1SEIA

Structure of 30s ribosomal protein s8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
VMTDPIADMLTAIRNANMVRHEKLEVPASKIKREIAEILKREGFIRDYEYIEDNKQGILRIFLKYGPNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIAILSTSQGVLTDKEARQKGTGGEIIAYVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for specific S8-RNA and S8-protein interactions within the 30S ribosomal subunit: ribosomal protein S8 from Bacillus stearothermophilus at 1.9 A resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
molecule keywords RIBOSOMAL PROTEIN S8
total genus 31
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1seiA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1seiA02
3J7AK 2HHHH 1IBKH 3J81W 4JV5H 1IBMH 4B3SH 4GKJH 4JI0H 4JI1H 1FKAH 4NXNH 4DV4H 4JI2H 4DUZH 1N36H 1HR0H 4DV0H 4GKKH 4LFAH 5A2QW 3RF2A 4DV7H 2E5LH 2UXCH 4DR7H 5LL6b 1IBLH 1AN7A 4DV6H 1HNWH 1XNQH 4DUYH 4YHHH 3T1YH 4X65H 4LF6H 4LF7H 1XMOH 4B3MH 4LF4H 2F4VH 4B3RH 1N32H 4DR4H 4KHPH 4DR6H 4AQYH 1HNZH 4JI5H 5IWAH 1HNXH 2UU9H 1I6UA 2UUBH 4NXMH 2UXDH 5LMUH 1FJGH 3JAMW 1SEIA 1I94H 4JI3H 4JI6H 1XNRH 1XMQH 2UUCH 4JI7H 4LFBH 4DV3H 3J80W 2ZM6H 4JI8H 3OTOH 2UXBH 4DV5H 2VQEH 5IT9W 3T1HH 4LF8H 4DR3H 4DV2H 2VQFH 5LMNH 2UUAH 4PDBA 4DV1H 4YY3H 4B3TH 5FLXW 4OX9H 4JI4H 4DR1H 5BR8H 4LF5H 1S03G 4LF9H 4DR2H 4K0KH 4LFCH 4X66H 4DR5H 4X64H 1N33H 4JYAH 1N34H 4X62H 1J5EH
chains in the Genus database with same CATH superfamily
3KHHA 4HNVA 3T5LA 2VUMA 5FJ8G 2HHHH 1IBKH 4HNUA 3TQ1A 4EBDA 2V5AA 5DLFA 4DL6A 5F9LA 1E4EA 3RFCA 4I50F 3L4KA 3SI8A 4JI1H 1FKAH 4QJFA 1TWHA 2NVXA 4WD3A 4FJSA 4F4XA 3H4DA 4TQSA 4B8CD 3WO1A 1Z2OX 1PK8A 3V69A 1IOWA 5KT2A 2IP4A 2R87A 3CVZA 4GKKH 4DV0H 4YB8B 3ORRA 3HOXG 1EYZA 2R8HA 3PW7A 2JA7G 4AIMA 3I0PA 3PR4A 1I50A 2W6ZA 5KFRA 3EYYA 4ED7A 2ALZA 2YS6A 5A2QW 4UCRA 4O4IF 4TV8F 3MR6A 2ANRA 2CTMA 1IOVA 1XDNA 4DV7H 5KFMA 1W93A 5KT6A 4FS2A 5KG1A 4DL7A 2LTMA 4RZRA 5FLMG 3GR5A 2YZMA 4J0MA 3V6KA 5KFQA 4DR7H 2ZDGA 3T5JA 1AUVA 2R8KA 3H3VH 2IA6A 4YBZB 1IBLH 1VBGA 4U6PA 4XZ3B 1AN7A 2HH3A 4UCSA 5D1OB 2JEIA 2DIKA 2VUGA 1V51A 1XNQH 4DUYH 3HBLA 4HR7A 4YHHH 1TWFA 5IYBG 3GV7B 4ECRA 1K83A 3T1YH 2R85A 3TINA 4X65H 4MV1A 2I8CA 1XMOH 4A3LG 4C2MA 1L2ZA 4YJ3F 2W9CB 2AGQA 4Q8EA 2ZDQA 1J4WA 2PN1A 5KKNB 4F4YA 4I55F 2Y0SA 4UCTA 4KHPH 1S68A 3UQ8A 3RBEA 2C2EA 3RB3A 1R9TA 4G08A 4FJUA 4DR6H 3N41B 1HNZH 1SFOA 3OHBA 1UNNC 4DLKA 4QW9A 5DG9A 1RYSA 3KDKA 5T14A 4RNNA 2XGPA 3PW2A 2AU0A 5C5JA 2UU9H 4IWYA 3ETJA 3CQZA 3R23A 1ZZJA 4Q43A 3U9TA 1UG8A 2RDJA 5KFDA 4NXMH 3I12A 4EFEA 5IYDG 2XCPA 4EFBA 3JAMW 4JI3H 2MJHA 1XNRH 2J6TA 3HOUG 2V9WA 1XMQH 2UUCH 4LFBH 2WB1A 3C0FB 2LF0A 2FK3A 2W9AA 3OUZA 5KFKA 4JI8H 1WCMA 4RUCA 2FLNA 4A3BG 2KSWA 1Y1WG 2R82A 4WALA 5IT9W 1GSHA 2GPSA 5DQGA 4QWEA 4TV9F 4RB3C 1DTJA 3NCVA 2E3UA 2UUAH 1OWTA 4PDBA 2I87A 2ZJTA 4BY7G 5KG7A 2CQYA 5FLXW 4EYHB 4O4LF 1GLVA 5BMVF 5L9XA 1K1QA 1DGSA 2FK1A 4GC7A 3WO0A 2BR0A 2CPQA 2W57A 5JQWA 1VIGA 2FPHX 3IN5A 1Y1WA 5DG8A 4MV3A 5KFGA 4ED3A 3VPDA 2CWHA 2W7OA 2J6UA 3PR5B 1JLLB 2YZGA 1JIHA 2DPIA 3GTMA 2C2RA 2R84A 4JVYA 2NU8B 4EEYA 2XGQA 4DL4A 1N34H 3HOZG 3AEVB 1EHIA 1O75A 4O4HF 5KT4A 2DLNA 4Q0YA 2VPSA 4LSAA 4Q44A 3MWMA 2AGPA 2FMRA 2O03A 4MV8A 1VS0A 5KFYA 1Z2IA 2JA6A 4AYBE 2HVQA 2M6QA 3RAQA 2DPJA 4GKJH 1RK5A 1WR2A 4Y8VB 5EWEA 4ZI7F 3GTJA 4L1KA 2LTLA 1MSZA 2JE6I 1S20A 1JKJB 4NXNH 5DQIA 3MR2A 3U1KA 1C30A 4J9MA 2JA9A 3JSLA 3Q2OA 2IBKA 4LIJA 5CA1F 5KFBA 1Z2PX 3HOVG 2R7ZG 4IWXA 1WH2A 2JVZA 1N36H 3DF7A 1VBHA 2XIGA 3JRXA 2R92G 2K1HA 4RB0A 4LFAH 4J9RA 2ZQEA 4FM9A 1X9NA 1XRHA 4Q8FA 5JVDF 2B63G 2OWOA 5L1IA 5KFWA 1JX4A 1WE8A 4UCOA 4EBEA 4A93G 2ATLA 3GABA 4JV2A 2UVRA 3TQTA 2O4CA 5DLGA 3RGZA 3GTLA 2W9BA 1RYRA 2VUMG 5LL6b 3MWEA 2ASDA 2FPIB 4YR3A 1A0IA 2GPWA 5H80A 2PT7G 5K2MA 1DIKA 3VPBA 3RIZA 2R7NA 4ZQIA 1A9XA 2P2RA 1CE8A 2R7KA 2W71A 2C2DA 4XYMB 1BNCA 1TWAA 5C44G 3VMMA 3H0GG 5JEAG 4A2AA 2R93G 3RB6A 1Z2NX 5EDWA 3OETA 1DV1A 3E5NA 3KAKA 4LH6A 5FD5A 4A2BA 2Q2TA 2R7ZA 3OSNA 4RAYA 4ECXA 4E9JA 4DR4H 1B33N 3RJ0A 5KG0A 1MZBA 5IP7G 4J9NA 2PBZA 4O3PA 4A3KG 3PW0A 5KFLA 2R86A 5DG7A 3T5HA 3GTOA 4O3QA 3KHLA 4OCHA 2JA6G 3PW4A 2VA3A 4AQYH 1S10A 2NVYA 2C28A 1RK6A 3M9MB 4JI5H 5LYJF 3GV8B 2FLPA 3SB1A 2W70A 1B6RA 4F50A 1I6UA 4BA2I 1S9FA 1JDEA 1JXLA 4O3RA 3GIQA 3KXYT 2W9CA 4ECSA 2UUBH 2UXDH 1M6VA 5LMUH 1DT4A 2CTKA 5IYZF 2FJZA 4ZOLF 4HQ6A 3RV4A 1I94H 4ED6A 1PQXA 5KFFA 2ASLA 2R7MA 5FD6A 4YQWA 3L4JA 5KFAA 1BXRA 3NGDA 3G6XA 4HYKA 2HH2A 3V6HA 4A3MG 2ZM6H 2JEJA 3HXLA 1EUDB 4IHJF 4DV5H 2XCLA 5KX5F 5KFVA 4BBRG 3Q8RB 2VQEH 3T1HH 2CW7A 3H4BA 4DR3H 3GTGA 2BQRA 2GLTA 4M7EA 5KG6A 4ED0A 3AYHB 1N48A 4IFDG 5EZYF 4YY3H 2C00A 5DGAA 2Y3MA 3FAUA 4BY1G 2DWCA 1ZTGA 2WYOA 4WBNF 2JEFA 4LSXA 3U9SA 4NZTM 5I47A 1KJIA 3M9OB 1SYXB 1EUCB 1TAEA 2PMZE 3K5HA 3M4IA 3GKUA 3MJFA 4YAJB 4O3NA 5KFEA 3M9NB 4LFCH 4RAZA 4JUZA 2B63A 4ECZA 4DR5H 3KHGA 2ZDHA 1TWCA 2R8GA 3ETHA 4QMFB 3GIMA 2R6FA 4JYAH 3N44B 2E2HA 5C1OA 1E4FT 2YYAA 3FMAA 2HGSA 4EC5A 1CQIB 3OSPA 5KG3A 1J5EH 4FBTA 3QZ7A 3KDGA 3J7AK 1V9PA 1ZHSA 2VR1A 2OLSA 4IR1A 4DL2A 1PX2A 2VPQA 1KEEA 4FS1A 3PW5A 3J81W 3BJYA 4O3SA 4JV5H 5LXTF 3I4NG 5LP6F 2YW2A 2JZXA 2FE3A 2JA5A 5KFNA 1M0TA 2OPUA 3MWDA 4JI0H 3SE7A 1ZZIA 2A1SA 4DV4H 3QFFA 4M9UA 3GTPA 1UC9A 4JI2H 3Q8SB 1I7NA 1K1GA 2C35B 3PN1A 1RJPA 4MV6A 1EC6A 5D1PA 1X4MA 2RF4A 1HR0H 2QK4A 5LOVF 4DL5A 4OD6A 3OHAA 2FLLA 2P0AA 3Q1KA 4RNMA 4H8AA 1ZETA 1EZ1A 2G8YA 3BA9A 2JA8G 1VBIA 4TQRA 5LA6F 3KALA 3UFXB 2V58A 4JV0A 1T36A 4ECQA 4FU0A 4RNOA 4U7CA 2WDTA 1UC8A 5JVLA 2XC9A 4MA0A 2YZNA 3IG0A 4R7RA 1S97A 2VA2A 3GQCA 2E2IA 5KG4A 2PMZA 2YL2A 4DV6H 5J2UF 4MV4A 4YR0A 2YS7A 3K3VA 2X06A 4JVHA 3LP8A 1HNWH 1M0WA 5D1OA 5EWFA 3G6YA 2CTJA 1WTJA 3EPIA 1CS0A 4QW8A 2W9BB 5KFHA 1ODHA 3MFHA 2XD4A 4J9KA 1M7JA 2PVPA 5CA0F 2AGOA 4EBCA 4B3MH 5C8YF 5DT9A 5HBRB 2LRRA 2F4VH 1N32H 3VKEA 1GSAA 2R93A 1TUAA 4I4TF 4EG0A 1RJRA 2FP4B 2NUAB 3G6VA 2CTFA 2R7LA 4MV9A 3WNZA 2FFMA 5C1PA 2VQDA 4ED8A 2Q2UA 4LH7A 2R92A 1TA8A 5CAEB 5KFOA 2R8JA 4CC6A 4ECYA 4PWQA 5D8DA 4YR2A 4OO1G 1K1SA 4MTEA 2W8LA 5IWAH 5EOYA 2OH2A 4MTDA 2CTEA 3HOWG 1HNXH 1KJQA 2YRWA 3GIDA 1KC7A 1WVNA 2FPPB 1AUXA 4APMA 2DGRA 3BQ1A 4J9OA 2JEGA 2JA7A 2CW8A 2JEBI 1ZHQA 3RUPA 5KT7A 1FJGH 2WAQA 1SEIA 2W6MA 2W6PA 3Q8PB 4JI7H 3RB0A 4DV3H 3J80W 5EWGA 2RGRA 3BA8A 3H0GA 1VAJA 3K3PA 3KHRA 1ULZA 2D9IA 2UXBH 3RAXA 2SCUB 1S0OA 1W96A 3HKZE 3VPCA 2WTFA 5L1LA 2AXYA 3JRWA 4LF8H 5C0XG 4DV2H 1GO3E 3I4MG 3QD7X 1WHRA 5F9NA 5DQHA 2C22A 4J9SA 3F8NA 2W6OA 2W6NA 2IMWP 3V6JA 4B3TH 1I7LA 4O3OA 4AM3A 4A3IG 1X9ZA 4DR1H 2WE6A 4MA5A 3MR5A 5L1KA 3R5XA 4LF5H 3GLKA 1S03G 5BPHA 1S0NA 2W6QA 2NU6B 4A3CG 5K36G 1C3OA 3T5KA 3FKIG 4NZRM 5KT5A 5IP9G 4IAJA 4CC5A 3RV3A 2AQ4A 4FBUA 4IZOA 4JV1A 3OSSD 4X64H 3FDSA 3GIIA 4UCUA 1BJTA 2Z0SA 2JEAI 5CB4F 1KBLA 4YP3A 4EGQA 1Y14B 1VIHA 4X62H 2VOBA 4Q45A 3L2PA 1WCMG 4E4TA 1VKZA 3HKZA 4F4ZA 2BQUA 3G8CA 3RTXA 1GGOA 2W7PA 4J9QA 1GYFA 5KFIA 4ED1A 4RUAA 3MFIA 1KJ9A 3HB9A 5KFUA 1IBMH 4B3SH 1E4GT 4QWBA 3GILA 4GLXA 3ORQA 1P8LA 2VKCA 3JZIA 3KTMA 1KJJA 5KFSA 1T3NA 2I80A 5KFPA 3EPGA 4XYLB 4ECUA 3MR3A 1V9NA 4XX0B 1B6SA 2UVVA 2MCTA 1BGWA 2OPVA 3GIPA 1V4YA 1GSOA 4DUZH 4O2AF 2V4QA 2J6SA 4NLGA 4NBQA 1X4NA 3TIIA 2FKLA 1JDBB 4G3IA 2BL5A 2M8WA 4ECWA 1S0MA 4QWAA 4LMYA 3RF2A 5JUMA 4UCVA 2BQ3A 3EZJA 4DL3A 1F0XA 1N56A 2E5LH 2RDIA 5KFZA 2UXCH 3UOEA 3R5FA 3GV5B 4MV7A 3V4SA 3BQ2A 4J9LA 3Q8QB 2NN6G 5KFCA 4BXXG 2CWFA 3PZPA 1KJ8A 1RJQA 1X0AA 5KFJA 2FPGB 5J2TF 4R8UA 3GIJA 4QIWA 3GTKA 4YAKB 3BG5A 4IR9A 4BWSC 3LMLA 5BPFA 3V4ZA 5C3EG 4LF6H 5IYCG 4LF7H 4LF4H 1Y1VA 2XCAA 4B3RH 2M05A 5FPRA 2NU7B 4RZQA 2W8KA 5HV6A 1V8CA 4RB1A 2RGVA 2YRXA 1FVIA 4C5CA 4J9PA 3KAJA 4ZHQF 3BQ0A 4EYIB 2YCHA 5KFXA 4WANA 5KG5A 4BBSG 2ASJA 2J9GA 1DV2A 4ED2A 1ZZKA 3GTQA 5C4XG 2UVUA 3TIGA 5JH7F 4GC6A 1T94A 2JA5G 3BAAA 4BA1I 5KFTA 3N6XA 3H40A 1J5KA 2CZGA 4A3FG 1SCUB 5FPOA 4QIWE 3PO3G 4A3EG 3L7ZC 1E4EB 1CQJB 3N40P 3OUUA 2UVWA 4RU9A 5L1JA 4RB2C 4JI6H 3PVXA 2WB1E 3N43B 2WAQE 3R5HA 4IRDA 3LWBA 5KG2A 2V59A 4TUYF 1NXUA 1Y1VG 3JSNA 2CPMA 4UFZA 5DGBA 4IRKA 3OTOH 2X0SA 2Y0SE 3K5IA 4QWCA 4A3JG 3RBDA 3RB4A 5GONF 2FMAA 2VQFH 1TWGA 3N8DA 2QYZA 4YJ2F 4I7HA 4EEQA 3PO2G 4A3DG 5LMNH 4HNTA 4C5AA 2HJWA 4DV1H 4B8TA 2PQUA 5KT3A 4OX9H 1B04A 4JI4H 4QWDA 3QZ8A 4ECVA 5BR8H 2HVRA 4LF9H 4DR2H 3H20A 4ME6A 2R8IA 4IRCA 2CKZB 2NU9B 2YU9A 3RGXA 2ANNA 2HVSA 2CTLA 2QNDA 4K0KH 2DZDA 3N42B 4EGJA 3GIKA 4X66H 4AYBA 4ETSA 2FK2A 1I3QA 2BA0A 4ECTA 1ZQ7A 1N33H 4R8UB 2V4RA 1WSCA 1KHMA 2PY9A 2FB9A 4MAMA 4F4WA 4A3GG 3FKIA 2YQRA 4O2BF 3BABA 3HOYG 4C5BA
chains in the Genus database with same CATH topology
4Q0YA 3KDGA 3J7AK 1V9PA 1ZHSA 2VPSA 3MWMA 2HHHH 1IBKH 3RTXA 4LSAA 1GYFA 2O03A 1VS0A 3J81W 4JV5H 2HVQA 2FE3A 1IBMH 4B3SH 1E4GT 4GLXA 4GKJH 1M0TA 1P8LA 3L4KA 2VKCA 4JI0H 4JI1H 1FKAH 4NXNH 4DV4H 3JSLA 4JI2H 4B8CD 1Z2PX 1Z2OX 2MCTA 3PN1A 1BGWA 1WH2A 5D1PA 4DUZH 1N36H 3CVZA 3DF7A 1HR0H 4DV0H 4GKKH 2XIGA 4OD6A 4RB0A 4LFAH 3EYYA 2ZQEA 4LMYA 4FM9A 1X9NA 5A2QW 4UCRA 3RF2A 2OWOA 4UCVA 1XDNA 3EZJA 4DV7H 3BA9A 4UCOA 1F0XA 3KALA 3GABA 2E5LH 2UXCH 3GR5A 2WDTA 2O4CA 4J0MA 4DR7H 4MV7A 3RGZA 3IG0A 5LL6b 4R7RA 1A0IA 1IBLH 2PT7G 3RIZA 1AN7A 4DV6H 4UCSA 5D1OB 3K3VA 5D1OA 1HNWH 1M0WA 2VUGA 1XNQH 4DUYH 4YHHH 3T1YH 1ODHA 4A2AA 4X65H 4BWSC 3LMLA 1Z2NX 4LF6H 3OETA 4LF7H 4LH6A 1XMOH 3KAKA 5FD5A 4B3MH 4A2BA 4LF4H 5DT9A 2Q2TA 1L2ZA 2F4VH 4B3RH 4E9JA 4DR4H 1N32H 4RAYA 5FPRA 1MZBA 3RJ0A 4RZQA 4RB1A 2RGVA 1FVIA 4MV9A 4KHPH 1S68A 4UCTA 3UQ8A 4OCHA 3KAJA 4LH7A 2Q2UA 4G08A 2YCHA 4DR6H 1TA8A 3N41B 4AQYH 1HNZH 4CC6A 4JI5H 4MTEA 3SB1A 5IWAH 5EOYA 3KDKA 3BAAA 4MTDA 3N6XA 1HNXH 2UU9H 5FPOA 1I6UA 3KXYT 2UUBH 4NXMH 2UXDH 3N40P 4APMA 4EFEA 5LMUH 1ZHQA 2CW8A 4EFBA 3JAMW 4JI3H 1SEIA 1I94H 1FJGH 4JI6H 1XNRH 4RB2C 1XMQH 2UUCH 4JI7H 4LFBH 3N43B 5FD6A 3L4JA 4DV3H 3J80W 3C0FB 2RGRA 3BA8A 2ZM6H 2LF0A 3JSNA 4UFZA 3HXLA 4JI8H 2D9IA 3OTOH 2UXBH 4DV5H 2KSWA 2VQEH 5IT9W 3T1HH 2CW7A 4LF8H 4DR3H 4DV2H 2VQFH 3QD7X 4M7EA 4I7HA 4EEQA 4RB3C 3NCVA 3F8NA 5LMNH 2UUAH 2ZJTA 4PDBA 4DV1H 4YY3H 4B3TH 5FLXW 2Y3MA 3FAUA 1X9ZA 4JI4H 4OX9H 1B04A 4DR1H 5BR8H 2WE6A 2WYOA 2HVRA 4LF5H 4LSXA 1S03G 4LF9H 4DR2H 3H20A 1DGSA 2W57A 4NZRM 2FPHX 4NZTM 1SYXB 4IAJA 1TAEA 3M4IA 4CC5A 3RGXA 2HVSA 4K0KH 4LFCH 3N42B 4RAZA 4X66H 4DR5H 4ETSA 3OSSD 4X64H 1N33H 4JYAH 4UCUA 3N44B 1BJTA 1N34H 1E4FT 3FMAA 1O75A 4EC5A 2HGSA 3BABA 4X62H 2VOBA 1J5EH 3L2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A K;  2HHH H;  1IBK H;  3J81 W;  4JV5 H;  1IBM H;  4B3S H;  4GKJ H;  4JI0 H;  4JI1 H;  1FKA H;  4NXN H;  4DV4 H;  4JI2 H;  4DUZ H;  1N36 H;  1HR0 H;  4DV0 H;  4GKK H;  4LFA H;  5A2Q W;  3RF2 A;  4DV7 H;  2E5L H;  2UXC H;  4DR7 H;  5LL6 b;  1IBL H;  1AN7 A;  4DV6 H;  1HNW H;  1XNQ H;  4DUY H;  4YHH H;  3T1Y H;  4X65 H;  4LF6 H;  4LF7 H;  1XMO H;  4B3M H;  4LF4 H;  2F4V H;  4B3R H;  1N32 H;  4DR4 H;  4KHP H;  4DR6 H;  4AQY H;  1HNZ H;  4JI5 H;  5IWA H;  1HNX H;  2UU9 H;  1I6U A;  2UUB H;  4NXM H;  2UXD H;  5LMU H;  1FJG H;  3JAM W;  1SEI A;  1I94 H;  4JI3 H;  4JI6 H;  1XNR H;  1XMQ H;  2UUC H;  4JI7 H;  4LFB H;  4DV3 H;  3J80 W;  2ZM6 H;  4JI8 H;  3OTO H;  2UXB H;  4DV5 H;  2VQE H;  5IT9 W;  3T1H H;  4LF8 H;  4DR3 H;  4DV2 H;  2VQF H;  5LMN H;  2UUA H;  4PDB A;  4DV1 H;  4YY3 H;  4B3T H;  5FLX W;  4OX9 H;  4JI4 H;  4DR1 H;  5BR8 H;  4LF5 H;  1S03 G;  4LF9 H;  4DR2 H;  4K0K H;  4LFC H;  4X66 H;  4DR5 H;  4X64 H;  1N33 H;  4JYA H;  1N34 H;  4X62 H;  1J5E H; 
#chains in the Genus database with same CATH topology
 3KHH A;  4HNV A;  3T5L A;  2VUM A;  5FJ8 G;  2HHH H;  1IBK H;  4HNU A;  3TQ1 A;  4EBD A;  2V5A A;  5DLF A;  4DL6 A;  5F9L A;  1E4E A;  3RFC A;  4I50 F;  3L4K A;  3SI8 A;  4JI1 H;  1FKA H;  4QJF A;  1TWH A;  2NVX A;  4WD3 A;  4FJS A;  4F4X A;  3H4D A;  4TQS A;  4B8C D;  3WO1 A;  1Z2O X;  1PK8 A;  3V69 A;  1IOW A;  5KT2 A;  2IP4 A;  2R87 A;  3CVZ A;  4GKK H;  4DV0 H;  4YB8 B;  3ORR A;  3HOX G;  1EYZ A;  2R8H A;  3PW7 A;  2JA7 G;  4AIM A;  3I0P A;  3PR4 A;  1I50 A;  2W6Z A;  5KFR A;  3EYY A;  4ED7 A;  2ALZ A;  2YS6 A;  5A2Q W;  4UCR A;  4O4I F;  4TV8 F;  3MR6 A;  2ANR A;  2CTM A;  1IOV A;  1XDN A;  4DV7 H;  5KFM A;  1W93 A;  5KT6 A;  4FS2 A;  5KG1 A;  4DL7 A;  2LTM A;  4RZR A;  5FLM G;  3GR5 A;  2YZM A;  4J0M A;  3V6K A;  5KFQ A;  4DR7 H;  2ZDG A;  3T5J A;  1AUV A;  2R8K A;  3H3V H;  2IA6 A;  4YBZ B;  1IBL H;  1VBG A;  4U6P A;  4XZ3 B;  1AN7 A;  2HH3 A;  4UCS A;  5D1O B;  2JEI A;  2DIK A;  2VUG A;  1V51 A;  1XNQ H;  4DUY H;  3HBL A;  4HR7 A;  4YHH H;  1TWF A;  5IYB G;  3GV7 B;  4ECR A;  1K83 A;  3T1Y H;  2R85 A;  3TIN A;  4X65 H;  4MV1 A;  2I8C A;  1XMO H;  4A3L G;  4C2M A;  1L2Z A;  4YJ3 F;  2W9C B;  2AGQ A;  4Q8E A;  2ZDQ A;  1J4W A;  2PN1 A;  5KKN B;  4F4Y A;  4I55 F;  2Y0S A;  4UCT A;  4KHP H;  1S68 A;  3UQ8 A;  3RBE A;  2C2E A;  3RB3 A;  1R9T A;  4G08 A;  4FJU A;  4DR6 H;  3N41 B;  1HNZ H;  1SFO A;  3OHB A;  1UNN C;  4DLK A;  4QW9 A;  5DG9 A;  1RYS A;  3KDK A;  5T14 A;  4RNN A;  2XGP A;  3PW2 A;  2AU0 A;  5C5J A;  2UU9 H;  4IWY A;  3ETJ A;  3CQZ A;  3R23 A;  1ZZJ A;  4Q43 A;  3U9T A;  1UG8 A;  2RDJ A;  5KFD A;  4NXM H;  3I12 A;  4EFE A;  5IYD G;  2XCP A;  4EFB A;  3JAM W;  4JI3 H;  2MJH A;  1XNR H;  2J6T A;  3HOU G;  2V9W A;  1XMQ H;  2UUC H;  4LFB H;  2WB1 A;  3C0F B;  2LF0 A;  2FK3 A;  2W9A A;  3OUZ A;  5KFK A;  4JI8 H;  1WCM A;  4RUC A;  2FLN A;  4A3B G;  2KSW A;  1Y1W G;  2R82 A;  4WAL A;  5IT9 W;  1GSH A;  2GPS A;  5DQG A;  4QWE A;  4TV9 F;  4RB3 C;  1DTJ A;  3NCV A;  2E3U A;  2UUA H;  1OWT A;  4PDB A;  2I87 A;  2ZJT A;  4BY7 G;  5KG7 A;  2CQY A;  5FLX W;  4EYH B;  4O4L F;  1GLV A;  5BMV F;  5L9X A;  1K1Q A;  1DGS A;  2FK1 A;  4GC7 A;  3WO0 A;  2BR0 A;  2CPQ A;  2W57 A;  5JQW A;  1VIG A;  2FPH X;  3IN5 A;  1Y1W A;  5DG8 A;  4MV3 A;  5KFG A;  4ED3 A;  3VPD A;  2CWH A;  2W7O A;  2J6U A;  3PR5 B;  1JLL B;  2YZG A;  1JIH A;  2DPI A;  3GTM A;  2C2R A;  2R84 A;  4JVY A;  2NU8 B;  4EEY A;  2XGQ A;  4DL4 A;  1N34 H;  3HOZ G;  3AEV B;  1EHI A;  1O75 A;  4O4H F;  5KT4 A;  2DLN A;  4Q0Y A;  2VPS A;  4LSA A;  4Q44 A;  3MWM A;  2AGP A;  2FMR A;  2O03 A;  4MV8 A;  1VS0 A;  5KFY A;  1Z2I A;  2JA6 A;  4AYB E;  2HVQ A;  2M6Q A;  3RAQ A;  2DPJ A;  4GKJ H;  1RK5 A;  1WR2 A;  4Y8V B;  5EWE A;  4ZI7 F;  3GTJ A;  4L1K A;  2LTL A;  1MSZ A;  2JE6 I;  1S20 A;  1JKJ B;  4NXN H;  5DQI A;  3MR2 A;  3U1K A;  1C30 A;  4J9M A;  2JA9 A;  3JSL A;  3Q2O A;  2IBK A;  4LIJ A;  5CA1 F;  5KFB A;  1Z2P X;  3HOV G;  2R7Z G;  4IWX A;  1WH2 A;  2JVZ A;  1N36 H;  3DF7 A;  1VBH A;  2XIG A;  3JRX A;  2R92 G;  2K1H A;  4RB0 A;  4LFA H;  4J9R A;  2ZQE A;  4FM9 A;  1X9N A;  1XRH A;  4Q8F A;  5JVD F;  2B63 G;  2OWO A;  5L1I A;  5KFW A;  1JX4 A;  1WE8 A;  4UCO A;  4EBE A;  4A93 G;  2ATL A;  3GAB A;  4JV2 A;  2UVR A;  3TQT A;  2O4C A;  5DLG A;  3RGZ A;  3GTL A;  2W9B A;  1RYR A;  2VUM G;  5LL6 b;  3MWE A;  2ASD A;  2FPI B;  4YR3 A;  1A0I A;  2GPW A;  5H80 A;  2PT7 G;  5K2M A;  1DIK A;  3VPB A;  3RIZ A;  2R7N A;  4ZQI A;  1A9X A;  2P2R A;  1CE8 A;  2R7K A;  2W71 A;  2C2D A;  4XYM B;  1BNC A;  1TWA A;  5C44 G;  3VMM A;  3H0G G;  5JEA G;  4A2A A;  2R93 G;  3RB6 A;  1Z2N X;  5EDW A;  3OET A;  1DV1 A;  3E5N A;  3KAK A;  4LH6 A;  5FD5 A;  4A2B A;  2Q2T A;  2R7Z A;  3OSN A;  4RAY A;  4ECX A;  4E9J A;  4DR4 H;  1B33 N;  3RJ0 A;  5KG0 A;  1MZB A;  5IP7 G;  4J9N A;  2PBZ A;  4O3P A;  4A3K G;  3PW0 A;  5KFL A;  2R86 A;  5DG7 A;  3T5H A;  3GTO A;  4O3Q A;  3KHL A;  4OCH A;  2JA6 G;  3PW4 A;  2VA3 A;  4AQY H;  1S10 A;  2NVY A;  2C28 A;  1RK6 A;  3M9M B;  4JI5 H;  5LYJ F;  3GV8 B;  2FLP A;  3SB1 A;  2W70 A;  1B6R A;  4F50 A;  1I6U A;  4BA2 I;  1S9F A;  1JDE A;  1JXL A;  4O3R A;  3GIQ A;  3KXY T;  2W9C A;  4ECS A;  2UUB H;  2UXD H;  1M6V A;  5LMU H;  1DT4 A;  2CTK A;  5IYZ F;  2FJZ A;  4ZOL F;  4HQ6 A;  3RV4 A;  1I94 H;  4ED6 A;  1PQX A;  5KFF A;  2ASL A;  2R7M A;  5FD6 A;  4YQW A;  3L4J A;  5KFA A;  1BXR A;  3NGD A;  3G6X A;  4HYK A;  2HH2 A;  3V6H A;  4A3M G;  2ZM6 H;  2JEJ A;  3HXL A;  1EUD B;  4IHJ F;  4DV5 H;  2XCL A;  5KX5 F;  5KFV A;  4BBR G;  3Q8R B;  2VQE H;  3T1H H;  2CW7 A;  3H4B A;  4DR3 H;  3GTG A;  2BQR A;  2GLT A;  4M7E A;  5KG6 A;  4ED0 A;  3AYH B;  1N48 A;  4IFD G;  5EZY F;  4YY3 H;  2C00 A;  5DGA A;  2Y3M A;  3FAU A;  4BY1 G;  2DWC A;  1ZTG A;  2WYO A;  4WBN F;  2JEF A;  4LSX A;  3U9S A;  4NZT M;  5I47 A;  1KJI A;  3M9O B;  1SYX B;  1EUC B;  1TAE A;  2PMZ E;  3K5H A;  3M4I A;  3GKU A;  3MJF A;  4YAJ B;  4O3N A;  5KFE A;  3M9N B;  4LFC H;  4RAZ A;  4JUZ A;  2B63 A;  4ECZ A;  4DR5 H;  3KHG A;  2ZDH A;  1TWC A;  2R8G A;  3ETH A;  4QMF B;  3GIM A;  2R6F A;  4JYA H;  3N44 B;  2E2H A;  5C1O A;  1E4F T;  2YYA A;  3FMA A;  2HGS A;  4EC5 A;  1CQI B;  3OSP A;  5KG3 A;  1J5E H;  4FBT A;  3QZ7 A;  3KDG A;  3J7A K;  1V9P A;  1ZHS A;  2VR1 A;  2OLS A;  4IR1 A;  4DL2 A;  1PX2 A;  2VPQ A;  1KEE A;  4FS1 A;  3PW5 A;  3J81 W;  3BJY A;  4O3S A;  4JV5 H;  5LXT F;  3I4N G;  5LP6 F;  2YW2 A;  2JZX A;  2FE3 A;  2JA5 A;  5KFN A;  1M0T A;  2OPU A;  3MWD A;  4JI0 H;  3SE7 A;  1ZZI A;  2A1S A;  4DV4 H;  3QFF A;  4M9U A;  3GTP A;  1UC9 A;  4JI2 H;  3Q8S B;  1I7N A;  1K1G A;  2C35 B;  3PN1 A;  1RJP A;  4MV6 A;  1EC6 A;  5D1P A;  1X4M A;  2RF4 A;  1HR0 H;  2QK4 A;  5LOV F;  4DL5 A;  4OD6 A;  3OHA A;  2FLL A;  2P0A A;  3Q1K A;  4RNM A;  4H8A A;  1ZET A;  1EZ1 A;  2G8Y A;  3BA9 A;  2JA8 G;  1VBI A;  4TQR A;  5LA6 F;  3KAL A;  3UFX B;  2V58 A;  4JV0 A;  1T36 A;  4ECQ A;  4FU0 A;  4RNO A;  4U7C A;  2WDT A;  1UC8 A;  5JVL A;  2XC9 A;  4MA0 A;  2YZN A;  3IG0 A;  4R7R A;  1S97 A;  2VA2 A;  3GQC A;  2E2I A;  5KG4 A;  2PMZ A;  2YL2 A;  4DV6 H;  5J2U F;  4MV4 A;  4YR0 A;  2YS7 A;  3K3V A;  2X06 A;  4JVH A;  3LP8 A;  1HNW H;  1M0W A;  5D1O A;  5EWF A;  3G6Y A;  2CTJ A;  1WTJ A;  3EPI A;  1CS0 A;  4QW8 A;  2W9B B;  5KFH A;  1ODH A;  3MFH A;  2XD4 A;  4J9K A;  1M7J A;  2PVP A;  5CA0 F;  2AGO A;  4EBC A;  4B3M H;  5C8Y F;  5DT9 A;  5HBR B;  2LRR A;  2F4V H;  1N32 H;  3VKE A;  1GSA A;  2R93 A;  1TUA A;  4I4T F;  4EG0 A;  1RJR A;  2FP4 B;  2NUA B;  3G6V A;  2CTF A;  2R7L A;  4MV9 A;  3WNZ A;  2FFM A;  5C1P A;  2VQD A;  4ED8 A;  2Q2U A;  4LH7 A;  2R92 A;  1TA8 A;  5CAE B;  5KFO A;  2R8J A;  4CC6 A;  4ECY A;  4PWQ A;  5D8D A;  4YR2 A;  4OO1 G;  1K1S A;  4MTE A;  2W8L A;  5IWA H;  5EOY A;  2OH2 A;  4MTD A;  2CTE A;  3HOW G;  1HNX H;  1KJQ A;  2YRW A;  3GID A;  1KC7 A;  1WVN A;  2FPP B;  1AUX A;  4APM A;  2DGR A;  3BQ1 A;  4J9O A;  2JEG A;  2JA7 A;  2CW8 A;  2JEB I;  1ZHQ A;  3RUP A;  5KT7 A;  1FJG H;  2WAQ A;  1SEI A;  2W6M A;  2W6P A;  3Q8P B;  4JI7 H;  3RB0 A;  4DV3 H;  3J80 W;  5EWG A;  2RGR A;  3BA8 A;  3H0G A;  1VAJ A;  3K3P A;  3KHR A;  1ULZ A;  2D9I A;  2UXB H;  3RAX A;  2SCU B;  1S0O A;  1W96 A;  3HKZ E;  3VPC A;  2WTF A;  5L1L A;  2AXY A;  3JRW A;  4LF8 H;  5C0X G;  4DV2 H;  1GO3 E;  3I4M G;  3QD7 X;  1WHR A;  5F9N A;  5DQH A;  2C22 A;  4J9S A;  3F8N A;  2W6O A;  2W6N A;  2IMW P;  3V6J A;  4B3T H;  1I7L A;  4O3O A;  4AM3 A;  4A3I G;  1X9Z A;  4DR1 H;  2WE6 A;  4MA5 A;  3MR5 A;  5L1K A;  3R5X A;  4LF5 H;  3GLK A;  1S03 G;  5BPH A;  1S0N A;  2W6Q A;  2NU6 B;  4A3C G;  5K36 G;  1C3O A;  3T5K A;  3FKI G;  4NZR M;  5KT5 A;  5IP9 G;  4IAJ A;  4CC5 A;  3RV3 A;  2AQ4 A;  4FBU A;  4IZO A;  4JV1 A;  3OSS D;  4X64 H;  3FDS A;  3GII A;  4UCU A;  1BJT A;  2Z0S A;  2JEA I;  5CB4 F;  1KBL A;  4YP3 A;  4EGQ A;  1Y14 B;  1VIH A;  4X62 H;  2VOB A;  4Q45 A;  3L2P A;  1WCM G;  4E4T A;  1VKZ A;  3HKZ A;  4F4Z A;  2BQU A;  3G8C A;  3RTX A;  1GGO A;  2W7P A;  4J9Q A;  1GYF A;  5KFI A;  4ED1 A;  4RUA A;  3MFI A;  1KJ9 A;  3HB9 A;  5KFU A;  1IBM H;  4B3S H;  1E4G T;  4QWB A;  3GIL A;  4GLX A;  3ORQ A;  1P8L A;  2VKC A;  3JZI A;  3KTM A;  1KJJ A;  5KFS A;  1T3N A;  2I80 A;  5KFP A;  3EPG A;  4XYL B;  4ECU A;  3MR3 A;  1V9N A;  4XX0 B;  1B6S A;  2UVV A;  2MCT A;  1BGW A;  2OPV A;  3GIP A;  1V4Y A;  1GSO A;  4DUZ H;  4O2A F;  2V4Q A;  2J6S A;  4NLG A;  4NBQ A;  1X4N A;  3TII A;  2FKL A;  1JDB B;  4G3I A;  2BL5 A;  2M8W A;  4ECW A;  1S0M A;  4QWA A;  4LMY A;  3RF2 A;  5JUM A;  4UCV A;  2BQ3 A;  3EZJ A;  4DL3 A;  1F0X A;  1N56 A;  2E5L H;  2RDI A;  5KFZ A;  2UXC H;  3UOE A;  3R5F A;  3GV5 B;  4MV7 A;  3V4S A;  3BQ2 A;  4J9L A;  3Q8Q B;  2NN6 G;  5KFC A;  4BXX G;  2CWF A;  3PZP A;  1KJ8 A;  1RJQ A;  1X0A A;  5KFJ A;  2FPG B;  5J2T F;  4R8U A;  3GIJ A;  4QIW A;  3GTK A;  4YAK B;  3BG5 A;  4IR9 A;  4BWS C;  3LML A;  5BPF A;  3V4Z A;  5C3E G;  4LF6 H;  5IYC G;  4LF7 H;  4LF4 H;  1Y1V A;  2XCA A;  4B3R H;  2M05 A;  5FPR A;  2NU7 B;  4RZQ A;  2W8K A;  5HV6 A;  1V8C A;  4RB1 A;  2RGV A;  2YRX A;  1FVI A;  4C5C A;  4J9P A;  3KAJ A;  4ZHQ F;  3BQ0 A;  4EYI B;  2YCH A;  5KFX A;  4WAN A;  5KG5 A;  4BBS G;  2ASJ A;  2J9G A;  1DV2 A;  4ED2 A;  1ZZK A;  3GTQ A;  5C4X G;  2UVU A;  3TIG A;  5JH7 F;  4GC6 A;  1T94 A;  2JA5 G;  3BAA A;  4BA1 I;  5KFT A;  3N6X A;  3H40 A;  1J5K A;  2CZG A;  4A3F G;  1SCU B;  5FPO A;  4QIW E;  3PO3 G;  4A3E G;  3L7Z C;  1E4E B;  1CQJ B;  3N40 P;  3OUU A;  2UVW A;  4RU9 A;  5L1J A;  4RB2 C;  4JI6 H;  3PVX A;  2WB1 E;  3N43 B;  2WAQ E;  3R5H A;  4IRD A;  3LWB A;  5KG2 A;  2V59 A;  4TUY F;  1NXU A;  1Y1V G;  3JSN A;  2CPM A;  4UFZ A;  5DGB A;  4IRK A;  3OTO H;  2X0S A;  2Y0S E;  3K5I A;  4QWC A;  4A3J G;  3RBD A;  3RB4 A;  5GON F;  2FMA A;  2VQF H;  1TWG A;  3N8D A;  2QYZ A;  4YJ2 F;  4I7H A;  4EEQ A;  3PO2 G;  4A3D G;  5LMN H;  4HNT A;  4C5A A;  2HJW A;  4DV1 H;  4B8T A;  2PQU A;  5KT3 A;  4OX9 H;  1B04 A;  4JI4 H;  4QWD A;  3QZ8 A;  4ECV A;  5BR8 H;  2HVR A;  4LF9 H;  4DR2 H;  3H20 A;  4ME6 A;  2R8I A;  4IRC A;  2CKZ B;  2NU9 B;  2YU9 A;  3RGX A;  2ANN A;  2HVS A;  2CTL A;  2QND A;  4K0K H;  2DZD A;  3N42 B;  4EGJ A;  3GIK A;  4X66 H;  4AYB A;  4ETS A;  2FK2 A;  1I3Q A;  2BA0 A;  4ECT A;  1ZQ7 A;  1N33 H;  4R8U B;  2V4R A;  1WSC A;  1KHM A;  2PY9 A;  2FB9 A;  4MAM A;  4F4W A;  4A3G G;  3FKI A;  2YQR A;  4O2B F;  3BAB A;  3HOY G;  4C5B A; 
#chains in the Genus database with same CATH homology
 4Q0Y A;  3KDG A;  3J7A K;  1V9P A;  1ZHS A;  2VPS A;  3MWM A;  2HHH H;  1IBK H;  3RTX A;  4LSA A;  1GYF A;  2O03 A;  1VS0 A;  3J81 W;  4JV5 H;  2HVQ A;  2FE3 A;  1IBM H;  4B3S H;  1E4G T;  4GLX A;  4GKJ H;  1M0T A;  1P8L A;  3L4K A;  2VKC A;  4JI0 H;  4JI1 H;  1FKA H;  4NXN H;  4DV4 H;  3JSL A;  4JI2 H;  4B8C D;  1Z2P X;  1Z2O X;  2MCT A;  3PN1 A;  1BGW A;  1WH2 A;  5D1P A;  4DUZ H;  1N36 H;  3CVZ A;  3DF7 A;  1HR0 H;  4DV0 H;  4GKK H;  2XIG A;  4OD6 A;  4RB0 A;  4LFA H;  3EYY A;  2ZQE A;  4LMY A;  4FM9 A;  1X9N A;  5A2Q W;  4UCR A;  3RF2 A;  2OWO A;  4UCV A;  1XDN A;  3EZJ A;  4DV7 H;  3BA9 A;  4UCO A;  1F0X A;  3KAL A;  3GAB A;  2E5L H;  2UXC H;  3GR5 A;  2WDT A;  2O4C A;  4J0M A;  4DR7 H;  4MV7 A;  3RGZ A;  3IG0 A;  5LL6 b;  4R7R A;  1A0I A;  1IBL H;  2PT7 G;  3RIZ A;  1AN7 A;  4DV6 H;  4UCS A;  5D1O B;  3K3V A;  5D1O A;  1HNW H;  1M0W A;  2VUG A;  1XNQ H;  4DUY H;  4YHH H;  3T1Y H;  1ODH A;  4A2A A;  4X65 H;  4BWS C;  3LML A;  1Z2N X;  4LF6 H;  3OET A;  4LF7 H;  4LH6 A;  1XMO H;  3KAK A;  5FD5 A;  4B3M H;  4A2B A;  4LF4 H;  5DT9 A;  2Q2T A;  1L2Z A;  2F4V H;  4B3R H;  4E9J A;  4DR4 H;  1N32 H;  4RAY A;  5FPR A;  1MZB A;  3RJ0 A;  4RZQ A;  4RB1 A;  2RGV A;  1FVI A;  4MV9 A;  4KHP H;  1S68 A;  4UCT A;  3UQ8 A;  4OCH A;  3KAJ A;  4LH7 A;  2Q2U A;  4G08 A;  2YCH A;  4DR6 H;  1TA8 A;  3N41 B;  4AQY H;  1HNZ H;  4CC6 A;  4JI5 H;  4MTE A;  3SB1 A;  5IWA H;  5EOY A;  3KDK A;  3BAA A;  4MTD A;  3N6X A;  1HNX H;  2UU9 H;  5FPO A;  1I6U A;  3KXY T;  2UUB H;  4NXM H;  2UXD H;  3N40 P;  4APM A;  4EFE A;  5LMU H;  1ZHQ A;  2CW8 A;  4EFB A;  3JAM W;  4JI3 H;  1SEI A;  1I94 H;  1FJG H;  4JI6 H;  1XNR H;  4RB2 C;  1XMQ H;  2UUC H;  4JI7 H;  4LFB H;  3N43 B;  5FD6 A;  3L4J A;  4DV3 H;  3J80 W;  3C0F B;  2RGR A;  3BA8 A;  2ZM6 H;  2LF0 A;  3JSN A;  4UFZ A;  3HXL A;  4JI8 H;  2D9I A;  3OTO H;  2UXB H;  4DV5 H;  2KSW A;  2VQE H;  5IT9 W;  3T1H H;  2CW7 A;  4LF8 H;  4DR3 H;  4DV2 H;  2VQF H;  3QD7 X;  4M7E A;  4I7H A;  4EEQ A;  4RB3 C;  3NCV A;  3F8N A;  5LMN H;  2UUA H;  2ZJT A;  4PDB A;  4DV1 H;  4YY3 H;  4B3T H;  5FLX W;  2Y3M A;  3FAU A;  1X9Z A;  4JI4 H;  4OX9 H;  1B04 A;  4DR1 H;  5BR8 H;  2WE6 A;  2WYO A;  2HVR A;  4LF5 H;  4LSX A;  1S03 G;  4LF9 H;  4DR2 H;  3H20 A;  1DGS A;  2W57 A;  4NZR M;  2FPH X;  4NZT M;  1SYX B;  4IAJ A;  1TAE A;  3M4I A;  4CC5 A;  3RGX A;  2HVS A;  4K0K H;  4LFC H;  3N42 B;  4RAZ A;  4X66 H;  4DR5 H;  4ETS A;  3OSS D;  4X64 H;  1N33 H;  4JYA H;  4UCU A;  3N44 B;  1BJT A;  1N34 H;  1E4F T;  3FMA A;  1O75 A;  4EC5 A;  2HGS A;  3BAB A;  4X62 H;  2VOB A;  1J5E H;  3L2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...