1SEIA

Structure of 30s ribosomal protein s8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
VMTDPIADMLTAIRNANMVRHEKLEVPASKIKREIAEILKREGFIRDYEYIEDNKQGILRIFLKYGPNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIAILSTSQGVLTDKEARQKGTGGEIIAYVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN S8
publication title Structural evidence for specific S8-RNA and S8-protein interactions within the 30S ribosomal subunit: ribosomal protein S8 from Bacillus stearothermophilus at 1.9 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
total genus 31
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1seiA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1seiA02
4JI5H 4DR3H 3T1HH 1HNXH 3T1YH 1N33H 1IBLH 4B3TH 1HNZH 4DR6H 4DUYH 4NXNH 4YY3H 4DV0H 4JI2H 4KHPH 2HHHH 3RF2A 5IWAH 4LF5H 1XNRH 4X62H 1HR0H 4DV2H 2UXBH 2UXCH 4YHHH 1XMOH 1N36H 4LF6H 1I6UA 3J80W 4B3MH 4AQYH 2UUBH 4X65H 1IBKH 4JI6H 2UXDH 2VQFH 4DR5H 2F4VH 5IT9W 4DV7H 5BR8H 4JV5H 5FLXW 1FJGH 4PDBA 2VQEH 4JI1H 1AN7A 4GKJH 1IBMH 4LF4H 4OX9H 2UU9H 4DUZH 4X64H 4DR2H 3J7AK 1J5EH 3JAMW 5LMUH 4LF8H 1S03G 3J81W 1SEIA 4GKKH 4LFCH 1I94H 2UUAH 4DV3H 4JI3H 5LL6b 4LFAH 4B3RH 2E5LH 3OTOH 4JI7H 4DV5H 4JYAH 4NXMH 1FKAH 4LFBH 4X66H 4DV1H 4LF7H 4K0KH 5A2QW 2UUCH 4JI4H 4B3SH 5LMNH 4LF9H 4DR4H 1XNQH 2ZM6H 1HNWH 4DR7H 1N34H 4JI8H 4DV6H 1XMQH 4DR1H 4DV4H 4JI0H 1N32H
chains in the Genus database with same CATH superfamily
2YS7A 3N40P 2YCHA 4Q44A 3BA8A 4DR3H 1JDEA 2JE6I 4WD3A 1VAJA 4APMA 1Z2IA 4EYIB 4Q43A 4DUYH 1RK6A 1WCMA 4TV8F 1Y1WG 2W9BB 3FKIG 1TA8A 4IWXA 4TV9F 1RYSA 3RFCA 3N41B 2SCUB 4NZTM 2WDTA 3BA9A 4YY3H 1WR2A 4EEQA 5FJ8G 4FS2A 1JX4A 4JI2H 2BQRA 2J6TA 5KFAA 3HB9A 4F4XA 5IWAH 5L1KA 4YB8B 4O3SA 3SE7A 5KFHA 2YYAA 1VBHA 4HNUA 3UQ8A 4YR2A 5KFVA 2DPIA 4X62H 2OH2A 4YJ2F 3HOZG 3PVXA 1TWAA 5D1OB 4OCHA 2C22A 1BXRA 2R8KA 2JEJA 3EPIA 1OWTA 4ZHQF 3Q8RB 1AUVA 5EWGA 4J9KA 2ZDGA 5KG1A 4J9NA 2JA7G 4MAMA 1VIHA 4EG0A 3KDKA 1R9TA 5EZYF 5KG2A 2OPVA 4MV1A 2IP4A 2FMAA 1N56A 3PN1A 2I8CA 4XZ3B 3TQTA 4RAZA 3OHBA 2CTKA 2WYOA 3GABA 2WB1E 2WB1A 3M9OB 1DGSA 5FPRA 3PR4A 4GC6A 2W6OA 3VPDA 1I7LA 3GLKA 1J5KA 3K5IA 4ZI7F 2VQFH 4ECTA 4QWDA 4BY7G 2KSWA 4IHJF 5KG3A 1F0XA 4ZQIA 5KFDA 5FD6A 3KDGA 3GIPA 2V4RA 1V9NA 4J9SA 4MTDA 4L1KA 5BR8H 4JVYA 5FLXW 1FJGH 1RJPA 3HOYG 4WALA 5DG8A 2Z0SA 5KFIA 4IRDA 4C5BA 2ALZA 2JZXA 2UVVA 4FM9A 4DUZH 2HGSA 3UFXB 2JEGA 3LWBA 1UC8A 5KFUA 1J5EH 4ED2A 5LMUH 5KG6A 1BGWA 4RB1A 3H0GA 4O4LF 5KFBA 3NGDA 2R8GA 2I80A 5F9LA 2CTJA 4B8TA 5DQIA 2JEIA 2XGPA 4A3LG 2PQUA 2GPSA 2R6FA 1KBLA 4QWAA 2UUAH 1SYXB 4ECSA 3MFIA 2IA6A 4B3RH 4CC6A 3BQ2A 3KAJA 2E5LH 2UVUA 4DL5A 5KFTA 3R5XA 4Y8VB 4A3GG 4QJFA 4JI7H 4DV5H 4R8UA 3L4KA 2J9GA 5I47A 2X0SA 3GTGA 1FKAH 4MV8A 3QZ8A 1JXLA 5L1IA 4UCVA 4LFBH 3GIKA 2CWHA 1IOWA 5K36G 4ECVA 2C2EA 2Q2TA 5FD5A 2QK4A 2PVPA 3Q8SB 4LIJA 1RK5A 3PZPA 3PO2G 4HNVA 5KG7A 2MCTA 3M9NB 4J9MA 2LTLA 5A2QW 3PW5A 3TIGA 1M7JA 1RYRA 2R7NA 4I4TF 2YU9A 2FMRA 4NZRM 2W57A 1Y1VA 1PK8A 2PMZE 2PMZA 4RB3C 4M9UA 4J9QA 4LF9H 1MZBA 4DR4H 3GKUA 1DIKA 2PY9A 3KTMA 3PW7A 2ZDQA 3FDSA 3EPGA 2ZM6H 2M6QA 3KXYT 4DR7H 4A3KG 3V6KA 1EUCB 1KHMA 5HBRB 2ASDA 4DV4H 1W96A 4XYMB 2JA6G 2CTEA 5DQGA 2DZDA 4EFEA 1N32H 1XDNA 1ODHA 1KJ8A 4FBUA 4TQRA 2XD4A 5DLGA 4ZOLF 3GIMA 1S10A 2ASLA 1P8LA 3C0FB 4O2AF 4Q8FA 2W70A 3T5LA 5KFWA 5KX5F 5KFEA 2JVZA 1N33H 3RUPA 3JZIA 1IBLH 3N6XA 1W93A 1HNZH 4FS1A 4DR6H 2CTMA 3MWEA 4TUYF 2FLNA 5KG4A 4QW9A 4LH7A 4ED6A 2LRRA 3U9TA 2C2DA 1SFOA 4ED1A 1S97A 4KHPH 4I55F 3MFHA 2VUMA 3JRWA 4UCOA 4AIMA 2VA2A 3OUZA 2E2IA 2FPIB 2ZJTA 4LSXA 4EBDA 2P2RA 3RJ0A 5C1OA 3RAQA 3GTMA 5C3EG 2AGOA 3BQ1A 1XNRH 1I7NA 2JA5G 2FPPB 4DL3A 1JIHA 3RAXA 2JA7A 5JVDF 1T94A 2AGQA 4J9PA 5F9NA 2W7OA 4ED7A 2FK3A 4NLGA 2W6MA 5C5JA 3KHLA 2FP4B 1X9ZA 3WNZA 2I87A 4C5CA 3RB3A 2R7KA 3HBLA 2C28A 1GO3E 2V58A 1KEEA 2R93G 4HR7A 3V4ZA 1X4NA 3GV8B 2HVRA 1L2ZA 1IOVA 4ECYA 1ULZA 2CPQA 3R23A 4FU0A 1K83A 2ATLA 5KFSA 1EZ1A 2R7MA 5JQWA 1VKZA 4LMYA 4ED3A 4ED8A 4ECZA 3MR5A 4EBCA 3PW0A 4I50F 2DPJA 2UVRA 5JUMA 3HXLA 4C5AA 2VPSA 2QYZA 4DV7H 2XCPA 4J9LA 3G6VA 5IYBG 2R82A 5FLMG 2CZGA 2CWFA 4Q45A 3NCVA 2W6ZA 3U9SA 3ORQA 2VQEH 2C2RA 3IG0A 1AN7A 5KFOA 4GKJH 1EC6A 2FB9A 2XIGA 3VMMA 3K3PA 3RBDA 2V59A 2DGRA 3J7AK 5CAEB 2RDJA 4IAJA 1DT4A 4IWYA 3PW4A 2W8LA 2AQ4A 2B63A 4B8CD 2WE6A 1K1QA 2ZDHA 3WO1A 4RZRA 4F4WA 2BQ3A 5JEAG 5KKNB 1N48A 4G3IA 1V8CA 1NXUA 4GKKH 2RGVA 4MV3A 1PX2A 5KFZA 1I94H 4DV3H 4JI3H 2OPUA 4LFAH 5T14A 1EHIA 4ECUA 4J9RA 2PT7G 3OTOH 1ZZJA 2VOBA 1B6RA 2W7PA 3F8NA 3AEVB 3K3VA 5KFCA 2D9IA 2W9AA 4NXMH 3I4NG 4IFDG 3R5FA 2VPQA 4IZOA 2R7ZA 4X66H 5IYDG 2FK2A 4O3OA 4DL7A 2NVXA 1UNNC 5J2UF 2Y0SE 2Y0SA 2WAQE 2WAQA 4U6PA 4DL2A 3RB0A 2CW7A 2UUCH 4JI4H 4QWBA 4B3SH 3L7ZC 2NU7B 5LMNH 5K2MA 4BBRG 3IN5A 2R92A 1WCMG 3I4MG 4O3NA 5H80A 5KT2A 3M4IA 3BAAA 3RV4A 4YP3A 2BR0A 3GV7B 3H3VH 4JI8H 3U1KA 1XMQH 1EUDB 2AU0A 4ECQA 2IBKA 4JI5H 5KT5A 3VPBA 4H8AA 2R84A 4EGJA 3KAKA 4A3JG 1HNXH 4RB2C 3RV3A 5L1LA 1T36A 5KFKA 4EEYA 1WTJA 5CA1F 5C8YF 3BG5A 4R7RA 2YL2A 2GPWA 4JV2A 1TUAA 4ETSA 5EWFA 1CE8A 4CC5A 3MR3A 2DLNA 5KFPA 2M8WA 3I0PA 3K5HA 5DQHA 2P0AA 2R92G 3VPCA 5BMVF 5IYZF 4DV0H 3GTPA 4O4HF 4DLKA 3MR6A 4F4YA 2HHHH 5DT9A 4LF5H 2FKLA 5DGBA 3T5KA 4R8UB 3GR5A 1BJTA 3ETJA 2C00A 1B04A 4MV4A 4UCTA 1A9XA 4IRCA 2MJHA 1M0WA 5J2TF 5KFGA 3GILA 3JRXA 1HR0H 1Z2OX 3KHGA 4YHHH 4OD6A 1S20A 1N36H 3MR2A 4LF6H 3FKIA 3H4DA 4IR9A 3OSNA 3V6JA 3AYHB 1Y1WA 3ORRA 4A3CG 4DL6A 3J80W 4XX0B 4RAYA 4XYLB 2XCAA 1WVNA 5D1PA 1WHRA 2R85A 4AQYH 4EYHB 1GSHA 3MWMA 1VIGA 4JUZA 2DIKA 5LP6F 5KFXA 2NU6B 2C35B 3Q8PB 2V4QA 4HQ6A 4X65H 1IBKH 4JI6H 2UXDH 2NN6G 5EOYA 2CTFA 5KFQA 3HOWG 1X0AA 1M0TA 2FK1A 4O2BF 4RUAA 1CS0A 2FPHX 1B33N 3QFFA 4A2BA 4RNMA 3RGXA 2F4VH 4O4IF 1S0MA 5LYJF 4E9JA 4BY1G 3H0GG 1ZZIA 2JEFA 2VUMG 4MV6A 3HKZE 3HKZA 4MTEA 4A3MG 1S68A 2A1SA 1E4EA 3KHRA 4O3RA 4J9OA 3GTOA 4E4TA 4PDBA 5IP9G 3GIIA 5KG0A 1TWHA 1I3QA 3G6YA 5KT4A 1O75A 2HH2A 4AM3A 4OX9H 1PQXA 2UU9H 4X64H 1RJRA 2HJWA 2NU9B 2HVSA 3JAMW 2CKZB 1E4FT 3N44B 4UCUA 4LF8H 3V69A 4MA0A 4ED0A 4A3BG 1S03G 3J81W 2RF4A 4QW8A 3KALA 4RZQA 3L2PA 5JVLA 4UCSA 4LFCH 4QIWE 4QIWA 5C1PA 3RBEA 5LL6b 5C44G 1Y1VG 2CW8A 3Q1KA 2UVWA 1GSOA 2JA9A 3PO3G 4J0MA 5BPFA 4OO1G 3HOXG 3GTLA 5C4XG 5L9XA 4JV1A 3CVZA 2ANRA 5KT7A 3FMAA 4F4ZA 2R87A 2V5AA 5EDWA 4DV1H 1KJQA 5D1OA 1DV1A 4MV7A 4LF7H 1KC7A 2CPMA 3BJYA 2RGRA 3SB1A 1FVIA 1Z2NX 3H4BA 1X4MA 3L4JA 5KFRA 2FJZA 5LXTF 4YAKB 4BBSG 2OLSA 2VUGA 2K1HA 2YS6A 1WH2A 1JLLB 2XC9A 3GIQA 3TINA 4U7CA 3PR5B 2W9CA 2J6UA 3EYYA 5KG5A 4UFZA 3BABA 1SCUB 2R8HA 1C3OA 1I50A 4QWCA 3GV5B 1X9NA 2BL5A 4DV6H 4A3EG 2YZMA 5DG9A 4C2MA 1ZTGA 5KFMA 4NBQA 4JI0H 2JEAI 4FJSA 4BA2I 4RU9A 2Q2UA 4IR1A 1V4YA 2Y3MA 2NVYA 3OSPA 2R7LA 1V9PA 4YBZB 4WBNF 2FLPA 4Q8EA 1KJIA 4QWEA 3G8CA 3T1HH 3T1YH 3GTQA 1GLVA 2W9CB 1TAEA 4B3TH 2VA3A 2RDIA 2J6SA 2XGQA 3T5JA 2YZNA 2AGPA 3MJFA 1ZHQA 2JEBI 2M05A 4RNOA 5IYCG 4NXNH 1CQIB 2PN1A 2W71A 3Q2OA 4YR3A 4TQSA 3OHAA 2WTFA 2JA6A 3CQZA 4YAJB 4HNTA 3RF2A 3MWDA 3TQ1A 3KHHA 5KFNA 1ZETA 2HH3A 1AUXA 2FPGB 2ZQEA 2AXYA 4DV2H 2BA0A 2UXBH 2UXCH 5KFLA 2ASJA 1XMOH 4G08A 2DWCA 2V9WA 1WE8A 1GGOA 3TIIA 2W6QA 1I6UA 3N42B 4JV0A 2G8YA 1TWFA 2FE3A 2YZGA 4B3MH 3I12A 2R86A 4BWSC 2BQUA 3RIZA 3GTJA 1S0NA 3GQCA 2CQYA 4A3DG 3V4SA 2UUBH 5KT3A 3HOUG 5C0XG 4YR0A 4BXXG 3HOVG 3LP8A 2JA5A 1K1GA 2FFMA 2VR1A 5KFYA 1DV2A 3WO0A 1M6VA 3N43B 2OWOA 5KFJA 4RB0A 5DG7A 3QZ7A 1XRHA 4DR5H 5IT9W 4EFBA 2B63G 1ZQ7A 3DF7A 4YQWA 4LH6A 4M7EA 1TWGA 2E3UA 1Y14B 1ZHSA 2O03A 3H20A 4YJ3F 5CA0F 3RGZA 3V6HA 2R93A 4GLXA 4O3PA 4BA1I 4MV9A 1UG8A 4JV5H 1CQJB 4EGQA 4O3QA 2R8IA 5D8DA 2NUAB 4JI1H 3M9MB 4A3FG 1TWCA 2W8KA 1IBMH 4LF4H 3FAUA 3VKEA 2YRWA 4RNNA 1T3NA 4DR2H 4A3IG 4RUCA 4FJUA 5FPOA 4HYKA 5DLFA 4IRKA 1WSCA 2YRXA 2R7ZG 1VBIA 5LA6F 4MA5A 5GONF 1C30A 3H40A 1J4WA 1SEIA 4I7HA 2W6NA 3ETHA 1S0OA 5KT6A 3RB4A 1B6SA 4F50A 3N8DA 4A2AA 3Q8QB 1GYFA 4ECWA 4A93G 2W6PA 2QNDA 4QMFB 1VS0A 1K1SA 1Z2PX 3GIDA 5EWEA 1A0IA 3G6XA 2LF0A 3QD7X 2NU8B 3PW2A 1ZZKA 2ANNA 4WANA 4JYAH 1JDBB 1V51A 2GLTA 1RJQA 4UCRA 1DTJA 3OSSD 4PWQA 2X06A 2VQDA 2XCLA 4EBEA 1E4GT 1UC9A 4AYBE 1KJ9A 4AYBA 3OUUA 5HV6A 2LTMA 3GTKA 1VBGA 4ECRA 3SI8A 3UOEA 2CTLA 1GSAA 5IP7G 2R8JA 5L1JA 4GC7A 5CB4F 3JSLA 4K0KH 2VKCA 1JKJB 3E5NA 4LSAA 5BPHA 2YQRA 5DGAA 5LOVF 3R5HA 2O4CA 4ME6A 4FBTA 2YW2A 4EC5A 3BQ0A 5KFFA 2IMWP 2PBZA 3EZJA 1XNQH 3LMLA 2W9BA 4ECXA 3T5HA 1HNWH 5JH7F 1E4EB 3GIJA 4DL4A 1N34H 4JVHA 2FLLA 1KJJA 3RB6A 3RTXA 2JA8G 1EYZA 2HVQA 4DR1H 3JSNA 2E2HA 1BNCA 4Q0YA 3OETA 1S9FA 1MSZA
chains in the Genus database with same CATH topology
4JI5H 1XDNA 3N40P 1ODHA 1V9PA 2YCHA 3BA8A 4DR3H 1P8LA 3C0FB 3T1HH 1HNXH 3KAKA 3T1YH 4RB2C 4APMA 1N33H 3N6XA 1IBLH 4B3TH 1TAEA 1HNZH 4DR6H 4DUYH 4R7RA 1ZHQA 4ETSA 4CC5A 1TA8A 4LH7A 3N41B 4NZTM 2WDTA 4NXNH 4YY3H 3BA9A 4EEQA 4DV0H 4JI2H 4KHPH 2HHHH 4UCOA 3RF2A 5IWAH 5DT9A 4LF5H 2ZJTA 4LSXA 3RJ0A 3GR5A 1BJTA 4UCTA 1B04A 1XNRH 1M0WA 3UQ8A 4X62H 2ZQEA 1HR0H 4DV2H 2UXBH 2UXCH 1Z2OX 5D1OB 4OCHA 4G08A 4OD6A 4YHHH 1XMOH 1N36H 4LF6H 1X9ZA 1I6UA 3N42B 2FE3A 3J80W 4RAYA 4B3MH 5D1PA 4BWSC 3RIZA 4AQYH 3KDKA 3MWMA 2HVRA 1L2ZA 2UUBH 3PN1A 4RAZA 2WYOA 3GABA 1DGSA 4X65H 1IBKH 4JI6H 2UXDH 3N43B 4LMYA 5EOYA 5FPRA 2OWOA 1M0TA 2VQFH 4RB0A 2FPHX 2KSWA 4A2BA 4DR5H 2F4VH 5IT9W 4EFBA 1F0XA 3RGXA 3DF7A 4E9JA 5FD6A 4LH6A 3HXLA 4M7EA 3KDGA 1ZHSA 2VPSA 3H20A 4DV7H 2O03A 4MTEA 4MTDA 1S68A 3RGZA 4GLXA 5BR8H 4MV9A 4JV5H 3NCVA 5FLXW 1FJGH 4PDBA 2VQEH 4JI1H 3IG0A 1AN7A 1O75A 4GKJH 1IBMH 4LF4H 4OX9H 3FAUA 2UU9H 4DUZH 2XIGA 2HGSA 4FM9A 4X64H 4DR2H 3J7AK 2HVSA 4IAJA 1J5EH 5FPOA 3JAMW 5LMUH 1E4FT 4B8CD 1BGWA 4LF8H 3N44B 2WE6A 4UCUA 1N32H 4RB1A 1S03G 3J81W 3KALA 4RZQA 3L2PA 1SEIA 4I7HA 2RGVA 4GKKH 4UCSA 4LFCH 1I94H 2UUAH 4DV3H 1SYXB 4JI3H 5LL6b 4A2AA 1GYFA 4LFAH 4B3RH 4CC6A 2CW8A 3KAJA 2E5LH 1VS0A 2PT7G 3OTOH 1Z2PX 1A0IA 2VOBA 2LF0A 3QD7X 3F8NA 3K3VA 4JI7H 4DV5H 4JYAH 4J0MA 2D9IA 4UCRA 3L4KA 4NXMH 3OSSD 1FKAH 4UCVA 4LFBH 2Q2TA 3CVZA 1E4GT 3FMAA 5FD5A 4X66H 4DV1H 5D1OA 4MV7A 4LF7H 2RGRA 2MCTA 3SB1A 1FVIA 4K0KH 2VKCA 5A2QW 1Z2NX 3JSLA 3L4JA 2W57A 4NZRM 2VUGA 4LSAA 1WH2A 2CW7A 2UUCH 4RB3C 2O4CA 4JI4H 4B3SH 5LMNH 4EC5A 4LF9H 1MZBA 4DR4H 3EYYA 4UFZA 3BABA 3EZJA 1XNQH 3LMLA 3M4IA 3BAAA 1X9NA 2ZM6H 1HNWH 3KXYT 4DR7H 1N34H 4JI8H 4DV6H 1XMQH 3RTXA 2HVQA 4DR1H 3JSNA 4DV4H 4JI0H 2Q2UA 4Q0YA 3OETA 4EFEA 2Y3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 H;  4DR3 H;  3T1H H;  1HNX H;  3T1Y H;  1N33 H;  1IBL H;  4B3T H;  1HNZ H;  4DR6 H;  4DUY H;  4NXN H;  4YY3 H;  4DV0 H;  4JI2 H;  4KHP H;  2HHH H;  3RF2 A;  5IWA H;  4LF5 H;  1XNR H;  4X62 H;  1HR0 H;  4DV2 H;  2UXB H;  2UXC H;  4YHH H;  1XMO H;  1N36 H;  4LF6 H;  1I6U A;  3J80 W;  4B3M H;  4AQY H;  2UUB H;  4X65 H;  1IBK H;  4JI6 H;  2UXD H;  2VQF H;  4DR5 H;  2F4V H;  5IT9 W;  4DV7 H;  5BR8 H;  4JV5 H;  5FLX W;  1FJG H;  4PDB A;  2VQE H;  4JI1 H;  1AN7 A;  4GKJ H;  1IBM H;  4LF4 H;  4OX9 H;  2UU9 H;  4DUZ H;  4X64 H;  4DR2 H;  3J7A K;  1J5E H;  3JAM W;  5LMU H;  4LF8 H;  1S03 G;  3J81 W;  1SEI A;  4GKK H;  4LFC H;  1I94 H;  2UUA H;  4DV3 H;  4JI3 H;  5LL6 b;  4LFA H;  4B3R H;  2E5L H;  3OTO H;  4JI7 H;  4DV5 H;  4JYA H;  4NXM H;  1FKA H;  4LFB H;  4X66 H;  4DV1 H;  4LF7 H;  4K0K H;  5A2Q W;  2UUC H;  4JI4 H;  4B3S H;  5LMN H;  4LF9 H;  4DR4 H;  1XNQ H;  2ZM6 H;  1HNW H;  4DR7 H;  1N34 H;  4JI8 H;  4DV6 H;  1XMQ H;  4DR1 H;  4DV4 H;  4JI0 H;  1N32 H; 
#chains in the Genus database with same CATH topology
 2YS7 A;  3N40 P;  2YCH A;  4Q44 A;  3BA8 A;  4DR3 H;  1JDE A;  2JE6 I;  4WD3 A;  1VAJ A;  4APM A;  1Z2I A;  4EYI B;  4Q43 A;  4DUY H;  1RK6 A;  1WCM A;  4TV8 F;  1Y1W G;  2W9B B;  3FKI G;  1TA8 A;  4IWX A;  4TV9 F;  1RYS A;  3RFC A;  3N41 B;  2SCU B;  4NZT M;  2WDT A;  3BA9 A;  4YY3 H;  1WR2 A;  4EEQ A;  5FJ8 G;  4FS2 A;  1JX4 A;  4JI2 H;  2BQR A;  2J6T A;  5KFA A;  3HB9 A;  4F4X A;  5IWA H;  5L1K A;  4YB8 B;  4O3S A;  3SE7 A;  5KFH A;  2YYA A;  1VBH A;  4HNU A;  3UQ8 A;  4YR2 A;  5KFV A;  2DPI A;  4X62 H;  2OH2 A;  4YJ2 F;  3HOZ G;  3PVX A;  1TWA A;  5D1O B;  4OCH A;  2C22 A;  1BXR A;  2R8K A;  2JEJ A;  3EPI A;  1OWT A;  4ZHQ F;  3Q8R B;  1AUV A;  5EWG A;  4J9K A;  2ZDG A;  5KG1 A;  4J9N A;  2JA7 G;  4MAM A;  1VIH A;  4EG0 A;  3KDK A;  1R9T A;  5EZY F;  5KG2 A;  2OPV A;  4MV1 A;  2IP4 A;  2FMA A;  1N56 A;  3PN1 A;  2I8C A;  4XZ3 B;  3TQT A;  4RAZ A;  3OHB A;  2CTK A;  2WYO A;  3GAB A;  2WB1 E;  2WB1 A;  3M9O B;  1DGS A;  5FPR A;  3PR4 A;  4GC6 A;  2W6O A;  3VPD A;  1I7L A;  3GLK A;  1J5K A;  3K5I A;  4ZI7 F;  2VQF H;  4ECT A;  4QWD A;  4BY7 G;  2KSW A;  4IHJ F;  5KG3 A;  1F0X A;  4ZQI A;  5KFD A;  5FD6 A;  3KDG A;  3GIP A;  2V4R A;  1V9N A;  4J9S A;  4MTD A;  4L1K A;  5BR8 H;  4JVY A;  5FLX W;  1FJG H;  1RJP A;  3HOY G;  4WAL A;  5DG8 A;  2Z0S A;  5KFI A;  4IRD A;  4C5B A;  2ALZ A;  2JZX A;  2UVV A;  4FM9 A;  4DUZ H;  2HGS A;  3UFX B;  2JEG A;  3LWB A;  1UC8 A;  5KFU A;  1J5E H;  4ED2 A;  5LMU H;  5KG6 A;  1BGW A;  4RB1 A;  3H0G A;  4O4L F;  5KFB A;  3NGD A;  2R8G A;  2I80 A;  5F9L A;  2CTJ A;  4B8T A;  5DQI A;  2JEI A;  2XGP A;  4A3L G;  2PQU A;  2GPS A;  2R6F A;  1KBL A;  4QWA A;  2UUA H;  1SYX B;  4ECS A;  3MFI A;  2IA6 A;  4B3R H;  4CC6 A;  3BQ2 A;  3KAJ A;  2E5L H;  2UVU A;  4DL5 A;  5KFT A;  3R5X A;  4Y8V B;  4A3G G;  4QJF A;  4JI7 H;  4DV5 H;  4R8U A;  3L4K A;  2J9G A;  5I47 A;  2X0S A;  3GTG A;  1FKA H;  4MV8 A;  3QZ8 A;  1JXL A;  5L1I A;  4UCV A;  4LFB H;  3GIK A;  2CWH A;  1IOW A;  5K36 G;  4ECV A;  2C2E A;  2Q2T A;  5FD5 A;  2QK4 A;  2PVP A;  3Q8S B;  4LIJ A;  1RK5 A;  3PZP A;  3PO2 G;  4HNV A;  5KG7 A;  2MCT A;  3M9N B;  4J9M A;  2LTL A;  5A2Q W;  3PW5 A;  3TIG A;  1M7J A;  1RYR A;  2R7N A;  4I4T F;  2YU9 A;  2FMR A;  4NZR M;  2W57 A;  1Y1V A;  1PK8 A;  2PMZ E;  2PMZ A;  4RB3 C;  4M9U A;  4J9Q A;  4LF9 H;  1MZB A;  4DR4 H;  3GKU A;  1DIK A;  2PY9 A;  3KTM A;  3PW7 A;  2ZDQ A;  3FDS A;  3EPG A;  2ZM6 H;  2M6Q A;  3KXY T;  4DR7 H;  4A3K G;  3V6K A;  1EUC B;  1KHM A;  5HBR B;  2ASD A;  4DV4 H;  1W96 A;  4XYM B;  2JA6 G;  2CTE A;  5DQG A;  2DZD A;  4EFE A;  1N32 H;  1XDN A;  1ODH A;  1KJ8 A;  4FBU A;  4TQR A;  2XD4 A;  5DLG A;  4ZOL F;  3GIM A;  1S10 A;  2ASL A;  1P8L A;  3C0F B;  4O2A F;  4Q8F A;  2W70 A;  3T5L A;  5KFW A;  5KX5 F;  5KFE A;  2JVZ A;  1N33 H;  3RUP A;  3JZI A;  1IBL H;  3N6X A;  1W93 A;  1HNZ H;  4FS1 A;  4DR6 H;  2CTM A;  3MWE A;  4TUY F;  2FLN A;  5KG4 A;  4QW9 A;  4LH7 A;  4ED6 A;  2LRR A;  3U9T A;  2C2D A;  1SFO A;  4ED1 A;  1S97 A;  4KHP H;  4I55 F;  3MFH A;  2VUM A;  3JRW A;  4UCO A;  4AIM A;  2VA2 A;  3OUZ A;  2E2I A;  2FPI B;  2ZJT A;  4LSX A;  4EBD A;  2P2R A;  3RJ0 A;  5C1O A;  3RAQ A;  3GTM A;  5C3E G;  2AGO A;  3BQ1 A;  1XNR H;  1I7N A;  2JA5 G;  2FPP B;  4DL3 A;  1JIH A;  3RAX A;  2JA7 A;  5JVD F;  1T94 A;  2AGQ A;  4J9P A;  5F9N A;  2W7O A;  4ED7 A;  2FK3 A;  4NLG A;  2W6M A;  5C5J A;  3KHL A;  2FP4 B;  1X9Z A;  3WNZ A;  2I87 A;  4C5C A;  3RB3 A;  2R7K A;  3HBL A;  2C28 A;  1GO3 E;  2V58 A;  1KEE A;  2R93 G;  4HR7 A;  3V4Z A;  1X4N A;  3GV8 B;  2HVR A;  1L2Z A;  1IOV A;  4ECY A;  1ULZ A;  2CPQ A;  3R23 A;  4FU0 A;  1K83 A;  2ATL A;  5KFS A;  1EZ1 A;  2R7M A;  5JQW A;  1VKZ A;  4LMY A;  4ED3 A;  4ED8 A;  4ECZ A;  3MR5 A;  4EBC A;  3PW0 A;  4I50 F;  2DPJ A;  2UVR A;  5JUM A;  3HXL A;  4C5A A;  2VPS A;  2QYZ A;  4DV7 H;  2XCP A;  4J9L A;  3G6V A;  5IYB G;  2R82 A;  5FLM G;  2CZG A;  2CWF A;  4Q45 A;  3NCV A;  2W6Z A;  3U9S A;  3ORQ A;  2VQE H;  2C2R A;  3IG0 A;  1AN7 A;  5KFO A;  4GKJ H;  1EC6 A;  2FB9 A;  2XIG A;  3VMM A;  3K3P A;  3RBD A;  2V59 A;  2DGR A;  3J7A K;  5CAE B;  2RDJ A;  4IAJ A;  1DT4 A;  4IWY A;  3PW4 A;  2W8L A;  2AQ4 A;  2B63 A;  4B8C D;  2WE6 A;  1K1Q A;  2ZDH A;  3WO1 A;  4RZR A;  4F4W A;  2BQ3 A;  5JEA G;  5KKN B;  1N48 A;  4G3I A;  1V8C A;  1NXU A;  4GKK H;  2RGV A;  4MV3 A;  1PX2 A;  5KFZ A;  1I94 H;  4DV3 H;  4JI3 H;  2OPU A;  4LFA H;  5T14 A;  1EHI A;  4ECU A;  4J9R A;  2PT7 G;  3OTO H;  1ZZJ A;  2VOB A;  1B6R A;  2W7P A;  3F8N A;  3AEV B;  3K3V A;  5KFC A;  2D9I A;  2W9A A;  4NXM H;  3I4N G;  4IFD G;  3R5F A;  2VPQ A;  4IZO A;  2R7Z A;  4X66 H;  5IYD G;  2FK2 A;  4O3O A;  4DL7 A;  2NVX A;  1UNN C;  5J2U F;  2Y0S E;  2Y0S A;  2WAQ E;  2WAQ A;  4U6P A;  4DL2 A;  3RB0 A;  2CW7 A;  2UUC H;  4JI4 H;  4QWB A;  4B3S H;  3L7Z C;  2NU7 B;  5LMN H;  5K2M A;  4BBR G;  3IN5 A;  2R92 A;  1WCM G;  3I4M G;  4O3N A;  5H80 A;  5KT2 A;  3M4I A;  3BAA A;  3RV4 A;  4YP3 A;  2BR0 A;  3GV7 B;  3H3V H;  4JI8 H;  3U1K A;  1XMQ H;  1EUD B;  2AU0 A;  4ECQ A;  2IBK A;  4JI5 H;  5KT5 A;  3VPB A;  4H8A A;  2R84 A;  4EGJ A;  3KAK A;  4A3J G;  1HNX H;  4RB2 C;  3RV3 A;  5L1L A;  1T36 A;  5KFK A;  4EEY A;  1WTJ A;  5CA1 F;  5C8Y F;  3BG5 A;  4R7R A;  2YL2 A;  2GPW A;  4JV2 A;  1TUA A;  4ETS A;  5EWF A;  1CE8 A;  4CC5 A;  3MR3 A;  2DLN A;  5KFP A;  2M8W A;  3I0P A;  3K5H A;  5DQH A;  2P0A A;  2R92 G;  3VPC A;  5BMV F;  5IYZ F;  4DV0 H;  3GTP A;  4O4H F;  4DLK A;  3MR6 A;  4F4Y A;  2HHH H;  5DT9 A;  4LF5 H;  2FKL A;  5DGB A;  3T5K A;  4R8U B;  3GR5 A;  1BJT A;  3ETJ A;  2C00 A;  1B04 A;  4MV4 A;  4UCT A;  1A9X A;  4IRC A;  2MJH A;  1M0W A;  5J2T F;  5KFG A;  3GIL A;  3JRX A;  1HR0 H;  1Z2O X;  3KHG A;  4YHH H;  4OD6 A;  1S20 A;  1N36 H;  3MR2 A;  4LF6 H;  3FKI A;  3H4D A;  4IR9 A;  3OSN A;  3V6J A;  3AYH B;  1Y1W A;  3ORR A;  4A3C G;  4DL6 A;  3J80 W;  4XX0 B;  4RAY A;  4XYL B;  2XCA A;  1WVN A;  5D1P A;  1WHR A;  2R85 A;  4AQY H;  4EYH B;  1GSH A;  3MWM A;  1VIG A;  4JUZ A;  2DIK A;  5LP6 F;  5KFX A;  2NU6 B;  2C35 B;  3Q8P B;  2V4Q A;  4HQ6 A;  4X65 H;  1IBK H;  4JI6 H;  2UXD H;  2NN6 G;  5EOY A;  2CTF A;  5KFQ A;  3HOW G;  1X0A A;  1M0T A;  2FK1 A;  4O2B F;  4RUA A;  1CS0 A;  2FPH X;  1B33 N;  3QFF A;  4A2B A;  4RNM A;  3RGX A;  2F4V H;  4O4I F;  1S0M A;  5LYJ F;  4E9J A;  4BY1 G;  3H0G G;  1ZZI A;  2JEF A;  2VUM G;  4MV6 A;  3HKZ E;  3HKZ A;  4MTE A;  4A3M G;  1S68 A;  2A1S A;  1E4E A;  3KHR A;  4O3R A;  4J9O A;  3GTO A;  4E4T A;  4PDB A;  5IP9 G;  3GII A;  5KG0 A;  1TWH A;  1I3Q A;  3G6Y A;  5KT4 A;  1O75 A;  2HH2 A;  4AM3 A;  4OX9 H;  1PQX A;  2UU9 H;  4X64 H;  1RJR A;  2HJW A;  2NU9 B;  2HVS A;  3JAM W;  2CKZ B;  1E4F T;  3N44 B;  4UCU A;  4LF8 H;  3V69 A;  4MA0 A;  4ED0 A;  4A3B G;  1S03 G;  3J81 W;  2RF4 A;  4QW8 A;  3KAL A;  4RZQ A;  3L2P A;  5JVL A;  4UCS A;  4LFC H;  4QIW E;  4QIW A;  5C1P A;  3RBE A;  5LL6 b;  5C44 G;  1Y1V G;  2CW8 A;  3Q1K A;  2UVW A;  1GSO A;  2JA9 A;  3PO3 G;  4J0M A;  5BPF A;  4OO1 G;  3HOX G;  3GTL A;  5C4X G;  5L9X A;  4JV1 A;  3CVZ A;  2ANR A;  5KT7 A;  3FMA A;  4F4Z A;  2R87 A;  2V5A A;  5EDW A;  4DV1 H;  1KJQ A;  5D1O A;  1DV1 A;  4MV7 A;  4LF7 H;  1KC7 A;  2CPM A;  3BJY A;  2RGR A;  3SB1 A;  1FVI A;  1Z2N X;  3H4B A;  1X4M A;  3L4J A;  5KFR A;  2FJZ A;  5LXT F;  4YAK B;  4BBS G;  2OLS A;  2VUG A;  2K1H A;  2YS6 A;  1WH2 A;  1JLL B;  2XC9 A;  3GIQ A;  3TIN A;  4U7C A;  3PR5 B;  2W9C A;  2J6U A;  3EYY A;  5KG5 A;  4UFZ A;  3BAB A;  1SCU B;  2R8H A;  1C3O A;  1I50 A;  4QWC A;  3GV5 B;  1X9N A;  2BL5 A;  4DV6 H;  4A3E G;  2YZM A;  5DG9 A;  4C2M A;  1ZTG A;  5KFM A;  4NBQ A;  4JI0 H;  2JEA I;  4FJS A;  4BA2 I;  4RU9 A;  2Q2U A;  4IR1 A;  1V4Y A;  2Y3M A;  2NVY A;  3OSP A;  2R7L A;  1V9P A;  4YBZ B;  4WBN F;  2FLP A;  4Q8E A;  1KJI A;  4QWE A;  3G8C A;  3T1H H;  3T1Y H;  3GTQ A;  1GLV A;  2W9C B;  1TAE A;  4B3T H;  2VA3 A;  2RDI A;  2J6S A;  2XGQ A;  3T5J A;  2YZN A;  2AGP A;  3MJF A;  1ZHQ A;  2JEB I;  2M05 A;  4RNO A;  5IYC G;  4NXN H;  1CQI B;  2PN1 A;  2W71 A;  3Q2O A;  4YR3 A;  4TQS A;  3OHA A;  2WTF A;  2JA6 A;  3CQZ A;  4YAJ B;  4HNT A;  3RF2 A;  3MWD A;  3TQ1 A;  3KHH A;  5KFN A;  1ZET A;  2HH3 A;  1AUX A;  2FPG B;  2ZQE A;  2AXY A;  4DV2 H;  2BA0 A;  2UXB H;  2UXC H;  5KFL A;  2ASJ A;  1XMO H;  4G08 A;  2DWC A;  2V9W A;  1WE8 A;  1GGO A;  3TII A;  2W6Q A;  1I6U A;  3N42 B;  4JV0 A;  2G8Y A;  1TWF A;  2FE3 A;  2YZG A;  4B3M H;  3I12 A;  2R86 A;  4BWS C;  2BQU A;  3RIZ A;  3GTJ A;  1S0N A;  3GQC A;  2CQY A;  4A3D G;  3V4S A;  2UUB H;  5KT3 A;  3HOU G;  5C0X G;  4YR0 A;  4BXX G;  3HOV G;  3LP8 A;  2JA5 A;  1K1G A;  2FFM A;  2VR1 A;  5KFY A;  1DV2 A;  3WO0 A;  1M6V A;  3N43 B;  2OWO A;  5KFJ A;  4RB0 A;  5DG7 A;  3QZ7 A;  1XRH A;  4DR5 H;  5IT9 W;  4EFB A;  2B63 G;  1ZQ7 A;  3DF7 A;  4YQW A;  4LH6 A;  4M7E A;  1TWG A;  2E3U A;  1Y14 B;  1ZHS A;  2O03 A;  3H20 A;  4YJ3 F;  5CA0 F;  3RGZ A;  3V6H A;  2R93 A;  4GLX A;  4O3P A;  4BA1 I;  4MV9 A;  1UG8 A;  4JV5 H;  1CQJ B;  4EGQ A;  4O3Q A;  2R8I A;  5D8D A;  2NUA B;  4JI1 H;  3M9M B;  4A3F G;  1TWC A;  2W8K A;  1IBM H;  4LF4 H;  3FAU A;  3VKE A;  2YRW A;  4RNN A;  1T3N A;  4DR2 H;  4A3I G;  4RUC A;  4FJU A;  5FPO A;  4HYK A;  5DLF A;  4IRK A;  1WSC A;  2YRX A;  2R7Z G;  1VBI A;  5LA6 F;  4MA5 A;  5GON F;  1C30 A;  3H40 A;  1J4W A;  1SEI A;  4I7H A;  2W6N A;  3ETH A;  1S0O A;  5KT6 A;  3RB4 A;  1B6S A;  4F50 A;  3N8D A;  4A2A A;  3Q8Q B;  1GYF A;  4ECW A;  4A93 G;  2W6P A;  2QND A;  4QMF B;  1VS0 A;  1K1S A;  1Z2P X;  3GID A;  5EWE A;  1A0I A;  3G6X A;  2LF0 A;  3QD7 X;  2NU8 B;  3PW2 A;  1ZZK A;  2ANN A;  4WAN A;  4JYA H;  1JDB B;  1V51 A;  2GLT A;  1RJQ A;  4UCR A;  1DTJ A;  3OSS D;  4PWQ A;  2X06 A;  2VQD A;  2XCL A;  4EBE A;  1E4G T;  1UC9 A;  4AYB E;  1KJ9 A;  4AYB A;  3OUU A;  5HV6 A;  2LTM A;  3GTK A;  1VBG A;  4ECR A;  3SI8 A;  3UOE A;  2CTL A;  1GSA A;  5IP7 G;  2R8J A;  5L1J A;  4GC7 A;  5CB4 F;  3JSL A;  4K0K H;  2VKC A;  1JKJ B;  3E5N A;  4LSA A;  5BPH A;  2YQR A;  5DGA A;  5LOV F;  3R5H A;  2O4C A;  4ME6 A;  4FBT A;  2YW2 A;  4EC5 A;  3BQ0 A;  5KFF A;  2IMW P;  2PBZ A;  3EZJ A;  1XNQ H;  3LML A;  2W9B A;  4ECX A;  3T5H A;  1HNW H;  5JH7 F;  1E4E B;  3GIJ A;  4DL4 A;  1N34 H;  4JVH A;  2FLL A;  1KJJ A;  3RB6 A;  3RTX A;  2JA8 G;  1EYZ A;  2HVQ A;  4DR1 H;  3JSN A;  2E2H A;  1BNC A;  4Q0Y A;  3OET A;  1S9F A;  1MSZ A; 
#chains in the Genus database with same CATH homology
 4JI5 H;  1XDN A;  3N40 P;  1ODH A;  1V9P A;  2YCH A;  3BA8 A;  4DR3 H;  1P8L A;  3C0F B;  3T1H H;  1HNX H;  3KAK A;  3T1Y H;  4RB2 C;  4APM A;  1N33 H;  3N6X A;  1IBL H;  4B3T H;  1TAE A;  1HNZ H;  4DR6 H;  4DUY H;  4R7R A;  1ZHQ A;  4ETS A;  4CC5 A;  1TA8 A;  4LH7 A;  3N41 B;  4NZT M;  2WDT A;  4NXN H;  4YY3 H;  3BA9 A;  4EEQ A;  4DV0 H;  4JI2 H;  4KHP H;  2HHH H;  4UCO A;  3RF2 A;  5IWA H;  5DT9 A;  4LF5 H;  2ZJT A;  4LSX A;  3RJ0 A;  3GR5 A;  1BJT A;  4UCT A;  1B04 A;  1XNR H;  1M0W A;  3UQ8 A;  4X62 H;  2ZQE A;  1HR0 H;  4DV2 H;  2UXB H;  2UXC H;  1Z2O X;  5D1O B;  4OCH A;  4G08 A;  4OD6 A;  4YHH H;  1XMO H;  1N36 H;  4LF6 H;  1X9Z A;  1I6U A;  3N42 B;  2FE3 A;  3J80 W;  4RAY A;  4B3M H;  5D1P A;  4BWS C;  3RIZ A;  4AQY H;  3KDK A;  3MWM A;  2HVR A;  1L2Z A;  2UUB H;  3PN1 A;  4RAZ A;  2WYO A;  3GAB A;  1DGS A;  4X65 H;  1IBK H;  4JI6 H;  2UXD H;  3N43 B;  4LMY A;  5EOY A;  5FPR A;  2OWO A;  1M0T A;  2VQF H;  4RB0 A;  2FPH X;  2KSW A;  4A2B A;  4DR5 H;  2F4V H;  5IT9 W;  4EFB A;  1F0X A;  3RGX A;  3DF7 A;  4E9J A;  5FD6 A;  4LH6 A;  3HXL A;  4M7E A;  3KDG A;  1ZHS A;  2VPS A;  3H20 A;  4DV7 H;  2O03 A;  4MTE A;  4MTD A;  1S68 A;  3RGZ A;  4GLX A;  5BR8 H;  4MV9 A;  4JV5 H;  3NCV A;  5FLX W;  1FJG H;  4PDB A;  2VQE H;  4JI1 H;  3IG0 A;  1AN7 A;  1O75 A;  4GKJ H;  1IBM H;  4LF4 H;  4OX9 H;  3FAU A;  2UU9 H;  4DUZ H;  2XIG A;  2HGS A;  4FM9 A;  4X64 H;  4DR2 H;  3J7A K;  2HVS A;  4IAJ A;  1J5E H;  5FPO A;  3JAM W;  5LMU H;  1E4F T;  4B8C D;  1BGW A;  4LF8 H;  3N44 B;  2WE6 A;  4UCU A;  1N32 H;  4RB1 A;  1S03 G;  3J81 W;  3KAL A;  4RZQ A;  3L2P A;  1SEI A;  4I7H A;  2RGV A;  4GKK H;  4UCS A;  4LFC H;  1I94 H;  2UUA H;  4DV3 H;  1SYX B;  4JI3 H;  5LL6 b;  4A2A A;  1GYF A;  4LFA H;  4B3R H;  4CC6 A;  2CW8 A;  3KAJ A;  2E5L H;  1VS0 A;  2PT7 G;  3OTO H;  1Z2P X;  1A0I A;  2VOB A;  2LF0 A;  3QD7 X;  3F8N A;  3K3V A;  4JI7 H;  4DV5 H;  4JYA H;  4J0M A;  2D9I A;  4UCR A;  3L4K A;  4NXM H;  3OSS D;  1FKA H;  4UCV A;  4LFB H;  2Q2T A;  3CVZ A;  1E4G T;  3FMA A;  5FD5 A;  4X66 H;  4DV1 H;  5D1O A;  4MV7 A;  4LF7 H;  2RGR A;  2MCT A;  3SB1 A;  1FVI A;  4K0K H;  2VKC A;  5A2Q W;  1Z2N X;  3JSL A;  3L4J A;  2W57 A;  4NZR M;  2VUG A;  4LSA A;  1WH2 A;  2CW7 A;  2UUC H;  4RB3 C;  2O4C A;  4JI4 H;  4B3S H;  5LMN H;  4EC5 A;  4LF9 H;  1MZB A;  4DR4 H;  3EYY A;  4UFZ A;  3BAB A;  3EZJ A;  1XNQ H;  3LML A;  3M4I A;  3BAA A;  1X9N A;  2ZM6 H;  1HNW H;  3KXY T;  4DR7 H;  1N34 H;  4JI8 H;  4DV6 H;  1XMQ H;  3RTX A;  2HVQ A;  4DR1 H;  3JSN A;  4DV4 H;  4JI0 H;  2Q2U A;  4Q0Y A;  3OET A;  4EFE A;  2Y3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...