1SEIA

Structure of 30s ribosomal protein s8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
b'VMTDPIADMLTAIRNANMVRHEKLEVPASKIKREIAEILKREGFIRDYEYIEDNKQGILRIFLKYGPNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIAILSTSQGVLTDKEARQKGTGGEIIAYVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN S8
publication title Structural evidence for specific S8-RNA and S8-protein interactions within the 30S ribosomal subunit: ribosomal protein S8 from Bacillus stearothermophilus at 1.9 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
total genus 31
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1seiA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1seiA02
5LMUH 4OX9H 3J80W 4DUYH 4JI4H 4B3MH 4X62H 2UUCH 4LF8H 4PDBA 2F4VH 5FLXW 4LF9H 1N33H 3JAMW 4YY3H 2UUBH 1IBKH 1J5EH 4DUZH 4DR2H 4LF4H 4DV6H 4DV1H 1XNQH 4DR3H 4B3TH 4DV7H 2ZM6H 2UUAH 4JYAH 1FKAH 4YHHH 1AN7A 4AQYH 4DR5H 4JI0H 4LFAH 4LFCH 1HNXH 1FJGH 1HNZH 4JI2H 4JI8H 4B3RH 5IT9W 4X65H 2VQFH 2VQEH 2HHHH 4JV5H 2E5LH 4DR6H 1XMQH 1XNRH 1N34H 1I6UA 4GKKH 4LF5H 5LL6b 3J81W 2UXBH 1XMOH 4JI1H 3RF2A 4LF6H 4KHPH 3T1YH 4JI6H 5A2QW 4DR4H 4DV4H 2UXCH 1HNWH 1S03G 4DV5H 1IBMH 5BR8H 3T1HH 1I94H 4DR7H 1SEIA 1N36H 1HR0H 4JI7H 2UXDH 4DV0H 1N32H 4JI3H 4DV2H 5IWAH 4K0KH 4X66H 2UU9H 4LF7H 4X64H 5LMNH 4GKJH 4NXNH 3J7AK 4JI5H 4DR1H 4DV3H 4LFBH 3OTOH 4NXMH 1IBLH 4B3SH
chains in the Genus database with same CATH superfamily
3OSSD 2VKCA 3CVZA 4QW9A 2R8IA 1E4FT 3R5XA 5DGAA 4YJ3F 2V59A 3J80W 1I50A 1TAEA 5KFVA 2W6QA 2J6UA 4X62H 2UUCH 5IYDG 4OO1G 2CW7A 1WTJA 1EZ1A 4XZ3B 2C00A 4A3IG 4LF9H 3N44B 3HKZE 5IYZF 4ECWA 5EWGA 1Y1VG 1DV1A 2WAQA 5IP7G 2CTLA 2DZDA 1VIGA 3RTXA 2M8WA 2JA9A 4B8CD 4F4ZA 3H4DA 3EPIA 2PMZE 4ED0A 4Q45A 3GIQA 2JA7A 1SYXB 5EDWA 1WHRA 2C2RA 4RB2C 4DUZH 3IG0A 1A0IA 3G6YA 4LF4H 1A9XA 4J9QA 1RJPA 1S68A 4MV3A 3NCVA 4R8UA 3GIPA 4EYIB 2ZQEA 4ECSA 1S0NA 5CA1F 2R8JA 1VBGA 3TIIA 2YS7A 4O3NA 4L1KA 2ZM6H 2ALZA 1UC8A 5KFRA 2DGRA 1FKAH 2LRRA 4YQWA 5HV6A 4Q44A 5KT7A 5KG4A 4DR5H 1TWAA 4QWAA 4FM9A 2J6TA 2W70A 4LFAH 5JEAG 4ECUA 2IBKA 3GTQA 2R7ZA 1UG8A 2Q2TA 2JEIA 4DL2A 4JVHA 3MJFA 3GIKA 2LF0A 1HNXH 1FJGH 1I7NA 2Z0SA 1S97A 1KJJA 4B3RH 3Q1KA 3BJYA 2R8KA 4CC5A 2YU9A 2LTMA 3BA9A 4AM3A 5EOYA 3WO1A 2VUMG 4WALA 5LA6F 3WNZA 4EEYA 5KFWA 3RAXA 3PW2A 2FJZA 3RB4A 4BA1I 2UVRA 1TWCA 3V4SA 1KJQA 5C5JA 4J9PA 3TINA 4A93G 5LL6b 2VPSA 1RJRA 1XDNA 5F9LA 4O3QA 3M9OB 2R82A 5IYBG 4RB1A 2RF4A 1JIHA 3GR5A 1X4MA 4KHPH 3T1YH 4JI6H 5FLMG 5A2QW 2ASLA 3GKUA 5KFPA 4J9LA 3SE7A 3KAKA 3H4BA 1HNWH 1GLVA 1Z2OX 2R8GA 4A3JG 4NZRM 1JLLB 5DG8A 5KFCA 2NVYA 4MA5A 4UCTA 4DV5H 1CE8A 2DIKA 3I12A 2PY9A 3TQTA 4RNNA 3U9TA 4LH6A 1B6RA 4H8AA 3Q8SB 4JUZA 5KFIA 4BA2I 5T14A 3K3PA 4ECRA 2QYZA 5KT6A 3DF7A 3L7ZC 1DV2A 2R92A 1VBHA 2UXDH 2R93A 3TQ1A 4HNTA 3ETJA 4GC7A 2PT7G 5LYJF 4ED3A 4EEQA 3JSLA 3QZ7A 5KFYA 2PQUA 3HOVG 4DV2H 1GYFA 4K0KH 2W6PA 2ZDGA 3JSNA 4Q43A 2JA5A 2V5AA 1M7JA 1ZQ7A 2WAQE 3N40P 4Q0YA 2VQDA 4CC6A 3T5JA 5C8YF 4G08A 2GPSA 2CPQA 4NXMH 2V9WA 1IBLH 3GV8B 2G8YA 3FKIG 3V6HA 1T3NA 3UOEA 1VS0A 4ED2A 2SCUB 2YZMA 5FPOA 5LMUH 4BBRG 4JI4H 3RJ0A 4PDBA 4FJUA 2FK3A 3F8NA 4R8UB 3RUPA 4ETSA 1TWHA 1Y1VA 2YCHA 5KG6A 4MV9A 2XIGA 2YW2A 1N33H 2R8HA 3HOXG 1FVIA 3G6VA 2BR0A 3QZ8A 2UUBH 1ODHA 4QW8A 1S20A 2A1SA 1IBKH 4RNOA 3GTLA 4RAZA 3MFIA 2OPVA 1J5EH 5L1IA 3PW7A 2JEGA 1T36A 1AUVA 2KSWA 2WYOA 4LIJA 3HXLA 4ED7A 1S0OA 1OWTA 1KJ9A 5CA0F 3BABA 3PVXA 4F4YA 5KFMA 5KFBA 5JVLA 4DV6H 4UCRA 2FFMA 2XCLA 2Y3MA 1DGSA 4MA0A 4TUYF 5L1KA 2DWCA 4DL6A 2AU0A 5KT4A 4DV7H 3FAUA 3KDGA 1WCMG 1IOWA 4U6PA 4XX0B 4JYAH 3N8DA 5DQIA 1AN7A 4JVYA 1RK5A 2FMAA 2R7LA 3RBDA 4ZOLF 4AQYH 3H40A 5CAEB 3Q8PB 4YAKB 5KFAA 1L2ZA 3MFHA 2FPHX 4HR7A 1K1QA 2Y0SE 3WO0A 2WB1A 1S9FA 4RAYA 1WR2A 4LFCH 2W9BA 4MTDA 5L1JA 4PWQA 4TQRA 3GQCA 4QWBA 2CPMA 2RGRA 4JI8H 3UFXB 2CKZB 1RYRA 5LOVF 2CTMA 3AEVB 4F50A 4X65H 1V8CA 5D1OB 4YAJB 3T5KA 4LSXA 1EC6A 2R87A 4DR6H 1Y14B 5K2MA 1XMQH 4ZI7F 4YP3A 2ASDA 1XNRH 5C1OA 2HH2A 1E4GT 1I6UA 4GKKH 2FPPB 3MR3A 3BQ0A 3PZPA 3GTGA 5J2TF 2W8LA 3EZJA 2CQYA 4I4TF 4MTEA 4DL5A 2R84A 4J9RA 1T94A 2QK4A 3J81W 3GIDA 2UXBH 1DIKA 5GONF 4EFBA 1XMOH 2VUGA 1CS0A 2W6OA 1GSHA 3FDSA 4LF6H 2B63G 1EUCB 2VR1A 4HNUA 1KC7A 1DT4A 5FJ8G 4O3RA 3R5FA 3QD7X 1GO3E 3VPDA 4ECVA 2UXCH 3OUUA 2NU9B 1BGWA 3JZIA 1K1GA 5IP9G 5KFTA 4FBUA 1M0TA 3RFCA 3AYHB 2V4RA 3KHHA 2AGOA 2FE3A 3T1HH 1S10A 1I94H 3C0FB 1ZHSA 2W9CB 1DTJA 4A3LG 4MAMA 3H0GA 3R23A 4ECYA 4QWCA 2XD4A 3R5HA 5KFSA 1N36H 1MZBA 2W6ZA 1HR0H 5DGBA 4QWDA 2UVWA 4J9MA 4JI7H 4GC6A 2C2EA 2BA0A 1MSZA 3PW5A 5LP6F 2GLTA 2E2IA 5F9NA 2AGPA 2FPIB 4IRKA 4F4XA 4ED8A 3PW0A 4I7HA 2OH2A 3FMAA 2ZDQA 4ECTA 1GGOA 5KFOA 5D1OA 2PBZA 2ANNA 2FK1A 5H80A 3H20A 4AYBE 1KBLA 3BQ2A 4A2BA 2NU8B 4GKJH 5KFJA 2WTFA 3J7AK 3FKIA 1GSOA 5KFNA 2GPWA 4DR1H 4FU0A 4ME6A 4DV3H 4LFBH 2QNDA 1PK8A 3LWBA 1KJ8A 1TWGA 3GV7B 3RBEA 4MV4A 5KFKA 1ZZKA 4Y8VB 2CTEA 1JDEA 2NU6B 3RGXA 1RYSA 2W7OA 2YYAA 1K1SA 4OX9H 5JQWA 4DUYH 3KDKA 2WE6A 2DPIA 4B3MH 4A3KG 3OSNA 4LF8H 3I4MG 4I50F 2R7MA 1GSAA 3HKZA 4UCOA 3T5HA 3KALA 2WDTA 2NUAB 4M9UA 1ZHQA 1V9PA 1X9ZA 4EBDA 4A3BG 1W96A 3RV4A 2JA6G 3JAMW 2PMZA 4JV1A 2ANRA 2HH3A 4NBQA 2W6NA 2YS6A 4O4IF 5KFZA 4I55F 2W9CA 2R7ZG 3MR2A 2FPGB 1IOVA 2WB1E 3GTPA 2E2HA 4ED1A 2O03A 2CW8A 2FLNA 1V4YA 3GTMA 5KG1A 4DR2H 4XYLB 4B8TA 1M0WA 2FB9A 5KG5A 2W9BB 2FK2A 4O3OA 4E4TA 1XNQH 4AIMA 5KKNB 3HBLA 3GILA 4DR3H 4B3TH 3V6KA 3G6XA 2VA3A 5KX5F 4EGJA 4YHHH 2X0SA 5I47A 2J9GA 1SCUB 2X06A 4FJSA 4RB3C 3NGDA 1SFOA 3N6XA 1X4NA 1Z2IA 2C28A 4O3SA 3GTOA 3GIIA 3VKEA 1WE8A 4YR2A 4LSAA 1R9TA 1EYZA 4IAJA 4ED6A 2PN1A 2YZGA 4MV1A 1EHIA 3L2PA 1BJTA 5IT9W 5EWEA 4A3EG 3RB6A 3HOZG 2RDJA 4WANA 2XC9A 2CTFA 2VQEH 4IHJF 4JV5H 3KHLA 3PO3G 1J4WA 4IFDG 5JUMA 1N56A 4O4HF 4A3DG 4IR9A 1N34H 4TQSA 2ZJTA 4OCHA 3KHRA 3GLKA 1TA8A 5DLGA 3Q8RB 2C22A 4IRCA 4A3MG 4BY7G 1V51A 4BWSC 2B63A 4RUCA 5JH7F 3BA8A 2R93G 4QIWA 2R7KA 1WVNA 4JI1H 3RF2A 1Z2PX 2YL2A 3E5NA 3G8CA 2Q2UA 5JVDF 4G3IA 2VPQA 5DQHA 2W9AA 4O3PA 4DR4H 5DG9A 3H3VH 4DLKA 1VAJA 2JE6I 3RAQA 1VIHA 3OHAA 2NN6G 5DG7A 2P2RA 4MV6A 4BXXG 2VUMA 3I4NG 3PN1A 2FLLA 2JA5G 2W8KA 4QMFB 4FBTA 5BR8H 2M05A 2IMWP 4GLXA 5C4XG 3ORQA 4JV0A 2LTLA 1UNNC 5KFUA 1I7LA 3LMLA 2D9IA 2RDIA 4IZOA 3M4IA 4C5CA 1UC9A 4EBCA 1BNCA 1O75A 3CQZA 4RZQA 4DR7H 4YBZB 1SEIA 2CWHA 2FLPA 1BXRA 3V4ZA 3MR5A 1NXUA 4O4LF 4YR3A 1JX4A 4J9NA 2V58A 2JZXA 3KXYT 1J5KA 3MWEA 1B04A 1N32H 4FS1A 3RB0A 3GABA 2NU7B 5C0XG 4Q8FA 2K1HA 2C2DA 2JVZA 1M6VA 2CWFA 5IWAH 3ORRA 4J9OA 4HYKA 4J9SA 3ETHA 2YZNA 4LF7H 4O2AF 5C44G 3RV3A 4RUAA 4ECXA 4X64H 1PQXA 2I8CA 4NXNH 1Y1WG 2J6SA 4JV2A 4A3CG 5KG0A 3PR4A 4M7EA 4JI5H 3BQ1A 4EG0A 2DLNA 5KT5A 4NZTM 3I0PA 5D1PA 4B3SH 2MJHA 4HNVA 2W6MA 1I3QA 5C3EG 5KFFA 3RIZA 4MV7A 3BAAA 3BG5A 1VKZA 1X0AA 4XYMB 4O2BF 5KFQA 2ASJA 5L9XA 2DPJA 1KHMA 4RB0A 2AGQA 2JA6A 5CB4F 3RB3A 4DL7A 4WD3A 1C3OA 3EPGA 1S0MA 2F4VH 1B33N 3GTJA 5FLXW 3EYYA 2R7NA 2JEAI 1XRHA 1N48A 1JXLA 4RNMA 2HVQA 3MWDA 2YRWA 2P0AA 4LH7A 2FP4B 3GIMA 3JRWA 4DL4A 2CTJA 4YY3H 4NLGA 1E4EB 2I80A 1KJIA 4WBNF 2XCAA 4A3GG 4EBEA 4YJ2F 2W71A 1K83A 4UCUA 2VA2A 4EC5A 3UQ8A 5KT3A 1PX2A 3TIGA 2YRXA 2VOBA 5KG2A 5FPRA 3KAJA 2JA7G 3OETA 3U9SA 3HB9A 4BY1G 2MCTA 4DV1H 3IN5A 4A3FG 2AQ4A 3PO2G 5DT9A 1ZTGA 5D8DA 4UCVA 3OUZA 3K5IA 4IRDA 2UVVA 2UUAH 1ULZA 3L4JA 3Q2OA 2BL5A 3K5HA 3VPCA 5BPFA 2BQRA 1TUAA 2IP4A 2O4CA 5FD5A 4C5AA 2W57A 2Y0SA 1X9NA 5KFXA 2ATLA 3MWMA 4YB8B 4JI0H 5LXTF 3M9MB 1EUDB 5KG3A 4EGQA 4FS2A 3SI8A 2BQ3A 4E9JA 4QIWE 5KT2A 1HNZH 3QFFA 2NVXA 3U1KA 1W93A 4JI2H 2XGPA 1TWFA 5KFEA 3GTKA 4ECQA 5K36G 1Z2NX 3VMMA 2OLSA 4OD6A 4HQ6A 2JEFA 1ZETA 2VQFH 5J2UF 2HHHH 1WCMA 5KFGA 2E5LH 2IA6A 3Q8QB 4ZQIA 3RGZA 5EZYF 1WH2A 2W7PA 5L1LA 2ZDHA 3H0GG 4MV8A 4IR1A 4Q8EA 4ZHQF 3HOYG 2YQRA 1CQIB 5KFLA 4LF5H 5KFHA 4YR0A 2I87A 4ECZA 3V6JA 4QWEA 3N43B 4J0MA 4RZRA 3GIJA 1E4EA 1KEEA 1P8LA 4A2AA 1JKJB 2CZGA 2JA8G 3M9NB 3N42B 4TV8F 1V9NA 2C35B 3T5LA 4DL3A 1AUXA 2CTKA 5IYCG 4J9KA 4IWXA 2HVSA 3OSPA 4DV4H 3PR5B 2M6QA 3KTMA 2HGSA 2JEJA 2BQUA 3V69A 3KHGA 1F0XA 1S03G 1IBMH 4RU9A 4LMYA 2E3UA 4APMA 5DQGA 5DLFA 4F4WA 4EYHB 5BPHA 2R6FA 5KG7A 2R86A 1ZZJA 2FMRA 2OWOA 4UFZA 1CQJB 2XCPA 3HOUG 1JDBB 2RGVA 3MR6A 4QJFA 3L4KA 2V4QA 4IWYA 4DV0H 2FKLA 1RJQA 4JI3H 4EFEA 4C5BA 2PVPA 4TV9F 5C1PA 3SB1A 2R92G 2JEBI 3JRXA 4AYBA 5FD6A 1VBIA 2UVUA 2XGQA 2HJWA 4U7CA 4UCSA 1Y1WA 1ZZIA 3LP8A 3PW4A 1B6SA 4X66H 5EWFA 4R7RA 2UU9H 4BBSG 5LMNH 3GV5B 3K3VA 1RK6A 4C2MA 2AXYA 5HBRB 3N41B 3OHBA 3VPBA 2HVRA 3HOWG 1C30A 2R85A 2OPUA 1WSCA 5BMVF 5KFDA 3OTOH
chains in the Genus database with same CATH topology
3OSSD 2VKCA 1VS0A 3CVZA 1E4FT 3RGXA 5FPOA 3RIZA 4MV7A 5LMUH 3BAAA 4OX9H 3J80W 4DUYH 3KDKA 1TAEA 2WE6A 4JI4H 4B3MH 3RJ0A 4X62H 2UUCH 4LF8H 4PDBA 2CW7A 3F8NA 4RB0A 4UCOA 3KALA 4ETSA 2WDTA 2YCHA 2F4VH 1ZHQA 5FLXW 1V9PA 1X9ZA 2XIGA 4LF9H 3EYYA 3N44B 1N33H 4MV9A 3JAMW 2HVQA 4LH7A 1FVIA 4YY3H 2UUBH 3RTXA 4B8CD 1ODHA 1IBKH 4RAZA 1J5EH 4UCUA 4EC5A 1SYXB 2O03A 3UQ8A 2KSWA 2CW8A 2WYOA 3HXLA 4RB2C 4DUZH 4DR2H 1A0IA 2VOBA 4LF4H 3IG0A 3BABA 1M0WA 3KAJA 3OETA 1S68A 5FPRA 4DV6H 3NCVA 4DV1H 2MCTA 2Y3MA 2ZQEA 5DT9A 1XNQH 1DGSA 4DR3H 4B3TH 4UCRA 4UCVA 4DV7H 3FAUA 3KDGA 2ZM6H 2UUAH 4JYAH 3L4JA 1FKAH 4YHHH 1AN7A 2O4CA 5FD5A 2W57A 1X9NA 4AQYH 4RB3C 3MWMA 4DR5H 4JI0H 3N6XA 4FM9A 4LFAH 1L2ZA 2FPHX 4E9JA 2Q2TA 4RAYA 4LFCH 2LF0A 1HNXH 1FJGH 4LSAA 4MTDA 1HNZH 4JI2H 4IAJA 2RGRA 4JI8H 4B3RH 5D1PA 4CC5A 1BJTA 5IT9W 3L2PA 1Z2NX 4X65H 5D1OB 4OD6A 3BA9A 5EOYA 4LSXA 2VQFH 2VQEH 2HHHH 4JV5H 2E5LH 4DR6H 1XMQH 3RGZA 1XNRH 1WH2A 1N34H 1I6UA 4GKKH 1E4GT 2ZJTA 4OCHA 3EZJA 4LF5H 1TA8A 4MTEA 5LL6b 4BWSC 3N43B 4J0MA 2VPSA 1XDNA 3J81W 2UXBH 1P8LA 3BA8A 4A2AA 1XMOH 4JI1H 2VUGA 3RF2A 4EFBA 4RB1A 3GR5A 4LF6H 4KHPH 3T1YH 1Z2PX 3N42B 2Q2UA 4JI6H 5A2QW 2HVSA 4DR4H 3QD7X 4DV4H 3KAKA 2UXCH 1HNWH 1Z2OX 2HGSA 1BGWA 4NZRM 1M0TA 3PN1A 1F0XA 1S03G 4UCTA 4DV5H 1IBMH 5BR8H 2FE3A 3T1HH 4LMYA 1I94H 4APMA 3C0FB 1ZHSA 4GLXA 4LH6A 3LMLA 2D9IA 3M4IA 1O75A 4RZQA 4DR7H 2OWOA 1SEIA 1N36H 1MZBA 4UFZA 1HR0H 3DF7A 2RGVA 4JI7H 2UXDH 3KXYT 3L4KA 4DV0H 1B04A 1N32H 2PT7G 4JI3H 4EFEA 4EEQA 3JSLA 3GABA 3SB1A 4I7HA 5FD6A 3FMAA 4DV2H 5IWAH 4UCSA 5D1OA 1GYFA 4K0KH 4X66H 4R7RA 2UU9H 3JSNA 3H20A 4LF7H 3N40P 4A2BA 4X64H 5LMNH 4GKJH 4NXNH 3K3VA 4Q0YA 4CC6A 3J7AK 3N41B 2HVRA 4M7EA 4JI5H 4DR1H 4G08A 4NZTM 4DV3H 4LFBH 3OTOH 4NXMH 1IBLH 4B3SH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU H;  4OX9 H;  3J80 W;  4DUY H;  4JI4 H;  4B3M H;  4X62 H;  2UUC H;  4LF8 H;  4PDB A;  2F4V H;  5FLX W;  4LF9 H;  1N33 H;  3JAM W;  4YY3 H;  2UUB H;  1IBK H;  1J5E H;  4DUZ H;  4DR2 H;  4LF4 H;  4DV6 H;  4DV1 H;  1XNQ H;  4DR3 H;  4B3T H;  4DV7 H;  2ZM6 H;  2UUA H;  4JYA H;  1FKA H;  4YHH H;  1AN7 A;  4AQY H;  4DR5 H;  4JI0 H;  4LFA H;  4LFC H;  1HNX H;  1FJG H;  1HNZ H;  4JI2 H;  4JI8 H;  4B3R H;  5IT9 W;  4X65 H;  2VQF H;  2VQE H;  2HHH H;  4JV5 H;  2E5L H;  4DR6 H;  1XMQ H;  1XNR H;  1N34 H;  1I6U A;  4GKK H;  4LF5 H;  5LL6 b;  3J81 W;  2UXB H;  1XMO H;  4JI1 H;  3RF2 A;  4LF6 H;  4KHP H;  3T1Y H;  4JI6 H;  5A2Q W;  4DR4 H;  4DV4 H;  2UXC H;  1HNW H;  1S03 G;  4DV5 H;  1IBM H;  5BR8 H;  3T1H H;  1I94 H;  4DR7 H;  1SEI A;  1N36 H;  1HR0 H;  4JI7 H;  2UXD H;  4DV0 H;  1N32 H;  4JI3 H;  4DV2 H;  5IWA H;  4K0K H;  4X66 H;  2UU9 H;  4LF7 H;  4X64 H;  5LMN H;  4GKJ H;  4NXN H;  3J7A K;  4JI5 H;  4DR1 H;  4DV3 H;  4LFB H;  3OTO H;  4NXM H;  1IBL H;  4B3S H; 
#chains in the Genus database with same CATH topology
 3OSS D;  2VKC A;  3CVZ A;  4QW9 A;  2R8I A;  1E4F T;  3R5X A;  5DGA A;  4YJ3 F;  2V59 A;  3J80 W;  1I50 A;  1TAE A;  5KFV A;  2W6Q A;  2J6U A;  4X62 H;  2UUC H;  5IYD G;  4OO1 G;  2CW7 A;  1WTJ A;  1EZ1 A;  4XZ3 B;  2C00 A;  4A3I G;  4LF9 H;  3N44 B;  3HKZ E;  5IYZ F;  4ECW A;  5EWG A;  1Y1V G;  1DV1 A;  2WAQ A;  5IP7 G;  2CTL A;  2DZD A;  1VIG A;  3RTX A;  2M8W A;  2JA9 A;  4B8C D;  4F4Z A;  3H4D A;  3EPI A;  2PMZ E;  4ED0 A;  4Q45 A;  3GIQ A;  2JA7 A;  1SYX B;  5EDW A;  1WHR A;  2C2R A;  4RB2 C;  4DUZ H;  3IG0 A;  1A0I A;  3G6Y A;  4LF4 H;  1A9X A;  4J9Q A;  1RJP A;  1S68 A;  4MV3 A;  3NCV A;  4R8U A;  3GIP A;  4EYI B;  2ZQE A;  4ECS A;  1S0N A;  5CA1 F;  2R8J A;  1VBG A;  3TII A;  2YS7 A;  4O3N A;  4L1K A;  2ZM6 H;  2ALZ A;  1UC8 A;  5KFR A;  2DGR A;  1FKA H;  2LRR A;  4YQW A;  5HV6 A;  4Q44 A;  5KT7 A;  5KG4 A;  4DR5 H;  1TWA A;  4QWA A;  4FM9 A;  2J6T A;  2W70 A;  4LFA H;  5JEA G;  4ECU A;  2IBK A;  3GTQ A;  2R7Z A;  1UG8 A;  2Q2T A;  2JEI A;  4DL2 A;  4JVH A;  3MJF A;  3GIK A;  2LF0 A;  1HNX H;  1FJG H;  1I7N A;  2Z0S A;  1S97 A;  1KJJ A;  4B3R H;  3Q1K A;  3BJY A;  2R8K A;  4CC5 A;  2YU9 A;  2LTM A;  3BA9 A;  4AM3 A;  5EOY A;  3WO1 A;  2VUM G;  4WAL A;  5LA6 F;  3WNZ A;  4EEY A;  5KFW A;  3RAX A;  3PW2 A;  2FJZ A;  3RB4 A;  4BA1 I;  2UVR A;  1TWC A;  3V4S A;  1KJQ A;  5C5J A;  4J9P A;  3TIN A;  4A93 G;  5LL6 b;  2VPS A;  1RJR A;  1XDN A;  5F9L A;  4O3Q A;  3M9O B;  2R82 A;  5IYB G;  4RB1 A;  2RF4 A;  1JIH A;  3GR5 A;  1X4M A;  4KHP H;  3T1Y H;  4JI6 H;  5FLM G;  5A2Q W;  2ASL A;  3GKU A;  5KFP A;  4J9L A;  3SE7 A;  3KAK A;  3H4B A;  1HNW H;  1GLV A;  1Z2O X;  2R8G A;  4A3J G;  4NZR M;  1JLL B;  5DG8 A;  5KFC A;  2NVY A;  4MA5 A;  4UCT A;  4DV5 H;  1CE8 A;  2DIK A;  3I12 A;  2PY9 A;  3TQT A;  4RNN A;  3U9T A;  4LH6 A;  1B6R A;  4H8A A;  3Q8S B;  4JUZ A;  5KFI A;  4BA2 I;  5T14 A;  3K3P A;  4ECR A;  2QYZ A;  5KT6 A;  3DF7 A;  3L7Z C;  1DV2 A;  2R92 A;  1VBH A;  2UXD H;  2R93 A;  3TQ1 A;  4HNT A;  3ETJ A;  4GC7 A;  2PT7 G;  5LYJ F;  4ED3 A;  4EEQ A;  3JSL A;  3QZ7 A;  5KFY A;  2PQU A;  3HOV G;  4DV2 H;  1GYF A;  4K0K H;  2W6P A;  2ZDG A;  3JSN A;  4Q43 A;  2JA5 A;  2V5A A;  1M7J A;  1ZQ7 A;  2WAQ E;  3N40 P;  4Q0Y A;  2VQD A;  4CC6 A;  3T5J A;  5C8Y F;  4G08 A;  2GPS A;  2CPQ A;  4NXM H;  2V9W A;  1IBL H;  3GV8 B;  2G8Y A;  3FKI G;  3V6H A;  1T3N A;  3UOE A;  1VS0 A;  4ED2 A;  2SCU B;  2YZM A;  5FPO A;  5LMU H;  4BBR G;  4JI4 H;  3RJ0 A;  4PDB A;  4FJU A;  2FK3 A;  3F8N A;  4R8U B;  3RUP A;  4ETS A;  1TWH A;  1Y1V A;  2YCH A;  5KG6 A;  4MV9 A;  2XIG A;  2YW2 A;  1N33 H;  2R8H A;  3HOX G;  1FVI A;  3G6V A;  2BR0 A;  3QZ8 A;  2UUB H;  1ODH A;  4QW8 A;  1S20 A;  2A1S A;  1IBK H;  4RNO A;  3GTL A;  4RAZ A;  3MFI A;  2OPV A;  1J5E H;  5L1I A;  3PW7 A;  2JEG A;  1T36 A;  1AUV A;  2KSW A;  2WYO A;  4LIJ A;  3HXL A;  4ED7 A;  1S0O A;  1OWT A;  1KJ9 A;  5CA0 F;  3BAB A;  3PVX A;  4F4Y A;  5KFM A;  5KFB A;  5JVL A;  4DV6 H;  4UCR A;  2FFM A;  2XCL A;  2Y3M A;  1DGS A;  4MA0 A;  4TUY F;  5L1K A;  2DWC A;  4DL6 A;  2AU0 A;  5KT4 A;  4DV7 H;  3FAU A;  3KDG A;  1WCM G;  1IOW A;  4U6P A;  4XX0 B;  4JYA H;  3N8D A;  5DQI A;  1AN7 A;  4JVY A;  1RK5 A;  2FMA A;  2R7L A;  3RBD A;  4ZOL F;  4AQY H;  3H40 A;  5CAE B;  3Q8P B;  4YAK B;  5KFA A;  1L2Z A;  3MFH A;  2FPH X;  4HR7 A;  1K1Q A;  2Y0S E;  3WO0 A;  2WB1 A;  1S9F A;  4RAY A;  1WR2 A;  4LFC H;  2W9B A;  4MTD A;  5L1J A;  4PWQ A;  4TQR A;  3GQC A;  4QWB A;  2CPM A;  2RGR A;  4JI8 H;  3UFX B;  2CKZ B;  1RYR A;  5LOV F;  2CTM A;  3AEV B;  4F50 A;  4X65 H;  1V8C A;  5D1O B;  4YAJ B;  3T5K A;  4LSX A;  1EC6 A;  2R87 A;  4DR6 H;  1Y14 B;  5K2M A;  1XMQ H;  4ZI7 F;  4YP3 A;  2ASD A;  1XNR H;  5C1O A;  2HH2 A;  1E4G T;  1I6U A;  4GKK H;  2FPP B;  3MR3 A;  3BQ0 A;  3PZP A;  3GTG A;  5J2T F;  2W8L A;  3EZJ A;  2CQY A;  4I4T F;  4MTE A;  4DL5 A;  2R84 A;  4J9R A;  1T94 A;  2QK4 A;  3J81 W;  3GID A;  2UXB H;  1DIK A;  5GON F;  4EFB A;  1XMO H;  2VUG A;  1CS0 A;  2W6O A;  1GSH A;  3FDS A;  4LF6 H;  2B63 G;  1EUC B;  2VR1 A;  4HNU A;  1KC7 A;  1DT4 A;  5FJ8 G;  4O3R A;  3R5F A;  3QD7 X;  1GO3 E;  3VPD A;  4ECV A;  2UXC H;  3OUU A;  2NU9 B;  1BGW A;  3JZI A;  1K1G A;  5IP9 G;  5KFT A;  4FBU A;  1M0T A;  3RFC A;  3AYH B;  2V4R A;  3KHH A;  2AGO A;  2FE3 A;  3T1H H;  1S10 A;  1I94 H;  3C0F B;  1ZHS A;  2W9C B;  1DTJ A;  4A3L G;  4MAM A;  3H0G A;  3R23 A;  4ECY A;  4QWC A;  2XD4 A;  3R5H A;  5KFS A;  1N36 H;  1MZB A;  2W6Z A;  1HR0 H;  5DGB A;  4QWD A;  2UVW A;  4J9M A;  4JI7 H;  4GC6 A;  2C2E A;  2BA0 A;  1MSZ A;  3PW5 A;  5LP6 F;  2GLT A;  2E2I A;  5F9N A;  2AGP A;  2FPI B;  4IRK A;  4F4X A;  4ED8 A;  3PW0 A;  4I7H A;  2OH2 A;  3FMA A;  2ZDQ A;  4ECT A;  1GGO A;  5KFO A;  5D1O A;  2PBZ A;  2ANN A;  2FK1 A;  5H80 A;  3H20 A;  4AYB E;  1KBL A;  3BQ2 A;  4A2B A;  2NU8 B;  4GKJ H;  5KFJ A;  2WTF A;  3J7A K;  3FKI A;  1GSO A;  5KFN A;  2GPW A;  4DR1 H;  4FU0 A;  4ME6 A;  4DV3 H;  4LFB H;  2QND A;  1PK8 A;  3LWB A;  1KJ8 A;  1TWG A;  3GV7 B;  3RBE A;  4MV4 A;  5KFK A;  1ZZK A;  4Y8V B;  2CTE A;  1JDE A;  2NU6 B;  3RGX A;  1RYS A;  2W7O A;  2YYA A;  1K1S A;  4OX9 H;  5JQW A;  4DUY H;  3KDK A;  2WE6 A;  2DPI A;  4B3M H;  4A3K G;  3OSN A;  4LF8 H;  3I4M G;  4I50 F;  2R7M A;  1GSA A;  3HKZ A;  4UCO A;  3T5H A;  3KAL A;  2WDT A;  2NUA B;  4M9U A;  1ZHQ A;  1V9P A;  1X9Z A;  4EBD A;  4A3B G;  1W96 A;  3RV4 A;  2JA6 G;  3JAM W;  2PMZ A;  4JV1 A;  2ANR A;  2HH3 A;  4NBQ A;  2W6N A;  2YS6 A;  4O4I F;  5KFZ A;  4I55 F;  2W9C A;  2R7Z G;  3MR2 A;  2FPG B;  1IOV A;  2WB1 E;  3GTP A;  2E2H A;  4ED1 A;  2O03 A;  2CW8 A;  2FLN A;  1V4Y A;  3GTM A;  5KG1 A;  4DR2 H;  4XYL B;  4B8T A;  1M0W A;  2FB9 A;  5KG5 A;  2W9B B;  2FK2 A;  4O3O A;  4E4T A;  1XNQ H;  4AIM A;  5KKN B;  3HBL A;  3GIL A;  4DR3 H;  4B3T H;  3V6K A;  3G6X A;  2VA3 A;  5KX5 F;  4EGJ A;  4YHH H;  2X0S A;  5I47 A;  2J9G A;  1SCU B;  2X06 A;  4FJS A;  4RB3 C;  3NGD A;  1SFO A;  3N6X A;  1X4N A;  1Z2I A;  2C28 A;  4O3S A;  3GTO A;  3GII A;  3VKE A;  1WE8 A;  4YR2 A;  4LSA A;  1R9T A;  1EYZ A;  4IAJ A;  4ED6 A;  2PN1 A;  2YZG A;  4MV1 A;  1EHI A;  3L2P A;  1BJT A;  5IT9 W;  5EWE A;  4A3E G;  3RB6 A;  3HOZ G;  2RDJ A;  4WAN A;  2XC9 A;  2CTF A;  2VQE H;  4IHJ F;  4JV5 H;  3KHL A;  3PO3 G;  1J4W A;  4IFD G;  5JUM A;  1N56 A;  4O4H F;  4A3D G;  4IR9 A;  1N34 H;  4TQS A;  2ZJT A;  4OCH A;  3KHR A;  3GLK A;  1TA8 A;  5DLG A;  3Q8R B;  2C22 A;  4IRC A;  4A3M G;  4BY7 G;  1V51 A;  4BWS C;  2B63 A;  4RUC A;  5JH7 F;  3BA8 A;  2R93 G;  4QIW A;  2R7K A;  1WVN A;  4JI1 H;  3RF2 A;  1Z2P X;  2YL2 A;  3E5N A;  3G8C A;  2Q2U A;  5JVD F;  4G3I A;  2VPQ A;  5DQH A;  2W9A A;  4O3P A;  4DR4 H;  5DG9 A;  3H3V H;  4DLK A;  1VAJ A;  2JE6 I;  3RAQ A;  1VIH A;  3OHA A;  2NN6 G;  5DG7 A;  2P2R A;  4MV6 A;  4BXX G;  2VUM A;  3I4N G;  3PN1 A;  2FLL A;  2JA5 G;  2W8K A;  4QMF B;  4FBT A;  5BR8 H;  2M05 A;  2IMW P;  4GLX A;  5C4X G;  3ORQ A;  4JV0 A;  2LTL A;  1UNN C;  5KFU A;  1I7L A;  3LML A;  2D9I A;  2RDI A;  4IZO A;  3M4I A;  4C5C A;  1UC9 A;  4EBC A;  1BNC A;  1O75 A;  3CQZ A;  4RZQ A;  4DR7 H;  4YBZ B;  1SEI A;  2CWH A;  2FLP A;  1BXR A;  3V4Z A;  3MR5 A;  1NXU A;  4O4L F;  4YR3 A;  1JX4 A;  4J9N A;  2V58 A;  2JZX A;  3KXY T;  1J5K A;  3MWE A;  1B04 A;  1N32 H;  4FS1 A;  3RB0 A;  3GAB A;  2NU7 B;  5C0X G;  4Q8F A;  2K1H A;  2C2D A;  2JVZ A;  1M6V A;  2CWF A;  5IWA H;  3ORR A;  4J9O A;  4HYK A;  4J9S A;  3ETH A;  2YZN A;  4LF7 H;  4O2A F;  5C44 G;  3RV3 A;  4RUA A;  4ECX A;  4X64 H;  1PQX A;  2I8C A;  4NXN H;  1Y1W G;  2J6S A;  4JV2 A;  4A3C G;  5KG0 A;  3PR4 A;  4M7E A;  4JI5 H;  3BQ1 A;  4EG0 A;  2DLN A;  5KT5 A;  4NZT M;  3I0P A;  5D1P A;  4B3S H;  2MJH A;  4HNV A;  2W6M A;  1I3Q A;  5C3E G;  5KFF A;  3RIZ A;  4MV7 A;  3BAA A;  3BG5 A;  1VKZ A;  1X0A A;  4XYM B;  4O2B F;  5KFQ A;  2ASJ A;  5L9X A;  2DPJ A;  1KHM A;  4RB0 A;  2AGQ A;  2JA6 A;  5CB4 F;  3RB3 A;  4DL7 A;  4WD3 A;  1C3O A;  3EPG A;  1S0M A;  2F4V H;  1B33 N;  3GTJ A;  5FLX W;  3EYY A;  2R7N A;  2JEA I;  1XRH A;  1N48 A;  1JXL A;  4RNM A;  2HVQ A;  3MWD A;  2YRW A;  2P0A A;  4LH7 A;  2FP4 B;  3GIM A;  3JRW A;  4DL4 A;  2CTJ A;  4YY3 H;  4NLG A;  1E4E B;  2I80 A;  1KJI A;  4WBN F;  2XCA A;  4A3G G;  4EBE A;  4YJ2 F;  2W71 A;  1K83 A;  4UCU A;  2VA2 A;  4EC5 A;  3UQ8 A;  5KT3 A;  1PX2 A;  3TIG A;  2YRX A;  2VOB A;  5KG2 A;  5FPR A;  3KAJ A;  2JA7 G;  3OET A;  3U9S A;  3HB9 A;  4BY1 G;  2MCT A;  4DV1 H;  3IN5 A;  4A3F G;  2AQ4 A;  3PO2 G;  5DT9 A;  1ZTG A;  5D8D A;  4UCV A;  3OUZ A;  3K5I A;  4IRD A;  2UVV A;  2UUA H;  1ULZ A;  3L4J A;  3Q2O A;  2BL5 A;  3K5H A;  3VPC A;  5BPF A;  2BQR A;  1TUA A;  2IP4 A;  2O4C A;  5FD5 A;  4C5A A;  2W57 A;  2Y0S A;  1X9N A;  5KFX A;  2ATL A;  3MWM A;  4YB8 B;  4JI0 H;  5LXT F;  3M9M B;  1EUD B;  5KG3 A;  4EGQ A;  4FS2 A;  3SI8 A;  2BQ3 A;  4E9J A;  4QIW E;  5KT2 A;  1HNZ H;  3QFF A;  2NVX A;  3U1K A;  1W93 A;  4JI2 H;  2XGP A;  1TWF A;  5KFE A;  3GTK A;  4ECQ A;  5K36 G;  1Z2N X;  3VMM A;  2OLS A;  4OD6 A;  4HQ6 A;  2JEF A;  1ZET A;  2VQF H;  5J2U F;  2HHH H;  1WCM A;  5KFG A;  2E5L H;  2IA6 A;  3Q8Q B;  4ZQI A;  3RGZ A;  5EZY F;  1WH2 A;  2W7P A;  5L1L A;  2ZDH A;  3H0G G;  4MV8 A;  4IR1 A;  4Q8E A;  4ZHQ F;  3HOY G;  2YQR A;  1CQI B;  5KFL A;  4LF5 H;  5KFH A;  4YR0 A;  2I87 A;  4ECZ A;  3V6J A;  4QWE A;  3N43 B;  4J0M A;  4RZR A;  3GIJ A;  1E4E A;  1KEE A;  1P8L A;  4A2A A;  1JKJ B;  2CZG A;  2JA8 G;  3M9N B;  3N42 B;  4TV8 F;  1V9N A;  2C35 B;  3T5L A;  4DL3 A;  1AUX A;  2CTK A;  5IYC G;  4J9K A;  4IWX A;  2HVS A;  3OSP A;  4DV4 H;  3PR5 B;  2M6Q A;  3KTM A;  2HGS A;  2JEJ A;  2BQU A;  3V69 A;  3KHG A;  1F0X A;  1S03 G;  1IBM H;  4RU9 A;  4LMY A;  2E3U A;  4APM A;  5DQG A;  5DLF A;  4F4W A;  4EYH B;  5BPH A;  2R6F A;  5KG7 A;  2R86 A;  1ZZJ A;  2FMR A;  2OWO A;  4UFZ A;  1CQJ B;  2XCP A;  3HOU G;  1JDB B;  2RGV A;  3MR6 A;  4QJF A;  3L4K A;  2V4Q A;  4IWY A;  4DV0 H;  2FKL A;  1RJQ A;  4JI3 H;  4EFE A;  4C5B A;  2PVP A;  4TV9 F;  5C1P A;  3SB1 A;  2R92 G;  2JEB I;  3JRX A;  4AYB A;  5FD6 A;  1VBI A;  2UVU A;  2XGQ A;  2HJW A;  4U7C A;  4UCS A;  1Y1W A;  1ZZI A;  3LP8 A;  3PW4 A;  1B6S A;  4X66 H;  5EWF A;  4R7R A;  2UU9 H;  4BBS G;  5LMN H;  3GV5 B;  3K3V A;  1RK6 A;  4C2M A;  2AXY A;  5HBR B;  3N41 B;  3OHB A;  3VPB A;  2HVR A;  3HOW G;  1C30 A;  2R85 A;  2OPU A;  1WSC A;  5BMV F;  5KFD A;  3OTO H; 
#chains in the Genus database with same CATH homology
 3OSS D;  2VKC A;  1VS0 A;  3CVZ A;  1E4F T;  3RGX A;  5FPO A;  3RIZ A;  4MV7 A;  5LMU H;  3BAA A;  4OX9 H;  3J80 W;  4DUY H;  3KDK A;  1TAE A;  2WE6 A;  4JI4 H;  4B3M H;  3RJ0 A;  4X62 H;  2UUC H;  4LF8 H;  4PDB A;  2CW7 A;  3F8N A;  4RB0 A;  4UCO A;  3KAL A;  4ETS A;  2WDT A;  2YCH A;  2F4V H;  1ZHQ A;  5FLX W;  1V9P A;  1X9Z A;  2XIG A;  4LF9 H;  3EYY A;  3N44 B;  1N33 H;  4MV9 A;  3JAM W;  2HVQ A;  4LH7 A;  1FVI A;  4YY3 H;  2UUB H;  3RTX A;  4B8C D;  1ODH A;  1IBK H;  4RAZ A;  1J5E H;  4UCU A;  4EC5 A;  1SYX B;  2O03 A;  3UQ8 A;  2KSW A;  2CW8 A;  2WYO A;  3HXL A;  4RB2 C;  4DUZ H;  4DR2 H;  1A0I A;  2VOB A;  4LF4 H;  3IG0 A;  3BAB A;  1M0W A;  3KAJ A;  3OET A;  1S68 A;  5FPR A;  4DV6 H;  3NCV A;  4DV1 H;  2MCT A;  2Y3M A;  2ZQE A;  5DT9 A;  1XNQ H;  1DGS A;  4DR3 H;  4B3T H;  4UCR A;  4UCV A;  4DV7 H;  3FAU A;  3KDG A;  2ZM6 H;  2UUA H;  4JYA H;  3L4J A;  1FKA H;  4YHH H;  1AN7 A;  2O4C A;  5FD5 A;  2W57 A;  1X9N A;  4AQY H;  4RB3 C;  3MWM A;  4DR5 H;  4JI0 H;  3N6X A;  4FM9 A;  4LFA H;  1L2Z A;  2FPH X;  4E9J A;  2Q2T A;  4RAY A;  4LFC H;  2LF0 A;  1HNX H;  1FJG H;  4LSA A;  4MTD A;  1HNZ H;  4JI2 H;  4IAJ A;  2RGR A;  4JI8 H;  4B3R H;  5D1P A;  4CC5 A;  1BJT A;  5IT9 W;  3L2P A;  1Z2N X;  4X65 H;  5D1O B;  4OD6 A;  3BA9 A;  5EOY A;  4LSX A;  2VQF H;  2VQE H;  2HHH H;  4JV5 H;  2E5L H;  4DR6 H;  1XMQ H;  3RGZ A;  1XNR H;  1WH2 A;  1N34 H;  1I6U A;  4GKK H;  1E4G T;  2ZJT A;  4OCH A;  3EZJ A;  4LF5 H;  1TA8 A;  4MTE A;  5LL6 b;  4BWS C;  3N43 B;  4J0M A;  2VPS A;  1XDN A;  3J81 W;  2UXB H;  1P8L A;  3BA8 A;  4A2A A;  1XMO H;  4JI1 H;  2VUG A;  3RF2 A;  4EFB A;  4RB1 A;  3GR5 A;  4LF6 H;  4KHP H;  3T1Y H;  1Z2P X;  3N42 B;  2Q2U A;  4JI6 H;  5A2Q W;  2HVS A;  4DR4 H;  3QD7 X;  4DV4 H;  3KAK A;  2UXC H;  1HNW H;  1Z2O X;  2HGS A;  1BGW A;  4NZR M;  1M0T A;  3PN1 A;  1F0X A;  1S03 G;  4UCT A;  4DV5 H;  1IBM H;  5BR8 H;  2FE3 A;  3T1H H;  4LMY A;  1I94 H;  4APM A;  3C0F B;  1ZHS A;  4GLX A;  4LH6 A;  3LML A;  2D9I A;  3M4I A;  1O75 A;  4RZQ A;  4DR7 H;  2OWO A;  1SEI A;  1N36 H;  1MZB A;  4UFZ A;  1HR0 H;  3DF7 A;  2RGV A;  4JI7 H;  2UXD H;  3KXY T;  3L4K A;  4DV0 H;  1B04 A;  1N32 H;  2PT7 G;  4JI3 H;  4EFE A;  4EEQ A;  3JSL A;  3GAB A;  3SB1 A;  4I7H A;  5FD6 A;  3FMA A;  4DV2 H;  5IWA H;  4UCS A;  5D1O A;  1GYF A;  4K0K H;  4X66 H;  4R7R A;  2UU9 H;  3JSN A;  3H20 A;  4LF7 H;  3N40 P;  4A2B A;  4X64 H;  5LMN H;  4GKJ H;  4NXN H;  3K3V A;  4Q0Y A;  4CC6 A;  3J7A K;  3N41 B;  2HVR A;  4M7E A;  4JI5 H;  4DR1 H;  4G08 A;  4NZT M;  4DV3 H;  4LFB H;  3OTO H;  4NXM H;  1IBL H;  4B3S H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...