 1OGWA 1XLNA 2AUKA 4RKLA 3ZRCA 2VW9A 3NVVA 3OYYA 4X3UA 4BXXG 4DDID 2E2IB 4HIDA 4M8MA 4LWCA 3DWGC 2IY5B 1SIFA 4YSZB 1STEA 4DAYA 2N9KA 4FN2A 3T1HL 3AB5A 3PVLA 1NAPA 2LMCB 3VYUA 4E6IA 2PNHA 4YWKA 4JI6Q 3HOZB 1HEZE 2JQRB 1RHPA 4II2B 4ZHPA 2G3QB 1RL2A 1EFID 5JPNC 5ELBA 1RLFA 4BZAA 1V5OA 3I4NB 4NW2A 1IBLL 1HNWQ 4CQNA 1WH3A 4F7ZA 3CAMA 1R9TH 1C77A 1WY8A 1ONLA 2PW7A 4TV3A 3BZCA 4XYOA 3A9KB 1T9HA 1TWCH 2INPE 4MT5A 1I94L 1WYDA 2E6XA 5C44G 1ICFB 5C44B 3PO3G 3PO3B 5NUCA 3K0YA 2KO3A 2MNAA 4KX6B 1RIPA 4LF8L 4DKAC 2DAFA 4GDKB 4MGYE 4AYBG 3F1ZA 4DV1Q 1WWTA 5G2NA 4PZ8A 3M7GA 3TCAA 3UIPB 3L9AX 3C2PA 2AQ2B 4A3PA 4IN3A 1JJ2A 5M3FG 4MM3B 3W5VB 4KDIC 4FBJB 3IXSA 3HS0C 4ID6A 2KDBA 4MZ9A 2KKCA 2LJ5A 2V3PA 2K6DB 2KVRA 4JI2L 3P75A 4S0RA 2MCNB 1NI3A 3MZ5A 4IG7B 3SK6A 4BA2I 3LB8C 1WX7A 2R2QA 4AWJA 2FBWB 1VQIA 1CA5A 2D3GA 2FUG1 3A33B 1KAAA 2IGGA 1EU3A 1WGDA 4CJ0B 4FULA 2L05A 1P7FA 1HNZL 2DYMA 2L52A 4HJKA 5M5WH 3FILB 2NTSA 3AQQA 2PZTA 2JRHA 5C1ZA 1X55A 2MFIA 1O78A 1X6OA 2FNJB 3P4SB 2RDHA 4WJ4A 2EJGC 2O2LD 3JAMi 2UUAQ 2MJ8A 3UI3A 4DR7Q 1EZ8A 4JV5Q 4AQ7A 2CQAA 4FXKC 3HFZB 3HG9A 1LTSD 3HKZG 2IPKD 1VQ5A 1JMLA 1T0SC 1L0XB 4GLAC 5IYCH 3F2UA 1GB1A 4OWTB 2KHJA 2FIDA 2I1KA 4HRSA 4B3SL 5D3IB 2RDGA 3PRZA 1LACA 3WDNA 1WJNA 1WXSA 5LMUQ 1BO0A 1D2BA 1Y56A 2ATWA 1PFMA 2PQAA 2BWFA 4L5QA 2RVLA 1YJWA 4MEMA 2DGYA 1Q5WB 2MJEA 2KX3A 2D62A 4FVMA 1JROA 3DEPA 1YJIA 4JBKA 5G55A 2K22A 4ALPA 4OWWB 4A3FG 1V49A 2GBRA 3GP7A 1V8QA 2PI2E 3NE5B 3AU7A 2JT4B 2KQ4X 1GUGA 2AWNA 4B9XA 2QDLA 3S2DH 2KDFB 4JG2A 2RDFA 1ASZA 1E2VA 5BN4A 1ZW7A 2JP1A 4YY3L 1S1QB 3ITPA 2D5DA 4DUYL 4OHJA 1HZ6A 4UPAA 1CHPD 4FF1A 4IKGA 3VR8B 3E0JA 3NBHB 2JY6A 2REXA 3KJOA 1E2ZA 4ODGA 2KXJA 3T9LA 4A3IH 4LNFA 1V43A 4NAWA 3SDZA 3HOXG 1BT0A 1TT5B 3N30A 2GBMA 3MXUA 2I46A 4NY0A 1I42A 4W9IA 3SK5A 4KGSA 4L5TA 3OTOQ 4L5RC 1LABA 4K0KL 3B1LX 3VAWA 1X3FA 3QR8A 5D65A 3DVNU 4WJPA 4UP9A 1STHA 1I3QB 3I4OA 4DA2A 4R1JA 1BUIC 4HPLB 1IBKQ 4HMJA 1VQFA 2WXLA 3L7ZC 1LT5D 1SMXA 4LF9L 1PTOH 1JWSD 1GAQB 1AWDA 2JXMB 4HJAA 1I3QH 2EMSA 3H91A 2K4KA 1BCPC 4DHZE 2L9HA 2R92G 1TZ1A 3WAMA 1QNKA 2K5QA 2WU5B 2PE9A 3I63C 3DBHI 2J7ZA 2WAQE 2A6HD 1L6VA 2MX2A 1WD0A 2KEDA 4H0LC 4JOIC 4N8X1 1Y1VH 2WXPA 3VRAB 5FR6A 2V4DA 3T1YQ 3VTUA 1L2NA 4LTUA 3UINB 1GOZA 1CM9A 2ZTCA 5E6NA 4CDDC 2F0HA 3CPWA 5M5XB 5JXVA 3KVFB 1KH0A 3K57A 1CMXB 2QC8A 5KYLA 1WX9A 3CXCA 2WXNA 1N8RC 3I4MG 2EKEC 1KF6B 5TR5A 1UGJA 2CKZB 3E5SA 3DBSA 4BBRB 3DCGA 1GJZA 5E4WC 2N4FA 3JAMc 1Z47A 2MBHA 1QE6A 1OEYJ 2LGYA 2Z0SA 3DBRB 2J0TD 1BKBA 1FEHA 1C8CA 2EYMA 4N6EB 4H13C 2EOTA 3S1NH 1M90C 2LVOA 1R4NB 4DFAA 2JA7B 3N32A 4MSMB 3M4QA 5J18A 2FAZA 3SFEB 3K0XA 4IFDJ 3HOUB 3PGEA 4JX1C 4C80A 5HURA 1UZXB 5COYA 2KWDA 1VQNA 1K83H 2A6ED 1YJ1A 4IUPA 4B3RL 1F9JA 2JA6G 5LMNL 2XK5A 4ZLTF 3QJYA 1V1PA 4YY3Q 5I6YA 2RCNA 4R8NA 2UUCL 2KDEB 4US9A 4IJLA 3H15A 3WOEA 2JYEA 2MO1A 4R4IA 1J9OA 5KRUA 1Q10A 4Q2JA 4L5SA 2D0OA 2IO0B 2LSSA 1EIGA 2R93B 3RN2A 1BQQT 3ZYYX 2Y5CA 2FMMA 3D4WA 1TS5A 1SJED 4DV0Q 2E76C 3RZDB 2XBBC 1TIFA 3PS6A 2Q2IA 4LK1C 1WI0A 2JWZA 1KABA 4KLKA 5CV7A 3VR2A 4F7XA 3A4SC 2Z9HA 4A3CG 4GS3A 3J9CA 1R4QB 1GC6A 1I94Q 1LXDA 3Q8CA 1A3UA 1N36Q 3NENA 1GVPA 1E8WA 1P1AA 1FPYA 1B7YB 5K36H 3PGZA 4G3XB 2CVRA 3U4EG 1CA6A 4A3DB 1L0WA 1TY2A 1BCPD 3EN2A 4YCUA 1PH4A 5FJ8H 2R61A 4JI2Q 3R3OA 1UWXA 1RKNA 4MN3A 5IOIA 3HOYB 3J81i 1EY9A 2ACZB 3AXCA 2Y0SG 5MPOA 1PRTD 4X3KA 2KJHB 1PRTF 4LLGM 4OVZA 3BG3A 1G91A 2CHWA 1K28A 4XGAB 1FL0A 4DK0A 5I2XA 2M8SA 2A19A 2KENA 4W9DA 4PQXA 3IAS1 2WDVB 4LW1A 3P63A 3VDYA 3ZNHB 1IBLQ 1HNWL 3TEYA 2OQKA 2BS3B 4KD4A 4U673 1X3EA 1PV4A 4KKUA 3CCQA 2LGDA 4G50A 3KBXA 3MC0B 4YXDB 1VZ6A 2JA5H 4KD3A 2C9OA 2YU9H 1JALA 2ZW1A 2DY8A 3DWPA 4OGQC 2IX1A 2GBKA 2RPVA 2IGHA 3VR9B 4CKEA 1XNQQ 3GTKH 4XIGS 4JYAQ 3W1SA 2ASQA 4RM9A 1WGKA 2B2WA 2K0PA 1WXMA 2B76B 1TWHH 2F0EA 3R2TA 4EFOA 2GB1A 4IUUA 1X65A 3MXPA 4DR3L 1IBMQ 1I6HH 4ABNA 2CH4A 1J5EL 3IAYA 2B3GA 1AZQA 4RH6A 4WJNA 4HIOA 4FHKA 1F2MA 2KCMA 4OWXB 2F0PA 3IL8A 1MIUA 2N1VA 3PHXB 1N62A 3OMCA 3I4MB 3C3LA 2D2CC 2WXGA 4X57B 4DXAB 2C5LC 3PSIA 2M19A 2DYOA 2IO3B 3RNBC 4D2KA 3RMHA 3S16B 2CR5A 2WKDA 2E74C 2MUYA 2F4IA 3RCZA 5ELDA 3VTVA 1F0ZA 1E90A 1Z2MA 3CHBD 5I6WA 2QW7A 2UWQA 4JI8L 1RF2D 2C60A 3BK2A 2KN4A 3FAHA 1K0SA 5CHVC 4QIWB 2XWBB 3G6EA 2AX5A 3GDEA 3VYSA 3TZDA 1MJEA 4C1NK 3ZXVA 4MTKA 1QZHA 4MSQB 4UHVA 2W3RA 3STBC 2ASBA 1KAWA 1X3GA 2JX5A 5J1ZA 3DM3A 4K0KQ 1GKHA 1L6UA 3PLVA 4KSLC 1TS4A 2G45B 1Y8RC 4XE0A 1F52A 4C3HH 1ZEQX 2RA4A 1RCVD 2RKSA 1IBXA 1WTVA 1E24A 4DAVA 2K75A 3EFCA 2KVZA 3A4RA 5IT9c 3H3VC 3TDQA 4JBJA 2VNUD 4HJ8A 4K81A 1STAA 2DENB 1Q86C 4MELA 4O2DA 3M4OH 1Y1WG 3OIQA 1LTAD 4W9EA 1PGAA 3L0WB 1TJEA 2PKOA 1XMQL 3T4AC 4P1CC 2WV6D 4V190 2JYOA 1NY4A 4W9HA 3AECB 4TKOB 2EPBA 2ZVNA 4MH8A 1PHJA 2UUAL 4BY1B 2Y0SB 2JSVX 1UE1A 4CKBA 4FJYA 4LFBQ 1CKNB 1EWIA 4C3IB 4GZYC 2Q8IB 1YZ6A 1N63A 5CV5A 3W1BA 3IVFA 4IC7B 5EPKA 4IURA 1N5XA 3LX0A 4XWWA 3DEOA 2VUMH 2DY7A 1SNOA 4A3DG 2J7QB 3TS0A 5I2YA 2F3VA 2KWVB 4K3BA 5KHOA 4WH4A 1ET6A 3VYRA 2R7ZH 4GKJL 5DCNA 4C2MH 4OVUA 2KACA 5EBCA 3S17B 3N3KB 2D5GA 4L2YA 1TWHB 2VQEL 1NDDA 2CCZA 2NTTA 3RN5A 3WA0A 5CMDA 2AEHA 2JF5A 3DVGY 1N32Q 2VUMB 1OFFA 2GBJA 1BMLC 2DZMA 3UQBA 2E2JH 2WXQA 1Y1VB 3ZJTA 4DF7A 1ACCA 1Y8PB 1VQAA 3U2SC 3KLRA 4JCVE 4C2MB 2LI5A 4XQQA 2CJOA 4ZRJA 2FCQA 2BYEA 2IGDA 1BBXC 3VYTA 4B3ML 4C3HG 3A9JA 3K59A 3K7AH 1RODA 1WFQA 1S5FD 1RTNA 4A4IA 1MG4A 1E10A 3AE7B 3J81j 2JZPA 3PRPB 1SYDA 4QMGA 1K52A 2KTRA 3W1SC 3GOEA 3AULA 5T8IA 2CHBD 1IW7C 3S2HH 1IKMA 2EY1A 3HOVG 2L0TA 3L17A 3ZVVA 1BNZA 2K5WA 2MQHA 3NJTA 5EDSA 4P1BC 2SAKA 4KV2A 4N58A 4RGNA 3S1RB 2JPHA 1E7UA 3Q8EA 4LNIA 3Q14C 5EPLA 4WFN3 4B3TL 1HR0Q 1YJ9A 5FJ8G 5KNBA 4OVVA 2JEAI 2MHJA 1CKOA 5CHWA 2PW9A 1D6EC 1UUPA 4A3IG 2R6GA 3AEBB 2QMTA 2B2TC 2D11A 1V1OA 4P7IA 3PUZA 5IYDG 2XTIA 2JZZA 1H4RA 3KYHC 4IUQA 1GO3E 3N1ZC 1O7LA 4H2AA 3I4NG 5LMUL 4A93H 2JYTA 4RMAA 2KWCA 3U30A 3UDIA 4BBRG 2NBVB 2LVPA 4PYZA 1VJKA 2V0GA 1H95A 2MP2A 5BO4B 4KJNA 4ZYSA 2K04A 2JA5G 4JI0L 2V4IB 3Q8FA 5C44H 2INCC 1J19A 1EOVA 3H09A 2CW0C 5C4ZA 4XX5A 4IUTA 3TJPA 4ANVA 1RDPD 2KMCA 1V97A 3OJ3A 1EZ6A 2K25A 2OXPA 3VDZA 4R8IA 3HOYH 3NVWA 1SFOH 3ZKJC 4GNXA 3L13A 1EYAA 4DR6Q 1ZKHA 2BDOA 4LF5L 3SFDB 4PMWA 4CBVA 4QGUA 4AS1A 3JSVA 1HTQA 5HHDG 2OJWA 3HP3A 1LT6D 2EJFC 2HHHL 2HCIA 5CV4A 1HHVA 3KBGA 3EROA 3DOWA 4L23A 4LAAA 1PXUA 1AYFA 4JI1Q 3Q23A 4A3BB 2A68C 3GTOB 1EQQA 1HUNA 3DWAA 4HAEA 1FD6A 1WJ6A 4X62L 4FDBA 1ASYA 4JE3B 4ARIA 5FK9C 4CJ2C 4PS7A 1G6JA 5ELFA 3NVYA 3J7AV 1WIAA 3BZKA 2BYFA 2SNMA 2H89B 4FNFA 2ZVOA 1C48A 4WJWA 4F8CB 4LF6Q 3DBLI 5IP4D 4XXEA 2WB1B 5DPWA 3KYDD 2UUCQ 1FXIA 2OEDA 1XMOL 2HQLA 2JA8H 2ZPYA 2JJQA 4HR7B 2Z6KA 1OXUA 4PT5A 3AE8B 4TUUA 1PH7A 2Q8RE 4AUQC 1SNMA 2OTJA 4W9FA 4HDQA 1U4PA 1VQCA 2B2WC 3N1YC 1X3QA 4EQNA 2A69C 1BOSA 4KGRA 2PE6B 1JWAD 1L5PA 1OQRA 4G11A 1ML0D 3VTWA 1X9NA 4C00A 1K83B 2EYOA 4IM3A 2FCNA 1IZ6A 4XQNA 2N9XA 1OXSC 2KJRA 2WKCA 2GA4B 2YTXA 1SE9A 1IP9A 1X54A 4JK1C 3QB3A 4BBNC 2DN8A 2IW3A 2J0MA 1MBYA 1EY0A 3S2DB 3TREA 1SE4A 4WRDA 2QHOA 2N55A 4BS9A 2C7HA 3I55A 1H9RA 3APDA 1C79A 5JHBA 2L12A 1OXTA 4RF0A 3UGBB 2C35B 2FINB 5BN5A 4IJHA 3TSSA 2WAQB 2V1YA 1HA5A 2ZCCA 3PZ7A 2W3SA 2RQXA 3S16H 3R93A 4EX5A 3Q8BA 3ZGZA 3A74A 3G4SA 2QJLA 2WB1G 2OOBB 3A9KA 4AOFA 1VMPA 4Y7NH 1SMYC 3CU7A 1PQSA 1PZKD 2LRWA 3U50C 3BY4B 3D31A 2EXDA 2W82A 1DZ1A 4TSSA 4HCSA 4MNOA 5IGEA 1AE3A 1K8AC 3GV6A 1EWYC 1MI2A 2JA8G 2LMCA 4ITKA 4GKKQ 2FUHB 1GUOA 1WTRA 2KN5A 4WWPA 2C7MB 1A0IA 1WGRA 3VR4A 1HZBA 1KC8C 1PGXA 5LXIB 2F0QA 1WFYA 3I90A 3TP6A 5CV8A 5FO8B 2ZJQA 3X0WA 2F0WA 2HUGA 4O42A 3DHHC 4G4KA 3V61A 4ZRKA 4IW0A 1VQGA 2M4NA 4O0AA 4AYBB 1EFWA 3I56A 1U4MA 3K5LA 4ZKBB 1JMCA 3RN9C 1MHHE 3D8GA 3Q3NC 2M56B 2X69A 1K3BC 3GB1A 3HK0A 5CV6A 4M02A 2INDC 3PO3H 2BT6A 3FHWA 2ZJRA 5E6PA 1XJVA 1K8OA 5FO9B 2QEXA 2NVXB 4ZUIA 1PFBA 1CZPA 2HQEA 3CP0A 1YN3A 5FLMH 3H6NA 3M62B 4A6QA 5J39A 1FCLA 3BINA 2MA9B 3H9DA 4J3OD 4WAAA 1J6QA 1STYA 1VQEA 1YOVB 2VZAA 4HCNB 2KX0A 1LTBD 1FRDA 4R4OA 2WQYB 2Y5PA 5CBAE 1YQ3B 2BQQA 1NE3A 4GN5A 2W54A 3HKZE 3I3TB 1D8LA 5D14A 1IYUA 4Q5VA 4LUVA 1OQQA 3ZXRA 2E8GA 1ZPSA 4B9KA 2BTEA 1EWHA 1PFSA 1IGDA 3FILA 3DBHB 3JYUA 5T1IA 4YHHQ 2QIEB 1VQJA 1GC7A 3HEJA 2CW0D 1ZUD2 2QSDA 4MACA 2I2YA 1I6VC 2UU9Q 3RNEC 2LGSA 3VA5A 5T1GA 4DAPA 2JA6H 1P9DU 3NWSA 2A5HA 3JAME 3VRBB 1GPXA 4UAIA 4KTAA 2K7VA 2HDMA 4A8XC 3QIAA 1ZYRD 1IYJB 4IPDA 1VQHA 3X3NA 3K80C 1K9MC 1MG8A 2N3SA 3C8YA 5C3EH 1HUMA 1P16A 4XYCA 3ERSX 3L3OC 2VQFQ 3C0RB 3DDCB 1KDCA 4DV6Q 4NJ6A 3F2DA 5LHY1 2I1JA 2KJXA 1IHZA 3MP9A 4J6IA 1HZAA 1I4PA 4JI7L 1FJGL 3PTFC 2DZKA 1IPGA 3HRDD 4QUFA 3PRMB 3S1MB 4B0MA 4PG3A 5A2QL 1SYCA 1SNDA 5BMHA 1CQVA 3O65B 4XDCA 5FKAC 2G5DA 2FCSA 3UE1A 2N49A 1TBEA 4US8A 3I8ZA 1SJHD 4OX9Q 5A2QE 1DGJA 1C4CA 1V9PA 1O7ZA 1F77A 2WGSA 1MGSA 2ZM6L 4L6TB 1SF0A 4DAYB 3KUDB 3OOCA 3MXNA 4R4TA 1YI2A 1SFOB 3WOFA 2DZJA 2B2YA 1CFMA 1FVIA 3N20C 3P4RB 3A7LA 3FP9A 2XGTA 4C3HB 3MEFA 3J81L 1A15A 3PPAA 4M00A 1EYGA 2R93G 1NYQA 2KOXA 2IWHA 1WCMB 4C3IG 1J7AA 3ZUNA 4I65A 2WAQG 2EQSA 2KANA 4K6LA 4YCWA 5F2DA 3IAM1 5HG2A 4E71A 1GJXA 2VUMG 3ERQA 2LWPA 4X65Q 4LJPB 1EF1A 2ON8A 3MHBA 5J17A 3S15B 1S72A 4JLCA 1Z6HA 4LFAL 2R7ZG 1CHQD 1CQFA 2CQOA 1YJNA 3D4RA 3RZWC 3S14B 3TN2A 2JA6B 4C4VA 2VB2X 4RWSC 4WWMA 5M5YB 3RNFC 1TS3A 1N9WA 2JA8B 1JWBD 1T3QA 1LTRD 2YTYA 1PVOA 2B63B 3AEVA 4A3JH 4BKSA 3LYYA 3C1EA 2B2TA 5IYBH 1PRTC 1LLRD 1KDBA 5CGKA 1A2TA 1XF5L 2IHEA 4KN4C 4RGMA 4TQ0A 3ALBA 2JK8A 3HOUH 4CHKA 2H1EA 4HIMA 3MEHA 5EAYA 1QZGA 3GZNI 3OTOL 3TIXA 2K5NA 4JWUC 2B29A 1SIJA 1HJPA 2WIIB 4JBWA 1EL0A 2NZHA 1VQ8A 3IHPC 2I0QA 2IX0A 3A5ZB 2L32A 3KF6A 4DR5L 4EVOA 4A3EB 1PH8A 4LFBL 3MJWA 3NY5A 2H5XA 4K7SA 2F4VQ 4ICUA 1TQOA 2BKRB 2VQFL 3FVQA 1J8IA 2O6VA 5KNDA 3K7AB 3T13A 4EKUA 3UF8A 3W5OA 1EY5A 2ZTEA 5C0XH 3UDGA 1QKZA 3MHSD 4J8QA 1SEBD 4A3GB 2NZ1D 2IO1B 1L0VB 4CDEC 4OZBA 2DNCA 2NMQA 1FGUA 1X56A 3AEGB 3HM3A 2BF8B 2M17A 4B9WA 3H6MA 5C23A 4HK2A 1Q8KA 2QILA 3GTJH 4GDKA 4ME5A 4HXDA 1ZP0B 4R9WA 3WALA 4DAMA 4EE2A 1PTOD 2MPMA 4IM2A 4OX9L 4IOAA 2UXCL 4QJFA 4POFA 1QG7A 2L3ZA 2SDFA 2G9HD 1NNXA 1NR2A 2XVSA 3AH7A 4R4QA 2K39A 3KK7A 4LJZC 1YNJD 4NXNQ 1E7PB 4EQOA 3NHHA 5DM73 4DV2Q 1Q1EA 1VLBA 1YJJA 2PJHA 3EQLC 4JQWC 3RYTA 3OSOA 1BR9A 1B9NA 1QOBA 2D2QA 3BWUD 3CCSA 4WQOB 2RHSB 5C4HA 1A3VA 1Q1BA 5JPMC 1FFUA 4AH6A 1C1YB 2JRIB 3Q6BA 3NOBA 4YT0B 4XC2A 4QL5A 3TEXA 1TWFH 1JRPA 2AL3A 2G4DB 5KGUA 3P42A 3BDCA 3QWZB 4KI0A 1QVGA 1UELA 4GKJQ 3FC4A 1U5KA 5FLMG 2N7JA 1K73C 5CC4A 4A93B 4GDLA 4I7AA 1GB4A 4BAXA 1D5MC 4HJ5A 3HKSA 5KIXA 3FPUB 5KYIA 5C4JB 1SSOA 1YQ4B 2KFKA 3DBRI 3FMCA 4C3JB 1E2WA 2KDMA 1C76A 1PTOC 2AYOB 1KRTA 1HRJA 3HUIA 5AJ3L 2VH2A 2QGQA 1L7YA 4B95A 4B0EA 3RFZB 3VH3B 4WAFA 5CTRC 2O4XA 3P1MA 4W9GA 4KY6A 2OQ0A 1T5EA 3MXNB 3A55A 3TQYA 3UI2A 4A3JB 2UUBL 1OO9B 3KW5B 1B3AA 5HGTA 4QF4A 4CGYB 2M2LA 4ZDVA 3E3XA 2O2VA 1IL8A 2KLCA 3DBLB 3CRLC 3M4YA 5EE3A 3I57A 4DNIA 1LQBA 2G1EA 2NVTH 4GNXB 3GTMB 5AZGA 1VQPA 5FOBB 3WAOA 5M3MB 2VZKB 2F0NA 2M9VA 3K58A 2W9NA 3T16A 4BBSB 3HKZB 5C4XB 3GTOH 1F2RI 2N8NA 2DAJA 3SXHA 5BYRA 3N9YC 1MD2D 1SRUA 3PO2G 2O6VD 3IRBA 5FR3A 2G4SA 4EUTA 3GD7A 3CRKC 2EY5A 5BN3A 1TKWB 2AQ3B 4ZRPA 3QWNA 3W1GA 5TSSA 2JQOA 2VY3A 2I07B 3NEMA 3WANA 2LXKA 3KDFB 2WACA 1V80A 2YLMA 1LTLA 1D5ZC 2UU7A 5BR8L 3PIPA 3TEWA 3PV0A 3OWEB 2I5MX 2HIXA 1TWAH 1EYDA 1F9SA 1K8GA 4EZKA 4BOZB 1QWYA 2F0UA 1FM0D 2WNMA 2Y3AA 2IHFA 3S2AA 1U9RA 2XWJB 2WDRB 5EJWA 5C3XA 1I6HB 4JVZA 3T1YL 2R7FA 1Q81C 3LDZE 2JXXA 5M5XH 4GOCA 3GTQB 4OIKA 4ULLA 1Z7TA 3CW2C 2RR9A 4ZRQA 2MWSB 2R2OA 4CHTB 4IWOA 3MXGA 4JV5L 3ND8A 4KVGB 1KIXA 4KHPL 5ELEA 4YHHL 3NG0A 5IYDH 4H44C 2L83A 4F88A 3GTPH 3KUCB 1KNEA 1PZID 4PS3A 1MSHA 1GD7A 2MEKA 2OJRA 4TQ1A 3QIJA 2TSSA 1NEKB 4NB3A 2XRQD 3H0GB 2MW5A 4LUZA 4DQOC 1P8LA 4A3EG 1JORA 2FIFA 2UYZB 5BYQA 2NVTB 1JB7A 3CMMB 2DJFC 3EC8A 5IYBG 3S2HB 3IG3A 4JI5Q 1PH6A 4S17A 3PZDA 5AJ3Q 3KF8A 4IPCA 1I50B 3R2IA 1EM7A 4LNKA 2MGSA 1V8CA 1YHQA 1EO6A 1OTCA 4L1BA 1VQ7A 3M85A 1E5WA 1I4QA 3STBD 3W3AA 1TWFB 1IUEA 3PT2B 1PH2A 2C7NB 4A3OA 4DHJB 3NELA 4WURA 2L15A 3MA2B 2RCFA 4MGIE 2CU1A 2M1MA 1WTHA 5EPJA 3GTGB 3CC7A 2J53A 4A9AA 3I4LA 3PIO3 3BVMA 1XNQL 1OQYA 5BMIA 1JJCB 1DD2A 1ESRA 3DPDA 3OHXC 3T3OA 1PH3A 4V0BA 3SK8A 4YWLA 4AQYQ 1SROA 3EUB2 5AEKB 3BZDB 3KLWA 3P20A 4OZAA 1VF7A 1VZ8A 4HJ9A 3HGBA 1CUKA 2KQ7A 3ZLZA 1DOXA 3NK9A 4J15A 3W1YA 2GN5A 4BXXH 5JZEB 4KY7A 3BDOA 2F0IA 4K7WA 2ALYB 2E5LQ 4LNNA 1EYCA 1FYCA 2A6HC 1NUCA 4FXGC 2MBBB 1O7IA 2WS3B 1BUVT 1TKYA 3RUZA 4A3DH 2BBCA 4MIUA 4B3RQ 3I7FA 4KKTA 4DNTB 4A3BG 2ZW0A 4ANUA 2BVCA 3TMPB 2DNEA 2DNFA 4KK7A 1NBFC 2F0LA 1OXXK 3WAPA 1LFDA 2LD9A 2KMAA 4ASWC 3IKJA 3K9PB 3D32A 1H9KA 2W55A 4Q0FA 4HIKA 3PLUA 3NPPA 1WGGA 3ZQ4A 3C19A 5IA7A 4HVBA 5L95C 3K9OB 3SR6A 3MTNB 2KC1A 1SNCA 2LS01 1K51A 2VZKD 2XEWA 3AE5B 4IWQA 1FMAD 1E3PA 2K14A 2V9HA 3EFUA 1KOTA 1B1ZA 2VS1A 1L2FA 4GXBA 2ZTDA 2LHEA 1U4AA 4YSXB 4DK6C 3Q2AC 4PMCA 2JE6I 3F2CA 3L4PA 1VS0A 3CIRB 4XWTA 3SE0A 3CCJA 2UXDL 4NDXA 2D3AA 3HIZA 3M63B 3BVGA 3U4ZA 1RYJA 4DV7Q 2J4XA 3L54A 3R7RA 1Y14B 3KF8B 3PMFA 1L4DB 3SD5A 1N61A 2ZNVB 2F0GA 2KHSA 1TR5A 4POGA 4RG1A 4AYBE 4DV5Q 4BKSD 1NR4A 2CHXA 4NQLB 1B4OA 1QCBD 2EIFA 5JJZA 2B3AA 2CS4A 1L1OB 1KLGD 2LVQA 1H9MA 1XWEA 4BKGA 2PVGC 2ZXOA 3NXWA 1XX8A 2Q8TA 1YNND 3JAML 4NQKE 4B3MQ 1GG3A 2O5IC 3V60A 4K5WA 5IN7A 1EY8A 2QKIC 4CO7A 1R7SA 3EVQA 1ZKOA 2YEPB 4FF3A 4C56C 2H88B 3KLSX 1AEXA 4RCOA 4YWMA 3PO2H 1LV9A 4X64Q 2XRSD 1VQMA 2A8VA 3GS2A 4RNAA 1FNWA 5LXHA 5D2MB 1C4AA 1YQBA 2V4LA 2Z59B 4DU9A 5IP9H 3H0GG 5DAUA 3ETRA 3T53B 3MHZA 3ZIMA 5G5GA 1UBQA 4FHJA 2EXZA 2L5TA 2Z6KC 2WHIA 2DZIA 4IOCA 4EQPA 4JYAL 2FMCA 4Y52H 3SU8X 1EU4A 2LGIA 1M8AA 4ACFA 4NJCA 2KZRA 3E9IA 2FHTA 2D0PA 1JWMD 2Z6BA 2NPTA 1V86A 1D1KA 4BA1I 1KFYB 4MGZE 2CWPA 1JB3A 1HTLD 1TIID 3M4PA 3ABVB 4GOPB 1Y69U 1JJGA 4OEMB 4LF9Q 1WXAA 2PMVA 4HROA 4XZ4A 3HOVB 2TMPA 1KDAA 1RTOA 2ZPNA 5KNCA 3ZTDA 3CQZH 5IGFA 3ZJYC 2V1CC 1LGRA 3IBEA 4N9TA 3JVZX 4AP4C 3AEEB 3HOXH 1YBYA 5AUKA 2Y5BB 1DOYA 4AIMA 1W2BA 4M0WB 1EIFA 4IPHA 3BIID 5HKHA 2K32A 2A68D 1UE6A 1JOQA 4LDTB 5BMGA 1ISNA 5CBEE 2K3UA 3V62A 1NCVA 1CTMA 1TGZB 2KK8A 3OMGA 1D3ZA 1WJJA 1QUQA 3SK4A 4F87A 3NBHA 1WR1A 5LNK1 2K5HA 3RNAC 4DR6L 4JWSC 1K3RA 1WVLA 4B3TQ 2IDYA 1SMYD 1RRBA 1XNRL 3PV1A 3CKIB 2ONQA 2QCPX 3I3CA 3KJPA 4LFCQ 2KTFA 4RCNA 3AB9A 3UDFA 3L16A 5JVG3 3KOJA 3QAQA 2WFWA 2Q5WD 3I9V1 4A20A 2OT2A 2L55A 5M3MG 2F0MA 3HM6X 4KHVA 3PHWB 5AZFA 1C4QA 2KC2A 4NKLA 1FCCC 5JAVA 1KL9A 3S17H 4FLHA 1SR3A 1T5XD 1SXTA 3H0GH 4IFDH 3DVNV 1G2SA 3NTIA 2NN6G 2KFJA 3D6WA 2X38A 5E4XA 4RMFA 5KEEA 1EIYB 2LJIA 3QOJA 4KZCA 2GLSA 1A6XA 3GQBA 2DBYA 3TUOA 3I4MH 2EYPA 2N7DA 4P71A 4K2KA 2K5PA 5LMNW 2RBMA 3DHIC 4MJSB 2BS4B 3UDXA 2R92B 1XTCD 4P72A 5IGDA 2JUOA 1DCZA 3C46A 1HTPA 2K5VA 4DR4Q 3J7ZC 3HHMA 4C3JG 5IWAQ 3CMAA 3GTLH 1TTNA 4QB4A 4FJVB 4J6HA 2L4NA 3LNNA 3GTPB 1TKEA 4P2CB 4LNQA 5C2TB 3SHLA 1TWGH 5C0XI 3K8AA 2ZT9C 2R93H 1RFAA 3AV8A 1SDFA 2MP2B 1AARA 4KKIA 1STBA 1L0YB 4K8JA 2SEBD 3TBIB 3CF6E 2IJ0A 5H8YE 2L76A 4GOPC 1T6BX 5FLXc 4K7UA 4KN7C 2K52A 3PUWA 1YHBA 1AFPA 1Q82C 4GGQA 2PW5A 3RR5A 1FD7D 1TVXA 2HTME 3NQIA 4LUOA 2PNRC 1E8XA 2KDIA 3L2PA 1N36L 4MH0E 2V3SA 1B8AA 4XT3B 4A3FB 1IYVA 2B8GA 2RPQA 5EE9A 5JOBA 3NRZA 2ES2A 5M3MH 1HNXQ 2YU9B 3LWEA 1PFDA 2WXIA 4W9KA 3V6EB 2BB6A 3CCUA 4K5XA 5EKLA 1QJOA 4F1SA 1SAPA 3EIVA 4GN4B 1MVKA 2BA0A 5IP7H 2O5JC 3QHTA 3NQTA 4P16A 3SVMA 3PUXA 1VD2A 3G48A 2IBIB 4DHZB 4QUCA 3PCOB 5JJIA 1TT2A 5EKKA 5DPSA 4U68A 5G3LD 3NZSA 1Y1WH 2KBNA 3K81C 4AQYL 4LCDE 4LNOA 2F0JA 1MPEA 4NAWB 4PYUA 1CI3M 1I7HA 3B2FA 2XN9C 1VZ7A 5E6OA 1SNQA 4NXMQ 2FXQA 4OXPA 1TZOA 1LYLA 1S5ED 3Q6SA 4OIJA 1EEFD 1LUZA 1FR3A 2UXBL 1QOAA 2DLBA 3RD4A 1VQKA 3IFDA 5AZHA 4WORA 1YVCA 3PQIA 4DHJD 1J8CA 5I4DA 3NZ3A 1PLFA 4YTNB 3ZW3A 3ZDMC 3OW2A 4HLEA 4CJ1B 1R4MB 3WCQA 2JEBI 1XCQL 3DQVA 3PREA 4REZA 1K53A 2PIAA 1PH1A 4I6NB 1VCIA 2R7DA 1K8RB 3ONSA 2WU2B 1IL2A 4DR1L 1UE5A 2E2HB 3QA8A 3AE4B 4HPPA 4LF6L 3RLOA 2O6VB 4TMAB 2VXWA 2JVCA 1TS2A 4DV3L 3Q3OC 1HZ5A 3ICEA 2E2HH 3O13A 2F0TA 3UQAA 4LF4L 3H8HA 1WCMH 4ZK9B 1W6KA 3E0EA 2D3BA 4DR7L 3CCMA 3T1HQ 3J7A5 3MJ5A 2EMTA 2D07B 1UH6A 2CHZA 2L7RA 3AYHB 1GXDC 2X6GA 1WE6A 3MAQA 1T0YA 3B0AA 1Y1VG 4PS8A 3URYA 3NVZA 3ZNGC 2Q2TA 1HH2P 4LF5Q 3SHQA 2DUDA 2YTVA 2F1MA 3FKIH 1GUWA 2K9XA 2UXDQ 1G291 1I35A 3APFA 1MKHA 5GAEC 2E2DC 5M5YH 2EVBA 4HJGE 2WXRA 3Q3FA 1S5CD 4ZHOA 4NMZA 2ZZPB 1VQOA 3KWVA 5G5HA 5KHQA 1SYGA 3GE3C 4WJ3M 1GM5A 4EZJA 4DV6L 3MTSA 1EIHA 3AN1A 4X62Q 1WTPA 3B6YA 4RFBA 1RWSA 1HNXL 2K6QA 4RF1A 3VR6A 2WX1A 3VHTC 2EYLA 2KQ3A 3CPFA 1T0RC 1F1HA 3Q8DA 1PFNA 3F8TA 2EZVA 4NPNA 3CQZB 1YX6B 3AEFB 4S3SA 2WWZA 3M3JA 1E22A 1PTOF 2HD3A 2FFKB 3QOLA 3TP5A 5GADC 3FKYA 4HWIB 1J7BA 4LJOB 2PZUA 1OTRB 3PO2B 4XDDA 3ZO5B 4URKA 5G3LF 2EDGA 3NP8A 3UE0A 1WYWB 1WYGA 1CSQA 1D1IA 4HJ7A 3GTMH 4A3BH 1Q0WB 1KNAA 3I4NH 4A93G 2ZEQA 5CORA 1FRRA 1AZPA 3MC9A 5IKCM 1JICA 1UE7A 2Q2HA 2RHQB 2UU9L 2GVBA 1LT3D 3RLFA 3A1QB 3UIOB 1SGHA 1YIWA 4ANXA 4DK5A 3K6OA 1IBKL 3HVZA 3T56B 2BCOA 2JA7G 3K5OA 5JEAG 4ME3A 4A3JG 2K8CA 3FEWX 4KZ0A 1QOGA 2KD0A 1IGCA 5CR3A 2QF7A 2JXTA 2F0OA 2F52A 4JPSA 3TL5A 5HFYA 1PGBA 1C3TA 1VF5C 4KMUC 2MJDA 3T3NA 2HT1A 1IBXB 1UAPA 3S24A 1BDOA 1GHKA 3OWFA 5D94A 4BY7H 2CH4W 3M7NA 2GRIA 1L4ZB 1SE3A 1YNTE 1KM7A 5C3EB 2LZ6A 4A3MB 4BBNF 2KA7A 1QILA 2KWUB 3DVGX 4BY7B 1ET9A 4ZYNA 5GXGB 4ZUJA 3N1XC 3T8MA 2KOLA 1VQDA 3GTJB 3LJ3A 2K28A 4A3KH 1H8CA 2A5UA 4IDIA 1F2RC 2FJ2A 4BFRA 4J1MA 1WSPA 1JQ4A 2A1AA 2LY7A 5C5LA 1XPOA 1SE2A 2H4OA 4HCEA 3TBLD 4DV0L 1XT9B 2NBWB 3OAWA 3Q3MC 1T0QC 5HY6A 5C3EG 1VCBA 4P75A 2N9LA 1AW7A 3VUXA 5ELOA 4W9JA 1TWAB 3LWUA 4UDUC 2F4VL 2BKFA 4DWFA 1JE4A 3J7YW 3NUCA 3WIMA 1YEZA 2NWGA 1SYBA 5IY0A 2E2IH 1SB3C 4QAYA 2JA9A 4HSPA 1A8VA 5IP9G 4HEA1 5D7GA 4B3SQ 2HHHQ 1PDXA 1P3QU 1EQTA 5LMNQ 1WZ3A 1V2YA 4H02A 4BY1H 1F2ZA 4NNJB 1UGMA 5JEAH 4M8AA 4BVUC 1YHAA 3K5MA 1D5XC 1SE8A 4GDLB 5LLIA 4PNYA 1A63A 2WDQB 5CHFA 4HEDA 3H7PA 3G7LA 1QT9A 5M3FH 1ENAA 1L1OC 2R7ZB 2BH2A 4P6VF 2D10A 3S14H 2BDNA 2NVQB 1SLJA 2KCTA 1KRHA 3QARA 1ZDVA 1HXYD 4JL9A 1FXTB 1DJRD 1CKNA 2EKIA 1STNA 3D4DA 1PH9A 5AUIA 4DR5Q 2QCZA 2B2VC 3EFXD 2N88A 2GBNA 1HR0W 2J0JA 3I91A 1FNUA 2IX3A 1Y8NB 3M3YB 2Z8LA 3T51B 3ZNID 5D6JB 1S3OA 3ULJA 3L08A 2WP8J 2HDEA 2MBOA 2LXJA 3AU5A 4A76A 1IKLA 2L1BA 1N34L 2KUMA 2MO0A 1J5EQ 2NVXH 2X6LA 3AMZA 5K5PA 3GTQH 4ZAIA 4DDGD 3RMKC 2RSNA 4GB9A 4LF8Q 3PUVA 4GLSC 3CF5A 3A7AB 2LFNA 3KLSA 2EY2A 3RZFA 1JWUD 2L8JA 3CC2A 4KSKC 1S3SG 2NN6I 3V2TA 3DMUA 2G9DA 5C6AA 5ISRA 3HOWB 1PRTB 1V81A 4KY5A 4P73A 1RFKA 1MHWC 2DWQA 1S5DD 4B08A 1E8YA 1A3TA 3NS8A 3NUHB 2A73B 4PMBA 3EECA 3FKIG 1DOMA 4WIPA 5M5WB 1OEYA 2HE7A 2BPSA 1EEID 4KV6A 5E3FA 1N5WA 2DYBA 3EGRA 3TP8A 1CZWA 2IL8A 1N6ZA 1ZXIA 3AFQA 1KRSA 4I7ZC 2ZM6Q 5C4XG 2A4ZA 2Z0EB 4W9CA 4DR2Q 2N9PC 3NHEB 4JOIA 1I4XA 5C0XG 2MJ3A 2KT7A 1EQRA 4A3MH 3U52E 3V6CB 4RHSA 4DBGA 1II3A 5IGCA 4GU2A 2SOBA 5M3FB 1KQSA 3A8KE 2QDFA 4KHZA 2LUMA 3DXJC 1ZXTA 2BB5A 5CX3A 3CMEA 2XIWA 2A74C 1Q8IA 4APVA 2IYDB 3RZOB 1E9MA 2PQAB 2NVYB 3RD2A 4DV1L 2D3CA 2K8HA 1AP0A 2WXKA 4HKQA 1B70B 1X32A 1Q12A 4X66Q 1TY0A 2Z4IA 2K33A 1B3QA 1WF9A 4A55A 1TXYA 4X65L 1WXVA 4DXGA 3P7JA 3S1RH 1YN4A 2NB0A 2HJ1A 3E6ZX 3QC8B 2P5ZX 4RM8A 2EYHA 3VUWA 4IZ8A 4MTNA 4DV3Q 1WGHA 2M0XA 2YVCA 1CT1D 1V5TA 3KYCD 4PV1C 1NVID 4FP5D 1SYFA 1EY6A 3OG5A 1AH9A 4AJWA 3HOZH 1MJDA 1ZXHA 4NJ7A 4YL8A 2BE5C 4XT1B 1QLBB 2KAJA 5I9PA 3E9SA 3ZRFA 2LXAA
chains in the Genus database with same CATH topology
4DXFA 2NUCA 4CKCA 2F03A 2A6EC 2BS2B 1CK1A 4DGZA 4FXCA 3NBIA 3ND9A 1WTWA 1SNPA 2D9UA 1ESFA 4OL7A 5E6JA 1X3PA 3J80L 1JQYD 2OHFA 2ZXRA 4OO1H 3HRZC 1R4PB 4RAUC 1JCKB 2WP9B 2B2UC 4HKZE 1PUTA 4FF4A 1S5BD 2PZWA 4K6DA 3HOXB 3NTHA 3CWIA 3W9CB 3PUYA 2RMMA 2IT1A 2ZXPA 3PZ8A 1ILPA 1HQRD 4ZRZA 1C9FA 4LK0M 1QNUA 1M4VA 2NN6H 1PZJD 1Q3LA 3A8JE 4N9PA 4IQZA 2AUJD 5DEHA 5CYUA 5IGBA 1C4PA 5E1FA 5C5MA 1TU2B 4YWGG 5IOCA 1G2TA 2NYZD 4KGTA 2ICIA 3GTLB 1XYIA 2HCCA 4XYQA 3DHQA 2B2YC 1XEEA 1FNVA 1MI0A 2JWUA 4USAA 2PYKA 3R8BA 3I72A 2YEPF 5FO7B 3FDTA 1H9SB 2EYJA 2RSOA 4XDXA 1TWGB 2XSCA 4G7HC 1GUNA 1UWMA 3EA6A 4G7ZC 1YN5A 2MH7A 2A69D 1O80A 2PPBC 2EY6A 1FGBD 2WINB 1STGA 5HI1A 3VQIA 2EYFA 4OW0A 1Y8OB 3P4PB 2WXFA 1SYEA 2F0KA 1DYQA 3Q22A 3M4OB 4TRDA 2PQEA 1LTTD 2K03A 2F0FA 5CV9A 1YMHE 4KJOA 1JR0D 4EGVA 2LFIA 2LHDA 1FFVA 3DM1A 2AQ1B 4YTMB 3OIPA 2CJNA 2PO4A 2L1AA 2FE8A 1ZDXA 5IODA 1ROEA 1PMRA 3GO5A 4OO1I 2WXOA 4R3DA 1PTOB 1XCTL 1D4BA 5C3JB 2V3NA 3AE9B 1OXVA 3U9SA 4X3SA 4MHEA 5LL6X 4G57A 2ICEC 2F3WA 2JSOA 1CJEA 2WLBA 4FF2A 4WQMA 1C78A 3AEAB 4HTHA 3P1HA 3GV3A 1NENB 1ZOYB 5EBDA 3PIP3 3NWTA 1XLPA 4HMIA 4TQUS 4RA8A 3G6JB 4ARCA 5I9OA 3K5NA 1GUTA 2J42A 1FO4A 4K2LA 1E0ZA 1I4HA 5BYSA 4F8MA 1HA6A 1DXMA 2QDBA 5H92C 1I4RA 4DN4M 1RD9D 4HSVA 4IFDG 3AE1B 4C7ZA 1HFGA 1QF6A 3U7ZA 1ILQA 1AN8A 5EGTA 3HVDA 2LEKA 1EY4A 4IOIE 2Z1CA 2WXHA 4Z9CB 1JOKA 3BYYB 1QB5D 1S4ZA 5K36G 4NP5A 4K14A 1WTXA 4IUVA 3S9WA 4L8JA 1K8MA 5J22A 2M00A 1HQMC 1KTKA 2PCFB 2MHVA 1KLUD 4HN7A 1BCPF 3Q24A 2INNE 3LXFA 1DOKA 2L11A 1PYWD 4QCLA 1QOFA 1BF4A 4KKJA 1G8ZD 2KEEA 1B9RA 1GUSA 4IALA 3J81E 4LMQD 1DM0B 3NTKA 4IUNA 1F2YA 2CU3A 5EE1A 1XO3A 2YYZA 2KCNA 3DWQA 3BK1A 4NAMA 3IT4B 1VR9A 4XQJA 3NS1A 5EE0A 1EWCA 1LO5D 3V96A 5ELCA 1PDQA 1NSNS 1I4GA 4ILWA 2GI9A 3RPFC 2LKVA 1WTQA 2NBFA 3IT6B 3TP7A 1TYGB 1A2UA 1Y1WB 1A70A 1HPCA 2PTLA 3AMUA 3Q69A 1JW9D 1HCZA 1YNJC 2M0AA 2ID0A 4K5VA 5M9OA 1ZYRC 2QEJC 3S1NB 3ONAB 2HDLA 5AFWA 4BWGB 1VMCA 3J7AF 1G6ZA 2PVOD 3NSWA 3B9JA 1BXTA 1EOTA 3C1FA 1FXAA 1J7CA 1H9JA 2PMZB 1F2LA 2WXMA 2XNAC 5LL6S 3TZUA 4OZCA 3SR1A 1JOOA 4X3TA 2Z4HA 3BVZA 1P7EA 1F9PA 1WRIA 1VDVA 3KUPA 1UNSA 2B39A 1HFNA 2C5CA 1GHJA 1K50A 1WD1A 4NZLB 2WXJA 3V3XA 3V05A 1B53A 1DOIA 3GTKB 4O1NA 1TKGA 2K05A 3BDLA 4ZOHC 3I70A 3B2GA 5C3WA 2AWOA 1DOLA 1WTOA 4RGTA 2KCCA 4M0WA 5EQ0A 3FPPA 4A90A 3SEBA 1WXQA 1ICWA 3FRPB 5IT9L 3MWYW 1ENCA 2BE5D 2L0CA 4DK1A 4L63B 2KVMA 4YTPB 3P4QB 4C7YA 1MSGA 2EE1A 3DWMA 2BYTA 2B8FA 3AE6B 1XLQA 3ZJUA 5D3DA 2KECA 1LTID 3Q0AA 1NYRA 2K01A 1RM6C 3D6CA 1CZGA 2SNSA 3VA7A 2VB3X 1B2TA 3IFTA 3W5UB 2F0VA 4ZKCB 5IIFA 1SBBB 2K1BA 3AE3B 3A54A 3TEZA 2F0SA 3H94A 1V1PB 5IT9E 3FKIB 2E3TA 2E2JB 4YIJA 4H7BA 2B2UA 4A3KB 3MFYA 1U4RA 1VDZA 3A56A 4C1NI 1O7YA 1DONA 5DM63 4FYDA 3KQ4A 1B44D 2B2VA 1UEAB 1XXGA 1QQRA 5JEAJ 2PLPA 1IW7D 4M1UB 1ENFA 2E75C 1TWCB 1VRAB 4KKSA 4FO2A 4N59A 3KWLA 1E0BA 3QG1A 1FIQA 4RKBA 2K6AA 3AM9A 3QO2A 1LT4D 1RJTA 2N0SB 2OEOA 4OO1G 1F9RA 5EKIA 3S1QB 3U9OA 2BA1A 4XTCS 3W2DA 5C0XJ 2R3ZA 1H9SA 3MVVA 1EY7A 2J52A 4FXDA 4ZQ3A 3AEDB 1U4LA 5JVH3 5FLXE 1F9QA 3ZJVA 3AE2B 5DNFA 2MP1A 1W6JA 3I73A 2K5DA 4RHRA 3D3RA 1B50A 1Q90A 1B9MA 5IGGA 1QOHA 4DNRB 5FLXL 3X3MA 2EELA 1R9TB 2BOSA 1MHXA 3DUZA 3OW7A 4K8IA 5A35A 1E6EB 2I38A 2ENBA 1JC7A 3BYTB 3MFGA 1ZE3D 3TMEA 4YSYB 4IFDI 1N60A 3Q8AA 4RGOS 3A8IE 3E56A 1BCPB 2EJMA 2OF1A 3J80E 1SSNA 1EQVA 2JA5B 3N6RA 3HZXA 3PO0A 3OPOA 2KMMA 3N52A 4G7OC 1YNNC 3VR5A 1XLOA 3BS1A 3EJIA 2JU6X 4Y7NB 1LTGD 2BW2A 4A3IB 3VR3A 2F0DA 1XLNA 2AUKA 4RKLA 3NVVA 4X3UA 2E2IB 3DWGC 4YSZB 1STEA 4DAYA 2N9KA 3AB5A 1NAPA 2LMCB 3VYUA 4E6IA 3HOZB 1HEZE 2JQRB 4ZHPA 1RHPA 5JPNC 1EFID 5ELBA 3I4NB 4NW2A 4CQNA 1C77A 1ONLA 2PW7A 4XYOA 2INPE 4MT5A 2E6XA 3PO3B 5C44B 5NUCA 3K0YA 4KX6B 4GDKB 1WWTA 3M7GA 3L9AX 3C2PA 2AQ2B 4IN3A 3W5VB 4MM3B 3IXSA 3HS0C 4ID6A 2V3PA 3P75A 1NI3A 3MZ5A 3SK6A 4BA2I 3LB8C 2FBWB 1CA5A 2FUG1 1KAAA 2IGGA 1EU3A 4CJ0B 1P7FA 2DYMA 2L52A 3FILB 2NTSA 2PZTA 1O78A 3P4SB 2RDHA 2EJGC 2O2LD 2MJ8A 3UI3A 1EZ8A 4AQ7A 2CQAA 4FXKC 3HG9A 1LTSD 2IPKD 1JMLA 1L0XB 3F2UA 1GB1A 4HRSA 5D3IB 2RDGA 1LACA 3WDNA 1Y56A 1BO0A 1D2BA 1PFMA 2RVLA 2MJEA 2D62A 4FVMA 1JROA 3DEPA 1YJIA 2K22A 3GP7A 1V8QA 3NE5B 3AU7A 2KQ4X 1GUGA 2AWNA 4B9XA 2RDFA 1E2VA 5BN4A 2JP1A 3ITPA 2D5DA 4OHJA 1HZ6A 1CHPD 4FF1A 4IKGA 3VR8B 3E0JA 1E2ZA 4ODGA 1V43A 3SDZA 3MXUA 2I46A 3SK5A 4KGSA 1LABA 5D65A 1STHA 1I3QB 4DA2A 1BUIC 4HMJA 2WXLA 3L7ZC 1LT5D 1PTOH 1JWSD 1GAQB 1AWDA 2JXMB 3H91A 1BCPC 2L9HA 1QNKA 2K5QA 2WU5B 2J7ZA 2A6HD 1L6VA 1WD0A 2KEDA 4H0LC 3VRAB 2WXPA 2V4DA 4LTUA 1GOZA 1CM9A 2F0HA 5M5XB 5JXVA 1KH0A 3K57A 5KYLA 2WXNA 1KF6B 1UGJA 3E5SA 4BBRB 5E4WC 1Z47A 1QE6A 2J0TD 1FEHA 1C8CA 2EYMA 4N6EB 4H13C 2EOTA 4DFAA 2JA7B 3SFEB 4IFDJ 3HOUB 4JX1C 4C80A 5HURA 5COYA 2KWDA 2A6ED 4IUPA 4ZLTF 3QJYA 1V1PA 5I6YA 4R8NA 4US9A 3WOEA 2JYEA 5KRUA 1J9OA 1Q10A 4Q2JA 1EIGA 2R93B 1BQQT 3ZYYX 2Y5CA 2FMMA 3D4WA 1TS5A 1SJED 2E76C 3RZDB 4LK1C 1KABA 5CV7A 3VR2A 4F7XA 3J9CA 1R4QB 3Q8CA 1A3UA 5K36H 2CVRA 3U4EG 1CA6A 4A3DB 1TY2A 1BCPD 2R61A 3R3OA 1UWXA 1RKNA 4MN3A 5MPOA 3HOYB 1EY9A 2ACZB 1PRTD 4X3KA 1PRTF 4LLGM 4OVZA 3BG3A 1G91A 4DK0A 5I2XA 4PQXA 3IAS1 2WDVB 3P63A 3TEYA 2BS3B 4KD4A 4U673 4KKUA 3KBXA 3MC0B 4YXDB 1VZ6A 4KD3A 2C9OA 1JALA 2ZW1A 2DY8A 2IX1A 3DWPA 4OGQC 2RPVA 2IGHA 3VR9B 4CKEA 4XIGS 3W1SA 1WGKA 2B2WA 2K0PA 2B76B 2F0EA 3R2TA 2GB1A 4IUUA 3MXPA 4ABNA 3IAYA 1AZQA 4RH6A 1F2MA 2F0PA 3IL8A 1N62A 3OMCA 3I4MB 3C3LA 2D2CC 2WXGA 2M19A 2DYOA 4D2KA 3RMHA 3S16B 2WKDA 2E74C 2MUYA 2F4IA 5ELDA 1F0ZA 3CHBD 5I6WA 1RF2D 3BK2A 2KN4A 3FAHA 4QIWB 2XWBB 2AX5A 3VYSA 3TZDA 4C1NK 2W3RA 2JX5A 5J1ZA 1L6UA 1TS4A 4XE0A 1ZEQX 2RA4A 1RCVD 2RKSA 1IBXA 1WTVA 4DAVA 3H3VC 3TDQA 2VNUD 1STAA 3OIQA 1LTAD 1PGAA 1TJEA 2PKOA 3T4AC 2WV6D 4V190 2JYOA 3AECB 4TKOB 2EPBA 4MH8A 4BY1B 2Y0SB 2JSVX 4CKBA 4C3IB 4GZYC 2Q8IB 1N63A 5CV5A 5EPKA 4IURA 1N5XA 3LX0A 4XWWA 3DEOA 2DY7A 1SNOA 5I2YA 2F3VA 4WH4A 1ET6A 3VYRA 2KACA 5EBCA 3S17B 2D5GA 4L2YA 1TWHB 2NTTA 5CMDA 2VUMB 1OFFA 1BMLC 2WXQA 1Y1VB 3ZJTA 4DF7A 1ACCA 1Y8PB 3U2SC 3KLRA 4C2MB 4XQQA 2CJOA 2IGDA 1BBXC 3VYTA 4C3HG 3K59A 1RODA 1S5FD 1RTNA 1E10A 3AE7B 2JZPA 1SYDA 4QMGA 1K52A 5T8IA 2CHBD 1IW7C 1IKMA 2EY1A 1BNZA 2K5WA 2SAKA 4N58A 4RGNA 3S1RB 3Q8EA 5EPLA 4WFN3 5KNBA 2JEAI 2PW9A 1D6EC 1UUPA 2R6GA 3AEBB 2QMTA 2B2TC 1V1OA 3PUZA 4IUQA 1O7LA 4H2AA 2JYTA 2V0GA 1VJKA 4KJNA 4ZYSA 2K04A 2V4IB 3Q8FA 3H09A 5C4ZA 2CW0C 4IUTA 1RDPD 1V97A 1EZ6A 2OXPA 4R8IA 3NVWA 1EYAA 2BDOA 3SFDB 4PMWA 4CBVA 4AS1A 5HHDG 3HP3A 1LT6D 2EJFC 1HHVA 2HCIA 5CV4A 4L23A 3KBGA 3EROA 4LAAA 1PXUA 1AYFA 3Q23A 4A3BB 2A68C 3GTOB 1HUNA 3DWAA 4HAEA 1FD6A 4ARIA 4JE3B 5FK9C 4CJ2C 5ELFA 3NVYA 3J7AV 2SNMA 2H89B 4FNFA 1C48A 4WJWA 4XXEA 2WB1B 1FXIA 2OEDA 4HR7B 1OXUA 4PT5A 3AE8B 2Q8RE 1SNMA 1U4PA 2B2WC 1X3QA 4EQNA 2A69C 1BOSA 4KGRA 1JWAD 1L5PA 1OQRA 1ML0D 1K83B 2EYOA 4XQNA 1OXSC 2WKCA 2GA4B 4JK1C 3QB3A 2DN8A 2IW3A 1MBYA 1EY0A 3S2DB 1SE4A 4WRDA 2N55A 4BS9A 1H9RA 1C79A 2L12A 1OXTA 4RF0A 2FINB 5BN5A 3TSSA 2WAQB 1HA5A 3PZ7A 2W3SA 2RQXA 3R93A 3Q8BA 3ZGZA 2QJLA 1VMPA 1SMYC 3CU7A 1PZKD 3D31A 2W82A 1DZ1A 4TSSA 4HCSA 5IGEA 3GV6A 1EWYC 1MI2A 2LMCA 4ITKA 1GUOA 1WTRA 3VR4A 1PGXA 2F0QA 3I90A 3TP6A 5CV8A 5FO8B 2F0WA 2HUGA 4O42A 4G4KA 4AYBB 1U4MA 3K5LA 4ZKBB 1MHHE 3D8GA 2M56B 2X69A 3GB1A 5CV6A 2BT6A 1K8OA 5FO9B 2NVXB 4ZUIA 1PFBA 1CZPA 2HQEA 1YN3A 4A6QA 5J39A 1FCLA 4J3OD 1STYA 1LTBD 1FRDA 2WQYB 2Y5PA 5CBAE 1YQ3B 2W54A 5D14A 1IYUA 4Q5VA 1OQQA 1ZPSA 2BTEA 1EWHA 1IGDA 3FILA 5T1IA 2QIEB 3HEJA 2CW0D 1ZUD2 2QSDA 4MACA 2I2YA 1I6VC 3VA5A 5T1GA 4DAPA 3NWSA 2A5HA 3JAME 3VRBB 1GPXA 4UAIA 4KTAA 2K7VA 2HDMA 4A8XC 3QIAA 1ZYRD 3C8YA 3X3NA 1HUMA 3L3OC 1KDCA 5LHY1 3MP9A 2KJXA 1IHZA 1I4PA 3HRDD 4QUFA 3S1MB 4B0MA 5A2QL 1SYCA 1SNDA 5BMHA 1CQVA 4XDCA 5FKAC 4US8A 3I8ZA 1SJHD 5A2QE 1DGJA 1C4CA 1O7ZA 1F77A 1MGSA 1SF0A 4L6TB 3OOCA 3MXNA 1SFOB 3WOFA 2B2YA 1CFMA 3P4RB 3A7LA 4C3HB 3J81L 1A15A 1NYQA 2IWHA 1WCMB 4C3IG 1J7AA 4I65A 4K6LA 5F2DA 3IAM1 5HG2A 1GJXA 3ERQA 2ON8A 3MHBA 3S15B 1Z6HA 1CHQD 1CQFA 3D4RA 3S14B 3TN2A 2JA6B 2VB2X 4RWSC 4WWMA 5M5YB 1TS3A 2JA8B 1JWBD 1T3QA 1LTRD 2B63B 3LYYA 3C1EA 2B2TA 1PRTC 1LLRD 1KDBA 5CGKA 1A2TA 1XF5L 4KN4C 4RGMA 4TQ0A 2H1EA 3MEHA 4JWUC 1SIJA 2WIIB 4JBWA 1EL0A 2IX0A 2L32A 4EVOA 4A3EB 1TQOA 3FVQA 1J8IA 5KNDA 3K7AB 3T13A 1EY5A 5C0XH 1QKZA 4J8QA 1SEBD 4A3GB 2NZ1D 1L0VB 4OZBA 2DNCA 2NMQA 3AEGB 4B9WA 3H6MA 2QILA 4ME5A 1ZP0B 4R9WA 4EE2A 1PTOD 2MPMA 1QG7A 2SDFA 2G9HD 1NR2A 2XVSA 3AH7A 3KK7A 4LJZC 1YNJD 1E7PB 4EQOA 3NHHA 5DM73 1Q1EA 1VLBA 1YJJA 3EQLC 3OSOA 1BR9A 1B9NA 1QOBA 3BWUD 5C4HA 5JPMC 1A3VA 1Q1BA 1FFUA 4YT0B 3TEXA 1JRPA 5KGUA 3P42A 3BDCA 4KI0A 3FC4A 2N7JA 4A93B 5CC4A 1GB4A 1D5MC 1YQ4B 5KIXA 3FPUB 5KYIA 5C4JB 1SSOA 3FMCA 4C3JB 1E2WA 2KDMA 1C76A 1PTOC 1HRJA 3HUIA 3RFZB 4B0EA 4WAFA 2O4XA 3P1MA 4KY6A 1T5EA 3UI2A 3A55A 4A3JB 1OO9B 1B3AA 5HGTA 4QF4A 4CGYB 2M2LA 1IL8A 5EE3A 3CRLC 3M4YA 3I57A 2G1EA 3GTMB 5FOBB 5M3MB 2VZKB 2F0NA 2M9VA 3K58A 3T16A 4BBSB 3HKZB 5C4XB 1F2RI 5BYRA 3SXHA 3N9YC 1MD2D 5FR3A 3GD7A 3CRKC 2EY5A 5BN3A 1TKWB 2AQ3B 4ZRPA 3QWNA 5TSSA 2I07B 2WACA 1D5ZC 3TEWA 3PV0A 3OWEB 1EYDA 1F9SA 1QWYA 2F0UA 1FM0D 2WNMA 2Y3AA 1U9RA 2XWJB 2WDRB 5EJWA 5C3XA 1I6HB 3GTQB 4OIKA 4ULLA 1Z7TA 4ZRQA 4CHTB 3MXGA 3ND8A 5ELEA 4H44C 2L83A 4F88A 1KNEA 1PZID 1MSHA 4TQ1A 2MEKA 2TSSA 1NEKB 2XRQD 3H0GB 4DQOC 1JORA 5BYQA 2NVTB 3S2HB 3KF8A 1I50B 3R2IA 1EM7A 2MGSA 1V8CA 4L1BA 3M85A 1I4QA 3W3AA 1TWFB 1IUEA 4WURA 3MA2B 5EPJA 3GTGB 2J53A 4A9AA 3I4LA 3PIO3 3BVMA 5BMIA 1DD2A 1ESRA 3OHXC 3T3OA 4V0BA 3SK8A 3EUB2 3BZDB 3P20A 4OZAA 1VF7A 1VZ8A 3HGBA 1DOXA 3NK9A 4KY7A 3BDOA 2F0IA 1EYCA 1FYCA 2A6HC 1NUCA 4FXGC 2WS3B 1BUVT 1TKYA 3RUZA 2BBCA 4MIUA 4KKTA 4DNTB 2ZW0A 2DNEA 4KK7A 2F0LA 1OXXK 3IKJA 1H9KA 2W55A 4Q0FA 3NPPA 3ZQ4A 3SR6A 1SNCA 2LS01 1K51A 2VZKD 3AE5B 1FMAD 1B1ZA 2LHEA 4YSXB 4PMCA 2JE6I 3L4PA 3CIRB 4XWTA 3SE0A 4NDXA 3BVGA 1RYJA 2J4XA 3PMFA 1L4DB 1N61A 2F0GA 2KHSA 1TR5A 1NR4A 1B4OA 1QCBD 5JJZA 1KLGD 1H9MA 1XWEA 2PVGC 2ZXOA 3NXWA 1XX8A 2Q8TA 1YNND 3JAML 2O5IC 4K5WA 1EY8A 2QKIC 1R7SA 3EVQA 1ZKOA 2YEPB 4FF3A 4C56C 2H88B 3KLSX 1AEXA 4RCOA 1LV9A 4RNAA 2XRSD 3GS2A 1FNWA 1C4AA 4DU9A 5DAUA 3ETRA 3T53B 3MHZA 5G5GA 2EXZA 2L5TA 4EQPA 2FMCA 1EU4A 2LGIA 1M8AA 4NJCA 2FHTA 1JWMD 1D1KA 4BA1I 1KFYB 1JB3A 1HTLD 1TIID 3ABVB 1Y69U 4HROA 2PMVA 3HOVB 2TMPA 1KDAA 1RTOA 5KNCA 5IGFA 4N9TA 3AEEB 5AUKA 1DOYA 3BIID 2K32A 2A68D 1JOQA 5BMGA 5CBEE 2K3UA 1NCVA 1CTMA 3OMGA 3SK4A 4F87A 3NBHA 5LNK1 4JWSC 1WVLA 2IDYA 1SMYD 3CKIB 2ONQA 2QCPX 3I3CA 4RCNA 3AB9A 5JVG3 2Q5WD 3I9V1 2OT2A 2L55A 2F0MA 4KHVA 1C4QA 4NKLA 1FCCC 5JAVA 1T5XD 1SXTA 4IFDH 1G2SA 3NTIA 2NN6G 3D6WA 2X38A 5E4XA 2LJIA 5KEEA 3QOJA 1A6XA 3GQBA 2DBYA 3TUOA 2EYPA 4K2KA 2K5PA 2RBMA 2BS4B 2R92B 1XTCD 5IGDA 1DCZA 3C46A 1HTPA 4C3JG 4QB4A 4J6HA 2L4NA 3LNNA 3GTPB 1TKEA 4P2CB 5C2TB 3SHLA 5C0XI 2ZT9C 3AV8A 1SDFA 4KKIA 1STBA 1L0YB 4K8JA 2SEBD 3TBIB 2IJ0A 5H8YE 1T6BX 4KN7C 3PUWA 1AFPA 2PW5A 1FD7D 1TVXA 2HTME 3NQIA 2PNRC 4XT3B 4A3FB 1IYVA 2B8GA 5EE9A 5JOBA 3NRZA 2YU9B 1PFDA 3LWEA 2WXIA 2BB6A 4K5XA 5EKLA 1QJOA 1SAPA 1MVKA 2BA0A 2O5JC 3NQTA 4P16A 3SVMA 3PUXA 4QUCA 1TT2A 5EKKA 4U68A 5G3LD 4NAWB 2F0JA 1MPEA 1CI3M 1I7HA 3B2FA 2XN9C 1VZ7A 1SNQA 1TZOA 1QOAA 1S5ED 3Q6SA 4OIJA 1EEFD 1FR3A 2DLBA 3RD4A 3IFDA 4WORA 5I4DA 3NZ3A 1PLFA 4YTNB 4CJ1B 3WCQA 2JEBI 1XCQL 4REZA 1K53A 2PIAA 1VCIA 2WU2B 2E2HB 3AE4B 4TMAB 2VXWA 1TS2A 1HZ5A 3O13A 2F0TA 3H8HA 4ZK9B 1W6KA 3MJ5A 1GXDC 2X6GA 3MAQA 3URYA 3NVZA 2F1MA 1GUWA 2K9XA 1G291 2E2DC 2EVBA 4HJGE 2WXRA 1S5CD 4ZHOA 4NMZA 3KWVA 5G5HA 1SYGA 3MTSA 1EIHA 3AN1A 1WTPA 1RWSA 4RFBA 4RF1A 3VR6A 2EYLA 2KQ3A 1PFNA 2EZVA 3CQZB 3AEFB 4S3SA 1PTOF 3QOLA 2FFKB 3TP5A 1J7BA 2PZUA 3PO2B 4XDDA 5G3LF 2EDGA 3NP8A 1WYGA 3HVZA 1D1IA 1KNAA 5CORA 1FRRA 1AZPA 1JICA 1LT3D 3RLFA 3K6OA 3T56B 2BCOA 3K5OA 5JEAG 3FEWX 1QOGA 1IGCA 5CR3A 2QF7A 2JXTA 2F0OA 4JPSA 5HFYA 1PGBA 1VF5C 4KMUC 2MJDA 3T3NA 1IBXB 1UAPA 1GHKA 1BDOA 3OWFA 3M7NA 2GRIA 1L4ZB 1SE3A 1YNTE 5C3EB 4A3MB 2KA7A 1QILA 4BY7B 1ET9A 5GXGB 4ZUJA 2KOLA 3GTJB 2K28A 4IDIA 1F2RC 2FJ2A 4J1MA 1WSPA 1JQ4A 2LY7A 5C5LA 1SE2A 2H4OA 4HCEA 2N9LA 1AW7A 1TWAB 3LWUA 4UDUC 1JE4A 3J7YW 3NUCA 2NWGA 1SYBA 1SB3C 4HSPA 4HEA1 5D7GA 1PDXA 1EQTA 1F2ZA 5JEAH 4M8AA 3K5MA 1D5XC 4GDLB 4PNYA 2WDQB 4HEDA 3G7LA 1QT9A 1ENAA 2R7ZB 4P6VF 2BDNA 2NVQB 1KRHA 1ZDVA 1HXYD 1DJRD 2EKIA 1STNA 3D4DA 5AUIA 2B2VC 3EFXD 2N88A 3I91A 1FNUA 2IX3A 1Y8NB 3M3YB 2Z8LA 3T51B 2WP8J 2HDEA 1IKLA 2L1BA 2KUMA 2X6LA 3AMZA 5K5PA 4ZAIA 2RSNA 3PUVA 4GLSC 3A7AB 2LFNA 3KLSA 2EY2A 1JWUD 2NN6I 3V2TA 3DMUA 2G9DA 5C6AA 5ISRA 3HOWB 1PRTB 4KY5A