1SEIA

Structure of 30s ribosomal protein s8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
VMTDPIADMLTAIRNANMVRHEKLEVPASKIKREIAEILKREGFIRDYEYIEDNKQGILRIFLKYGPNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIAILSTSQGVLTDKEARQKGTGGEIIAYVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN S8
publication title Structural evidence for specific S8-RNA and S8-protein interactions within the 30S ribosomal subunit: ribosomal protein S8 from Bacillus stearothermophilus at 1.9 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
total genus 31
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1seiA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1seiA02
4JI7H 5A2QW 4JI8H 4DV2H 5FLXW 2UUAH 2E5LH 4X65H 3T1HH 1N36H 4B3TH 1N32H 5LL6b 4DV7H 4JI2H 4GKKH 4DUYH 4OX9H 2HHHH 4DV0H 1HNXH 4B3RH 4JI6H 1J5EH 4X66H 4DR1H 1AN7A 4B3SH 2UUCH 4JI5H 1I6UA 4JI4H 4DV1H 2F4VH 2VQFH 4JI0H 4JV5H 5BR8H 4LF5H 1XNQH 4LFBH 4LF7H 1N34H 4DR6H 4B3MH 2UUBH 1S03G 4NXNH 5LMNH 3J80W 4NXMH 1IBLH 4YHHH 2UXCH 1SEIA 4DV5H 4KHPH 4JYAH 4X64H 4DR2H 1FJGH 4LFCH 4DR7H 1N33H 5IT9W 3OTOH 1XNRH 1FKAH 4LFAH 5LMUH 4AQYH 4JI1H 4DR4H 4DV3H 4JI3H 1I94H 1HNWH 4LF8H 3J81W 1XMOH 2VQEH 4LF6H 3T1YH 2ZM6H 3JAMW 3RF2A 4DUZH 4LF9H 4DR5H 4PDBA 4DV6H 4X62H 5IWAH 2UXDH 4DR3H 1HNZH 2UXBH 4YY3H 1IBKH 1HR0H 4DV4H 1XMQH 3J7AK 1IBMH 4K0KH 4LF4H 2UU9H 4GKJH
chains in the Genus database with same CATH superfamily
2VOBA 2FLLA 4EBEA 2B63G 2DPJA 1KBLA 3RB4A 1ZQ7A 2JA5A 3RV4A 3EPIA 5DGAA 3PN1A 3GIPA 3K3PA 5C1OA 1VKZA 2W6NA 3N6XA 3RTXA 4YP3A 5KFRA 3T1HH 4OO1G 3M9NB 2FP4B 4TUYF 2AGQA 1Z2IA 2CPMA 4EGJA 3MR2A 4UCUA 2P2RA 4J9NA 1V9NA 1WTJA 2IMWP 3GTLA 4QMFB 5IYZF 1S97A 4GKKH 5KFTA 5F9NA 1Y1VA 3U9SA 2CW8A 3KDGA 2V9WA 3KTMA 2YL2A 4ECSA 5KFKA 1JIHA 4B3RH 1CQIB 2Q2TA 1RJQA 2BQRA 1K1GA 4L1KA 4X66H 3RB0A 2A1SA 4ECZA 4B3SH 1GLVA 2VR1A 2FLPA 3GIIA 2B63A 1I6UA 2PBZA 4Q45A 3PR5B 1MZBA 3N40P 2C35B 1EUCB 1DTJA 4Q0YA 4QIWE 5GONF 2VUMG 2NUAB 1A0IA 4Q43A 4A3DG 4MA5A 4C5CA 2WYOA 5JH7F 2UVVA 1KJ9A 2R8IA 5KFNA 3Q8SB 2JE6I 4A3EG 3HKZE 4DR6H 4NLGA 1UC8A 2FFMA 1DIKA 2FJZA 2XCLA 3VPCA 3RIZA 2NU6B 3I0PA 3Q1KA 1GYFA 3TINA 2AGPA 2J6UA 1O75A 5LMNH 3J80W 2HJWA 2R7LA 2FE3A 3RBEA 4J9LA 2J6TA 4EG0A 1VAJA 4LSAA 1SEIA 5C0XG 3H0GG 1OWTA 4A93G 4YJ2F 2Z0SA 3CQZA 1CE8A 4LIJA 5FPRA 4F4XA 1FJGH 3T5JA 4ECXA 3EZJA 1CS0A 5KG6A 5L1JA 5LOVF 1WHRA 2O4CA 1E4FT 3OTOH 2VUMA 4I50F 1GSHA 1ZZIA 4EEYA 3H20A 3PW4A 2CTEA 1J5KA 2LRRA 3KAJA 1UG8A 5LMUH 4QIWA 2YZMA 5K2MA 4ZI7F 4TV9F 3JSLA 2C2RA 3GTMA 1C30A 4DV3H 3HOYG 1PQXA 4FM9A 4WALA 3HKZA 4MV3A 2Q2UA 2YZGA 4ED0A 1UC9A 1KJ8A 1BXRA 2V4RA 3TQ1A 2E3UA 1X4NA 5LA6F 4ECUA 2V58A 1I7LA 4NZRM 5C5JA 4C5BA 2ZM6H 1RK5A 3H0GA 5KFIA 2HVQA 2HH2A 3RF2A 4LF9H 2HVSA 5KG1A 3GTQA 4JV1A 1M7JA 3QD7X 3EYYA 3FDSA 5J2TF 5KG5A 4RB0A 2K1HA 3GTGA 4GC7A 4O2AF 3G6YA 4EEQA 5J2UF 5IYBG 3FKIG 4G08A 4BA2I 4DR3H 2IBKA 2PY9A 4F4ZA 2YW2A 2W9AA 4DL5A 1W96A 4AIMA 3N44B 3GIKA 4QWEA 5KFDA 3PR4A 2UXBH 1EYZA 1IBKH 1IOWA 2VA3A 3V4ZA 3KHHA 4IR1A 5DQIA 2W6ZA 3G6VA 4J9RA 4R7RA 3PW5A 2DGRA 5FD5A 4JUZA 3OHBA 1DV1A 1GSAA 1Y1WG 1ZETA 4MV8A 3BAAA 2NU8B 4UCSA 4UCRA 1XRHA 3UQ8A 3JRXA 4DV2H 2W70A 1DT4A 5EWGA 3V6KA 3MR6A 2C2EA 5JEAG 1S68A 5C1PA 4IRKA 2NVXA 4JV2A 2NU9B 3KAKA 1L2ZA 3FKIA 5CAEB 2LTLA 5JUMA 2QYZA 1VBIA 2G8YA 5KFEA 2ATLA 4ECVA 5BPHA 3N8DA 4J9SA 4DUYH 2AU0A 2PQUA 3MR3A 5DT9A 3SE7A 5CB4F 4TQSA 4Q8EA 4RUAA 3Q8PB 1HNXH 3G6XA 1DV2A 4NBQA 2XD4A 4JI6H 3MWDA 5KX5F 1AUXA 4IRDA 2JVZA 2YCHA 3H40A 4O3RA 1S9FA 4QW9A 2UUCH 1Y1WA 5DGBA 3Q8QB 2CWHA 1EHIA 2V4QA 4QWBA 2FPGB 4FU0A 4O3NA 3ETJA 2V59A 5D1OA 2ANRA 5DQHA 4DL2A 2F4VH 1AUVA 2OWOA 1S0NA 4HNTA 1S0OA 4ED2A 2R8JA 4F4WA 4JI0H 1J4WA 5KFHA 4AYBE 4ZOLF 4YJ3F 3OUZA 2PMZE 4U6PA 2E2IA 4LF5H 1XNQH 3OSPA 4LF7H 4HNVA 4OCHA 4RAYA 1M0TA 5LYJF 3BQ0A 2MJHA 2FK2A 2W8KA 3RFCA 5KT3A 4QWCA 2R6FA 2GPWA 1RJRA 3F8NA 2W9BA 2W6MA 1JX4A 1KEEA 4A3GG 2NN6G 5KFGA 4QWDA 4EBCA 1WCMG 5KT7A 4RZQA 2CWFA 3HOZG 4ECTA 4M9UA 2RF4A 3BABA 5FPOA 4G3IA 5FD6A 5C4XG 2M05A 4UCTA 4X64H 2IP4A 3G8CA 4R8UA 3PW0A 2R8KA 2CTJA 2PT7G 3HBLA 1GGOA 4O3PA 3K5HA 2BA0A 4MV7A 4FBTA 4E4TA 2I87A 3T5LA 4A3JG 4RUCA 1FKAH 3I4MG 4MTEA 2JA7G 1KJQA 3WNZA 4IWXA 1MSZA 4AQYH 4RB3C 4I4TF 3GV7B 4FJUA 3Q2OA 4YBZB 5KKNB 4DR4H 3GV5B 3VPBA 4A3BG 3RBDA 5KFVA 4AYBA 2R93G 1I94H 4MTDA 2PMZA 4EYHB 1BNCA 5KFYA 1P8LA 4PWQA 4LF8H 5BPFA 2JA8G 4I7HA 2O03A 4ECYA 3BQ2A 3TQTA 3J81W 3AYHB 1EC6A 4A2AA 2VQEH 4LF6H 2HH3A 1WCMA 3N41B 3RJ0A 3JAMW 4JV0A 3BA9A 4DL6A 2R7KA 3VMMA 5KT4A 4E9JA 1R9TA 3GABA 1I7NA 3KXYT 2J6SA 1NXUA 1B6RA 2JZXA 2ZQEA 3SB1A 3BJYA 3IN5A 4ED7A 2DIKA 2JEBI 4H8AA 1VIGA 5JQWA 4ED1A 3PW7A 5KFCA 5L1LA 2YRWA 2JA7A 4YR2A 4RNOA 3OETA 1TWCA 5DQGA 4J9PA 1E4EA 4F50A 3LP8A 2R8HA 2AXYA 1B6SA 2R93A 1HNZH 3BQ1A 4UCVA 5KFQA 1XDNA 4YY3H 4BY1G 4IFDG 2HVRA 3GIQA 5DLGA 3J7AK 4YR0A 4LF4H 4RNMA 5KFOA 2CTKA 1B33N 5I47A 5KT5A 4FS1A 2VA2A 5D1PA 3AEVB 3RAXA 1T3NA 2YRXA 2YZNA 2RDIA 3ETHA 5KFFA 2W8LA 5A2QW 3PO3G 2MCTA 3CVZA 4IWYA 2ASLA 3KALA 2R82A 2XIGA 5CA0F 4JI8H 4MV4A 5IYDG 1C3OA 3JSNA 5KT6A 5EDWA 4J0MA 3RGXA 3RAQA 5L1IA 5FLXW 4MA0A 3PW2A 3KHLA 4YB8B 4X65H 1TA8A 5DG8A 2W7PA 1N32H 3SI8A 2ASJA 3GKUA 1K1SA 4WBNF 2FKLA 2W6PA 1JDEA 2BR0A 2PVPA 2CPQA 2P0AA 2R85A 2VQDA 2W6OA 3JZIA 1BGWA 5EOYA 3R23A 2R86A 4BY7G 3R5XA 4XYMB 4A3KG 4GC6A 4HYKA 5KG0A 1X9NA 3VPDA 1J5EH 5KFJA 3MJFA 4DR1H 1AN7A 2RGVA 2XC9A 4EBDA 1JKJB 5KFUA 4CC6A 4EYIB 5IP9G 3WO0A 4XX0B 3FAUA 4JI5H 5LP6F 3M9MB 2JA9A 1WE8A 4DV1H 3PZPA 3OSSD 2VQFH 4LMYA 5IYCG 3OHAA 1SFOA 2C22A 4ED3A 5L9XA 2CW7A 3L4KA 3GIMA 4ED6A 4O3QA 4O3SA 4B8CD 1Y14B 1Z2PX 2WTFA 1S10A 2CTLA 1BJTA 4WANA 2C2DA 1N34H 2YS6A 2CTFA 5KFZA 2XGQA 4GLXA 4EC5A 2R84A 4BWSC 2FB9A 1A9XA 4JVYA 5FJ8G 4ECWA 2FMAA 2UVRA 2E2HA 4A3IG 2KSWA 4DLKA 4APMA 3V6HA 3HOWG 4FBUA 4ECQA 3Q8RB 5KFSA 4Q44A 2DLNA 1X0AA 4A2BA 4NXMH 2W6QA 1TWHA 2AQ4A 4A3MG 1WR2A 1S0MA 5K36G 2M8WA 4ECRA 2JEGA 4O4HF 3K5IA 4UCOA 4KHPH 4JYAH 4ME6A 4B8TA 4RB2C 3DF7A 3HOUG 3OUUA 2CZGA 2FPPB 4DR2H 4EFBA 3GTPA 4LFCH 1RJPA 2ZDGA 1VIHA 2HGSA 3OSNA 2YU9A 4ZHQF 2DWCA 5KG4A 2W9BB 4HNUA 2W9CA 3T5KA 4Y8VB 3H3VH 2YS7A 4LFAH 1VBGA 1K1QA 4M7EA 3GIJA 2J9GA 5C44G 1K83A 4LH6A 1M0WA 4JI3H 4C2MA 4R8UB 2FK3A 4BA1I 5KFAA 3JRWA 2OH2A 3NGDA 1W93A 2WDTA 3MWMA 2R87A 1M6VA 4IRCA 2CKZB 2DZDA 1I3QA 3I12A 1GSOA 2C00A 5IP7G 2JEIA 5EWEA 4NZTM 3GTOA 1TAEA 2W57A 3RUPA 4DUZH 3T5HA 1B04A 4RU9A 4QJFA 2LTMA 2ANNA 4DR5H 1VS0A 4DL3A 1KHMA 4PDBA 4RNNA 1TWFA 4DV6H 4IAJA 5IWAH 3K3VA 3R5FA 2JEAI 3GILA 1RK6A 2BQUA 4XYLB 5KG3A 4YR3A 4J9MA 3VKEA 1WH2A 3RB6A 2ZJTA 3TIGA 4ETSA 3KHGA 2YYAA 3KDKA 2Y3MA 3TIIA 5L1KA 4LSXA 4DL4A 4MV9A 2OPVA 2WB1A 1XMQH 2Y0SA 2FK1A 3BA8A 4J9KA 2XCAA 5LXTF 3R5HA 1IBMH 5JVLA 1N56A 2UU9H 2JEFA 4GKJH 4IZOA 3GR5A 1DGSA 4HR7A 3MFIA 1PK8A 3KHRA 4FS2A 1RYRA 1E4EB 4YQWA 4JI7H 2QK4A 3PO2G 4TQRA 4TV8F 1JLLB 3WO1A 1V51A 3V4SA 3MR5A 3UOEA 4YAKB 2WAQE 5JVDF 5KFBA 1V9PA 1Z2OX 4O3OA 3H4DA 2ZDQA 3GTKA 3GTJA 2UUAH 4O4IF 2R7ZG 1SCUB 1ZTGA 2E5LH 5CA1F 1N36H 4B3TH 5LL6b 2R7MA 1F0XA 3C0FB 3L2PA 4DV7H 4BXXG 2BQ3A 2ZDHA 2UVWA 2I80A 2LF0A 4JI2H 3HXLA 3BG5A 4EGQA 4OX9H 3QZ8A 4Q8FA 1SYXB 3NCVA 2HHHH 4WD3A 2JEJA 4DV0H 3HOVG 2NU7B 5DG9A 3H4BA 2X0SA 1FVIA 2PN1A 2GLTA 3V6JA 2AGOA 4CC5A 2R92G 3GIDA 4A3LG 3M9OB 4IR9A 2RGRA 3LWBA 4LH7A 5KG7A 2NVYA 3QZ7A 4JI4H 4HQ6A 4A3CG 3LMLA 5KFPA 4QW8A 2R7ZA 3I4NG 2FPIB 5KG2A 2WAQA 3ORRA 1I50A 2CQYA 1S20A 4JV5H 5KFMA 3GQCA 2YQRA 5BR8H 2W71A 4J9OA 2XGPA 4EFEA 5DLFA 4LFBH 3V69A 5KFWA 5KFLA 4FJSA 4B3MH 2CTMA 2SCUB 4I55F 2UUBH 5C8YF 3HB9A 5KFXA 1S03G 4MV1A 2DPIA 3RGZA 4NXNH 1T94A 1ULZA 2VPQA 2C28A 3L4JA 1X4MA 2R92A 4U7CA 5H80A 3EPGA 1IBLH 4YHHH 2UXCH 3IG0A 4DV5H 1E4GT 3E5NA 5T14A 1V8CA 4OD6A 2GPSA 2R7NA 4UFZA 3U9TA 4RZRA 2JA6G 4DR7H 1N33H 1CQJB 1JDBB 5IT9W 5DG7A 5EZYF 1TUAA 2RDJA 1V4YA 1XNRH 2D9IA 1EZ1A 4C5AA 1VBHA 2UVUA 2I8CA 1GO3E 3UFXB 3MWEA 2WE6A 1T36A 3N43B 4O4LF 4O2BF 4RB1A 4JI1H 2OLSA 2FMRA 5EWFA 3U1KA 4ED8A 3ORQA 1HNWH 3RV3A 4ZQIA 4MV6A 1WSCA 5D1OB 4A3FG 1Z2NX 4YAJB 4JVHA 1EUDB 2W9CB 1UNNC 3PVXA 1KJIA 5F9LA 1KJJA 2BL5A 1TWAA 2FLNA 5KT2A 1XMOH 3T1YH 2OPUA 5HBRB 2ASDA 5D8DA 1JXLA 3HOXG 3MFHA 4IHJF 1WVNA 2JA5G 2JA6A 3QFFA 3GV8B 1KC7A 4X62H 1IOVA 2QNDA 2UXDH 3RB3A 3M4IA 2W7OA 2VKCA 3L7ZC 1ZHSA 2R8GA 1X9ZA 2ALZA 5HV6A 4QWAA 1ODHA 2WB1E 2XCPA 1RYSA 2FPHX 2Y0SE 3FMAA 4MAMA 2VPSA 2IA6A 3GLKA 2X06A 1ZZJA 1HR0H 1Y1VG 1TWGA 4DV4H 2V5AA 5C3EG 1ZHQA 4K0KH 1PX2A 4BBSG 5FLMG 4DL7A 5BMVF 4F4YA 2VUGA 4XZ3B 1ZZKA 4J9QA 3N42B 2M6QA 1N48A 4BBRG 4RAZA 4AM3A
chains in the Genus database with same CATH topology
4JI7H 5A2QW 2VOBA 2MCTA 3BAAA 3CVZA 4UCSA 3KALA 4UCRA 3UQ8A 2XIGA 4JI8H 4DV2H 1V9PA 1Z2OX 3JSNA 4J0MA 3RGXA 3PN1A 5FLXW 2UUAH 1S68A 3N6XA 3RTXA 4RB2C 2E5LH 1L2ZA 3KAKA 4X65H 3T1HH 1TA8A 1N36H 4B3TH 1N32H 5LL6b 1F0XA 3C0FB 3L2PA 4DV7H 4UCUA 2LF0A 4JI2H 3HXLA 4GKKH 4DUYH 1BGWA 5EOYA 4OX9H 5DT9A 1SYXB 3NCVA 2HHHH 3KDGA 2CW8A 4DV0H 1HNXH 4B3RH 1FVIA 2Q2TA 1X9NA 4JI6H 1J5EH 4CC5A 2YCHA 4X66H 4DR1H 1AN7A 4B3SH 2RGVA 2RGRA 2UUCH 4CC6A 4LH7A 3FAUA 4JI5H 1I6UA 4JI4H 5D1OA 4DV1H 1MZBA 3LMLA 3N40P 2F4VH 3OSSD 2VQFH 4LMYA 2OWOA 4Q0YA 1A0IA 4JI0H 2CW7A 3L4KA 2WYOA 4JV5H 4B8CD 5BR8H 1Z2PX 4LF5H 4EFEA 1XNQH 4LFBH 1BJTA 4LF7H 1N34H 4DR6H 4OCHA 4RAYA 1M0TA 4B3MH 4GLXA 4EC5A 4BWSC 2UUBH 3RIZA 1GYFA 2KSWA 1S03G 4APMA 3F8NA 3RGZA 4NXNH 1O75A 5LMNH 3J80W 3L4JA 2FE3A 4A2BA 4NXMH 1IBLH 4YHHH 2UXCH 3IG0A 4RZQA 1SEIA 4DV5H 1E4GT 4KHPH 4JYAH 3BABA 4UCOA 5FPOA 4LSAA 3DF7A 4OD6A 4UCTA 4X64H 4UFZA 4DR2H 5FPRA 4EFBA 5FD6A 1FJGH 4LFCH 3EZJA 2PT7G 4DR7H 1N33H 2HGSA 2O4CA 5IT9W 1E4FT 3OTOH 4MV7A 1XNRH 2D9IA 3H20A 1FKAH 4MTEA 4LFAH 4M7EA 3KAJA 4RB3C 5LMUH 4AQYH 2WE6A 3N43B 4RB1A 4JI1H 3JSLA 4DR4H 4DV3H 4LH6A 1M0WA 4JI3H 1I94H 4FM9A 4MTDA 1HNWH 5D1OB 1Z2NX 1P8LA 2Q2UA 2WDTA 4LF8H 3MWMA 4I7HA 2O03A 3J81W 4NZRM 1XMOH 2VQEH 4LF6H 3T1YH 2ZM6H 4NZTM 3N41B 3JAMW 4A2AA 3RJ0A 3BA9A 1TAEA 2HVQA 2W57A 3RF2A 4DUZH 4LF9H 2HVSA 1B04A 4E9JA 3QD7X 3EYYA 3GABA 4DR5H 1VS0A 3KXYT 4PDBA 4RB0A 3SB1A 2ZQEA 4DV6H 4X62H 4IAJA 5IWAH 4EEQA 3K3VA 2UXDH 3M4IA 2VKCA 1ZHSA 4G08A 1X9ZA 3OETA 4DR3H 1ODHA 1WH2A 2FPHX 2ZJTA 3N44B 3FMAA 4ETSA 1HNZH 2VPSA 3KDKA 2Y3MA 1XDNA 4UCVA 4LSXA 2UXBH 4YY3H 1IBKH 1HR0H 4MV9A 4DV4H 1XMQH 3BA8A 2HVRA 1ZHQA 3J7AK 1IBMH 4K0KH 4LF4H 2UU9H 4GKJH 4R7RA 2VUGA 3GR5A 1DGSA 3N42B 5D1PA 4RAZA 5FD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 H;  5A2Q W;  4JI8 H;  4DV2 H;  5FLX W;  2UUA H;  2E5L H;  4X65 H;  3T1H H;  1N36 H;  4B3T H;  1N32 H;  5LL6 b;  4DV7 H;  4JI2 H;  4GKK H;  4DUY H;  4OX9 H;  2HHH H;  4DV0 H;  1HNX H;  4B3R H;  4JI6 H;  1J5E H;  4X66 H;  4DR1 H;  1AN7 A;  4B3S H;  2UUC H;  4JI5 H;  1I6U A;  4JI4 H;  4DV1 H;  2F4V H;  2VQF H;  4JI0 H;  4JV5 H;  5BR8 H;  4LF5 H;  1XNQ H;  4LFB H;  4LF7 H;  1N34 H;  4DR6 H;  4B3M H;  2UUB H;  1S03 G;  4NXN H;  5LMN H;  3J80 W;  4NXM H;  1IBL H;  4YHH H;  2UXC H;  1SEI A;  4DV5 H;  4KHP H;  4JYA H;  4X64 H;  4DR2 H;  1FJG H;  4LFC H;  4DR7 H;  1N33 H;  5IT9 W;  3OTO H;  1XNR H;  1FKA H;  4LFA H;  5LMU H;  4AQY H;  4JI1 H;  4DR4 H;  4DV3 H;  4JI3 H;  1I94 H;  1HNW H;  4LF8 H;  3J81 W;  1XMO H;  2VQE H;  4LF6 H;  3T1Y H;  2ZM6 H;  3JAM W;  3RF2 A;  4DUZ H;  4LF9 H;  4DR5 H;  4PDB A;  4DV6 H;  4X62 H;  5IWA H;  2UXD H;  4DR3 H;  1HNZ H;  2UXB H;  4YY3 H;  1IBK H;  1HR0 H;  4DV4 H;  1XMQ H;  3J7A K;  1IBM H;  4K0K H;  4LF4 H;  2UU9 H;  4GKJ H; 
#chains in the Genus database with same CATH topology
 2VOB A;  2FLL A;  4EBE A;  2B63 G;  2DPJ A;  1KBL A;  3RB4 A;  1ZQ7 A;  2JA5 A;  3RV4 A;  3EPI A;  5DGA A;  3PN1 A;  3GIP A;  3K3P A;  5C1O A;  1VKZ A;  2W6N A;  3N6X A;  3RTX A;  4YP3 A;  5KFR A;  3T1H H;  4OO1 G;  3M9N B;  2FP4 B;  4TUY F;  2AGQ A;  1Z2I A;  2CPM A;  4EGJ A;  3MR2 A;  4UCU A;  2P2R A;  4J9N A;  1V9N A;  1WTJ A;  2IMW P;  3GTL A;  4QMF B;  5IYZ F;  1S97 A;  4GKK H;  5KFT A;  5F9N A;  1Y1V A;  3U9S A;  2CW8 A;  3KDG A;  2V9W A;  3KTM A;  2YL2 A;  4ECS A;  5KFK A;  1JIH A;  4B3R H;  1CQI B;  2Q2T A;  1RJQ A;  2BQR A;  1K1G A;  4L1K A;  4X66 H;  3RB0 A;  2A1S A;  4ECZ A;  4B3S H;  1GLV A;  2VR1 A;  2FLP A;  3GII A;  2B63 A;  1I6U A;  2PBZ A;  4Q45 A;  3PR5 B;  1MZB A;  3N40 P;  2C35 B;  1EUC B;  1DTJ A;  4Q0Y A;  4QIW E;  5GON F;  2VUM G;  2NUA B;  1A0I A;  4Q43 A;  4A3D G;  4MA5 A;  4C5C A;  2WYO A;  5JH7 F;  2UVV A;  1KJ9 A;  2R8I A;  5KFN A;  3Q8S B;  2JE6 I;  4A3E G;  3HKZ E;  4DR6 H;  4NLG A;  1UC8 A;  2FFM A;  1DIK A;  2FJZ A;  2XCL A;  3VPC A;  3RIZ A;  2NU6 B;  3I0P A;  3Q1K A;  1GYF A;  3TIN A;  2AGP A;  2J6U A;  1O75 A;  5LMN H;  3J80 W;  2HJW A;  2R7L A;  2FE3 A;  3RBE A;  4J9L A;  2J6T A;  4EG0 A;  1VAJ A;  4LSA A;  1SEI A;  5C0X G;  3H0G G;  1OWT A;  4A93 G;  4YJ2 F;  2Z0S A;  3CQZ A;  1CE8 A;  4LIJ A;  5FPR A;  4F4X A;  1FJG H;  3T5J A;  4ECX A;  3EZJ A;  1CS0 A;  5KG6 A;  5L1J A;  5LOV F;  1WHR A;  2O4C A;  1E4F T;  3OTO H;  2VUM A;  4I50 F;  1GSH A;  1ZZI A;  4EEY A;  3H20 A;  3PW4 A;  2CTE A;  1J5K A;  2LRR A;  3KAJ A;  1UG8 A;  5LMU H;  4QIW A;  2YZM A;  5K2M A;  4ZI7 F;  4TV9 F;  3JSL A;  2C2R A;  3GTM A;  1C30 A;  4DV3 H;  3HOY G;  1PQX A;  4FM9 A;  4WAL A;  3HKZ A;  4MV3 A;  2Q2U A;  2YZG A;  4ED0 A;  1UC9 A;  1KJ8 A;  1BXR A;  2V4R A;  3TQ1 A;  2E3U A;  1X4N A;  5LA6 F;  4ECU A;  2V58 A;  1I7L A;  4NZR M;  5C5J A;  4C5B A;  2ZM6 H;  1RK5 A;  3H0G A;  5KFI A;  2HVQ A;  2HH2 A;  3RF2 A;  4LF9 H;  2HVS A;  5KG1 A;  3GTQ A;  4JV1 A;  1M7J A;  3QD7 X;  3EYY A;  3FDS A;  5J2T F;  5KG5 A;  4RB0 A;  2K1H A;  3GTG A;  4GC7 A;  4O2A F;  3G6Y A;  4EEQ A;  5J2U F;  5IYB G;  3FKI G;  4G08 A;  4BA2 I;  4DR3 H;  2IBK A;  2PY9 A;  4F4Z A;  2YW2 A;  2W9A A;  4DL5 A;  1W96 A;  4AIM A;  3N44 B;  3GIK A;  4QWE A;  5KFD A;  3PR4 A;  2UXB H;  1EYZ A;  1IBK H;  1IOW A;  2VA3 A;  3V4Z A;  3KHH A;  4IR1 A;  5DQI A;  2W6Z A;  3G6V A;  4J9R A;  4R7R A;  3PW5 A;  2DGR A;  5FD5 A;  4JUZ A;  3OHB A;  1DV1 A;  1GSA A;  1Y1W G;  1ZET A;  4MV8 A;  3BAA A;  2NU8 B;  4UCS A;  4UCR A;  1XRH A;  3UQ8 A;  3JRX A;  4DV2 H;  2W70 A;  1DT4 A;  5EWG A;  3V6K A;  3MR6 A;  2C2E A;  5JEA G;  1S68 A;  5C1P A;  4IRK A;  2NVX A;  4JV2 A;  2NU9 B;  3KAK A;  1L2Z A;  3FKI A;  5CAE B;  2LTL A;  5JUM A;  2QYZ A;  1VBI A;  2G8Y A;  5KFE A;  2ATL A;  4ECV A;  5BPH A;  3N8D A;  4J9S A;  4DUY H;  2AU0 A;  2PQU A;  3MR3 A;  5DT9 A;  3SE7 A;  5CB4 F;  4TQS A;  4Q8E A;  4RUA A;  3Q8P B;  1HNX H;  3G6X A;  1DV2 A;  4NBQ A;  2XD4 A;  4JI6 H;  3MWD A;  5KX5 F;  1AUX A;  4IRD A;  2JVZ A;  2YCH A;  3H40 A;  4O3R A;  1S9F A;  4QW9 A;  2UUC H;  1Y1W A;  5DGB A;  3Q8Q B;  2CWH A;  1EHI A;  2V4Q A;  4QWB A;  2FPG B;  4FU0 A;  4O3N A;  3ETJ A;  2V59 A;  5D1O A;  2ANR A;  5DQH A;  4DL2 A;  2F4V H;  1AUV A;  2OWO A;  1S0N A;  4HNT A;  1S0O A;  4ED2 A;  2R8J A;  4F4W A;  4JI0 H;  1J4W A;  5KFH A;  4AYB E;  4ZOL F;  4YJ3 F;  3OUZ A;  2PMZ E;  4U6P A;  2E2I A;  4LF5 H;  1XNQ H;  3OSP A;  4LF7 H;  4HNV A;  4OCH A;  4RAY A;  1M0T A;  5LYJ F;  3BQ0 A;  2MJH A;  2FK2 A;  2W8K A;  3RFC A;  5KT3 A;  4QWC A;  2R6F A;  2GPW A;  1RJR A;  3F8N A;  2W9B A;  2W6M A;  1JX4 A;  1KEE A;  4A3G G;  2NN6 G;  5KFG A;  4QWD A;  4EBC A;  1WCM G;  5KT7 A;  4RZQ A;  2CWF A;  3HOZ G;  4ECT A;  4M9U A;  2RF4 A;  3BAB A;  5FPO A;  4G3I A;  5FD6 A;  5C4X G;  2M05 A;  4UCT A;  4X64 H;  2IP4 A;  3G8C A;  4R8U A;  3PW0 A;  2R8K A;  2CTJ A;  2PT7 G;  3HBL A;  1GGO A;  4O3P A;  3K5H A;  2BA0 A;  4MV7 A;  4FBT A;  4E4T A;  2I87 A;  3T5L A;  4A3J G;  4RUC A;  1FKA H;  3I4M G;  4MTE A;  2JA7 G;  1KJQ A;  3WNZ A;  4IWX A;  1MSZ A;  4AQY H;  4RB3 C;  4I4T F;  3GV7 B;  4FJU A;  3Q2O A;  4YBZ B;  5KKN B;  4DR4 H;  3GV5 B;  3VPB A;  4A3B G;  3RBD A;  5KFV A;  4AYB A;  2R93 G;  1I94 H;  4MTD A;  2PMZ A;  4EYH B;  1BNC A;  5KFY A;  1P8L A;  4PWQ A;  4LF8 H;  5BPF A;  2JA8 G;  4I7H A;  2O03 A;  4ECY A;  3BQ2 A;  3TQT A;  3J81 W;  3AYH B;  1EC6 A;  4A2A A;  2VQE H;  4LF6 H;  2HH3 A;  1WCM A;  3N41 B;  3RJ0 A;  3JAM W;  4JV0 A;  3BA9 A;  4DL6 A;  2R7K A;  3VMM A;  5KT4 A;  4E9J A;  1R9T A;  3GAB A;  1I7N A;  3KXY T;  2J6S A;  1NXU A;  1B6R A;  2JZX A;  2ZQE A;  3SB1 A;  3BJY A;  3IN5 A;  4ED7 A;  2DIK A;  2JEB I;  4H8A A;  1VIG A;  5JQW A;  4ED1 A;  3PW7 A;  5KFC A;  5L1L A;  2YRW A;  2JA7 A;  4YR2 A;  4RNO A;  3OET A;  1TWC A;  5DQG A;  4J9P A;  1E4E A;  4F50 A;  3LP8 A;  2R8H A;  2AXY A;  1B6S A;  2R93 A;  1HNZ H;  3BQ1 A;  4UCV A;  5KFQ A;  1XDN A;  4YY3 H;  4BY1 G;  4IFD G;  2HVR A;  3GIQ A;  5DLG A;  3J7A K;  4YR0 A;  4LF4 H;  4RNM A;  5KFO A;  2CTK A;  1B33 N;  5I47 A;  5KT5 A;  4FS1 A;  2VA2 A;  5D1P A;  3AEV B;  3RAX A;  1T3N A;  2YRX A;  2YZN A;  2RDI A;  3ETH A;  5KFF A;  2W8L A;  5A2Q W;  3PO3 G;  2MCT A;  3CVZ A;  4IWY A;  2ASL A;  3KAL A;  2R82 A;  2XIG A;  5CA0 F;  4JI8 H;  4MV4 A;  5IYD G;  1C3O A;  3JSN A;  5KT6 A;  5EDW A;  4J0M A;  3RGX A;  3RAQ A;  5L1I A;  5FLX W;  4MA0 A;  3PW2 A;  3KHL A;  4YB8 B;  4X65 H;  1TA8 A;  5DG8 A;  2W7P A;  1N32 H;  3SI8 A;  2ASJ A;  3GKU A;  1K1S A;  4WBN F;  2FKL A;  2W6P A;  1JDE A;  2BR0 A;  2PVP A;  2CPQ A;  2P0A A;  2R85 A;  2VQD A;  2W6O A;  3JZI A;  1BGW A;  5EOY A;  3R23 A;  2R86 A;  4BY7 G;  3R5X A;  4XYM B;  4A3K G;  4GC6 A;  4HYK A;  5KG0 A;  1X9N A;  3VPD A;  1J5E H;  5KFJ A;  3MJF A;  4DR1 H;  1AN7 A;  2RGV A;  2XC9 A;  4EBD A;  1JKJ B;  5KFU A;  4CC6 A;  4EYI B;  5IP9 G;  3WO0 A;  4XX0 B;  3FAU A;  4JI5 H;  5LP6 F;  3M9M B;  2JA9 A;  1WE8 A;  4DV1 H;  3PZP A;  3OSS D;  2VQF H;  4LMY A;  5IYC G;  3OHA A;  1SFO A;  2C22 A;  4ED3 A;  5L9X A;  2CW7 A;  3L4K A;  3GIM A;  4ED6 A;  4O3Q A;  4O3S A;  4B8C D;  1Y14 B;  1Z2P X;  2WTF A;  1S10 A;  2CTL A;  1BJT A;  4WAN A;  2C2D A;  1N34 H;  2YS6 A;  2CTF A;  5KFZ A;  2XGQ A;  4GLX A;  4EC5 A;  2R84 A;  4BWS C;  2FB9 A;  1A9X A;  4JVY A;  5FJ8 G;  4ECW A;  2FMA A;  2UVR A;  2E2H A;  4A3I G;  2KSW A;  4DLK A;  4APM A;  3V6H A;  3HOW G;  4FBU A;  4ECQ A;  3Q8R B;  5KFS A;  4Q44 A;  2DLN A;  1X0A A;  4A2B A;  4NXM H;  2W6Q A;  1TWH A;  2AQ4 A;  4A3M G;  1WR2 A;  1S0M A;  5K36 G;  2M8W A;  4ECR A;  2JEG A;  4O4H F;  3K5I A;  4UCO A;  4KHP H;  4JYA H;  4ME6 A;  4B8T A;  4RB2 C;  3DF7 A;  3HOU G;  3OUU A;  2CZG A;  2FPP B;  4DR2 H;  4EFB A;  3GTP A;  4LFC H;  1RJP A;  2ZDG A;  1VIH A;  2HGS A;  3OSN A;  2YU9 A;  4ZHQ F;  2DWC A;  5KG4 A;  2W9B B;  4HNU A;  2W9C A;  3T5K A;  4Y8V B;  3H3V H;  2YS7 A;  4LFA H;  1VBG A;  1K1Q A;  4M7E A;  3GIJ A;  2J9G A;  5C44 G;  1K83 A;  4LH6 A;  1M0W A;  4JI3 H;  4C2M A;  4R8U B;  2FK3 A;  4BA1 I;  5KFA A;  3JRW A;  2OH2 A;  3NGD A;  1W93 A;  2WDT A;  3MWM A;  2R87 A;  1M6V A;  4IRC A;  2CKZ B;  2DZD A;  1I3Q A;  3I12 A;  1GSO A;  2C00 A;  5IP7 G;  2JEI A;  5EWE A;  4NZT M;  3GTO A;  1TAE A;  2W57 A;  3RUP A;  4DUZ H;  3T5H A;  1B04 A;  4RU9 A;  4QJF A;  2LTM A;  2ANN A;  4DR5 H;  1VS0 A;  4DL3 A;  1KHM A;  4PDB A;  4RNN A;  1TWF A;  4DV6 H;  4IAJ A;  5IWA H;  3K3V A;  3R5F A;  2JEA I;  3GIL A;  1RK6 A;  2BQU A;  4XYL B;  5KG3 A;  4YR3 A;  4J9M A;  3VKE A;  1WH2 A;  3RB6 A;  2ZJT A;  3TIG A;  4ETS A;  3KHG A;  2YYA A;  3KDK A;  2Y3M A;  3TII A;  5L1K A;  4LSX A;  4DL4 A;  4MV9 A;  2OPV A;  2WB1 A;  1XMQ H;  2Y0S A;  2FK1 A;  3BA8 A;  4J9K A;  2XCA A;  5LXT F;  3R5H A;  1IBM H;  5JVL A;  1N56 A;  2UU9 H;  2JEF A;  4GKJ H;  4IZO A;  3GR5 A;  1DGS A;  4HR7 A;  3MFI A;  1PK8 A;  3KHR A;  4FS2 A;  1RYR A;  1E4E B;  4YQW A;  4JI7 H;  2QK4 A;  3PO2 G;  4TQR A;  4TV8 F;  1JLL B;  3WO1 A;  1V51 A;  3V4S A;  3MR5 A;  3UOE A;  4YAK B;  2WAQ E;  5JVD F;  5KFB A;  1V9P A;  1Z2O X;  4O3O A;  3H4D A;  2ZDQ A;  3GTK A;  3GTJ A;  2UUA H;  4O4I F;  2R7Z G;  1SCU B;  1ZTG A;  2E5L H;  5CA1 F;  1N36 H;  4B3T H;  5LL6 b;  2R7M A;  1F0X A;  3C0F B;  3L2P A;  4DV7 H;  4BXX G;  2BQ3 A;  2ZDH A;  2UVW A;  2I80 A;  2LF0 A;  4JI2 H;  3HXL A;  3BG5 A;  4EGQ A;  4OX9 H;  3QZ8 A;  4Q8F A;  1SYX B;  3NCV A;  2HHH H;  4WD3 A;  2JEJ A;  4DV0 H;  3HOV G;  2NU7 B;  5DG9 A;  3H4B A;  2X0S A;  1FVI A;  2PN1 A;  2GLT A;  3V6J A;  2AGO A;  4CC5 A;  2R92 G;  3GID A;  4A3L G;  3M9O B;  4IR9 A;  2RGR A;  3LWB A;  4LH7 A;  5KG7 A;  2NVY A;  3QZ7 A;  4JI4 H;  4HQ6 A;  4A3C G;  3LML A;  5KFP A;  4QW8 A;  2R7Z A;  3I4N G;  2FPI B;  5KG2 A;  2WAQ A;  3ORR A;  1I50 A;  2CQY A;  1S20 A;  4JV5 H;  5KFM A;  3GQC A;  2YQR A;  5BR8 H;  2W71 A;  4J9O A;  2XGP A;  4EFE A;  5DLF A;  4LFB H;  3V69 A;  5KFW A;  5KFL A;  4FJS A;  4B3M H;  2CTM A;  2SCU B;  4I55 F;  2UUB H;  5C8Y F;  3HB9 A;  5KFX A;  1S03 G;  4MV1 A;  2DPI A;  3RGZ A;  4NXN H;  1T94 A;  1ULZ A;  2VPQ A;  2C28 A;  3L4J A;  1X4M A;  2R92 A;  4U7C A;  5H80 A;  3EPG A;  1IBL H;  4YHH H;  2UXC H;  3IG0 A;  4DV5 H;  1E4G T;  3E5N A;  5T14 A;  1V8C A;  4OD6 A;  2GPS A;  2R7N A;  4UFZ A;  3U9T A;  4RZR A;  2JA6 G;  4DR7 H;  1N33 H;  1CQJ B;  1JDB B;  5IT9 W;  5DG7 A;  5EZY F;  1TUA A;  2RDJ A;  1V4Y A;  1XNR H;  2D9I A;  1EZ1 A;  4C5A A;  1VBH A;  2UVU A;  2I8C A;  1GO3 E;  3UFX B;  3MWE A;  2WE6 A;  1T36 A;  3N43 B;  4O4L F;  4O2B F;  4RB1 A;  4JI1 H;  2OLS A;  2FMR A;  5EWF A;  3U1K A;  4ED8 A;  3ORQ A;  1HNW H;  3RV3 A;  4ZQI A;  4MV6 A;  1WSC A;  5D1O B;  4A3F G;  1Z2N X;  4YAJ B;  4JVH A;  1EUD B;  2W9C B;  1UNN C;  3PVX A;  1KJI A;  5F9L A;  1KJJ A;  2BL5 A;  1TWA A;  2FLN A;  5KT2 A;  1XMO H;  3T1Y H;  2OPU A;  5HBR B;  2ASD A;  5D8D A;  1JXL A;  3HOX G;  3MFH A;  4IHJ F;  1WVN A;  2JA5 G;  2JA6 A;  3QFF A;  3GV8 B;  1KC7 A;  4X62 H;  1IOV A;  2QND A;  2UXD H;  3RB3 A;  3M4I A;  2W7O A;  2VKC A;  3L7Z C;  1ZHS A;  2R8G A;  1X9Z A;  2ALZ A;  5HV6 A;  4QWA A;  1ODH A;  2WB1 E;  2XCP A;  1RYS A;  2FPH X;  2Y0S E;  3FMA A;  4MAM A;  2VPS A;  2IA6 A;  3GLK A;  2X06 A;  1ZZJ A;  1HR0 H;  1Y1V G;  1TWG A;  4DV4 H;  2V5A A;  5C3E G;  1ZHQ A;  4K0K H;  1PX2 A;  4BBS G;  5FLM G;  4DL7 A;  5BMV F;  4F4Y A;  2VUG A;  4XZ3 B;  1ZZK A;  4J9Q A;  3N42 B;  2M6Q A;  1N48 A;  4BBR G;  4RAZ A;  4AM3 A; 
#chains in the Genus database with same CATH homology
 4JI7 H;  5A2Q W;  2VOB A;  2MCT A;  3BAA A;  3CVZ A;  4UCS A;  3KAL A;  4UCR A;  3UQ8 A;  2XIG A;  4JI8 H;  4DV2 H;  1V9P A;  1Z2O X;  3JSN A;  4J0M A;  3RGX A;  3PN1 A;  5FLX W;  2UUA H;  1S68 A;  3N6X A;  3RTX A;  4RB2 C;  2E5L H;  1L2Z A;  3KAK A;  4X65 H;  3T1H H;  1TA8 A;  1N36 H;  4B3T H;  1N32 H;  5LL6 b;  1F0X A;  3C0F B;  3L2P A;  4DV7 H;  4UCU A;  2LF0 A;  4JI2 H;  3HXL A;  4GKK H;  4DUY H;  1BGW A;  5EOY A;  4OX9 H;  5DT9 A;  1SYX B;  3NCV A;  2HHH H;  3KDG A;  2CW8 A;  4DV0 H;  1HNX H;  4B3R H;  1FVI A;  2Q2T A;  1X9N A;  4JI6 H;  1J5E H;  4CC5 A;  2YCH A;  4X66 H;  4DR1 H;  1AN7 A;  4B3S H;  2RGV A;  2RGR A;  2UUC H;  4CC6 A;  4LH7 A;  3FAU A;  4JI5 H;  1I6U A;  4JI4 H;  5D1O A;  4DV1 H;  1MZB A;  3LML A;  3N40 P;  2F4V H;  3OSS D;  2VQF H;  4LMY A;  2OWO A;  4Q0Y A;  1A0I A;  4JI0 H;  2CW7 A;  3L4K A;  2WYO A;  4JV5 H;  4B8C D;  5BR8 H;  1Z2P X;  4LF5 H;  4EFE A;  1XNQ H;  4LFB H;  1BJT A;  4LF7 H;  1N34 H;  4DR6 H;  4OCH A;  4RAY A;  1M0T A;  4B3M H;  4GLX A;  4EC5 A;  4BWS C;  2UUB H;  3RIZ A;  1GYF A;  2KSW A;  1S03 G;  4APM A;  3F8N A;  3RGZ A;  4NXN H;  1O75 A;  5LMN H;  3J80 W;  3L4J A;  2FE3 A;  4A2B A;  4NXM H;  1IBL H;  4YHH H;  2UXC H;  3IG0 A;  4RZQ A;  1SEI A;  4DV5 H;  1E4G T;  4KHP H;  4JYA H;  3BAB A;  4UCO A;  5FPO A;  4LSA A;  3DF7 A;  4OD6 A;  4UCT A;  4X64 H;  4UFZ A;  4DR2 H;  5FPR A;  4EFB A;  5FD6 A;  1FJG H;  4LFC H;  3EZJ A;  2PT7 G;  4DR7 H;  1N33 H;  2HGS A;  2O4C A;  5IT9 W;  1E4F T;  3OTO H;  4MV7 A;  1XNR H;  2D9I A;  3H20 A;  1FKA H;  4MTE A;  4LFA H;  4M7E A;  3KAJ A;  4RB3 C;  5LMU H;  4AQY H;  2WE6 A;  3N43 B;  4RB1 A;  4JI1 H;  3JSL A;  4DR4 H;  4DV3 H;  4LH6 A;  1M0W A;  4JI3 H;  1I94 H;  4FM9 A;  4MTD A;  1HNW H;  5D1O B;  1Z2N X;  1P8L A;  2Q2U A;  2WDT A;  4LF8 H;  3MWM A;  4I7H A;  2O03 A;  3J81 W;  4NZR M;  1XMO H;  2VQE H;  4LF6 H;  3T1Y H;  2ZM6 H;  4NZT M;  3N41 B;  3JAM W;  4A2A A;  3RJ0 A;  3BA9 A;  1TAE A;  2HVQ A;  2W57 A;  3RF2 A;  4DUZ H;  4LF9 H;  2HVS A;  1B04 A;  4E9J A;  3QD7 X;  3EYY A;  3GAB A;  4DR5 H;  1VS0 A;  3KXY T;  4PDB A;  4RB0 A;  3SB1 A;  2ZQE A;  4DV6 H;  4X62 H;  4IAJ A;  5IWA H;  4EEQ A;  3K3V A;  2UXD H;  3M4I A;  2VKC A;  1ZHS A;  4G08 A;  1X9Z A;  3OET A;  4DR3 H;  1ODH A;  1WH2 A;  2FPH X;  2ZJT A;  3N44 B;  3FMA A;  4ETS A;  1HNZ H;  2VPS A;  3KDK A;  2Y3M A;  1XDN A;  4UCV A;  4LSX A;  2UXB H;  4YY3 H;  1IBK H;  1HR0 H;  4MV9 A;  4DV4 H;  1XMQ H;  3BA8 A;  2HVR A;  1ZHQ A;  3J7A K;  1IBM H;  4K0K H;  4LF4 H;  2UU9 H;  4GKJ H;  4R7R A;  2VUG A;  3GR5 A;  1DGS A;  3N42 B;  5D1P A;  4RAZ A;  5FD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...