1SELA

Crystal structure of selenosubtilisin at 2.0-angstroms resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
274
structure length
273
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of selenosubtilisin at 2.0-A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase(serine protease)
molecule keywords SELENOSUBTILISIN
total genus 88
structure length 273
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1993-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1selA00
3QFHA 4C3VA 5JXJA 5JMOA 1GCIA 1YU6A 2Z2YA 2IY9A 4KG7A 1SELA 2SICE 5I9SA 1HT3A 1SBNE 1SCAA 1T1IA 1Y34E 4KB5A 3GT4A 3H42B 2WUVA 3PRKE 2W2MA 1P7VA 1SPBS 1CNMA 1SUBA 3D43A 1WVMA 2HPZA 1YJBA 3EIFA 3DYBA 4I0WB 4MZDA 3AJ9A 4NE9A 1T1GA 1MPTA 5FFNA 2PMWB 2Z30A 1ZVKA 4K8RB 3VV3A 4CFYA 1C9JA 1YJCA 2WWTA 1SIOA 2PWBA 3P5BA 4ZARA 1GNSA 3LPDA 1PFGA 1Q5PA 1Y4DE 1BFUA 1TMGE 3DVQX 3DE7X 4OMCA 3UNXA 1TK2A 1WSDA 2W2PA 1BJRE 3WQBA 4LVNA 1EGQA 1S01A 2W2QA 4Z2AA 2V8BA 1MEEA 1LW6E 2Z56A 3A3NA 3F7MA 4JP8A 1PEKE 1C3LA 3DVRX 3DDZX 1KDVA 3F49S 2HD4A 3I37X 2ID4A 1C9NA 1Y33E 3BX1A 4HX2A 2Z2XA 1GTG1 5AMXA 3DE6X 3I30X 4OV6B 3EDYA 2XRMA 1AU9A 1ST3A 4H6VA 4GI3A 4CG0A 1R0RE 4CFZA 1TM5E 5SICE 1WMEA 2P4EA 3DE1X 3GT3A 1WMDA 1AH2A 1IAVA 5B1EA 2PYZA 3DE2X 1THMA 1NLUA 1SBHA 1UBNA 2GKOA 3QTLA 2ZWOA 1AQNA 1AVTA 2SNIE 2X8JA 2ST1A 3ZXYA 3DE0X 1YJAA 1SCJA 3LPAA 1IC6A 4H6XA 1PTKA 4KPGA 4DZTA 3PTLA 2E1PA 3EE6A 3BPSA 3GCWA 4YN3A 1SUEA 1Y9ZA 1AK9A 1R64A 1KE2A 1SIBE 2PWAA 3TI9A 2WUWE 3AFGA 1P8JA 2PRKA 1SUDA 2TECE 2PKCA 3VSBA 3VHQA 4RYDA 1BFKA 2ZRQA 3Q5GA 2SBTA 1NDQA 3F7OA 3TI7A 4DWWA 3CNQS 2X8JB 3GCXA 3ZXXA 4M1ZA 1GTJ1 1Y3CE 1SBTA 2Z2ZA 5FAXA 1SN7A 4AKSA 4B5LA 1NDUA 1Y4AE 3A3OA 1GTL1 1T1EA 1TM4E 1SCNE 4WOCA 1Y3FE 1S02A 2W2OA 3D9QX 3OSZA 4AKTA 5ARBA 1SBCA 1SUAA 5CW1A 1KE1A 5K7SA 1Y1KE 1CSEE 1VSBA 3SQOA 3T41A 3TECE 1XF1A 3CO0S 1GA1A 1Y3DE 1DUIA 4FONA 1TO2E 1SIUA 1V6CA 1AF4A 3DVSX 3HJRA 1SVNA 3I34X 3LPCA 2Z57A 1TM7E 1OYOA 1S2NA 2ZWPA 1SCDA 2WV7A 3I2YX 4H6WA 3WHIA 1KDZA 4C3UA 3DWEX 3A3PA 1SUPA 1OT5A 1GNVA 1PJ8A 1OYVA 1AV7A 1TM1E 1TM3E 1Y3BE 1ZVJA 1TO1E 2B6NA 2IXTA 2PQ2A 3AJ8A 4J94A 4LVOA 4BWGA 5JXHA 2SECE 1DBIA 3DE4X 3Q40A 1EA7A 2QTWB 1R6VA 4NE7A 1TECE 1GT91 3SICE 2Z58A 5ARCA 3VYVA 3WIVA 2XTJA 1JEAA 4HVLA 5ARDA 1BH6A 1SCBA 3DW3X 5AQEA 5AVKA 4DJ5X 3DE5X 5AVJA 2G4VA 3DW1X 1BE6A 5B1DA 1GA6A 5JXIA 2DQKA 3BGOS 5FBZA 1ST2A 1A2QA 3QMPA 3LXUX 3WIUA 1BE8A 1Y48E 2ID8A 3L1KA 1P7WA 3VTAA 4ZOQI 2W2NA 4NMXB 1GA4A 2DUJA 1SBIA 3DE3X 4WOBA 5JXGA 1SUCA 2DP4E 1WMFA 1SH7A 1V5IA 4OMDA 3VV2A 1C9MA 1KDYA
chains in the Genus database with same CATH superfamily
2VP4A 1Z73A 1PR5A 4A4DA 4BMOB 1YJQA 1CHNA 3AKCA 3UMJA 1PG5A 2FK7A 3B1WA 3UK1A 1TU3A 3VTZA 3W6UA 1T9GS 4QDUA 4F5DA 5LKRA 3VUEA 4ZO8A 2IX3A 4E70A 2BJVA 3R8CA 3I5YA 2BTQA 2VTEA 4KSBA 2H92A 1D1PA 4BLUA 2EWWA 3K1AA 5EQFA 1OAOC 4EJSC 4Y6LA 5A9SB 3OLVA 5EUCA 1GUZA 2EFHB 5SZHB 3ZOZA 4GQIA 2R6GA 2HDNB 4FD2A 1H23A 1E3EA 1ZS9A 4P7BA 4UMDA 3EFOB 4QD3A 1I7LA 3I6QA 2GAIA 4ZAVA 4CMIA 2GWRA 5JZMA 3VSAA 1S1CA 3GZNA 3U9LA 5CLFA 3ESAA 1JPVA 4I5GA 2WIKA 4GLFA 2D8AA 5I9TA 1AXEA 4IMRA 1IOZA 3TCNA 5GPBA 2GLUA 3C8HA 2RHGB 1KARA 3A4TA 1N0UA 3RGWS 2GN9A 2C2XA 4G1VA 2XPCA 2I6XA 4GKVA 1BHO1 3P97A 3CYFA 3ZR4B 2VO1A 4UFPA 4QWWA 1ECPA 2BKVA 1AH2A 3DTVA 3IVAA 4YASA 3TZLA 2PAAA 4BFCA 4ZJZA 5DJ5A 1X9IA 2IPOA 2V7QD 2Z5FA 1BCRB 1FFDA 4MGHA 1L5LA 2ZJ6A 1FL9A 2X7XA 2QPAA 1V96A 4LRQA 3T0IA 1NL3A 3V3TA 4D44A 2Q7XA 1QCCA 1EFCA 1Z0FA 2PWYA 8ABPA 4GAEA 1P7CA 1NWCA 3SLRA 3WISA 3KM0A 3UYLA 1WBDA 4WE3A 4RJLA 2XECA 4WI1A 5AI5A 4LISA 5AVRA 3RU9A 1FYXA 4IZ6A 3GLIA 5JCJD 4L0MA 1HZZC 2EFJA 3NDPA 2BN4A 3DQQA 4RTRA 4QARA 4MR9B 4NH0A 4E1BA 2DUNA 1J39A 1UOQA 2BGRA 4OQLA 3U1TA 4BMVA 2C2WA 4D9EA 3THYA 1Y4AE 4POOA 5ICEA 1M2NA 3UKDA 4IHJB 4G25A 4DNQA 1NFFA 2C4MA 4GZ6A 2JVKA 4CV1A 4UZFA 1B0UA 4FONA 3H2ZA 4BVKA 6Q21A 2V0NA 2HHCA 4KQ9A 1SGWA 4REQA 2IZ5A 1DJPA 4KUHA 4QHYA 4ZQFA 2X5KO 5J2UA 3CKMA 1Y6JA 4QEKA 1K27A 2GXQA 4LOJA 1TM1E 1QIIA 2A5GA 1DDIA 2B5WA 4JCOA 3ODPA 4PLHA 5P21A 4ERNA 4NEGA 1R16A 2WJHA 4DLTA 1ZJYA 1H8EA 3CTPA 3EUEA 4BX8A 3AF6A 4LY3A 1V1RA 4JIMA 4B3TB 4GXRA 4DIDA 2BFCB 4JDUA 1J0BA 1L5RA 4JLBA 1EFTA 4FEAA 5J4LA 4YXWD 5K01A 3E15A 1T8RA 4KLZA 3KOZA 2ZRIA 1LI4A 1R4ZA 1SO8A 2FUCA 2QQ0A 3AR8A 3GLTA 4XYEA 5FBRB 1NMZA 3NS7A 1ND5A 2BDEA 5KKCA 3ETJA 2CE2X 3IAXA 2FWBA 4YRZA 2IPAB 2OAP1 5EYPB 2VJMB 1EYZA 3L1UA 4RY0A 3ZQ6A 4B43A 4MWGA 4E5PA 1MN6A 2O0JA 4CMKA 5K0JA 1D2EA 4R16A 1JECA 3ENKA 2P9TA 1B6RA 2FRDA 2QXUA 2KB0A 4MUMA 4OHOA 1HLDA 4C4ZA 3I6ZA 1TMYA 1ZKMA 3QPUA 4JGGA 1ZITA 4JYAB 5HIIA 2WFAA 3OHPA 1WOYA 2D3TA 2IY9A 2PBZA 2WU8A 1AKTA 3NW9A 4V0NA 3PA8A 1N1DA 1SELA 3ADBA 3I5XA 4EI7A 2WJPA 1LQ2A 4C4YA 2NXCA 1NAIA 3JARA 2ZG6A 2B4QA 3DYBA 4QXMA 1L5HB 4H0FA 3T99A 5A6SA 5K0SA 3WBKA 4M83A 1NQUA 1JEJA 3A27A 4RV5A 3I6YA 1FRNA 1NHWA 4Y2XA 3N5CA 2V5AA 1TGVA 4QGFA 4BKUA 5BOSA 3QJYA 2HXSA 5DLDA 2QAGA 4WKOA 4CM4A 2FX5A 4TMFA 4RTSA 1S01A 2A78A 2J67A 2M1XA 4PQYA 1MEEA 8LDHA 1YFJA 1B41A 4F5WA 1QZUA 3BUSA 1MB2A 1MORA 2HN9A 2I2AA 1EM8B 5AVXA 4FEGA 3CZ5A 2IHZA 3MILA 4TLAA 2Q3EA 4YMWA 2H5IA 1GZ6A 2G9VA 1IEXA 2P5SA 5D6OA 4O4LA 1AU9A 1NW7A 2Y68A 3DFMA 3FLEA 4BV9A 1U3DA 2EFEB 2J3HA 4UE3S 4HLNA 5JD4A 2R0QC 2D5CA 4FB5A 3ND5A 5DI3B 1YHZA 2ACVA 4CKWB 1J0AA 1SU4A 2E85A 3F6YA 3GX1A 2RCNA 1J97A 3SJCA 1CNFA 3MJVA 3C8UA 1G1MA 3WLLA 3PLRA 1ISPA 3RWMB 2GEBA 2HU5A 3PDHA 4MWBA 5EN4A 4BC0A 3D7LA 2RI1A 4NPCA 4ZPXA 6GPBA 1E9AA 4MYHA 5IT4A 5K6TA 1LF5A 2B7BA 1T35A 3PWTA 1GV0A 4CQMD 2AV6A 2O8EB 3ZEIA 1CJCA 1IUPA 5EZSA 1Z82A 4NENB 2C3OA 4OK6A 4PWZA 2FW8A 5G3ZA 1IRIA 1N7JA 4IUYA 3KZCA 3F6SA 1M8JA 1R88A 3FR7A 3JQGB 3PIDA 1Z5OA 5ETJA 2V4MA 3UAOA 3B7PA 5DASA 4EUNA 1A1VA 3K8ZA 2VR1A 1SVSA 1NLZA 2AUNA 4NMWA 4Z9YA 4PHCA 2NM0A 2OO5C 1LVUA 1L6RA 2C9OA 2WPDA 3CB2A 2OO3A 1VSBA 2QG9A 2AB0A 1AMNA 1QANA 4GDMA 1TCAA 3RSHA 4BNXA 1AKYA 1QIFA 1EXVA 2YDXA 3ZHTA 5JNWA 3E03A 3K4QA 4C07A 3UA4A 3O2QB 1EK1A 4G0MA 1U8EA 5DM70 5LJLA 3FGNA 4R8LA 4BASA 2A9QA 1N6IA 4PCLA 1GGJA 5AT1A 4UVIA 1H05A 4Y2JA 5DE3A 3OTHA 2EKDA 3AR7A 2OPHA 4UOZA 5DX8A 1F2UA 3D6UA 4I6EA 5EP3A 4A2CA 2H7XA 1US8B 3KP1A 3VYRB 3OJLA 4N54A 1BGWA 4TWAA 2AKYA 3VYSB 1FS5A 1XCJA 3GV0A 4HTFA 4KWEA 1I7DA 2V3WA 4IIEA 4M8LA 5KYTA 3QKTA 4GQAA 1PF7E 1Y42X 4GOMD 2RGWA 5AHWA 3EXFA 4DWJA 4BPRA 1O7JA 3K5WA 4WFJA 2DOKA 2YN0A 5HWSA 3QUCA 4GI2A 1GDDA 3V4FA 3R9XB 2W6OA 3DE3X 3TJMA 1ZHHA 3IHKA 5KTRA 2ZR9A 3CJRA 2BMAA 1LPPA 5D1HA 3U61B 2ES4A 1C7EA 3Q9LA 1VBMA 2GN8A 2BTOA 1E2GA 3EVEA 4OH1A 4YQEA 3BK2A 5LVAA 1IQRA 2OBXA 1PKEA 1U9YA 1GCIA 5SY4A 3CH5A 5FORA 2CBXA 5TPWB 1KORA 3B6MA 3HRKA 4MB0A 3CNNA 1BDMA 1SB8A 2FPPB 3K30A 1O6GA 2ZI5A 4TV9B 2BHSA 5CRIA 4B35A 3W5DA 1SQ0A 3LECA 4ZRMA 3IMKA 1PRYA 1J70A 3PUHA 2Q5EA 5FNZA 1N6PA 1LTKA 4WESA 1NNI1 5AI9A 1EJ2A 3IESA 2LCFA 4R8RA 2GXAA 4FFBA 3L93A 3TW8B 2REQA 1XMXA 2J41A 3TOXA 1HDIA 2J3DA 3QF7A 3E70C 1XTJA 2C00A 4FT4A 3BSSA 1M34B 3EZ7A 1LW6E 5ERGB 5F23A 3SGLA 2O5RA 3CLUC 3L0IB 3ADCA 2H8KA 1WXXA 1JLSA 3PJRA 1JFLA 5CA0A 5AMXA 3KOYA 2W4QA 2GYWA 1JXQA 3X3HA 4ZYZA 1TPZA 4RPLA 2FP4B 1LBTA 3F5SA 4HYQA 2XCRB 4B9EA 4WVFA 4BMZA 2Z5LA 3IDFA 2JGDB 4LHVA 4PHGA 5CFQA 1XEFA 4DC9A 4TS3A 3QWAA 4RULA 3WWEA 2JFBA 4I2VA 3HDJA 1ZMBA 2DKFA 3FZEA 1ESZA 1BHSA 2SKEA 1CRZA 1KC3A 3ESBA 3G85A 1V3UA 1C30A 1D6NA 1N1MA 3MZ0A 4PSVA 3W6PA 1JLRA 1T8WA 1T5SA 1TA9A 3LVBA 4RE6A 2IYEA 3HDVA 5E9JA 2LCQA 4DA6A 2J0UB 3UBTA 2JGJA 5D3MA 1EZZA 3Q8WA 4BNVA 2JJ1A 4UXHA 2TECE 3ZKAA 4RTLA 3VHQA 3WMXA 2DWCA 1UKCA 5B7QA 2P9YA 5I3CA 3IP6A 5K8VA 4O4JA 1R8SA 3KQPA 1BW9B 1DT3A 1ZK0A 5FWYB 2W2KA 1TVKB 4Y9SA 3PCXA 5TEWA 4B3IA 1W0KD 1W6RA 4YRBA 2CHEA 4U4AA 4ZZ0A 3D9QX 2GARA 1MENA 5KJCA 1PS8A 2EKLA 1JSCA 2M1ZA 1TCCA 3CR7A 4I9UA 4C0AC 4B71A 3TLBA 3BD9A 3CUTA 2XNKA 3ZGVA 2RH9B 1M2KA 2FWAA 2DH5A 2EL9A 3OC0A 4JI5B 5DV9A 2COUA 4GS5A 2XSZD 5JECA 4AY4A 1M2OA 1XTUA 4MV8A 1JNXX 1ZR2A 2NOAA 2OECA 3QPBA 4UMVA 5CH3A 3AJ8A 1JE1A 3FSEA 5FRDA 3KLBA 3UKJA 1G8SA 1EWYA 3JQFA 5AJYA 1HE1C 3PGJA 4MW4A 3D4OA 3HZZA 4MAAA 5BV7A 16PKA 4PLGA 1BH6A 4QU5A 2YHIB 1ZM3A 1HQKA 1FC0A 4WSOA 4LE2A 4MQEB 5J63A 3BH0A 3WXMA 3ND6A 4ZV7A 1W19A 1WXEA 2AHOA 2V6FA 4UUOA 3BXFA 2J7PD 2XB2A 3WDSA 2X2PA 5DIZA 2XOXA 3C6XA 4V02A 4EKGA 4XLLA 1CD5A 3C1TA 3ROXA 2UXDB 3PPVA 3ASUA 5J2UF 1D9XA 1U3TA 4GUDA 3W34A 3WSWA 1P0QA 5DBHX 5CDUA 5JALA 1J24A 3HI6A 1D07A 2D1FA 1GQOA 3NDJA 5EKSA 4Y1FA 1A2KC 6CHYA 4DGQA 2AFVA 1KEPA 5JAOA 1MOPA 3NANA 3OLQA 4NAVA 1EGVB 1BEZA 1R5NA 1YDFA 2LRHA 3O9VA 4LJRA 1WSAA 1YTUA 4LFCB 1FFXA 1JWBB 3ZE0B 2JFVA 1RAIA 1JI0A 1TYBE 2C4HA 3AEUA 3M1LA 5CCEA 1OC4A 5IM5A 2PH5A 3PICA 2V6MA 1KETA 3LY5A 4MQUA 1LDNA 4KNYA 2EIXA 1JVBA 1QH0A 2Q99A 4P54A 4TUYF 2PGNA 2W58A 1Z15A 1M2VB 1U65A 5LA6A 1M2WA 3NV7A 1HKHA 4AROA 1V6SA 2CVFA 4HNSA 5BVGA 5FI5A 2AC4A 1WU7A 1NSTA 2HSWA 2B2XA 4UNIA 4D4LA 2BFAA 1P2TA 1DC5A 1JQJC 1N5OX 1MIOA 4MMXB 3DNFA 2GT1A 3TDMA 5E1BA 3EZ9A 4EMSA 3FHCB 2FDCA 4M37A 2EJCA 3JQ6A 1VL5A 1E4OA 1OHHA 4ER3A 5L7YA 3TMYA 2QUIA 3UO8B 5BNZA 3EWNA 5EIOA 4OREX 3KHSA 3RV4A 4AK9A 3D4NA 4LK2A 2MYTA 4AYXA 3ADOA 1GRNA 1IHUA 1XJQA 4DZZA 3RYCB 3MBOA 2GXSA 1PWHA 1O1YA 1ZJ4A 1WMDA 3JQDA 3L2OB 1NZJA 4NK4A 4WZBB 1MC4A 2FN4A 5IDYA 1CY8A 5F64A 4CMAA 3FE2A 3R6DA 4I5DA 4JXKA 2BY4A 1PAUA 1YMUA 2FMFA 2ZWOA 5ALTA 1T25A 4QBIA 5IC6A 1XVTA 2QA5A 4L8VA 2EEZA 3JQCA 4BOYA 1FYDA 4NAHA 3JZMA 1XYYA 3BA1A 4U7TB 3WLKX 2ADFA 5B37A 4YUAA 4RJ2A 4GNKA 1O95D 3GWGA 1VIYA 4NOJA 1P4SA 4UHKA 5EIAA 1ADBA 1ECBA 1EP9A 1SWVA 2DKNA 2Z8ZA 2PQMA 5EQJB 5IJAA 2XLBA 5EPEA 1GOTA 3JU3A 1T6ZA 1LSJA 4Y9DA 1B00A 1RTTA 3D64A 1CUEA 5H1YA 5AW3A 5KQGA 1BD4A 1HDOA 1Z6GA 2XMZA 1S8FA 1D5WA 3V1YA 4KXUA 4M0UA 1I4DD 1LC0A 4B47A 1PZNA 2W6ID 2Y0EA 4UUPA 1DJOA 1MG0A 1V7ZA 3BGWA 4RKYA 2PL5A 3FFTA 1XMIA 5JFTA 2PRIA 4G5OA 4QGGA 3RJ5A 3O2NA 1N75A 3GNQA 1UINA 2VDUE 4B8YA 3FF1A 1VPLA 3ED1A 1AF4A 1FZQA 2JFUA 3HHPA 4OYHA 3MT7A 5CB8A 1PW7A 1HO3A 3DPIA 1TKCA 3MB5A 4ARBA 3B48A 4QTUB 3E9EA 4C4SA 5GJVC 1L7DA 1GP2A 4X3OA 5FJIA 4ASUA 4WHMA 1TCBA 2AEJA 1VP3A 4QWMA 5HDQA 4LV8B 3QF4A 3HI4A 1VLZA 3FDXA 3NPMA 4KJXA 3QYPA 1M6WA 1YS6A 2WZCA 1KP2A 3G9QA 3UBMA 3UH0A 3DWFA 1PTJA 4XH9B 1BE6A 2WG1A 3HBNA 3OIWA 3GFPA 1U6IA 4JBXA 2VRCD 4NAUA 4R1UA 4OCZA 2B37A 5B3JA 4DIEA 4DR5B 5H81A 4F92B 1GEEA 3VO8A 2ID8A 5JSFA 1U6JA 2NADA 4PV7A 2Q5QA 2PKEA 1G5TA 3QVJA 3D3WA 4YR7A 5CBPA 1R0YA 1CQWA 4LDQA 1C9MA 2WLSA 3H9BA 4WOPA 2QL5A 1PHRA 1RZVA 2FMTA 3CN9A 4K87A 3SX4A 2R6HA 1AN0A 3GVXA 1ZRSA 2OCYC 1KVQA 4H4EA 2G4LA 3FZNA 2I4OA 3GT7A 4R68A 1SBNE 3VFDA 4ED9A 3E3OA 3KHKA 4I3HA 2LKCA 4YT8A 2JLWA 4DT1A 2VXYA 3CLVA 2ETXA 2RONA 1FS4A 2D1RA 3CUWA 1GN8A 4I0WB 4KZPA 4BO1A 4WK2B 4W63A 3BF8A 3DKPA 1J06A 1CVRA 4BB9A 2P30A 3A4VA 4FHZA 2EL7A 3HKBB 4IILA 2FN3A 4WKBA 4ZT3A 4AJOA 2OCDA 3BHIA 5LKAA 3I53A 1A8UA 1NZFA 1RAFA 4DY4A 4DJEC 1QIDA 3LLMA 4MW5A 1C3LA 1Z2PX 2CXHA 3QXXA 1X80B 1ZYUA 4GH5A 1H2WA 1ZP6A 4OTZA 3R23A 4ZU1X 2JGLA 3SEZA 4M0KA 4DCVA 1RU3A 2YHSA 3HYTA 3RSLA 4CG0A 4E2WA 4EG0A 3VAYA 1CJMA 2AR0A 5EE1A 3CRRA 1BN7A 1P5RA 1LI5A 3MAAC 4YP0A 3WL4A 4EKYA 5CDFA 4TMVA 3QUSA 4HNVA 1PJBA 1UWVA 3NC1C 3SHTA 3QKWA 3RUFA 3TAUA 5L3RA 3H8WA 1KEZA 2CLOB 4PX3A 3H7AA 1QC5B 1W2WB 1QJ4A 1Y3HA 1PLLA 2I55A 3PKIA 1PV1A 4LSMA 3IVMA 4ZTUB 1R6DA 1W25A 4LWPA 3W4IA 1QGED 2X5OA 3N2IA 1Y6RA 1CUJA 1OAKA 1VL8A 3LL7A 2PXXA 1PD1A 2DR3A 1HQDA 3D5TA 4HT3B 2JLZA 3G9TA 4WUVA 1N8KA 3PQ5A 5FIUA 5F9FA 2PCJA 3GCXA 4RZIA 5TGDA 1DOZA 4JMLA 1O2DA 2GM3A 2XJ4A 3ACDA 3TDKA 4NCKA 3PD7A 2FW7A 4Y0AA 2X15A 3S44A 3UTDA 4E12A 1LCIA 3ICQB 1DQZA 3NG1A 1A0OA 5HILA 2JIZD 2FDRA 2RI0A 1ZNXA 2GFQA 3UB2A 1F1BA 2Y0CA 4XB1A 2PKYX 4EABA 3ILXA 4O2AA 3HJGA 2JAWA 4PAMA 2INGX 4RGQA 5KJ6A 2BGWA 3ANXA 1JSRA 1NNUA 3HJRA 1HC7A 3EAQA 5BSMA 4NKRA 1UKVY 4YRDA 4DQUA 4EEZA 2C4KA 1HSZA 5DHFA 3AR3A 4EYQA 1RI3A 1U7UA 2JA2A 2QQFA 3OCVA 2PV0A 4Q0MA 4OHMA 3WIUA 2NSHA 4J0DA 4AG6A 1I7NA 1XXLA 3CLTD 3PFWO 2XB6A 4BLVA 5CFNA 2LNDA 3Q5EA 3V97A 1Z0AA 3DOFA 3QU5A 4IF4A 3VO1A 4N1AA 3ITDA 3E6AA 3NBZC 2R8ZA 4QVKA 2ACWA 3QVUA 3WYCA 2PGDA 3M89A 1VJGA 3DEZA 3T1OA 1Z63A 3DW1X 2HNBA 1Q0SA 4RENA 1SXJD 3K0FA 3ME5A 1GR0A 3LLUA 3QPAA 3PNSA 1E62A 3LUHA 4OJTA 4QO8A 1SOWA 3THSA 4ZVSA 5BMVA 4W5WA 5ITVA 3PNVA 3R3JA 4P7KA 1B42A 3NHWA 4I55A 2YMLA 4ZO9A 3QMWA 1VE3A 2PLRA 2IUTA 1E6MA 5JC1A 4EZBA 5ALHA 4H2DA 1BX3A 2PNFA 3EXHA 3NIBA 3MRXA 4RGYA 4ILEA 3W2FA 4C2BA 3PL5A 4DIOA 1P2FA 1PVOA 4L08A 1Z38A 2D4AA 3GJ7A 1I2AA 3HKCA 2R1VA 3MG9A 1JHVA 4ZI7B 4F84A 4IWYA 4RMGA 3JQPA 1KQOA 3BJRA 4FDMA 4QAQA 3W2HA 3RODA 4D4HA 3OO1A 2CJXA 3O3OB 5J1TB 5DOZA 4WIAA 4C7JA 2XDQA 4UTRA 5LOVB 2X22A 1NG9A 3PE4A 4DJFC 1TYZA 4LPKA 5AXCA 2VJPA 5DRTA 4B4WA 4EFDA 4XPIB 1S9HA 1W73A 2VJCA 3TQIA 2JLXA 4MWZA 3TCXB 1T8TA 4XD7D 4AY5A 1MG5A 2EV9A 1MPXA 1PGOA 1ZUNB 2DG2A 2GHRA 1P1FA 3R7FA 5F7ZA 5FYDA 4ZVTA 4AUMA 3V4ZA 3QBDA 1NY5A 2VYVA 4Q47A 5AFSA 4DV7B 3FTQA 2YZMA 3HNOA 3E7PA 2WIBA 4OQMA 4V03A 1Y1SA 2Q6VA 4QJ4A 5EP1A 2IYVA 3OU2A 5B36A 3M5PA 3HM9A 3B82A 4N3CA 3LO8A 4WNCA 5CIQA 2PL1A 2WE7A 1Y4ZA 1FFYA 3LT5A 4Q6WA 1K9VF 4OG2A 4RK0A 3HKEA 4RWZA 1LDMA 2H4WA 2NAFA 4FNAA 3K35A 2NLOA 2YJ5A 1TO6A 2W6JD 2XYQA 1W85A 4L5YA 3DEFA 4NDZA 5BN5B 5KVQA 2H06A 4R81A 5LZ8A 5B4UA 4B3SB 4D96A 3HBMA 3P1JA 3QX9A 4K9RA 4X6XA 5C8XA 1HTBA 1NQXA 2B9VA 1G66A 2CLDX 2RFLA 4QUGA 3ZDYB 3FOEC 1XTSA 2X77A 4OFZA 1CJTC 1M1YB 1UKZA 3E81A 4FMCB 1FNMA 4HNAA 2K87A 1F8UA 1VLQA 2XMRA 3TE7A 1SZPA 3L1HA 3Q87B 4KI7A 1TUBA 4LJLA 3VSCA 1GLNA 3DAHA 1SQFA 2D1SA 3GRVA 1BEEA 3C7CB 3EUFA 3E4CA 5LZ9A 1Z5WA 2NO6A 1T9CA 3I2KA 4QEDA 2YXPX 3KOXA 1KO8A 3OX2A 3NC0C 4MUGA 1E1QA 3KEGA 2RGNC 1LZKA 1PR2A 3Q85A 1HORA 2C5BA 3DDUA 1ZOSA 2ZSHA 1GZ7A 1LPNA 5C0OE 4EKDA 3UPTA 5C53B 2FG6C 3NTVA 5G4KA 3KKMA 2V45A 5J4HA 1P3JA 1E9FA 4PBSA 2GXUA 1PLKA 4HWRA 2FXIA 2J5XA 1TFRA 3P9NA 2VNAA 1WEHA 4RELA 5C3MA 2ZUEA 3N0XA 2IQ5A 3KLMX 3GCDA 4BAUA 3GT0A 1IXRC 1J8MF 1WXQA 1PNTA 1NYQA 2QZ9A 2AUMA 3M8KA 2B78A 3EGVA 1GADO 1WJGA 1N5KA 2QEQA 4Y2TA 2GM5A 4RQAA 1ILEA 1PJ2A 2CMDA 4LCJA 3I1YA 4P58A 2Z98A 4RC9A 4F56A 1L4MA 1UMCA 4ESEA 3TLYA 3K4PA 1R8XA 4KR6A 4V3BA 1C0KA 3S2IA 4FYHA 3WFIA 5DHQA 2HLPA 1RRMA 2VPQA 4U6QA 4M98A 4GM1A 4RKEA 3NXSA 1E3QA 2NSLA 1DDOA 3KSMA 2QMUA 2A6PA 1E1CB 4WZZA 4OP1A 1CEYA 5LIRA 1ENOA 2CDNA 4DHWA 3MAJA 1DAGA 1BU8A 2VWHA 1P7PA 4GM0A 3K9WA 2OZKA 1U63A 4EM6A 3A9UA 4U5QA 2YOHA 2RCYA 1Z2NX 2HBZA 4C5AA 4C20A 4RV9A 1JKIA 5ALLA 3I58A 2C2GA 2NV0A 4HAZA 1H66A 4JQSA 1U7DA 4JVSB 1RJDA 3OIGA 2PMCA 1FSSA 1T9BA 4FDTA 4U02A 2H2AA 4W7SA 4E30A 3W8DA 2OGTA 4KFTA 3VVLA 2GM4A 3TSYA 1AURA 1VZ2A 3BH7A 4P4SA 4C2TA 1VE1A 2W2QA 1NN0A 4QQ8A 4Q1EA 4BQNA 1E2KA 2OM2A 4IXWA 4RD1A 2Z5VA 4S35A 3TXYA 1STOA 1Y33E 1DKRA 2HHJA 3CUEF 4MW9A 4CYMA 4P33A 4RTKA 4CNBA 2HRDA 3PEYA 4MCJA 4BJ3A 1PV2A 1C7QA 3S55A 2X1LA 1BXKA 4YO7A 4KNWA 1JKFA 5HZMA 3G8YA 4ZI2A 3DEJA 4ZYTA 2ZUVA 1KSJA 4EECA 2DCUA 3CW2A 2RG1A 4IJ6A 1XZBA 4HADA 4H3HB 4D4IA 2O7RA 2WDZA 2OUIA 1W1IA 2C98A 1PYGA 3L1IA 4IOMA 4BMXA 3IVCA 3PU6A 4TSFD 4AFNA 1FVHA 2JI7A 4XVCA 1EWTA 4PZLA 5EJ9A 4ETWA 2FPOA 3WLPA 4DMFA 4ZOLB 5EKXA 2O3SA 3RK0A 4A1OA 5A5FA 5C5EA 3E53A 1JSLA 3RU3A 1KQFA 1S6YA 1O8BA 3CLRC 3HVHA 3MMSA 3U4IA 3DD1A 3EQ6A 4LJ9A 1JDSA 3L7IA 2YV5A 4TQGA 5EHIA 3RAPR 2C99A 2I2XB 4Q39A 2V59A 2ZSAA 9LDTA 4H1WA 1CQZA 1GVHA 2DJ5A 4ROSA 4QPPA 3GYGA 4B0PA 2EZ8A 2PD6A 1Y3CE 5CM8B 1EB9A 5LL6P 5LYJB 1UPCA 3NIFB 4IIJA 1A9QA 2C57A 2GEVA 4K6KA 1P60A 4AKHA 1JSZA 2XI4A 4LSZA 3H4IA 1E9CA 4KQMA 2ZSKA 1A8SA 1IBMB 5IAOA 4M49A 4EG7A 5JS7A 4LQ4A 1Q0UA 3ZCTA 3TAXA 2I9KA 1QZTA 3EVCA 3EDQA 3X1KA 5AKXA 4U3JA 1URPA 4FYIA 1ONOA 4OBEA 2EGUA 3SXJA 4EW1A 3FDFA 4P53A 3IKMB 1KDZA 2FH5B 1J2YA 5KNCD 2HTFA 2DM6A 2JK0A 1GGNA 3IMEA 4ND8A 4A0RA 2QJRA 4P4TA 1QPBA 3NV9A 4TXNA 4W5QA 2O8DA 3IBTA 4M9UA 4NYMR 1L4NA 3EIOA 3FAZA 4R3NA 2X4DA 4I1PA 1QCZA 1AC5A 2YJGA 3GBPA 3UJ8A 4AZ0B 3G2KA 3BAZA 4RHFA 2QYTA 2DXIA 3AVYA 2ZE8A 2Q4OA 5JTTA 3INGA 5IMSA 4KR7A 4L0DA 3OURA 2CLEB 3ZJTA 1QPGA 4RCVA 4FKMA 4EZEA 1Y4SA 3CH4B 4PWYA 2VTBB 4HN9A 3MOIA 2O3UA 4EW6A 4IIBA 3F2VA 5HS6A 1UM8A 4DBLE 4D9CA 3ZW7A 1BU5A 4W5HA 1C1DB 1WG8A 4UDXX 4O4IB 4Q1DA 3B3FA 5KU1A 3VJKA 3KL4A 4K26A 1F8XA 3G02A 1Z8DA 2WAMA 3HRHA 1QG2A 3KFXA 5FL3A 2FPKA 2P2GA 2YZNA 1CDZA 1XT6A 3JALA 5BSEA 5FNVA 1TYDE 3C6MA 3OTIA 1SUBA 3QYJA 2ZJ3A 2OAQ1 4IDCA 5EE5B 5FTMA 1KVTA 5G1OA 4ZOBA 4U9HS 3LAWA 2IS1A 2Q46A 3LC7O 3KCNA 1CQJA 1SVUA 4CFYA 3ADKA 3G0GA 1UOPA 4ZO7A 1XVVA 4O4IA 5DTJA 2MR6A 3LNCA 4N5DA 1J4AA 1DLIA 2DULA 3A1CA 3RAFC 1V2GA 4C4OA 4DA8A 1PL8A 3SVLA 1JR4A 2M9MA 2OZPA 4BX9A 2WSIA 4G8BA 3SVZA 4RHXA 2Q9CA 3STHA 1SD1A 2HWYA 5BN3B 1LX7A 3RSCA 3TTYA 4AQ7A 1OR8A 2HD4A 1LTHR 1YGPA 1P3DA 1IU9A 4NDNE 3PXBA 1CRLA 4XCXA 1RKBA 1ECLA 4XTCS 2OFWA 3TTTA 1ZSYA 4GDFA 2FB9A 4AZ0A 2O7VA 4L8FA 1HNZB 1FUYB 1P6XA 2JKYA 3BRCA 1VE9A 4MWTA 2GZRA 2J59A 3EQ9A 3Q6IA 4RTJA 1RM5A 5BSHA 4RMJA 4YIHA 5TQ0A 2HRBA 3MEQA 3B5IA 5GZ6A 4ND8B 1P4AA 1UBNA 1YOBA 2FLKA 4BTVA 3NWJA 3M82A 3W7VA 2IU3A 3I3SR 4LXYA 3C6QA 3CBGA 3SC2B 3I0ZA 2WM3A 4JYMA 3FWHA 1MMFB 3BPSA 2IWHA 2O2DA 5FBKA 4NBVA 1ZJ6A 1JS1X 4Q34A 4IWXA 1GPWB 4LYAA 4L6AA 2PKQO 3MWEA 4HYEA 4XWYA 5HQJA 3V4VB 2IYZA 1XU4A 1KNXA 3DBHB 3ESYA 1GKUB 1AHIA 1P31A 1WCIA 3T3EA 3K0HA 4NX2A 5BWLA 2WOJA 3CX3A 2VKQA 2WKQA 4JASB 3B12A 5IAAA 3NNDA 2O2GA 4M1MA 5JYBA 2FMUA 1RP1A 4GLLA 4K5QA 2RKWA 4KYUA 2H4JA 3E82A 2QN3A 4RXTA 4PRKA 4HLUC 5DLQC 2PS3A 4G3XA 3GARA 4URYR 3U9SA 3HFGA 1OTYA 1WCYA 5D7NA 1I7PA 3T7RA 2CD9A 4DUGD 3L4JA 4X7BA 2OB1A 2GEJA 1CETA 3H0CA 2IY7A 1NNSA 5HRAA 2HLDA 4MR8B 4WK4B 4MVJA 1S2NA 4HSEA 5JAPA 4NV1A 3PR1A 3UT6A 2IH4A 3UMGA 1W4ZA 1GNVA 3KXDA 3L6CA 3AHJA 3FPHA 2BZGA 1B8OA 1UC5B 4D3DA 1MDBA 3KZKA 4JI7B 2B35A 3HP4A 3K0EA 2GLTA 3DT6A 1M1ZA 5ARCA 3NTRA 4HVLA 2HEIA 5D85A 2JANA 1O8CA 3F9RA 4F3RA 4IVQA 4BVAA 1MJGA 3KIPA 2A5JA 3QU9A 2XIQA 4G4GA 4JBLA 4XYBA 1A82A 3JVIA 5CEEA 4WN9A 2HK7A 1ZOOA 2JGIA 1LLUA 2Z08A 1O9HA 3LXUX 1L1FA 4CVNA 4E03A 4BO3A 1CR4A 1P61B 4PFQA 3MGGA 1K5GA 1JQAA 2X9VA 5DO9A 4RJKA 5I47A 1UXHA 2I99A 2IITA 2AHRA 1EUDB 1UDAA 4IYRA 4KQ6A 1UAGA 3YASA 4IAOA 1TA0A 3NBKA 3JRXA 4GM4A 4E2FA 2RGEA 4ZZ3A 1FQJA 1KS9A 2PH7A 2XQKA 2VZ9A 4N4AA 3CEPB 3JD4A 4MPDA 1MDFA 2C2OA 3GP5A 4RD4A 5IHXA 1JIXA 5DCWA 3AO0B 4Y8VA 3BWYA 4Q7KA 1FVFA 3UH1A 1PR3A 3Q7EA 4NYIQ 2C5GA 5DN6D 3N07A 3KE9A 2G80A 1XZGA 5IK2A 3UA3A 1YIAA 3C3DA 4XYGA 3G7UA 4R9UC 4V0MA 1P33A 1BJRE 3B6ZA 2VT2A 1UBSB 4QECA 2N1MA 1Z2EA 3NHAA 1LWNA 1UIRA 3P2IA 3CEAA 3PCRB 4OQYA 1K75A 2ZYHA 3JWPA 3L4EA 1YB2A 2O7SA 4UNPA 3TSAA 4J90A 3VGJA 1U8XX 5TMPA 2QX9A 1HPLA 3ABZA 3MQ2A 2QAGC 2Z2XA 1X92A 4QTYA 5IKXA 1KZ1A 2HAEA 5IABA 4GPIB 3EDYA 3Q7RA 4RMNA 2R96A 4DSTA 1VHWA 3LOPA 2GK6A 4K2HA 3KJEA 4LTNA 3R3SA 5H80A 3KALA 2A9PA 3L8FA 1IAVA 2P0EA 4MUEA 4DNFA 1P74A 2VUIB 3PC8A 3IV9A 3P71T 3WB2A 2W6ZA 2C5FA 4P3XA 3SBOA 2GMWA 2VLBA 4U7JA 4MHOA 4CGZA 3TH5A 2QSJA 3EVTA 1O4WA 3E0QA 4CQLA 4UBLA 3P32A 5IF3A 4WPGA 4EW2A 3U40A 1D1TA 1MRSA 4QICA 5JDCC 3MWLA 1A7JA 1HOTA 4C4RA 3R7DA 3P9ZA 5JI2E 3OPYB 1JFRA 2QJOA 4TXHA 1QH1B 3HU2A 3OFVA 1V35A 1F7VA 2FN9A 4MYTA 5CLLA 3H19A 4Q1BA 4YFVA 2R68A 3FA2A 2XUPA 3HZHA 4P3PA 2MWMA 3A6GA 5BT9A 2GD0A 2IYXA 1G4HA 1WHSB 2BKAA 4KN9S 4PZPA 5IYZF 4PLCA 3IRUA 2WJJA 5CW1A 1JG2A 4HOYA 2OHVA 4UATA 1RMTA 1FLAA 3AJRA 3ZZTA 5NULA 5BUQA 3Q3CA 2ZOSA 1ZQ1A 4P1ZA 1V8OA 4Q3BA 4DVJA 1A77A 1E5XA 1TM7E 2Z57A 2CKDA 2DE0X 4X0EA 4ZEWA 3K53A 1YXMA 5EQTA 2YR0A 4PLZA 1P4JA 1XLWA 2X0KA 4NDAA 1YL6A 2PQ2A 1P5HA 1I7QB 1GR1A 3BCUA 4PRYA 2QX6A 4KO8A 2KMLA 3H1AA 3STWA 3WZLA 2GJ8A 2FSGA 3ENZA 3QEBZ 1G2PA 4DG8A 1N8TA 3RT9A 3QVMA 4DWVA 4NSNA 1OJ7A 5KWSA 2VSOA 4Z1OA 5LWQA 3LDFA 4BO9A 3GF4A 3UMVA 1JDBC 1JKXA 5AI8A 3FCOA 4JI0B 3KJZA 2Q3HA 1KAGA 3NWPA 2NT4A 2RD2A 4JSTA 4M7WA 2A0WA 4MIEA 1MEJA 1VKNA 4MPRA 4V2IA 4XGRA 1DRVA 4ZEXA 2JCXA 2R9VA 2XAAA 3CG4A 3OLXA 1E3SA 4CPDA 4DCMA 4JI8B 4Z99A 1U0TA 2WUGA 2CZQA 2R00A 4FJ1A 4G4IA 3ZV6A 3P26A 2A0UA 4YAIA 4ZTZB 1YS7A 4XPIA 3LA6A 4C76A 1QB7A 5J4VA 2VCHA 4QPNA 1PFVA 3KU1A 3MK31 3OLWA 4M7RA 2XDQB 3MW8A 4BQOA 1E64A 2RGAA 2RKOA 1WB5A 1IBCA 1V7QA 5K3EA 3WFJA 4OXNA 1CR6A 1T1IA 2FK8A 1CUYA 1VI6A 1OXKB 4R1NA 4FVTA 2C83A 3LBAA 4GX0A 5G1PA 3D7RA 1K2WA 4IOLA 4MPTA 3ILSA 3NIWA 1DTSA 1EK6A 4AX4A 1SJ9A 1SRQA 3DBLB 5E8JA 1VBNA 3TQSA 4XJTA 1MJNA 1C9JA 1T6BY 1U2QA 3D4LA 1OQAA 4XASA 2YYZA 3WSVA 5D01A 3SFZA 3GJZA 4LNHA 5BMVB 2RK3A 1ZCZA 1T9GR 2C5HA 5E1MA 3AEYA 3DHNA 2H5LA 4G9GA 3JQ8A 3F7MA 3CE9A 3SDSA 3WE7A 3PNYA 4A2WA 1X7HA 1RE0A 2D7CA 2FZEA 3CINA 3Q10A 3PWSA 1KIMA 2E49A 1COZA 3KR9A 4A6XA 1UKBA 1XTBA 2CHUA 2GF9A 1BMTA 1MJ5A 3R6WA 2PIAA 2GPTA 1TD9A 4G5QA 3GVHA 2JI9A 2PQ6A 2QMQA 5AHOA 3X1WA 4JMPA 5K0ZA 3LRPA 1C3EA 4L4UA 3V1KA 2JIOA 3WNCA 3CSDA 3OT1A 1UQTA 4EFLA 1Z8FA 2IS2A 2XJ9A 1R9GA 3AIIA 1ID1A 1ODCA 3T5MA 1C3JA 4Y7DA 1DOAA 3EEFA 4LFAB 1WE2A 5KNDH 1JTVA 1BQ3A 3O26A 4NIMA 2NZ2A 4HDKB 4OHVA 4R8MA 5AVWA 1Y9JA 2R6CA 1DI0A 3PJEA 4HLDA 4B74A 1L5SA 1W94A 2B0CA 2Z2JA 4II2A 3F3SA 1M1XB 1MX3A 2CMFA 2IEBA 3AB8A 4QFDA 4UPDA 1IIRA 4M6WB 1ZGJA 4PLTA 3TX2A 4WFQA 3E27A 3LVFO 2YJTD 4ZC8A 4RACA 2I1WA 1ZUIA 4UNSA 3AF2A 1E7WA 1T43A 1OE0A 3AIKA 2QTHA 3SQOA 2OFXA 4KX3A 2Z4RA 1K5DA 5DM0A 2HCTA 2G08A 4G0QA 2HF2A 3RIHA 3UHOA 1NATA 4INZA 1DELA 2X3UA 1E8MA 3FMFA 4Y30A 2NUTA 3UT0A 4AWBA 1EFAA 3AYZB 1TM3E 4ALLA 3AILA 3CLUD 4AJ9A 1K8ZB 1PW5A 1DBVO 1KI8A 3GLFA 3UT5B 4X85A 1EAMA 2OP1A 3IJRA 4MTCA 2HR1A 1FUIA 3ZGLA 1EQAA 4B83A 4EG8A 4CM8B 3AZPA 2KJQA 2W2TA 3NFRA 3HA5A 1KBZA 1OFTA 4KE8A 3O21A 1K7EB 3Q41A 2ZKIA 1X80A 3M2TA 3QU4A 1VIMA 3GFFA 3QVVA 1FRVA 2WF8A 4RKQA 3UMSA 2FSHA 5LYJF 3M34A 3KPYA 2B1QA 3N0VA 2YZ2A 3B20A 2FPSA 3OVMA 1XN1A 3ZI7A 4LK3A 3DV0B 4OSPA 3D7NA 5LPNA 3OZ7A 2FVYA 3BGDA 4F6LA 2RGRA 5F7JA 4Z4EA 3PHLA 4YHHB 1V5IA 1A4XA 3VV2A 1EDBA 3O4FA 4QT0A 4NBLA 1DZ3A 3C7TA 1TJ5A 3WAJA 3L0PA 2KS6A 3BF7A 4UNNA 4UOEA 5BN4A 5ICGA 3VR1A 3IBFA 3A25A 4OGGA 1WDWB 4QHTA 1FNBA 2FQ1A 2DVMA 4DT1B 5JDIC 1KZGB 1G17A 1RHMA 3L6OO 2H54A 5DN9A 2AZTA 5BN4B 2WYOA 4LXHA 5DFAA 2XUJA 3C7KA 1IY0A 3REQB 5KKNB 3FPGA 1GKKA 6AT1A 3QFRA 4PAWA 4D4JA 2XGGA 1SC3A 2IYSA 2ZJ1A 2HCBA 2XZLA 2WKSA 2JF0A 2XIJA 3I9NA 4O2BB 5CDHA 4Q9NA 1OWMA 3WLMA 2G83A 4PZ0A 4HPXB 1MT0A 1N0HA 1ZIDA 2R5WA 3O9ZA 4O25A 1L4LA 2Y6VA 1QSGA 3JZDA 3EPPA 3MTBA 4IDPA 4XIYA 1JLHA 2HRQA 3S1AA 3W2TA 1WB9A 2A9KA 2B8NA 2B8EA 3FPCA 1B93A 2VOJA 3HCFA 3QJGA 4JEUA 4C5BA 3DB1A 1W9MA 2IDKA 2WA2A 4KN8A 4HAUA 1L8QA 3CG0A 3RFTA 3SP1A 1GTSA 5HW0A 1ODSA 1NURA 3WWPA 4NCAA 1SVOA 5ICCA 3HXOA 5DBEX 1H85A 3VR0A 4QYSA 3HUDA 5DN6A 5EFZA 1QS0B 3N86A 2YCBA 2JEYA 2WJ6A 1ESMA 4G0XA 4K3UA 2O9JA 4ZPJA 2VJKA 2ZBUA 4LDAA 3IIIA 3FKSA 3BHJA 1H8HD 2HA3A 3R5HA 4JGBA 3K1TA 3K2EA 3DZHA 4KGXA 5CVCA 3HK2A 1RI5A 3TCKA 3MQFA 4YT5A 2R84A 2GBFA 4NHOA 5IC4A 1QGUB 2XB4A 3G6KA 1U1DA 5LFAA 2Y8EA 1HKUA 2G3YA 1YRQA 3WP1B 4BFLA 3O4HA 4RZUA 2H1RA 2Q07A 5MN5A 2F43B 2ECQA 4R98A 2PUEA 1IHPA 1NY6A 5IN5A 4E4RA 1N7HA 1P17A 3VZCA 4H0CA 1Z0DA 3NQ41 3AG6A 2G76A 3LLSA 1GPAA 3PP8A 4M0LA 3TM5A 3WL6A 5AUPB 3OTOB 3AKYA 1VKRA 2X3FA 4DCPA 3RDPA 1XTRA 2Q1SA 4OLHA 3U44B 3UN1A 3SS9X 1LFAA 2QAIA 4Y2GA 5FOTA 5CJJA 1NI4A 5AK0A 2G0TA 2WRZA 4MPPA 5CYPA 2OD2A 2PG3A 3QTBA 1O0SA 1AKQA 4JJ7A 1N4DA 1Z29A 3DSRA 3IPCA 4G97A 1IXSB 3CW8X 4CG3A 3OM9A 1OZAA 3UJBA 1T9KA 4LF9B 4PM4A 5LQKA 4D45A 2C7OA 1Y1TA 1ZN8A 3NP7A 3RYCA 4CHGA 1YQ9A 1JG3A 3VNAA 3TUZC 2PL3A 4DAOA 3WRYA 3H5IA 5D5HA 1DKPA 1WKCA 1XRQA 3AEZA 3EW7A 4CLOB 4DDMA 621PA 3OF5A 1XFDA 5G3YA 3WBFA 5IRCD 3GPIA 1L6IA 1ODLA 5GM2A 4XWOA 4D46A 1E69A 1CJBA 2HPAA 3UQZA 4MWSA 4R7TA 2NO5A 2ZBPA 1SVLA 3WKEA 2ZSJA 2XE8A 3VSEA 2AOWA 2PRSA 4MV1A 1IUKA 2WSSD 2YMMA 1VQ1A 4N9WA 1XWFA 3OEEA 3WDMA 3PFKA 3N58A 1SCAA 3IAFA 4U7FA 2O0MA 2C58A 2XQJA 2B83A 5I48A 3QE9Y 2ATCA 5AW6A 1Q83A 3QNWA 3W8FA 4ZMBA 1NDHA 1X15A 4KQCA 4RFLA 1RCUA 4XGKA 3T7TA 1Z74A 3CVOA 3UJCA 5ALJA 3FUWA 2ZBRA 3IRVA 4G63A 5F7XA 4KR2A 4FOSA 3UV6A 1WOMA 3D6TB 3UTCA 4DSZA 4ZHQF 2EQBA 3SHQA 2WWIA 3ZVLA 3NI2A 5EWMB 4K1LA 5H3LA 3RRXA 3VR4A 4DF3A 4XIJA 1HYQA 2NZWA 3BQMB 3LKBA 2ZZMA 4JJ4A 1JKJB 3KYDA 5GV8A 4BNZA 3HMQA 4F4FA 3HCNA 3IP7A 1E3WB 3T1HB 3IKVA 2BMVA 1NXQA 3GRUA 4JLSA 4PQEA 1AKUA 2O8NA 2V6GA 4I5EA 5FFFA 4EPRA 3BXPA 3PQDA 3G3EA 5E6RA 7REQB 1WMEA 1YL5A 4GBED 5JQGF 3ICPA 3EBPA 2A0XA 5BW4A 4RY2A 4LNUA 1HF3A 1OFUA 5K20A 2PFGA 2X76A 4Z9BA 2OKCA 2YY6A 5F35A 4CW7A 3LPAA 2OGZA 4C04A 1GFSA 4MQBA 4C7KA 2Q5CA 1WZNA 1FQWA 5AI0A 3TKAA 4M21A 2H48A 1H4SA 2GVNA 1P2UA 3NGXA 1GL6A 1SRRA 4H7IA 3TIXB 3KSZO 3TLKA 4XWKA 4U7DA 1O94A 2GWHA 4HV4A 2ZRPA 1SQ5A 4Z7QB 1RWBA 1WHSA 3AFIA 1MO6A 3IO3A 4Q9DA 2N1BA 4YMGA 3WRWA 4B3GA 1VJ5A 3DBOB 3EXHC 2Q3DA 3I4LA 2IYPA 2TYSB 1O57A 2F8SA 3JYHA 1CUGA 3HR7A 4HQNA 1OXSC 3AEQA 4MEBA 1Z0SA 2Q49A 3TAHA 3KQNA 3IVXA 1OVMA 5EOVA 5HKLA 4O4JB 4Z6KA 3ROKA 2G0NA 1GUYA 3Q7SA 1RJ9B 2EX4A 4MCAA 3OF2A 3THXA 1PZGA 1M0TA 1V1MA 3HVKA 2G88A 1QYRA 5G4LA 4ZVVA 2Q50A 2V7GA 3ICOA 1N4AA 3Q3EA 1KY4A 1NU8A 1XQWA 2NZUG 3B1VA 2OHOA 4RPKA 2HDOA 4RK4A 4RBNA 5DF1A 3UWMA 3WLQA 4CM9A 1QKJA 4AG5A 3THXB 3GA5A 4XQ9A 2VP5A 4EVRA 1C8KA 4RF3A 3HVRA 2C97A 5EWLA 2VHXA 2VZ8A 4O2AF 5F3DA 2P8JA 5I5GA 1MIHA 4XGNA 2SECE 1OASA 1M66A 3MIZA 1I36A 1NM5C 1AKRA 1T0UA 4KN5A 2AWNA 4QYMA 3MCVA 5CGQB 3OJ0A 4ZT6A 3WTBA 4B73A 2Y1LA 4BZPA 3G0OA 5G2OA 5JVDA 4P5EA 3AL2A 1IJFA 5F4ZA 3DFKA 1I13A 3EEBA 1N6HA 2HCFA 3BWXA 1ETHA 4FHCA 2HWWA 4P84A 4BQPA 3KZOA 1DTEA 3F78A 4S0XA 1ATZA 3OZUA 2QYSA 1W0JA 1JE0A 1MH1A 4MKRA 1U4OA 2NYUA 3TVTA 3SLKA 1NOJA 5CFMA 4F2HA 4Z4GA 1YRHA 1HDYA 1UZLA 1Z2OX 1RHKA 2A5LA 4YAKA 1MRZA 1YDMA 3FI9A 4OGWA 4LNUB 4DHEA 5B1YA 1L7QA 4CT0A 4JJAA 1DEOA 3O9MA 4BV8A 1SAYA 3TDNA 1YRYE 2EWMA 1YGYA 3DCJA 3EXG2 3TL6A 7REQA 1SXPA 2VPZA 2WJYA 2CK3D 2Q2OA 1H93A 5KC8A 5I4BA 4UFOA 3EB9A 3G5UA 3M83A 5CNIA 4EARA 2ZYUX 5JW6A 2G7ZA 3SD7A 5TJ9A 1EFPA 1J2EA 3LTEA 4M1WA 4OKNA 3GJSA 3FJYA 1MPTA 2EBFX 2R6JA 4TKMA 4UM7A 4PZUA 1DOHA 3HU3A 1JHZA 2D2EA 2ZROA 4M9ZA 3T1YB 3TK1A 1DZIA 1X6VA 3NB0A 1Z3CA 3P2YA 4GICA 1ODFA 3R7AA 1TYCA 3ZWBA 1T8YA 4HDMB 4OP3A 4AX8A 1G8AA 1TL7C 3ABSB 4MUBA 2Q9AA 3SI7A 3RLIA 1YB7A 3LRTA 4OI0A 1Z07A 4CEIA 2C2ZA 3X44A 5B4TA 4JQYA 4WZBE 1LLQA 5IZCA 1EG7A 2YINC 2A35A 4MKFA 1VKJA 3Q8KA 1M76A 4LHWA 4QGHA 3IQGX 4KLRA 1QUFA 5B3LA 3VHLB 1UM9B 3TSOA 1HFKA 4A0SA 1VYTA 3AG5A 2UDPA 3UUFA 2IYQA 2YV4A 3U16A 5EGSA 4F04A 2JFFA 2E1PA 1BXRB 1Q0RA 3A70A 3TUJC 2HHHB 1PS9A 4TX1A 3AF5A 3D2BA 3TI9A 1C7RA 1QK3A 5A04A 4YMHA 1XKXA 4D9KA 2YV2A 5DSZA 3EF0A 3LXMA 5U4XA 2Q9UA 4XQGA 1G9XA 1N2ZA 4FDAA 4MV0A 1Y8AA 5FI3A 2WF6A 1S3IA 2O2EA 1WPRA 3A2NA 4EPVA 3ZOKA 3SYNA 4YJ2F 1X94A 7MDHA 1CZLA 2XUHA 4OAPA 5CJ2A 4E7PA 4EGQA 1LBHA 2UVQA 3M1YA 3OU6A 5BR7A 2PLFA 4E31A 2VZLA 1ICEA 3DPUA 5I7VA 1G63A 3HL0A 2XNDA 3OECA 3TTXA 5A5DA 3LG2A 1PJRA 2ZB7A 5AKHA 4UUAA 4C3ZA 1A9XB 2O6HA 3VU0A 3WHIA 5ALUA 4NESA 2J9FB 2WHQA 1EESA 2EKZA 1G21E 2AZDA 3KRTA 2PX3A 2J0QA 3MPUA 3EXG1 3R6LA 2I1QA 8OHMA 3Q40A 1JUDA 2BZSA 2OCKA 4PSCA 5AKEA 1DC8A 4EHHA 2PV7A 1Z13A 3B1FA 2H5EA 3PPYA 4CM9D 4O4LB 4MS3B 1WW2A 1Y8QA 3X2EA 4IQFA 5AI4A 5AQ1A 3A2KA 2PGXA 1W5AA 1USKA 4KSCA 1F6BA 1WCV1 5TV2A 1K92A 3ZBTA 3EMDA 1YB5A 2OWEA 1E1QD 3FFBA 4RLSA 4FBMA 3T7IA 1BDIA 1DX6A 2FJUA 3BSYA 1W34A 4LQDA 3RYTC 4M4SA 3ZY2A 1WY5A 4PBRA 5T4FA 5CA1A 2IYAA 3LF2A 4QLBA 3FROA 4FYYA 4DQ0A 1CVIA 3HNPA 5E0OA 5ANRB 2NVBA 1DXOA 2FSPA 2AG8A 1V4VA 1YHYA 2C78A 4PG4A 3WA7A 2ZAIA 1D2AA 1AOXA 4FDUA 1XTKA 1L5HA 1F0NA 3FKQA 2QRUA 3JARB 1O6ZA 3ZDDA 4KDEA 1CUBA 5ITSA 5L45A 1A9OA 3QUAA 4URXR 4PLVA 1CULC 2FRVA 1NMEA 1L5GB 4JCCA 3E5NA 4A8HA 2GFIA 1ZHOA 1FFEA 2A3NA 4J16C 3SYKA 4R9RA 4K8RB 2OHGA 4E2XA 2L17A 3I0MA 2PANA 3FPKA 4FGUA 3Q3HA 2BFEB 3GMSA 2JATA 5EE3A 3FSRA 1WS6A 4O2BA 4KXWA 1R9MA 2EFCB 3RF7A 1QCDA 5EYPA 1BVHA 3LBFA 4KQEA 3Q3IA 3QEKA 4F96A 3EK2A 4V0RA 1H4VB 4YTEA 3D3NA 1YUNA 1L5WA 3I37X 3ZHQA 1PJCA 3JQQA 3LC2O 4KWCA 1UMKA 3RUEA 4X54A 1Z2CA 4B34A 5AKKA 4F97A 1BC5A 4PYLA 1D2GA 2QVZX 4PSKA 4REMA 2BFCA 4AICA 2X14A 3H3XA 4J9UE 5DVZA 4PO1A 4WT7A 4R83A 1L5MA 2IXAA 3TKYA 3PXEA 5JOQA 4XCQA 5JLJA 3HVIA 2Z8YM 4ZOAA 1XVLA 3WB9A 4BNMA 2VH2A 4N12A 4HXFB 1B8UA 1LK5A 3DV0A 2E4XA 3EHEA 5JV5A 1HLGA 2AR9A 1RC1A 4EY8A 4L73A 1XOIA 1CQXA 4DR1B 1T2NA 2YVUA 2E6KA 2QRKA 2WTNA 3R0XA 4PNPA 2GZ1A 4ZKEA 2HC9A 3WKAA 3OM8A 4BJ1A 1AK2A 4F3YA 1P0FA 2VXOA 4JEMA 3GLFE 5F9MA 3K92A 4CM8A 4ENUA 4R2LA 1QS0A 2G04A 2XVYA 4IIJB 5E2BA 5ADHA 1O96A 5JZOA 3W5UA 2CSXA 1NJ8A 3LPLA 1PR4A 2AXQA 1WB4A 2EHDA 2VTKA 3E0XA 4RKFA 5IEJA 3GLFB 3OE7A 4BQQA 4P0TA 1RDFA 5K7SA 3VO2A 3EZYA 2G70A 4UTNA 1M0EA 1IUNA 2NUTB 3UJAA 4FYPA 4YCJA 1QQ7A 4GYYA 4H35A 1T4GA 4NECA 2VLIA 3PTAA 3HYLA 1AQYA 1TAHA 3MWDA 1UBCA 2B4RO 3O03A 2YFYA 1A9PA 1DG3A 1VMIA 2XNSA 3D0QA 4YROA 3WIEA 4FUTA 4QRIA 4YRIA 1ZGGA 4AURA 4PGFA 5L51A 1WSBA 1HT0A 1AV7A 3VISA 4Q7EA 1E20A 1TLLA 1ZU5A 3FYUA 4JBHA 3UF0A 3W3AD 3PEWA 1GM5A 2UYCA 5EJFA 4JX9A 3SIPA 4C6SA 2R6ZA 3NP9A 2NU6B 4S24A 3REQA 1M7BA 3CF4A 3NASA 4ACAA 4P34A 1NRJB 3OLCX 1J5XA 4YDQA 2W42A 1BWQA 3R3YA 1O0BA 1M7HA 5CBKA 5FBZA 3CVYA 4CXMA 3AV0B 2QVYX 3AJAA 2YYAA 2GBGA 2JIZA 1PZMA 4MUAA 4PHHA 4UQPA 2XCUA 1J20A 3MINA 1QYDA 1HWYA 2DP4E 2HADA 2XTZA 1OT3A 4DCNA 3Q98A 3G0DA 3LQFA 5JMOA 2J07A 2AN5A 3MJRA 4OLBA 4K8OA 5JMPA 3T7CA 4JXXA 4FCTA 4RDCA 5HHTA 4LOAA 5J43A 5KS2A 1T3GA 4UMFA 1RRCA 3SIRA 4X1KA 3NOQA 4EA9A 1T4BA 4US1R 1KMMA 3LQYA 4PC3A 1TTQB 3UWKA 1BGXT 4DV5B 3MWGA 5A05A 4NFYA 4BLOA 1Y1QA 3AT1A 1ZMRA 2VAVA 1VOTA 4IVNA 1U94A 4MWCA 3G23A 3SM3A 3OOWA 5CB0A 2H4ZA 3LW7A 1NULA 2YW9A 4M87A 3W5HA 1LBQA 3PUZA 2LUOA 2V8BA 5AVOA 4U0JA 4JVNA 1EQ2A 2OEPA 2WMOB 2IS4A 1M8KA 4YX9A 2QXTA 1VCIA 1VXRA 3UMYA 3W5SA 4EPWA 3A9CA 3GN1A 2XQVA 2PWZA 4G8DA 4RL4A 3GDOA 1MAWA 2HSGA 1D6MA 2MTBA 5D8DA 1TEVA 4WW0A 5AYVA 2ZR0A 3CH6A 2HI0A 5IXSA 3NKLA 4B6FA 1E98A 3HEMA 3JR3A 2AFIB 2EEPA 2OORA 1NVKA 4YRTA 4E6EA 1PJSA 1N2GA 1GKYA 4FGKA 3CKLA 1K97A 1I8TA 3K4HA 4QNNA 2GCEA 3KQUA 5A2GA 1L7EA 2GERA 4J6EA 3AQ4A 1EFLA 3WRXC 4KXVA 3A6HA 2V4ZA 1K88A 2BAGA 3V34A 1U1FA 2H11A 1E9EA 3QEOA 4MIOA 1ZXXA 4CMBA 2C8JA 2YJ4A 1H3FA 1ML4A 1W96A 3NETA 1OWNA 1DEXA 2CXNA 4O8ZA 1QVZA 1QWOA 1H9AA 5FL7A 3KETA 5IS2A 1E0JA 1QHSA 1R9JA 2ZR7A 1MV8A 5ALEA 4CIDA 3PGMA 1RWOA 1Y63A 1DO0A 4HD8A 4BBAA 4MP3A 5EJMA 2R751 2XCLA 2NU9A 4Y9RA 1J5PA 2VJLA 4EHAA 4IDBA 2PTGA 1SBCA 1MNAA 1L4KA 3DKKA 5EAIA 5MFZA 1AIPA 2ZCJA 1V25A 3GFOA 2QLLA 3Q0IA 4S3MA 5JRDS 1ZVVA 1YCHA 3LW8A 2O0HA 4QVIA 3ANMA 1TW2A 5IHPA 5LSAA 4OFBA 3LUJA 3HJUA 4G0OA 5BN5A 1ZNYA 3SYLA 5FUYA 2O2ZA 5BNTA 2ZUWA 4KOAA 2XMQA 3ENVA 2CNNA 4PANA 3CB4A 2ZZKA 1AGRA 1DAMA 3NDRA 4LXTA 3DOJA 2CV2A 1M6EX 3KHTA 4LC1A 1J33A 1L7VC 1NN1A 1CY2A 5K45A 1UODA 1HFEL 1NTOA 1VCHA 2H6EA 3LBIA 1GT6A 4YAOA 3TLGA 3TOSA 2VA8A 1U7TA 3KPWA 5ALRA 1QH1A 3WWZA 3G89A 5EJ6A 4WKCA 4FFMA 4C5CA 1Q6YA 3KZ1E 3TZHA 1VG0B 3TD2A 1NUQA 3FNFA 3UQYS 4YAWA 3QM1A 2ECOA 5FTJA 5A4KA 1BKDR 4U6NA 3ZLUA 2BMEA 1G6KA 2PSFA 2X8LA 3W90A 2NYVA 1O94C 4QJBA 2PCLA 4MP6A 1Z7BA 4XDZA 2Y1KA 4R8SA 2VK4A 2XBLA 3FLMA 1EWQA 4ZT2A 3GD7A 2A88A 5FCDA 2V5VA 4PIMA 4MVJM 2P9BA 1TJ4A 1TJ3A 3DLTA 4J1NA 3SOPA 1N3YA 2WUVA 3R74A 4V1CI 1C4WA 3AZQA 3C45A 5CLHA 3MHPA 1OX4A 2BSAA 1NJ5A 5LLTA 3AUSA 1OV6A 2OWDA 4Q24A 1EG2A 1NI3A 1SCQA 1GNSA 3B85A 3CA8A 3KAJA 1VHJA 4HPJB 2DTEA 4S05A 2E89A 2QRGA 3A7DA 4P32A 3ZBPA 1RLTA 3NGLA 1OFIA 3PIIA 4FQ5A 1Q57A 1XP8A 2G1AA 3AR4A 4X63A 2IYYA 3W8EA 3SZUA 2PE5A 1LBSA 1KI1A 1GZDA 3QWIA 1IZ7A 4FFSA 4ZVMA 1Q19A 4A5SA 3TRFA 2QTVA 5FPPA 4X1KB 1Q92A 4W6QA 3OZBA 3PNLA 4RY9A 4EVQA 4OHKA 5LZ4A 2Z4SA 1R9NA 5CFLA 2QI9C 3LT2A 3QNMA 3ZBQA 4AP5A 3NEAA 4I6GA 1P45A 2HHLA 3ND8A 2J6IA 2LDXA 2CCKA 1SUWA 3V4OA 4Z7JA 1DINA 1Q1NA 4RVUA 3N1UA 1V11A 1IXZA 4PYIA 4Z7NB 4NCIA 1U0OC 1LNZA 5HM8A 4QXQA 4LOHA 3G88A 3V1TC 1I01A 3OPYA 1KSGA 4C6RA 1KE2A 3RHSA 1RYDA 2AX4A 2JI8A 3DVAB 4CF6A 3FVRA 2I80A 4HBGA 5DU2A 2ICAA 3HKDA 1SOUA 1T9DA 3H5AA 5IJXA 3SKVA 3UJ6A 4Z4IA 2C4WA 3EG9A 1P81A 1QP8A 4INAA 1O87A 2E82A 4ECEA 1EVEA 3B7GA 4EYEA 1V0JA 3QKRB 4HZUA 4OHCA 2WJVA 4JH0A 1BVRA 2FKNA 1OB5A 5D7BA 4EGAA 1PYOA 4JYPA 3I9V1 1IB6A 4WNAA 3FUTA 5DHTA 1NQ5A 2HM7A 3PGKA 2J7PA 4ZFNA 3PD1A 2EW2A 2YS7A 3SAJA 1Q1QA 4J0HA 4E2YA 1FP1D 5K8LA 5KHLB 4KPUB 1N2IA 3A0RB 2YFHA 1SK9A 5JH7F 5K6AA 5HFAA 3KBOA 4FWIB 4E11A 1SUSA 3LL4A 4DEYA 4PYQA 4URUR 3I8OA 3KV3O 4OYYA 3OHMA 4WZAE 3ZDRA 5EKUA 3ZCPA 4LXGA 1UANA 5FO0A 4ZVPA 2ETVA 4PY2A 3GP3A 4JR0A 5IP5A 1D4FA 1KZ9A 3SPXA 2F6RA 2OHFA 4NS1A 1NXXA 3F6RA 2JIMA 1QUEA 1UK7A 1XI2A 3DBVO 4HZGA 4ZRNA 3QITA 4BIIA 4LY0A 3DNMA 1XRSB 1WCIB 3SNHA 2VJYA 4XWTA 5FOUA 1GSIA 3RVBA 4DCGA 5B2EA 3B51X 5C46F 5EPUA 1QU2A 4OO3A 2MSEB 2ZUSA 4NU8X 4XVQA 3O3CA 1HYHA 4H7JA 2OV1A 2QRMA 3VTAA 4C6HA 1RAHA 1KMIY 1XQ9A 1G3QA 3UXMA 1LNQA 2Z4TA 3BIJA 4WOBA 1DAKA 1SUCA 5ES3A 4D99A 5U1PA 1CUXA 2VXCA 3HKBA 1RYHA 1WLSA 2VDRB 4FGJA 4O29A 5HMMA 4MV6A 3V1MA 4HDNB 1Z36A 1N6LA 2VK1A 1P2GA 3FJOA 3NCHA 3O92A 2JFQA 3FNQA 4PZEA 3CZPA 4IZOA 3UZUA 3NM6B 4LDNA 1M72A 3ROTA 1NVGA 4RIHA 1UXKA 1XLVA 4HNGA 4JB8A 1QO9A 5ALZA 3UJDA 2I33A 4B80A 2DHRA 4BIMA 1S4MA 2JPDA 8AT1A 5A7FA 4CLRB 2OPBA 4O6VA 4ARAA 3ECSA 4BQSA 4NZPA 3DEIA 3LV8A 4QUIA 5JNVA 1LV8A 3CCFA 2LDBA 3FYUB 4FR2A 2XT0A 4MRVA 4XIFA 3TGLA 5HBGA 3O4VA 3QI7A 3STVA 4DCTA 2EX0A 2VYCA 1F48A 2PY6A 1F12A 2P5YA 2ZCUA 3AXSA 3HXLA 3IPXA 4FYMA 4OBXA 4OM8A 4F86A 5B1HA 1E8DA 3E9NA 2HU2A 2GBLC 1FBTA 1HDGO 4HKTA 3MWDB 3AHFA 4C7XA 2MMCA 2ZBQA 5T3UA 5IARA 4BO0A 1PDWA 4C0WA 5CD9A 5TX7A 4A6EA 5HUQA 3HXKA 1KIFA 4EG4A 1T0PA 1T2VA 2HY7A 4RTMA 3HYSA 3PDWA 4PO3X 3P4UA 4P35A 2JBHA 1IK6A 2R85A 2PHZA 4BTLA 2AQIA 4ZKDA 4FEYA 1EVLA 2FMHA 5CK4A 3MOGA 3FF4A 2E21A 4O0MA 5C7IO 7AT1A 3G8BA 1UCFA 2NPFA 5J23A 2QD5A 4RHTA 3CVUA 2ZDHA 3ZIUA 1UADA 2B0JA 4FWBA 1NT4A 2YQZA 2VHJA 4GRIA 3T3DA 2ZI9A 5CB6A 3QVSA 1RM0A 1T9AA 3UOAB 1P5ZB 2IHVA 2PS9A 2QRNA 3A3YA 2YN4A 3DAYA 2D7JA 3KB2A 4BLWA 3HN2A 3U48A 1ZI6A 2W6PA 3O4GA 3BG5A 3JYNA 4RE5A 4V24A 3VR4H 4MS3A 1AGPA 1TQ8A 2VJDA 3CLSC 3O8QB 4ZODA 3CCCA 2IOYA 2HA2A 1BIFA 4M1TA 1O9BA 1NF3A 2CL0X 3FDIA 1NKTA 3R41A 1RACA 4OQQA 4JR1A 4X20B 3NHJA 4BLQA 3MLBA 3RUIA 5GTDA 1YQXA 2IYUA 2H1IA 2NTEA 2O3JA 1C14A 1SOMA 2H63A 4R1TA 3W8NA 4DR3B 4TTRA 4KNVA 3WGTA 2J9FA 1VE6A 1UJMA 1YULA 2RGUA 1DCMA 1MTZA 1UEJA 4LGCA 2UYQA 1A9XA 3AXTA 2JD0A 3CF4G 3DC7A 3EY4A 2BONA 2OHJA 3IPYA 3ORFA 3ZH9B 1NBIA 1I4TD 2B9EA 3S2FA 4CQJA 3IDQA 2OFOA 1GGMA 1NUUA 4HGOA 2O5VA 2OESA 4RH1A 2QK4A 2ZJBA 1Z6QA 3VMMA 1PJ8A 2Q1TA 3EZLA 2Y1WA 4Q4CA 5T8KA 3VR5A 3S1SA 3QLVC 1P9NA 2TMKA 3QW4B 4IDEA 4K6HA 4KRGA 4XUDA 5CPBA 1Z0ZA 4WZBA 4Y2PA 3SC3A 4RHUA 4LWOA 3E8MA 5KINB 1SFRA 4MUYA 3L5KA 1L3CA 2WHXA 1KOJA 1TB4A 5K4HA 1QDEA 2NPOA 4FI3C 3W9BA 1ZU4A 1HE8B 3TNDA 1PFKA 1CLUA 1RKXA 2P1RA 1E2JA 1QX4A 4IEFB 1BXRA 4RQUA 2XNJA 4JP1A 1NONA 4MJ7A 1IJEA 5T3YA 4B2IA 3M2PA 4E94A 1W59A 3R3XA 2GJ9A 3C6KA 3CEMA 3AP2A 5JXJA 1Q50A 2I2WA 3HACA 2XXJA 3M4JA 3VAZA 2KI5A 4IJWA 3K7EA 3UJ7A 2VTBA 3MMZA 1Q77A 3DHVA 4KIJA 2AI3A 1Z6ZA 1P1JA 5FR2A 2HX1A 2I4TA 3CSUA 4YLEA 2ZYWX 3MT0A 3IHWA 3AEUB 5T57A 3U3ZA 5K0EA 3V46A 4O1MA 2BRUA 2ZDGA 5KWJA 2HK9A 3KPUA 4QT4A 3PQ2A 5EUMA 2RJ3A 2IEIA 1GCUA 3JQRA 3K8YA 5H9VA 2OFFA 3ZWWA 2DBVO 1YIDA 3OQMA 1QVAA 2QM3A 4Y2SA 3ZU2A 2GEKA 3FCYA 1KI2A 3GH3A 2X0DA 3ORQA 1A95A 1T3TA 3NHSA 3GLHE 2DZDA 1DAFA 4WJKB 2AZMA 3ET5A 4S2EA 2O50A 1JI3A 4EELA 1R12A 1FTGA 1YI1A 2IEDA 2QZSA 2QV0A 1MQ8B 3FPFA 3GAZA 1Y6GA 3SXUA 4K0KB 4AT1A 4MQEA 4B8WA 3MTQA 3OCXA 1B26A 1ZD9A 5HA5A 4DZRA 1WZEA 3H5TA 1OZ0A 4GEGA 5SICE 2V96A 3ZS9A 3KSBC 2PT6A 3HCBA 3VO9A 5B58C 1F0PA 4B6RA 5JD3A 4Y2QA 1U9CA 3F6BX 2XWJI 1IPHA 2NQTA 4MV7A 1EIWA 4OBBA 4D82A 2WNSA 5IVIA 3SJAA 1SC6A 4KCGA 3H0KA 5K3FA 2HDHA 1W9HA 2CN1A 3PNMA 2WR8A 2C31A 1NVVQ 3I2JA 3EGEA 2Q41A 2RH5A 4FFRA 1LVGA 1V7CA 1M9NA 2REOA 2CB0A 4HXEB 1ZVQA 4BQEA 2AQ8A 1K7YA 2JAUA 3AF0A 3UM9A 1DG9A 2C1ZA 1L8XA 4JC8A 1G9TA 1CBUA 4TLBA 4M89A 2AZ4A 1EE9A 3OUZA 1U9IC 2Z8XA 5AW0A 4JXZA 1V9SA 4TT8A 2BUBA 3QKRA 4HZUB 1VDZA 2DBYA 2OV8A 2D4HA 4R2JA 1C0LA 5JAIA 3VTKA 4P22A 1J22A 4JA0A 2NO1A 1IN4A 2H18A 5D3MB 4G1FA 2J0UA 4FSHA 4CU5A 5KREA 3N76A 3VYTB 2E18A 2FQYA 4YECA 1XTPA 1XJ5A 1VHTA 4CEIB 5LDHA 3PC4A 1V1MB 3WGYA 4QOEA 1ZO8A 5K0LA 1X0VA 3B89A 5JHHB 1BE1A 3HO8A 4P4SB 2BMFA 1V11B 4XM2A 4BMNA 1RLUA 4BMCA 4MWEA 2Q9BA 3TRDA 3UGKA 3O3MB 2PBFA 4Y7CA 2GTPA 3F4BA 5THKA 3WG9A 1EFPB 4FHDA 2AI2A 4M0CA 4QOHA 2WWVD 5CA0B 1JU4A 4YVFA 5AVJA 1UK8A 1IBLB 1U3GA 4K40A 4YLGA 2NNLD 3PC8C 4Q5IA 3S5UA 2J5RA 4H7HA 4NFLA 3AU8A 4CTKA 1SR8A 2PO7A 5FUVA 1KPGA 1WQ1R 3RRFA 1Z25A 1Z7WA 2EBWA 5JJBA 3T61A 1EMDA 2DPXA 3GBSA 3G8CA 3ILYA 3Q88A 4YR9A 3LUGA 1BJTA 3P9YA 2FNAA 1N5JA 4LRSB 1BJKA 2P67A 4JLJA 1NG1A 4ZQBA 3F97A 5HX7A 5MN4A 4MVXA 3TMAA 1CP2A 4K9NA 1EPUA 1UXIA 5DWVA 3GMIA 1NC3A 4PSAA 3BMXA 1E3WA 1P29A 1Y5IA 4U1RA 4OQ4A 2B8JA 3I5AA 4QGAA 3HO1A 3KJXA 3DMYA 2CV0A 2GZ2A 1GCGA 1R00A 1XEXB 3DZFA 3K1ZA 5JVDB 1RPJA 3L0OA 3P5BA 1MA3A 1RJWA 2Q27A 4PNHA 5MFPA 2B1RA 1RCFA 4GBMA 4QQKA 3PGXA 2QXYA 3K94A 1LBEA 2F59A 1XPJA 4J7UA 1UJCA 5EWLB 1Q0HA 3DNPA 3LY9A 3R40A 4H3KB 3RI3A 2ZYVX 3T38A 1RBQA 5KPDA 3V8QA 1S2OA 2BR3A 3FOAA 3HLTA 5AUNB 2PPVA 2QW1A 2NP7A 3GDFA 4OGKA 1KPHA 4OY3A 4GOND 5DK4A 1M10A 2ZVQX 3RKUA 2I3DA 4F60A 3EBOA 2ABWA 4QA9A 1H8HA 1ST3A 5HCNA 3ELUA 1RJ9A 3OP1A 3C3EA 3NXKA 1AHHA 3FKSD 3FTPA 2IU0A 5IKEA 2PR2A 4WXHA 2WJWA 1F2UB 5IEBA 1GPLA 2A9RA 3AEQB 4AKGA 1FNSA 1VZ3A 3TZBA 2X0IA 1UH5A 1CY0A 1F14A 1IWPB 2B8WA 2BKXA 2M6SA 1HFJA 1SVIA 2G09A 1TUBB 1MF7A 2VI5A 3NHMA 4YRFA 1DIHA 2AT1A 4TRMA 3O2JA 1HX7A 1OJLA 3SEQA 1GAXA 1OPXA 2CXPA 4DJTA 2EKQA 5EFOA 2JJ2D 1KDOA 3PR3A 1Q6ZA 5G0UA 4YT2A 1SU8A 1FA9A 3G82C 1A5BB 5KQMA 2BHLA 2FSSA 2B1JA 3G1WA 3R9WA 1W85B 5A3QA 3JQAB 3U7GA 3JVDA 3OQVA 3MS4A 1GNTA 1I3OA 2HPHA 2RHRA 2UZ1A 4FU0A 4JXJA 4R1SA 4ER0A 5MF6A 1KRXA 4N7MA 4NENA 3V32A 1ZN7A 1Y3FE 1PGNA 5E6RB 1I2DA 1HRKA 3OPXA 1AKVA 2J5KA 4HNQA 2BGJA 2H2FA 2Q6TA 2Y76A 4IMJB 4I1VA 4MQ4A 4RIIA 5J2TF 4F1JA 3GLGE 1XPRA 2RAPA 4KAXA 1JKJA 1HT2E 3KYDB 3NAMA 3KWLA 3MJDA 5FF9A 3R77A 3KZXA 3MYYA 3H83A 1VG9B 2CJYA 2J9GA 5BSUA 4JI3B 2H7YA 4Q9KA 1Y3BE 4KUEA 2DT8A 2F1OA 1UJ6A 2F43A 1OI4A 1IBRA 3QBJA 5LQJA 1FFBA 3IIJA 1PKXA 2AFIA 2ASVA 2VH1A 2XB8A 3L49A 4H0NA 3ND9A 4R7GA 5B1SA 4BEBA 4B3MB 5J59A 1RYMA 1U90A 2H08A 4RVNA 2PZ8A 3WLSA 1PJ4A 4HXGA 3TUIC 2IDZA 3NKFA 5E3IA 4ARUA 4ZI7A 3PXDA 1TLTA 2NYRA 3HKCB 3GJ6A 2JZOA 3GDGA 5EVJA 3T1NA 2EDAA 1CIPA 2B4YA 1YCGA 2F8MA 3C7DB 3QY0A 3ZHUA 1NFRA 5JCOC 4ZVRA 4OI4A 1KFCB 3S3TA 2PSSA 4BEVA 1UZNA 2X23A 3SBXA 3GZ4A 4RD6A 3CZAA 3IEKA 2GS9A 2ECPA 3O8BA 3VDNB 3WKDA 5FX2A 4OI1A 1M5RA 1BEUB 1U1CA 2ZE5A 3B1JA 4UEOA 5CVEA 5DYTA 1LXCA 5I9SA 1IEQA 4KLNA 1XGKA 3KKQA 4LG1A 2ZUDA 2BJHA 3TO5A 3FLAA 3IXQA 4LXIA 1E77A 1DIBA 3BA6A 1FUKA 4W1PA 3KQYA 4B2PA 4BNJA 4JLKA 4P92A 5IZ4A 2AGVA 4BKOA 3KFVA 5ECDA 2ESRA 5LIPA 2YWEA 5KO2A 1J8YF 2R7NA 4L5IA 4NATA 1JYEA 3I01M 4RX1A 5TNXA 1BX1A 2ZIVB 3H6KA 4GGOA 3T0GA 3UWPA 2AQKA 1UC8A 1M0WA 2AMVA 2PLAA 4XPZA 3II6X 3ZN2A 5LQDA 4A1FA 4DKXA 1VLLA 1KFEB 2PYDA 5JO9A 2MU1A 3O75A 4K9QA 4G5HA 2Q4DA 3BKXA 4JB0A 1G4UR 1CUAA 1Z37A 2HQ1A 3B5EA 4LX8A 4BZWA 3KT0A 3THRA 1Y7TA 3E9YA 4JLMA 4L3OA 5H68A 4RJTA 4ZQEA 5HBRA 2NV6A 2B30A 5LBUA 2J7KA 3SX2A 4FZVA 3T9DA 4M1OA 1V1RB 2XT6A 1G8GA 1P4GA 2NXJA 2A0YA 4Y6OA 3RG8A 3ENNA 4P3KA 2H4YA 4L57A 2X1HA 4WEQA 5TC4A 4JUAA 1Q0QA 3NIGB 4H6XA 5AR1A 5FLKA 3PITA 4FHFA 1FMJA 5EINA 4YRAA 2OYCA 5F7OA 3ZVKA 3RC1A 2HT1A 1VFPA 4DDTA 4REQB 4K81B 1QH8A 2GZMA 2ODQA 2PWAA 1C7IA 4CKYA 3CMCO 4M0MA 3I9MA 3WGJA 4J0JA 1DBSA 4CGYA 2HA7A 5EE0A 3A9TA 3QHAA 1UK9A 1KS2A 3GEGA 2WHRA 1IDOA 5LZ7A 4YY3B 1RQNA 2GN2A 2XA9A 2B3TA 3AIOA 4XXHA 4RTPA 4C0JA 1OAOA 3HBAA 2X0NA 3WLIA 1IG0A 1GPH1 4BFWA 4G26A 1YB4A 3DR5A 2G63A 1Z62A 2RI6A 1DS6A 5DTRA 1W5SA 4X93A 5LD2C 4NBRA 1OWPA 3BGIA 1EA5A 3T9AA 1SHLA 1SCKA 2BC9A 2D06A 5KQSA 1RXCA 1BS9A 4XLTA 4RZHA 4XJXA 1ODKA 3CNLA 5COAA 3RWOA 4PC7A 3S1AB 1JFSA 3WMWA 1MH9A 3N53A 3JD0A 3QTLA 1ZEJA 1GAEO 3H4TA 3ZBUA 1ETUA 5IH3A 4CF4A 2ZYAA 2B99A 4JEIA 3MLEA 4M6WA 3DTVB 2GOYA 5GP1A 3VNSA 3DD5A 4TRJA 5C9ZA 3CLKA 4LBVA 2NTVA 3VYVA 2F48A 3MGCA 5IFKA 5IAEA 2QOEA 3UHAA 3AVVA 4X8MA 1CKEA 2C77A 2W2LD 2QE7A 5F12A 4YREA 1P7YA 2XUOA 3EIEA 4G4JA 5F73A 1MNQA 1ZRNA 5GOTA 4D4MA 3EIQA 1I4LD 2JAHA 5F52A 1PLJA 1LDBA 1K4KA 4IQ8A 4YWJA 2Y2UA 4BNHA 2YXDA 1K5HA 3BK7A 1BYUA 1M2JA 1FZTA 1G0OA 1ADCA 3RHTA 1NUPA 2D1TA 5A9SA 3RHZA 3W1EA 1R0LA 2DHCA 2NUBA 1FDUA 2GF0A 2P1ZA 2QDXA 4PC6A 4YYEA 4L22A 3D8SA 1M6VA 4WMLA 1GAQA 1HNWB 4OHXA 3AFNA 4JFAA 2XYPA 3S99A 1F51E 1K06A 1SQSA 1HTWA 4PW0A 4UAJA 1WMSA 1H22A 1ZVKA 1TAUA 1VLJA 3WL7A 3ZWOA 1CZOA 4E33A 1E2EA 1WHTB 5BOVA 1Z5GA 4PTZA 1F2VA 4XFDA 3UT5A 3K9HA 4L15A 1PR6A 2Y93A 4RK6A 2N42A 1G5IA 1XU7A 4TXMA 5CXXA 3TZEA 5BW8A 2XRZA 2G5CA 1RP7A 5GONF 1F20A 2IUEA 3VVMA 3L7BA 3DBLA 4F12A 4OXQA 3AM4A 2C4UA 1NW4A 3GDHA 4XM1A 4BZZA 5LXTA 4I50A 5L95A 2O57A 4IIUA 4C0SA 4GYKA 3DDWA 4KIWA 2HA0A 1Y8QB 2VF8A 5H4HA 1JSXA 5BV2P 2DUWA 2PD3A 4ZVQA 2YZGA 1QLJA 3W79A 1GAWA 1ODTC 2DY0A 3V6MA 1S2MA 1WY7A 4LC0A 2PMBA 1R5OA 5B58T 5B53A