1SELA

Crystal structure of selenosubtilisin at 2.0-angstroms resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
274
structure length
273
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SELENOSUBTILISIN
publication title Crystal structure of selenosubtilisin at 2.0-A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase(serine protease)
total genus 88
structure length 273
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1993-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1selA00
2WV7A 5ARBA 1BE6A 3GT4A 3F7OA 3PTLA 2PYZA 1SUPA 5K7SA 3DWEX 1ST3A 1A2QA 3DDZX 3F7MA 1S2NA 1SCNE 3Q5GA 2QTWB 2DUJA 4DWWA 1SUAA 1SN7A 1SBIA 1SH7A 3I2YX 4WOBA 3PRKE 5AQEA 2G4VA 4CG0A 2HPZA 1LW6E 3LPCA 4Z2AA 2WUWE 2W2QA 1PEKE 1TO1E 2IY9A 2B6NA 3LPDA 2Z56A 5B1EA 4AKTA 1SBNE 3DVQX 3CNQS 1AU9A 4OV6B 3GCWA 5I9SA 2SICE 5AVKA 4B5LA 5AVJA 1SCJA 1YJAA 3VHQA 3QTLA 1IC6A 1SPBS 4H6XA 3GT3A 3AJ8A 2ID4A 1C9JA 4KG7A 1Q5PA 2V8BA 2HD4A 5ARCA 1GTL1 3D9QX 3Q40A 1R0RE 1R64A 4HVLA 2ID8A 3DE7X 1Y34E 3EIFA 5FAXA 3AJ9A 1S02A 1C3LA 1TK2A 2PQ2A 2IXTA 1GA1A 3GCXA 3ZXXA 1T1EA 5JXHA 3A3PA 3H42B 4DZTA 3P5BA 4KB5A 1Y33E 5ARDA 1GA6A 1Y3BE 1WMDA 1SCBA 1SBTA 1T1GA 3DE2X 1EA7A 1YU6A 2W2NA 5CW1A 1TMGE 2W2MA 4C3VA 3LXUX 2PMWB 4LVOA 4C3UA 1AF4A 1SBHA 1Y9ZA 1PJ8A 1Y4AE 1WVMA 4CFYA 1TECE 3DE0X 2PWAA 5JMOA 2Z2XA 3TI9A 4H6VA 1NDUA 4RYDA 1OT5A 4OMDA 2DP4E 3BPSA 1SCDA 1C9NA 4CFZA 2Z58A 3LPAA 3QFHA 2DQKA 3T41A 1SVNA 2Z30A 1YJCA 1OYOA 2W2PA 1Y3FE 3QMPA 1TM3E 2Z2YA 2Z57A 3DW1X 1GNSA 4OMCA 1MPTA 5FFNA 1TM7E 3AFGA 2ZWOA 1BJRE 2PKCA 1AVTA 3I34X 1ST2A 5FBZA 5AMXA 1IAVA 2ZRQA 2WUVA 2GKOA 1TM1E 4DJ5X 3D43A 2X8JB 4GI3A 4NE9A 2ST1A 1CSEE 3OSZA 1YJBA 1VSBA 1KE1A 3CO0S 1P7VA 2P4EA 2WWTA 1GTG1 1WMFA 4K8RB 4LVNA 1V5IA 1JEAA 3WQBA 1KDZA 1Y3CE 4ZARA 3A3OA 3SQOA 1T1IA 1AH2A 1SCAA 1PTKA 3TI7A 1SUBA 2W2OA 1XF1A 1Y1KE 3L1KA 4ZOQI 3WHIA 3EE6A 3DE1X 3BGOS 1P8JA 1SUEA 1AQNA 1MEEA 4WOCA 1SIUA 1NDQA 5JXGA 4AKSA 3EDYA 1BH6A 1ZVKA 1KDYA 3DE6X 3WIVA 1EGQA 2E1PA 1BFKA 3I30X 1AV7A 1BFUA 3DE3X 3VTAA 3VSBA 4YN3A 1SIBE 5JXIA 3DW3X 4M1ZA 1SUDA 1S01A 1NLUA 4MZDA 1AK9A 4I0WB 2ZWPA 1C9MA 1THMA 1Y48E 1OYVA 1TO2E 1CNMA 1ZVJA 4NE7A 1SIOA 1SELA 2SBTA 1WSDA 1Y3DE 1GT91 4NMXB 2XRMA 2Z2ZA 1GA4A 1KE2A 3DVSX 1UBNA 1Y4DE 2X8JA 1GTJ1 4J94A 1DUIA 2XTJA 3I37X 5SICE 5B1DA 4KPGA 3VYVA 1BE8A 1GCIA 3WIUA 1SBCA 3DVRX 1TM4E 4H6WA 1DBIA 3F49S 4BWGA 1HT3A 3HJRA 1P7WA 2TECE 1WMEA 2PRKA 1GNVA 3VV3A 3ZXYA 3UNXA 1TM5E 3BX1A 1R6VA 3VV2A 3DE5X 5JXJA 1PFGA 2PWBA 4HX2A 4FONA 2SNIE 1V6CA 3SICE 4JP8A 1SUCA 1KDVA 3DYBA 3DE4X 3A3NA 3TECE 2SECE
chains in the Genus database with same CATH superfamily
1YR6A 2PG3A 1WHSB 2ZUWA 5LZ5A 3LBYA 2JLCA 4GPD1 4MVYA 4QOSA 4N5NA 5DNDA 1ZL2A 3VTFA 5FR2A 1U3TA 1ZINA 2C7VA 1G8YA 4FXPA 1FYFA 4TT8A 3S2ZA 3ZGNA 1XNQB 4PZYA 3F6YA 1SC9A 3IP6A 1T5DX 1JIUA 4UNNA 1IRIA 2G6TA 3G89A 4RIIA 1NBMD 2R6GA 3RV4A 1W73A 3RFFA 3EEYA 1N78A 2AQ8A 3PXEA 5BRJA 5JH7F 1DDGA 3OFND 4WD3A 2GPJA 5FPQA 5KJEA 2NQ8A 1EG2A 2Q1SA 1VMAA 4G0NA 4GPBA 3QLUC 2WSMA 3GFVA 1WP4A 1Z8DA 2WJVA 2PA0A 1XTKA 3K0EA 4IWYA 3ZHSA 2FA9A 3H99A 1Y81A 2YWEA 1QONA 3NP7A 5FQNA 4HB2A 4P84A 2GH1A 4G25A 2M6LA 4BFWA 2NO5A 1KBOA 3M2TA 1YRHA 3FETA 5JISA 3GGGA 4MGHA 1NVDA 1X7YB 3PUKA 1O3YA 2BJVA 3QSGA 3ANTA 5D01A 1D9XA 4CKEB 2GN2A 2OB1A 4F8EA 2D2IA 4MLPA 4YDHB 5CU7A 2RGYA 4QXQA 4G9BA 5K0JA 4QFCA 3SLKA 4U7FA 5DI3A 1F38A 2FW9A 2G1PA 4H7EA 2GARA 2I7VA 2ZTMA 4Q1BA 5IC6A 4DE5A 1NWCA 4M1TA 2AZDA 3R7AA 3H2JA 3MCUA 3PRKE 4U9UA 1WKBA 2D62A 2GBPA 3SBEA 1RQXA 3TF5A 1L4KA 1JSXA 2FDRA 1Y8RA 2AIRA 2X40A 3F5FA 3RUEA 1BXRA 4XLLA 5LZ4A 2BFNA 3EG9B 3GPBA 2XTZA 2R3SA 3RHTA 2ZE8A 3EVDA 1K88A 1ZBDA 1KJNA 3D5QA 4IXNA 5LKAA 1CS0B 1N6OA 3KL4A 4UUOA 4U6SA 1TO1E 2IY9A 2OVBA 3C8UA 2L19A 3CIOA 3HCWA 3IQEA 1OW3B 1QFZA 2GM9A 3QPWA 3NBUA 2Z56A 1U2ZA 2QG9A 4UBIA 4CODB 3RK4A 1JTVA 3RVPA 1YL6A 1JEOA 3GDOA 4CDMA 3WLLA 1AN0A 4BBJA 1JWBB 5KOYA 3VJRA 1JDZA 1LDBA 3MF4A 4V1CA 4MA5A 4DCSA 3W05A 1E3LA 1AU9A 1W59A 4KK3A 3TJZA 3ZIUA 5J5AA 1PS8A 1IATA 3MCVA 10MHA 2P6NA 1QK5A 4J3FA 2DJIA 1YJAA 4K40A 5I48A 1HYQA 3H0CA 5D3ZA 3LBFA 1DIOB 1ZOSA 2IOYA 1SPBS 3CE9A 1XR3A 4TUYB 4H6XA 3GT3A 1EFUA 1K5HA 4BX9A 1WW2A 5DHRA 3JS5A 5J2UF 5CUQA 3DP7A 1NNI1 2WOJA 3GJ6A 4X54A 1DUVG 3SZOA 1RFLA 3ACBA 4UHBA 1W87A 2Y05A 4D43A 4CMCA 4LUCA 4BLRA 4L8YA 1GV1A 3K9WA 4N6OA 3BWDD 1LQTA 2P6PA 3CGGA 4DNQA 1J0EA 4JROA 3T38A 2W48A 1NIPA 2B98A 2B1IA 4FVTA 3C3JA 4BO1A 3W6NA 4NV3A 3RREA 1MAHA 4KDCA 3FOZA 4XFKA 1JTFA 4HVTA 4X5OA 2J3LA 5BQ5A 3MJRA 2BKEA 2RG1A 4O4LB 2A3RA 2IZ0A 1BEUB 4EI2A 3ITKA 4RKWA 1WG8A 3L7AA 4QSMA 3DE7X 3TQRA 1I2ZA 2CDAA 2HU8A 3LM8A 1ZWLA 4R71A 4ALKA 4AX4A 4BJ6A 1CF9A 4Q9AA 2J9XB 3LQRA 3LUFA 3EVCA 3NIWA 2OZLB 3N8GA 2B4YA 2JL1A 1KO7A 4MGEA 5K2OA 3F97A 4KIWA 3GLQA 4RKRA 3OZWA 1P91A 2E5LB 1IZYA 2FB9A 2YJ4A 5HDQA 3KDSE 4R2JA 5FL7A 1IOLA 1BE1A 1PBNA 5EE5B 1NYRA 2PPLA 1FUIA 1OTYA 3DEHA 5JAIA 3A2MA 4BMVA 2A9JA 4DDHA 2VP5A 3ER6A 4LNUB 2C29D 3L1HA 1PFWA 3FDJA 3TZHA 2EJCA 2YVUA 1GCOA 1FEZA 5JWHA 3HK2A 1F6DA 1PZXA 2E9SA 4N3AA 4RETA 5AO9A 4MV1A 3PWSA 3TOSA 4L16A 2X86A 4BGVA 5AVRA 2QUHA 4IIFA 2A1UB 3SZGA 1QV7A 3ANMA 3ZHXA 4CG2A 1I3LA 1JPNA 2LIPA 3A7DA 4Y7CA 5KNCD 4B6QA 2XTMA 1EFKA 1YS1X 3IVRA 3FOEC 3QLUA 4MQFA 1HX7A 3U0BA 3IMCA 4DSZA 3DOJA 4QATA 3V7YA 2QW8A 4WZBA 4EB0A 1M2EA 2QD1A 3HNPA 1ZJ4A 3CKYA 4M1OA 1F1JA 2GXAA 5TARA 1R74A 4KRFA 3KG2A 3USZA 1EFPB 2XVAA 4HAIA 4JLNA 4PLCA 3R5FA 4ZXFA 4DTCA 4KMOA 3AF4A 2C1EA 1DO2A 3GJ5A 4JH0A 1N36B 5IM4F 2W2MA 2MINB 3FKQA 4OP3A 4HFRA 2VWQA 4ZAXA 4NQZA 3AHJA 5EP3A 4PO1A 2QYSA 1R6DA 2XW6A 3H2GA 4QUHA 4Z3KA 5BNTA 3DPIA 2COKA 3SKVA 4GSLA 2E5WA 4PX3A 5AFSA 2EZUA 1U9YA 1JV2B 2HCBA 4O4JB 4TZKA 1Y9ZA 2PGOA 1J06A 3C6BA 2B8NA 3PFFA 2RAPA 3IKLA 1CB7A 1ZH6A 4AJPA 2RHBA 1S9DA 2GXQA 3KQWA 5HHTA 5G3YA 1MB3A 1U0NA 1WZNA 1ZEMA 3NAMA 4RTLA 1ZW1A 4LJ7A 1PJCA 4Q9NA 2A3NA 5JZOA 3D6FA 3OE4A 2JLXA 1WMAA 2EXXA 1Z0JA 4GU5A 1EZZA 1T3LA 2FFQA 3TCXB 3TR0A 4BB6A 2AOTA 2NUTB 1V16A 3CXUA 1Q44A 1V41E 1JLSA 1TM2A 4GR4A 3V4FA 1KOFA 1KYZA 1VBMA 1WQ3A 3UJNA 4F4IA 4RKQA 3TNLA 3MWDB 1V8BA 4BPRA 1JG4A 3BCHA 2C98A 5H70A 3TMAA 1FX0A 2I7TA 3B1ZA 1JPUA 4QVKA 3N8DA 2FNAA 3AUKA 5GONB 2P3SA 1SVNA 3GXBA 3HH8A 4JOSA 4W1PA 3W1WA 4AP5A 1A9ZA 1BWSA 2QRVB 1X7HA 3MJVA 4WRRA 5ALFA 4JXZA 2BEWB 1QH9A 2JH8A 1USIA 3WV5A 4EGQA 5AVSA 3PI6A 5HQ3B 1UXOA 1UCFA 3FHCB 1WD5A 1A9OA 1BU8A 3FHLA 4FFOA 2WAMA 3FI0A 3ND8A 1DSSG 2Y3IA 3L7IA 4RFVA 1ZMXA 2DFDA 2PKXA 2YHAA 4V3BA 4KQFA 2Q4TA 4PG8A 2O52A 4Q1AA 4MV7A 1P2SA 3I1JA 3OCYA 1UJ5A 1E6UA 4YREA 1YZKA 2V5AA 5CLQA 4G1MB 4BE9A 2R1VA 1HURA 1RM5A 1JA9A 1WW8A 3LLVA 4ZYYA 1NSTA 1SXJA 4G81A 4XCXA 1MJNA 5JEEA 5KVSA 1XQYA 5BW5A 1EVIA 3BRWA 1T0JB 1W88A 2FY8A 4UXHA 1BGVA 3BD7A 1SKAA 4BWYA 4YMGA 4QEDA 3PEYA 4F9FA 1VPWA 5L95A 1WDKA 2PMDA 3RQIA 1H6AA 3VH3A 1DJQA 2J3DA 2YZ7A 4YP9A 2DR0A 4GF5A 4QUBA 4ND7A 1GO2A 4E4TA 3ZVNA 3PXUA 3MS2A 1T5IA 2CB0A 2PTHA 2A9KA 3P0HA 1TXGA 2O50A 3CURA 5M04A 2W98A 5ECGC 5ER6A 5J5VA 2C5EA 4KKVA 2JLYA 5EZYA 3FWYA 2AV6A 4NPCA 3UJAA 2P9GA 3DD1A 1GGKA 3A14A 4U2KA 5LXTF 4BIIA 3T54A 1CZLA 3CONA 3MLAA 1TU0A 1TZ2A 4FGSA 3Q87B 2F9LA 4YT5A 4ENUA 3W04A 2J9FB 3IUQA 4W5RA 3GX1A 2QL6A 4MLCA 3O8OB 3WLFA 1O0CA 4XWWA 2B83A 3GVPA 3ZHRA 3KALA 3L5OA 4JVNA 1GM5A 1AKRA 4B34A 5DM70 3RF6A 1TTPB 1Z5OA 2A84A 4HB3A 4MS3B 2BE9A 2CF6A 1IE3A 2XCQA 4H7PA 2B7CA 2CXPA 4GYJA 3C4JA 1RD4A 1QLHA 2PXXA 3Q5DA 3QXGA 2BHNA 2LWIA 3CH5A 2VDKB 2LVBA 3UH1A 4BPBA 4JBYA 2FPPA 4NZZA 5GV7A 3PD1A 2PUWA 1VHLA 4KQKA 3V2HA 3ADKA 1W36B 4LYAA 1T4BA 1U8ZA 5AYVA 1F0YA 3QE4A 1HE8B 2AL7A 2EQ5A 2GPAA 2O1XA 2PUHA 3AFOA 3I4FA 5EEGA 3WGOA 1FNCA 4D3DA 5J43A 5KC9A 1UDWA 3W5JA 1HKUA 1UT8A 1T5OA 1V8PA 1RXEA 1U04A 3F1LA 4TOIA 4FGLA 5C4IA 2QQFA 3WMFA 1U1CA 1P31A 1WAMA 3LP5A 3INRA 5LL6P 3D6HA 4DR2B 1Z22A 4ZVMA 5IAEA 2G06A 2WNSA 3KXIA 4J0DA 1Z5GA 2IEBA 3W5CA 4OB8A 2QB5A 2H1WA 2Q1TA 3AEYA 3B5EA 2AXQA 3MOSA 4MVCA 5FIUA 1LRKA 2O8NA 4RMNA 1Y82A 2LDBA 3T7KA 3ZZTA 3EPRA 3IV6A 4BN5A 4DKJA 1NDQA 3MK31 3RD5A 1RQNA 1T9KA 4DLNA 3NEAA 4AKSA 4R8LA 3T3OA 1RYDA 4DA7A 1N4DA 2PKQP 3AHCA 4ERNA 4PVDA 5MFZA 1ODCA 4FMCF 5E95A 2O2ZA 1C5KA 2QUZA 2XMSA 3OZBA 5FP0A 4YHHB 1NF8A 1ZXBA 4LF6B 4HH3C 1XYVA 2E1PA 3PKZA 5MN6A 4QL3A 4A8PA 3N6XA 3VR5H 3QIVA 2DPGA 1RYMA 3DBOB 1XOIA 3SYNA 3AUYA 1QZ3A 1XUOA 2PU7A 1QTNA 4MQ5A 1RZ3A 2WF7A 4QBIA 1W7AA 2J7KA 5EWJA 2GVNA 2E4WA 2JAWA 3C3KA 5AKJA 3HRHA 1SBYA 3NEPX 4Z99A 3VI4B 4JYCA 1FRFS 5C8ZA 4P58A 1TGYA 3UMFA 4QSHA 3C3WA 4PYIA 5IJAA 4GMGA 5FLXA 4L22A 5AHRA 3RRYA 2WTNA 4JSRA 1Z38A 2O1SA 5FF9A 3WLQA 1KYXA 5IBPA 3DW3X 4F1JA 3JYQA 5BNIA 4ZO9A 5EPOA 3THRA 4D99A 3MWFA 4OSEA 2O2SA 5ALGA 2Z08A 3VU9A 1P0QA 2JIQA 2YUIA 3VSEA 1O0SA 1EWKA 5AHXA 3K35A 2XNSA 4NQRA 3ZUGA 3A9TA 1PVDA 1YE3A 2IXAA 1I4WA 4WZBE 1B14A 1GG2A 4UXJA 4FIDA 5E6SB 4RF3A 4TKUB 1OBFO 3GLSA 4EW2A 1V1RA 2G1JA 2RGNC 2BMJA 1KU6A 2RCNA 3D59A 4JKOA 3S99A 1WA5A 2XB6A 4F3NA 5DISB 1NN5A 7REQB 4JYAB 1NA5A 5HILA 5CDGA 3ZLVA 1MJGM 1FDUA 3MLBA 1HNNA 2OVFA 1OZAA 1Y48E 3L77A 5FR1A 5IW8A 1R9GA 2AQHA 2RHHA 1RC1A 2XE8A 4IHKA 5FPYA 2YIMA 3KPUA 2X3FA 3X44A 1JF8A 3ZW8A 2O2XA 3H11B 3U3DA 1MKYA 3L79A 1T4GA 1TI7A 1X9GA 3B1VA 4TTRA 3UJ3X 1HTBA 3WLMA 4N8DA 4UVDA 4D9CA 1ULAA 1QIKA 2B1JA 4JK3A 2XE7A 4G1CA 5KTYA 2ZBEA 2JFBA 4EUSA 5I9BA 1IBMB 3A9CA 1PR6A 4X60A 3FCCA 1KE2A 1SQ5A 5JDCC 3WYDA 4P8RA 3EWIA 4V3CA 2P6MA 3E9NA 5BSHA 5HZHA 2E4YA 4HX5A 1Q7TA 1SKUA 1Y4DE 2B6HA 2X8JA 4K26A 4M7WA 1XN4A 1MFPA 2Z1NA 3CPEA 4HB4A 4JNCA 4RVCA 5P8WA 2CNLA 4PIPA 4E33A 3H97A 4NCIA 3GBVA 3KB2A 1DUIA 2XTJA 5KTRA 3GJYA 3EQ6A 3HCRA 2W8BB 4KDEA 4A6EA 3S0JA 5E3JA 4PZZA 4MXDA 5FOWA 2BTQA 4CN9A 5LFAA 1BE8A 1Q0RA 1N6LA 4OEHA 3WWDA 1LLUA 2FR1A 3T06B 4U39A 4FDLA 4DJDC 5IMBA 3SS8A 1MW9X 2JHCA 2FUNB 2JD0A 2B34A 1RADA 1FTSA 5CEFA 1NN3A 3HGMA 1QQ7A 1E9FA 2Q45A 2R1TB 3JVEA 3PGXA 2F43B 2O05A 1DRVA 2PRSA 1GGNA 1HRDA 1JT2A 3KKEA 4HDMA 3CR7A 1OD6A 1TF7A 1L5SA 3O7MA 4RPLA 3IQHX 4BP8A 2C57A 4R8VA 2QE7D 2SKEA 5CAEB 2Z2KA 2NSDA 4C4YA 4IZHA 4CNBA 2WJGA 3R0VA 2FMHA 5I7AA 2OHFA 3S2UA 3MA0A 1XFAA 1XALA 4GLOA 4B44A 1J2JA 3B38A 3BMQB 4L9AA 4RMHA 1EJ6A 5AI5A 3HJAA 4D98A 1EE9A 3JWPA 4IIHA 4PPYA 5JTTA 1KSFX 5BV7A 4ZCRA 1WUYA 1Z39A 2YIVX 5ALEA 4RTNA 1Y7TA 2RDMA 3IA2A 1G7RA 2ZBUA 4MQ6A 1L7PA 1NJ5A 1PFGA 1QGED 2DKNA 2C2ZA 2IHYA 2C5GA 2BHLA 2P0YA 3ONNA 3R5XA 4FONA 3WK8A 3BSFA 4P3XA 1O97D 1V6CA 5FTLA 2BI4A 3BB3A 4B3CA 1OX4A 1Y98A 1FFGA 3IBTA 1BKDR 2OXFA 3THYB 3HPRA 1J2RA 2W11A 4EI8A 4MWEA 2NU9B 4FEEA 4KE8A 2VDRB 4O2BA 2QZ9A 1JJIA 3HR7A 1OIWA 1GEEA 3TECE 2ZANA 4EFKA 4AO6A 2VQFB 2JEYA 4LV5B 4Y9UA 5DLDA 1MPXA 3WB1A 1WCWA 4GVXA 1D0IA 2OGZA 1SOWA 3FZNA 3GEIA 4I2NA 4BO8A 1V1JA 13PKA 1KSJA 4HG2A 1RU3A 3T95A 2YWJA 3WQHA 5AVWA 1LBSA 3QELA 3VISA 4MQEB 1YASA 1L4YA 2H9IA 2JFGA 2OSVA 3OJLA 4N18A 5ELMA 2ZYWX 5KNCH 4EGJA 2C95A 2I62A 1ZM7A 5HG0A 1JDSA 2X4DA 4BMDA 3E8MA 4PY2A 3MCZA 5DOVA 4HHEA 5A5FA 3O3OB 3ZCTA 4QPCA 3ZIAA 4AURA 4YAUA 1G21B 2OXEA 1HDIA 1KO1A 2J0SA 1B8PA 1YQDA 2F1JA 2FSHA 3KKLA 4ZO8A 5IH3A 2VQ6A 4TQUS 3P8ZA 1S2NA 4GYYA 3KCNA 3VR6D 5JASA 1T9CA 4EVRA 5JWOA 1NG1A 1KQ3A 4P7JA 1NRXA 4GL2A 2OBLA 1CR2A 1PGNA 5B7PA 4GQIA 4LKOA 5GQSA 1IONA 2FPMA 1PNTA 3RSFA 3CLTC 1DEHA 1QPZA 3T5DA 2B99A 1TAQA 3QQPA 4QTTB 4D9MA 2RGNA 3DNMA 5DE3A 4WMLA 3J7AC 2QLTA 4E7PA 4Z8YA 2REBA 1RWXA 5AJHA 1ND5A 3KQVA 3SMVA 5EMNA 4ZKDA 3O2JA 2P77A 3H9JA 1UOPA 1FUUA 2R8OA 3QV1A 3LLUA 4LRQA 4EPXA 2D8AA 4FCTA 5A4MS 3O3MB 5KTMA 2G4LA 2G1KA 3V4RA 1LNQA 2YZNA 1DWQA 4Z0TA 2GN6A 4DV3B 5CITA 2ZDGA 2OV8A 5U4XA 5GADl 2QT1A 3K0HA 3AOGA 1MC1A 2PZFA 1PR2A 4Z2AA 1UBJS 3CLSC 4WESB 1SU7A 1RWQA 1B6TA 3M5DA 1QFJA 4QQ8A 3UB4A 4MTLA 1W36D 5ESDA 3P1JA 1FTGA 4G2TA 4AROA 1L7EA 4AKIA 2Q3CA 2HF8A 2JI6A 3RIMA 1W9MA 1F2UB 1O57A 1XL1A 1N5KA 3ESQA 5FWXB 3BILA 1T2CA 3I1FA 4KQGA 4K6KA 4JX9A 2I9KA 4H35A 4L3VA 4AG5A 1MRSA 1CULC 4R1PA 4G1BA 2YNMC 1I7DA 5I9SA 3A06A 2IQ5A 4DCUA 2CDRA 4KMMA 1KMCA 4GZ6A 4N0EA 1DEOA 5KNDD 3O0DA 2G4CA 4HYTA 1T36A 3DAGA 2ZEJA 2P9TA 4WKPA 5D5HA 1DQPA 1SQ0A 5KNLA 2OZEA 1EIZA 4CDRA 4J0CA 4KPUB 3AUSA 1Y8ZA 2IHZA 3CNOA 2XUKA 4GWLA 3UMBA 4R2WA 1U0RA 4WLUA 4OJYA 4BQQA 3TG2A 2P30A 2PEZA 5U9CA 1RYZA 4L4YA 3AR3A 3L4SO 3NWEA 3EW9A 1COWA 1QRDA 1JG7A 1YJQA 4PXAA 3R6TA 3UTCA 1Q5PA 1YA4A 4AO7A 4DLPA 1T4MA 4WKCA 1EX7A 4KX5A 2Q1XA 4P5DA 1UP6A 2DX7A 4MS1A 1RRKA 1ZVMA 3ND6A 2BDTA 3DFZA 4XUGB 5J4VA 1Y8AA 2YTZA 3SNHA 3QG5A 1KFCB 2H85A 2FV8A 5EIFA 4I81A 5FPPA 3F3KA 3AK4A 3U4IA 1RAIA 2QIOA 4GO1A 2FUEA 5EGSA 1UDCA 3RRFA 1STOA 1JP7A 2WTBA 1M7BA 4OSPA 4IDAA 4ZI7A 3SZMA 5IJ0B 1CJKC 2VNKA 3H1TA 1OXXK 1KA9H 3AJ9A 3NJ4A 1CZNA 1Y37A 4JJEA 4I4LA 4XRRA 1TK2A 1MQ8B 1KKLA 2PQ2A 4EJMA 5JPIA 3WGLA 3A6LA 4GBED 2Y4NA 3BAFA 4M46A 3GQBA 3ZXXA 5EKUA 4MVJE 3WP1B 2JH3A 2P6OA 3VR1A 5FX2A 3ESDA 2DBRA 1O5IA 1VHTA 4NPAA 4H3HB 4XCVA 4W5QA 3DBHB 3AEKB 4FT4A 4WCVA 4AG6A 1ECJA 1KYWA 3N05A 4R5MA 5L3QA 4LSWA 2FP4B 3AM1A 2FPXA 1G41A 1K8RA 3IS3A 2B94A 1MT0A 1AN9A 4MO2A 5CH3A 5D2CA 5HEKA 2XNKA 5C4GB 3BMOB 5TS2A 1IUKA 5K6AA 3BTOA 3WL7A 3I61A 2EJBA 1Z6PA 4CETA 1KPHA 2GNOA 4HSEA 1UBHS 1GGVA 4R40A 1KEVA 5KMGA 1TB4A 2QVZX 3U48A 5BW8A 1J6UA 5ERGB 2JLSA 3JQBC 4OAPA 3DAYA 4B43A 4BVKA 1WETA 1Y9AA 5KX5F 4PHFA 2EHJA 2ZPUA 1QIHA 2EJUA 3BXEA 2FPLA 3HV0A 4TSRA 3BN3A 5L3SA 1P7PA 2UYOA 2W2NA 2YXNA 3PG5A 1QVWA 3KE8A 1CUXA 2PR2A 3RS7A 4RAOA 3DDUA 1LZKA 1IN6A 4ZAVA 1R4ZA 1Q50A 3ESZA 4Z51A 3DCJA 2WA1A 3PDWA 2J0UB 4AYWA 3BJEA 2WHRA 1J0BA 1E79A 1P77A 2VDJA 5LA6A 2Q5QA 4P92A 4C3UA 4YDSA 5BWOA 4PLHA 2YBEA 1H22A 2BRUC 1PZGA 2Y1CA 2VSYA 4BE7B 1NNLA 4FZJA 4QFMA 4CTNA 3IIEA 4BFYA 1OGJA 4QOEA 5D00A 2ERCA 3HJGA 2C9OA 2SKCA 3Q85A 1OOEA 4NONA 2DECA 3TDMA 3EG5A 1Z4QA 3B51X 2EX1A 3IQXA 1NIJA 4F4UA 1YDMA 4LJRA 4X1OA 1L5YA 1JSZA 2ZGVA 1LZLA 1YD7A 2CVZA 5FOQA 3QYFA 4IRMA 2VF4X 4G0PA 3OOJA 2JGMA 2Z5VA 3ZGZA 4C0SA 1XG5A 4UPVA 4C2AA 4QECA 2PRIA 3L0YA 2KPOA 4DSAA 2G83A 2D5CA 2DP4E 4TN1A 1J4AA 1LC3A 1C9NA 2ZQ5A 1Y6FA 4MUYA 3KHKA 4WK0B 4X6YA 3UHAA 4JT2A 4A2WA 4DQKA 1XQ9A 3F74A 1NBWB 1JR6A 4ZVSA 1FTYA 5A4AA 5CA1A 2H11A 1MLDA 2XEXA 3V80A 5JYEA 1GKKA 5CTJA 2W2LD 3V8EA 2VHXA 3VZBA 4YXWA 1MJGA 1O5TA 5C1IA 4IRUB 4LZPA 4X24A 4F6LA 1IG3A 1QIFA 3PC4A 2C4VA 3EZNA 5EKTA 3J80A 2VNSA 2FKAA 4GZ5A 3T4XA 4UBKA 1FXSA 4PZ9A 3DHEA 3EMVA 4PPQA 2AFRA 4A7PA 4EBFA 3F90A 3COSA 3CS3A 3K2IA 4UUPA 1NR1A 4V0SA 3KQYA 4UTZA 4X44A 3EODA 2X9LA 5G3ZA 521PA 5H9WA 1TC2A 3P0EA 4RD3A 3TTVA 3RYIB 4E3ZA 1MIOA 3V6MA 4HQLA 4C0AC 3PPVA 2FWJA 2P27A 4YV2A 1Z56C 5KTOA 2PL1A 1QAMA 1GFSA 1Z17A 4NAVA 4UVHA 3ZWDA 3PYLA 4LV6A 4BMCA 3RLIA 2IEYA 2DBQA 4MRPA 3WGNA 4MUNA 3ZGOA 2YR0A 2W6CX 5EGNA 2Q2NA 2MU1A 3WNBA 3DV9A 4TL8A 1WHTA 3RHSA 2N1MA 3BZUA 3SC2A 3V1NA 5ITVA 3LPLA 1JH8A 1TQ2A 4LTDA 2H4XA 2X6TA 5JAMA 1DCTA 3ISTA 2PDAA 5IFLA 4EA6A 1OQAA 4FDAA 1NVEA 4PN3A 2Q4DA 3GGCA 3QFSA 4JI7B 4YJFA 2F4NA 2LW7A 3JYHA 2WUVA 4FP9A 1UJCA 4U0KA 1CEXA 4E5VA 3RLFA 1RMYA 3NHZA 3CA8A 3S81A 3NEJA 5IYZA 1IK6A 3ZKWA 2L17A 3EXFB 2XCLA 3KT0A 4ISCA 3QSYA 2VJNA 3L0BA 2HA2A 2TSYB 4JODA 4CLRA 5D3MB 1KI1A 4FE3A 1CSEE 5EXXA 2F8TA 1F0PA 2JCBA 3UAVA 4E30A 5HGXA 1FVXA 1J2UA 5C1DA 1QYCA 4KI0A 5CTAA 1FFXA 2XT6A 1O03A 2PGIA 4JJ6A 4HJRA 4MHSA 1UMCB 5I47A 4TQGA 4NIMA 2C31A 1XDSA 3LF1A 3RDPA 4KLZA 1U2QA 2VTEA 1EVQA 4KN6A 3A6GA 4F5YA 2UYQA 2V9ZA 2OE2A 5GVSA 3H8VA 2H7YA 1R0BA 4RQAA 4E12A 2C7RA 5D5PA 3KU1A 3FI9A 4LXGA 2VA8A 3DZ8A 1ZCJA 5CLHA 3QKIA 1ZFNA 3OOHA 4M1WA 4JBLA 3UF0A 4AJ4A 3OX4A 1GTRA 1E69A 3LAWA 1K7SN 2NXWA 2DWQA 4D02A 1N57A 3OTIA 4LQ4A 5DYIA 1PL8A 3TLMA 5C5CA 3AG6A 5HE8A 4WT7A 2C7OA 4PG4A 1G8MA 3REGA 3VDRA 4DREA 1LS1A 2RH5A 3CTMA 1WOMA 3WLHA 3BGOS 2PYIA 4BAUA 1PHRA 3KAJA 3OZCA 1N5JA 4ER0A 3CE6A 4ZOLF 2P8JA 3W7AA 2QBYA 3ICCA 2KM1A 4RLQA 1G8JA 2CF5A 3BE6A 3SG0A 1MEEA 2BH9A 1PK7A 3K5PA 5JR3A 5IEJA 3G0IA 3EXIB 2O1EA 3T9FA 1IQ0A 3O4HA 2GF0A 3H2HA 2XGMA 3HN6A 3N5CA 3DVLA 4W9RA 4V02A 3T4PA 5CB4B 2YJ5A 1SVWA 1EDZA 4INPA 2WT4A 3KQSA 1VHDA 3GJQA 2AI3A 1EUQA 4IF4A 5DGDA 2Q5HA 4CQNA 4N48A 1KDYA 4BZZA 5B4TA 4A0GA 1P1JA 4DYDA 3T4UA 3OIUA 1JEEA 1OE0A 4N7BA 1XKQA 1P73A 3PXBA 3V4PB 4AJKA 5IVHA 1AV7A 1N2OA 1ZW6A 5IC5A 4N6NA 2ZJ5A 1LPPA 1KH2A 2F48A 6CHYA 1JL3A 1E2UA 3OMWA 3NOQA 3GJTA 2XCTB 2PGNA 1OWLA 4MR8B 4Y30A 1KR2A 1WQ4A 4ND8B 4FW8A 1YKSA 2DQ4A 1WOYA 4UUBA 4B84A 1P19A 1V26A 2W8ZA 2WUDA 4ZT5A 2XUHA 1RACA 2N9UA 2A0XA 2J85A 4M0UA 1FVFA 3C1AA 4MV5A 4UAJA 5BVGA 5ITZB 5GIOE 3KT8A 2DFLA 3NTLA 3FH0A 2YINC 1CUVA 4NH4A 4NYMR 4XPIA 2X0EA 5DP2A 3VXKA 3TG8A 2YWBA 3I58A 3VOTA 3CT6A 4BVBA 2G0NA 3JQQA 1VLZA 1Z07A 4EJ2A 5KQLA 5BURA 3G0BA 2PH1A 3HWRA 1POWA 3AESA 3RS0A 1JILA 2EFJA 3B1XA 3KTOA 2WF8A 2ZJ0A 4GGOA 3T8YA 4RHTA 4BKQA 1PR9A 2CHUA 4IOJA 2QR3A 2A78A 3WKBA 4A2QA 4BUJA 4CM5A 5C5EA 3ZVKA 1UKEA 2HU7A 4IWNA 4B4WA 4M0EA 3U40A 2JLZA 2IH4A 3G6KA 4DV5B 3CZMA 1GUZA 2O06A 1PNRA 3WAGA 3OD5A 2KHZA 3EFBA 4DANA 2BKLA 2WTUA 2UYHA 5ELXA 1QZZA 2AK3A 4RL6A 5CVTA 4E5DA 3N8HA 1GPDG 1QB7A 4S35A 2WWYA 1D6NA 2C8JA 4R69A 1ZJWA 3UHOA 1UXKA 1LSJA 2BZ0A 2OYSA 2HHCA 2WIGA 5HF9A 1B1CA 1M1YE 2A6PA 3I2GA 4GC5A 3W78A 2EGGA 3LZ6A 1U5AA 2FZWA 1PJ2A 2FPGA 2ZJZA 1KNQA 2XVZA 2R25B 2AJCA 3GAMA 5KWIA 1EESA 3OIYA 4TMYA 4A0HA 5KNDH 4UMFA 3E1SA 5HGJA 1QH8B 4CU2A 4FJ2A 3I37X 1FOEB 2RFLA 3PEVA 2VP4A 5B1DA 4BIMA 3OICA 3ZQKA 5IF9A 2IBSA 3AF6A 3RYHA 3O82A 1BXGA 2PT5A 1E8DA 1I1NA 3JPYA 2M32A 1PK9A 2GS9A 3C7AA 3LQKA 2FZGA 5CW2A 1EXDA 2VAPA 4I4TB 4NBVA 1HT0A 1XZMA 1JLHA 4U9HS 2RJ3A 2HDHA 3L6CA 4Q7MB 4WLVA 1U0BB 4C78A 1FNBA 5KVAA 1DXOA 5FORA 4TXMA 4ZOAA 2H8KA 3DEAA 1O87A 3R7SA 4WVFA 4CMHA 1WUKS 5ED4A 1MCZA 4WADA 1USWA 2ZT7A 4B3DA 1OTHA 4D45A 4UKDA 2GHQA 3NYRA 1CHNA 4HJXA 1OAOC 4KPYA 1KQPA 4REQA 3KUKA 4WOJA 2E89A 1VE3A 2RGXA 1H2YA 4O4HF 3NHMA 3E23A 4OQXA 4X92A 5T57A 4CMGA 2X6QA 1TFUA 2AG6A 3R9WA 1TM5E 1RTTA 3ANXA 3DDCA 2KE5A 2JPDA 3G8BA 1P9WA 3I8OA 1UANA 4FFBA 1VMIA 1XKTA 4JC0A 4LDRA 1E0DA 1M76A 3MD0A 2ZTVA 4RVFA 1HI9A 2OV2A 5CPBA 4YFYA 1ULZA 1XZAA 2GESA 2H7XA 2J6HA 1E77A 3FTFA 3ILSA 3O4RA 3VOSA 1KEPA 4CIBA 4J0GA 1NRJB 2R11A 3ZNOA 5KIAA 2HB6A 4M7RA 4BMSA 5FTKA 3RYCB 1ZESA 2ZT5A 2AUTA 3GZTB 3PC8A 5E1OA 2CXRA 3WBFA 1T3TA 2IY7A 3SVLA 4QFDA 2PE5A 3U7GA 1Q11A 4FFWA 1QO0A 3EPHA 1QQ6A 3TKAA 3FUWA 1CUDA 1JX6A 1KBQA 2MSEB 3I01M 3SYMA 2WV7A 2J7PA 5EUCA 2W71A 2ZRKA 3VNQA 4KVFA 1IJEA 1BE6A 2YHSA 2ZYRA 3LUBA 3H13A 2C5FA 3GT4A 4HXFB 1UINA 4TV9B 2XA1A 3ZTYA 3HCPA 1N1DA 1SCIA 5EXPA 1U28A 1GPYA 1NZDA 1XU4A 2NSYA 3UMMA 5JO9A 4MWDA 2BEUA 4OHYA 3K53A 3ET5A 4D8YA 1B3BA 1NXOA 5KJ1A 2H52A 2WAOA 2D1SA 3FYUB 3HBJA 3IPLA 4U3JA 4V03A 5EZSA 3OIFA 3PHHA 2QSYA 4UE6A 4QRHA 3PQEA 3OCJA 2XIQA 3R6WA 4ITRC 5IJZA 4E5NA 1UT6A 3Q5GA 3UOWA 2O8EA 4GH5A 2M6SA 2NIPA 3B9RA 3TTWA 4RPCA 1E7WA 3CUUA 5HPYB 4DLLA 4QYSA 5L3ZA 2V65A 3IXLA 3NIDB 5DGXA 4JLWA 3DKVA 3ZYZA 4NOKA 3LJKA 2DBYA 2WIAA 2B3TA 4BNIA 1T9AA 3UEOA 4F92B 4C2UA 2XBLA 3W79A 1CJCA 1QCDA 4BGEA 4P4LA 5FUXA 2OCYC 1N33B 3LQFA 4RY9A 1YZGA 5JY1A 2XTNA 3I12A 4H4CA 5DSXA 2HEIA 2G4VA 3W3AD 3LBAA 3ITDA 5AKIA 3EPKA 2R68A 4RIEA 1Q91A 2QN2A 3PDIB 3GFTA 4JLAA 5TMPA 1K27A 2GHIA 2WUWE 4KWCA 4NENB 5LR6A 1UC4B 3C85A 4PC2A 3KIPA 5FOTA 3RSHA 2L42A 4WNCA 1QFMA 3OQOA 6REQA 1W0CA 2CNNA 2DHRA 4OREX 3HKBA 1US8B 4JR0A 1CVLA 4YRKA 2MHCA 2I0FA 2P40A 2PMFA 4MAAA 4DM3A 3C8ZA 2IBTA 1KGDA 2I4OA 3C6YA 4H3VA 4B75A 1BHQ1 3CNNA 3FPGA 1P3DA 2VP0A 3CNQS 5HCNA 1Z13A 3CW2A 4QYIB 4DVGA 1U9JA 1JG6A 2R44A 4I6GA 4MZXA 4ACBA 4AZWA 5HKOA 4MJLA 2BP7A 2WPDA 2IE8A 3A28A 2R6AA 4QM7A 2HBZA 4B5LA 2A30A 4WY2A 5KINB 2X2OA 3LQ4A 3S28A 5EE1A 3B2QA 4FZRA 4A1FA 1L7NA 2ZUBA 3BK2A 1S4MA 2PZKA 3LP6A 4TTIA 3GEMA 5IJXA 2HJVA 1P2GA 4PC7A 4QOFA 1XD2A 4BEJA 2O5EA 2VOJA 4ZDIA 4IOKA 4MPPA 3GLIA 1Z4OA 2R7AA 5LC1A 5DT2A 5GOZA 2WP0A 3HFGA 4Y2JA 1T3GA 1F20A 4OB6A 2NYAA 3VKUA 4ZZ0A 1GG9A 3EA0A 5M3BA 1OAOA 1I94B 1A9YA 1AHIA 1JBKA 1QDUA 3TXAA 1H94A 1ICIA 2PR7A 1WX1A 2X14A 4XGQA 1MV8A 1MJ5A 5CK4A 3GWGA 3N0WA 1BX1A 3TM5A 3D5EA 5I7OA 4YQZA 3R20A 2DR3A 3OOYA 1P6QA 1QAQA 3L2OB 1V3VA 4COKA 2BTEA 4HVLA 5J4YA 3L6BA 4MUHA 3DMYA 4O33A 1IY0A 4CV1A 3OUZA 1VMDA 4DLKA 3ELUA 5TX7A 2O8FA 1E2EA 4KUHA 4XUCA 2QX9A 5F7XA 4M22A 1IBSA 3AERA 4GLBA 4X3OA 2IS1A 1BMQA 2MWMA 4PFSA 4KFCA 3CXRA 1NV8A 1XQ1A 1Y1QA 5EYPA 4IIXA 1T9GS 3EVAA 3M2PA 1BTOA 1YQQA 1ISGA 1USUA 2LDXA 2XJ9A 3GCXA 4M9UA 1PYDA 5KQPA 2EDAA 2FUG1 4WA7A 1SRRA 5F5NA 5JYBA 3BIFA 3GPCA 4BCDA 3O8NA 1FDVA 2RKOA 3K05A 1PV4A 3CF4G 3IBGA 3IQFA 3UJ9A 5JXHA 1FX1A 3H42B 4DYHA 1UXGA 2XYVA 3FX2A 3IEMA 2A57A 1HH4A 3EXHC 2F3TA 1DC6A 1XCPA 1M6YA 3DZFA 3QA9A 4KAXA 5JDIC 1EVEA 1Y33E 4BQFA 4AJNA 3E7WA 4Z4QA 3I23A 4PZCA 4FSHA 4TM8A 3SPXA 1RS0A 3FZEA 1V3QE 2YXLA 4HAUA 4HQOA 5JARA 1Y5NA 1ZSVA 4KQHA 1EIWA 2JLWA 1EZ4A 3M4JA 4Z2YA 1SBTA 2HYDA 4KE9A 2H5JA 2BLLA 2JJMA 2UZIR 3G5TA 2IP1A 4CLOA 1T1GA 3QMWA 3DE2X 1S8FA 4DZRA 4KW7A 3E6AA 2B30A 2PZMA 4HWOA 4OFXA 2AQIA 1JR3E 4J7CA 2D2FA 2VPYA 1ZUNA 2WA2A 1W4BA 1AD2A 4GZ3A 3HBLA 1EZ1A 3NO4A 3U7FB 3GRYA 2O5VA 1GPLA 1T6ZA 4U4AA 5DLPA 4D4LA 1XQVA 3ADBA 3IMGA 1CY4A 5IT9A 1FSZA 3V6LA 3RVOA 4C04A 1C3VA 2VKTA 4K88A 4RM2A 1DJMA 2V5UA 4HZGA 1RPNA 3EGDB 2B82A 3EZ7A 3G8YA 3QX8A 3OCVA 4AVYA 4C0HA 3L6DA 4I8XA 3PNMA 4BV3A 1Q83A 5JVDF 1RI2A 3OTWA 4ID9A 4OVKA 1J8YF 1HZZC 2QG4A 2QHXA 1PJ8A 1Y4AE 5DV9A 1C80A 4HEA6 4DCJA 4EO9A 3HNRA 2P9CA 2HUPA 4D8VA 2Q7XA 3WB0A 1T8YA 2IODA 2GTIA 2V0NA 1GITA 5DEOA 3U4DA 3I62A 1TECE 2ZKIA 2WJ4A 3D64A 3WISA 3LHIA 1QGUA 4N49A 3RG8A 4BBPA 3TNJA 1IVYA 2B3DA 2F64A 3CCFA 4UUAA 4B7XA 5JS7A 1NFQA 2C9YA 5AW5A 3R74A 1A72A 4D57A 1JQEA 2Z4RA 4EL5A 2C5BA 3AHIA 3LCVB 1F8YA 1UFQA 2FEMA 1GSHA 1JQJC 2PMBA 3VRHA 3F6RA 4G0YA 5DTMA 3B7WA 4HAVA 4MIYA 3JRWA 3UMSA 4V1CI 2ADMA 1S8OA 2V59A 4TV8A 3EDMA 3AUAA 2XSZD 3KPVA 4QULA 2G40A 3QKRA 3ZOKA 2I03A 4I5DA 1VSUA 2BHRA 1HQKA 4WXHA 4BX2A 5LNK1 1YIAA 2HOQA 4X3CA 1QIMA 1U0GA 1E4VA 4EPTA 4YJ2A 3WWPA 4K03A 5ABPA 4CUZA 1NYLA 3V8PA 4EAAA 4KU4A 4PLPA 1NI4B 3QJGA 1DRKA 4B3IA 2PUAA 2O7VA 1KYQA 2BELA 5HYVA 5IJ9A 2IYYA 1INLA 4X91A 3HCFA 4O2AF 5LZ7A 1YF3A 3NANA 2X0JA 3L92A 2ZBQA 2XUAA 1E62A 2QVGA 1A7KA 1NJ1A 1POXA 3LUGA 2QU7A 2C88A 5FPSA 3PUIA 2J41A 1V8OA 5C2JB 1G4HA 4FDMA 3D8SA 3IOYA 1IK4A 1MF7A 2P1ZA 4ME6A 3PVZA 3GRCA 4U2FA 4JFAA 2J3JA 3HXTA 1L5FA 1FB5A 2CEKA 5I9MA 2A58A 3CUTA 4GE0A 3REQB 2FZCA 4DARA 5FI0B 3AW8A 2EIXA 1QS0A 2ISCA 3R1IA 2WZCA 1SWWA 1DKLA 1SK8A 2V6JA 2W6QA 3I73A 3N0RA 3BRCA 5K2MA 1DAPA 5EUQB 5GJBA 1XZFA 1RZVA 1KAHA 5HTKA 5BR7A 5H4GA 1K7FB 2AFHA 3CNHA 5AESA 2N47A 1M2NA 1TYDE 6ADHA 1BMFA 1VSVA 1CLEA 3WGYA 3USES 5COQA 3D02A 3L9XA 4PTZA 1KJ9A 2OD2A 2R6R1 3I3SR 5CVEA 3G9UA 2CK3A 4LCJA 4EELA 1YMQA 3T3PB 1FQWA 2C9ZA 4AQ7A 1NOJA 2ST1A 5AM3A 4Z4EA 1BDIA 4NARA 4LDNA 5BT8A 4BP9A 4L5JA 2GI4A 2XE4A 2BFBA 3ZGLA 1J5EB 1VC2A 4JNKA 3SKYA 3WZLA 4UMDA 1TYBE 5JDIA 1Z0FA 1W19A 4CMKA 5K8LA 1CR6A 3G17A 3WKDA 1JAIA 3HA5A 4KE7A 1O6CA 5LIRA 1DAGA 1NF2A 2APJA 1U0OC 2GXUA 4PGAA 3MGGA 3KWJA 4UAUA 3UWDA 4HZUA 5CA0A 2HXYA 4EVQA 5BYBA 2VJKA 4AFNA 4FMBB 5B2ZA 3B1FA 1KDZA 4H7JA 4WASA 3TS1A 5JLAA 3GGJA 4M0KA 1T1IA 2OCPA 2QT9A 3N76A 4L3OA 2QJWA 2XA2A 1DC4A 3CCBA 4HGOA 3NGMA 1SUBA 4EY8A 3AG5A 3GLIE 1GXSB 4D5EA 1CJVC 1VCOA 2GEUA 1JEQB 3OWHA 3GDWA 5E9WA 2Z3ZA 3GRFA 4IBOA 4OP2A 5TF0A 1TPYA 3KYCA 3OLZA 3T7TA 4JITA 4NJMB 3G9QA 2EHDA 2PL9A 5AK3A 5EWLA 2FHPA 3MB8A 1GV0A 3O31A 1RHQA 4EARA 5BSFA 4JJAA 3B5IA 1LBQA 3MAJA 3OMLA 5DIFA 4D82A 3B1YA 2V7UA 3KQLA 1YQGA 3THOA 1LQUA 3NWBA 4CLHA 4RV5A 4TROA 5CXSA 4EDHA 4C01A 2PNJA 3EPPA 4UNRA 3GL9A 3BMNA 3VA7A 3URKA 3DEJA 1KI6B 1ZZEA 5CVUA 4XD7D 3CC8A 1FPMA 4R3UC 4ESHA 2EJWA 3NHPA 2VF7A 1VLLA 5BWNA 1JHDA 2BDUA 3GMTA 1NUAA 3KJQA 3X1WA 3SS9X 1KDTA 1JMKC 1PX0A 2P7HA 1N3YA 3DE6X 1PFVA 5EWMB 1EM8A 2QRHA 3WIVA 4EG1A 4LCEA 4P4SA 2VCEA 4CMIA 1QJ4A 3EYWA 2B2XA 2ZZNA 1A8HA 4GBJA 4PLWA 2AVDA 2BN4A 1BFUA 1M8JA 2ZETA 3FPAA 4UHHA 1Q2UA 4DM4A 3Q8XB 1DKNA 1UJ2A 5D3MA 5DTEA 2QQ0A 3ULKA 3OQPA 4P54A 3PQDA 2O20A 4DMUB 3RR2A 3U1VA 3STYA 1U5BA 3CLHA 4RE6A 5EI5A 3NTUA 1T6YA 5DGTA 3QLTA 3GD7A 3QM1A 5SZJA 1QPGA 5AXAA 1JDPA 3CRQA 4JOQA 3CX4A 3V8RA 3FBTA 3RC8A 5BUSA 1DKUA 3PWTA 3OEED 4HH4A 1AKNA 4LWOA 5K51A 1QU2A 1DAFA 3BDIA 2YVLA 5H3HA 3W8EA 2AC7A 1XCBA 2FZLA 4BNKA 4E32A 5TVKA 4L4UA 4P82A 1J25A 3IXMA 5LBIA 2UU9B 1H2WA 4H1WA 1H2AS 2NZUG 3AWIA 3G5UA 3KV3O 4HBGA 1L3BA 4DDUA 1KYYA 1DFHA 1SG0A 2H54A 4GP7A 4L9SA 3JZFA 4GNKA 2BSAA 4WKBA 4CVNA 3FPSA 5TQ0A 1W0KA 2CUZA 1AK9A 1V5FA 5IVDA 2R7MA 3LWNA 1DI0A 3A9UA 3W3AH 4B9AA 4AAYA 1E6MA 1FS6A 3HVRA 1OYVA 4URZR 3ZEIA 1ZXLA 3PTZA 1Z2CA 4TWRA 2VBCA 4HTAA 3G8CA 4TKVA 2WB4A 4D42A 3H87A 1CPYA 4Z0PA 5FWYA 3IB3A 1MX3A 3DAPA 1AKEA 1ZLYA 2I29A 2QTVB 1Y4SA 3KHUA 4HCJA 1O94C 3TNDA 3LP8A 4TL6A 2OL4A 2A9FA 3BUSA 1YHZA 1V35A 2H5IA 5TQ2B 3BVPA 2HMTA 3OPMA 1FJ2A 1RQPA 2C4UA 1XRJA 2RGWA 1TK9A 5TXGA 4CUJA 2ZRPA 4LRTB 3TO5A 1U02A 2VCHA 5J63A 5C8YA 1SHUX 4RVHA 5A1JA 1SBQA 4MV0A 5TT0A 3RBZA 1XELA 2FRVA 3ZTWA 5B53A 5YASA 3W4IA 1NM5A 2QLNA 3MWJA 3F71A 5BWLA 1D8AA 4FIZA 4BC1A 2V9CA 5JECA 3TUZC 1B23P 2VXBA 4JN6B 5DXAA 2EJTA 1EVZA 3I3OA 1U3GA 1V4VA 5A3RA 1D03A 1FP4A 2A88A 5C34B 2Z2IA 5EZQA 1H1TA 2JJ2D 5WRFA 5CDYA 3FNHA 4WI1A 4QUJA 3NGXA 4OFBA 4CIAA 4A0QA 4BKMA 3Q3GE 2R5WA 4H6WA 2M6RA 3SD7A 1SOMA 3C8MA 3G79A 2LKCA 1W85A 2Z9CA 2CWWA 3HR8A 3U9SA 3VR4H 4KWEA 2ZUFA 3LCCA 5D86A 5L4SA 3A1FA 1JFSA 3NM6B 1P7WA 1PL0A 1Z0AA 1VRWA 2PZGA 4Z0NA 4C7MA 4PNEA 5IANA 5CG2A 2IHBA 3P7MA 3VV3A 3LCRA 4AY4A 3CPJB 4KJXA 2ZKLA 4X1YB 1AGRA 3U13A 4FHEA 5B3KA 1N2CA 3P4UA 2PJDA 3NBQA 1JDBC 3EH1A 3UA4A 3JQAD 3NIFB 2JIOA 1I36A 3TDNA 4G4SP 1EKXA 3RAJA 4H16A 3X1DA 3HSSA 5F4BA 1A9QA 3BXHA 3TQOA 1GKLA 2CKDA 4PCLA 5GP1A 2PL3A 2MOKA 2ZRBA 3V7WA 2BR5A 5A2QA 1V7PC 1N25A 2IHKA 2FVXA 5BV1A 4UHEA 4RZ3A 5ED0A 4QTYA 2AFHE 5ALSA 5A1TA 2OZVA 4KLAA 4TX1A 4IIUA 5D5QA 1KU0A 4Q4DA 5E4JA 5EQDA 2VXOA 3MOIA 4LBYA 4D6PA 3UKOA 1ENZA 1NXVA 3RT9A 3E22A 4NPHA 4ZTZB 4O0MA 1XTTA 5HDBB 4D2IA 3KU4A 2DULA 2Q5OA 1ZH4A 2IJGX 4HGRA 1SQSA 2J07A 2I78A 3D8NA 1CKEA 2IUUA 1ZIPA 3E58A 4NDNE 4OLAA 3QEMA 4G86A 1E3WA 1E4EB 3HJTA 5HW0A 4BC0A 4J0EA 1W94A 2PWZA 1Y6RA 2OMKA 3G88A 4HDRA 1E94E 4A6DA 4RA6A 2JF0A 4CL0A 1M2KA 2CMHA 3QMVA 2IUEA 4LJYA 2WU0A 3W5HA 3UCEA 2FLWA 3LTEA 5K7SA 5DKFA 1W8IA 2H1IA 1G7SA 2Q6VA 4PZDA 3NT4A 1AURA 4ZVLA 5BQXA 2P5SA 2OM2A 3KQMA 2BZ1A 3RAGA 4YT2A 1T15A 3IGFA 3VOBA 1FTNA 3WOHA 1BHSA 4D97A 4HWPA 1Z47A 4KGXA 3TL3A 1M2OB 4P4GA 2WT8A 4YUYA 1N92A 3LHDA 3OBBA 1J20A 1UAYA 3L7CA 5JYDA 1X8KA 1VXOA 4NBUA 5DHTA 2FG7C 4TTQA 1KJQA 2ENUA 2X1MA 1VQ1A 1L7XA 4KP7A 4OYYA 1G18A 5IT4A 1G20B 1HEUA 1RLOA 1X74A 3G2NA 1WV1A 5KU7A 3HZOA 2WJWA 3Q2IA 2P3QA 2WDPA 4MARA 3DHWC 5EJ5A 1ZK0A 1XV5A 3D1JA 4N12A 4NU8X 5CLIA 3ZDXB 1P2BA 2VI5A 3E9MA 4RV4A 2WOOA 1NLFA 4HVAA 2FWBA 4RIGA 2C5SA 3KUDA 4R84A 4BLPA 4CL3A 4ZGGA 1Z2DA 1CHDA 2J31A 4OXQA 2MYTA 1KYIA 3KUCA 1U9ZA 4JVOA 3A36A 4DQUA 4ZIRB 1U63A 2W90A 1FDIA 5LU9A 4AJHA 1P61B 1ZEJA 2C7QA 3OQIB 3ZHOA 1MA0A 1YR3A 2XHZA 2H0RA 4PRKA 2BGTA 1O94A 2VEOA 5F73A 1IHXA 5LQMA 4CQMA 3VU3A 1X1DA 5JCJD 2PFKA 3MS4A 1PGPA 1DCMA 1XZQA 2A9QA 2FXVA 2P6UA 2YJTD 3DV0A 3HR4A 2I6XA 3PEFA 5PGMA 4NYIR 3T7JA 2BTOA 2MMCA 3F67A 2HO5A 1GY8A 4X20B 1HK7A 1GDDA 4MVJI 5HMLA 4Q24A 3UGKA 1IY2A 1U7WA 3ESXA 1NXWA 4F5EA 3N2KA 2WJIA 3QP9A 4X93A 1ZISA 4D0GA 4F91B 4TT3D 1B8NA 3HM9A 1YVRA 5KYGA 4DLWA 1KKMA 4D5GA 1V5GA 1XVIA 1RIIA 3RVQA 4D0RA 5LLDA 4BNTA 4CKCB 3T7DA 3L7BA 2O07A 3E9YA 1Z0UA 1X14A 3NBMA 3HDJA 4OHRA 1VLJA 2OORA 4ZV9A 5JNUA 4DEXA 4PRYA 2ALJA 4IDCA 1REQB 1U65A 2FF5A 4IEIA 2B0JA 1TJNA 3AJ8A 4BVFA 1RVV1 2YUTA 2BFFA 1K86A 2ZI3A 4FR5A 3A58B 4BFLA 2UUCB 5IWAB 1TEZA 1C9JA 1RHUA 2WFZA 3EGCA 3GRKA 4L8VA 2G28A 4X6LA 2FPRA 3JD0A 2VWGA 3HXOA 4HWGA 4EB3A 3KSRA 2YWHA 5AIBA 3OQNA 2QZ4A 4ZALA 1GFIA 2XDQB 2Y4OA 3JARA 3QHPA 5I5EA 1M34A 2AJ8A 3QOFA 1H6CA 2AN1A 4OK5A 1Z25A 4IDOA 3MJFA 4G85A 3TINA 5CK5A 3WRXA 5IAOA 4FYKA 2XZDA 1L7MA 1YNSA 1BHJA 4GOXA 3W6ZA 1Z3CA 5B1IA 3PT5A 1V3UA 1CF4A 1E61A 3QVTA 1U7OA 3D6MA 5HA5A 2GILA 5JHGB 1C7QA 1AF7A 4Y2GA 2HA4A 3FAZA 5SV2A 3WXMA 1PQPA 4X66B 2ZJOA 3OPNA 3KO8A 4W1SA 3H8WA 4AP6A 3FLEA 3NM4A 4KR6A 4BNUA 3R9XA 4PLFA 1I3MA 2RH8A 1NNEA 3E9EA 5K5EA 1AMOA 4O2AB 4IOMA 2CCJA 1KO4A 5AVTA 1RXWA 1FL9A 1RM0A 5BSTA 3RS4A 2CLFB 5EJAA 2VO1A 1Q6ZA 3CZCA 4JJFA 2VSQA 5J4KA 5K0ZA 3VYRB 4J3JA 1ZOIA 3DL4A 4BVHA 3BWCA 3S40A 3HCDA 4JUDX 3PUWA 2ZU6A 2QD4A 5BYKA 5C5IA 1WB5A 4YMWA 3RG2A 4BATA 3RYFB 1N0WA 4A0FA 1K92A 4OQDA 2B4RO 1GZVA 2CSXA 1W25A 1GHTA 4JLSA 1I4OA 1B16A 2WWIA 1QHGA 3GMIA 4G9GA 5FNVB 1XMSA 4DNFA 5IUJC 5ICSA 1DGQA 2WJJA 1YOVB 2DFKB 1TMKA 2QSJA 3GNTA 1K9SA 2FPIB 5KAMA 3BE4A 3U62A 4BN4A 1PV1A 4F60A 4CEIB 4P83A 5KOJA 2VTKA 2H2HA 1P72A 2IZ7A 3HVKA 5C8XA 5L6LB 2CSUA 4D7AA 3LS2A 4C3VA 1BEEA 1YRAA 1ORDA 4M8LA 2YJ6A 5F5LA 2W58A 1QB8A 4IJKA 3KD2A 1P29A 2J3MA 4ZJZA 3D54D 1RE1A 1AF4A 3DGEC 1ZGJA 3OWOA 2ZDHA 3IJRA 3WAJA 2E2WA 4S1OA 3IVXA 4Q3NA 3L0SA 2JGAA 3O2QB 3PQFA 1DQRA 4IX9A 1G5QA 2FMKA 5TLSA 1FQOA 1QIJA 4U00A 1R0XA 2HN9A 1PZFA 2DUNA 2EFGA 2GMWA 2PWAA 2P9FA 3TOZA 4XTCS 4PZ0A 3ZLBA 3OX3A 2Y1GA 1HOXA 4IQFA 3N2NA 4QXAA 4X71A 1AB5A 2VUTA 3L7JA 1PT8A 4GDFA 4OMDA 5AW1A 4NX2A 5LQNA 4P3KA 3L3BA 1ZU4A 4HNSA 2I4TA 3LWDA 1BNCA 2IHTA 4BEVA 2NXNA 4KWHA 5M29A 3TLXA 1GZ3A 2DQKA 4DEVA 1YVUA 4HNGA 3ESAA 4G07A 1KI4A 3P2IA 3PFIA 4E14A 1W93A 3KSMA 5EEHA 3FUTA 3IAXA 1QF7A 5FADA 2ZIFA 4EUFA 5HJ7A 1NUUA 4MEAA 5EZYF 2R86A 2PT6A 3UO8B 1C1YA 3I5UA 4CKWB 3EVBA 3LX8A 3GLFA 4D3YA 2XNDA 1KFJB 3AUXA 3D31A 1AGPA 4IGIA 3WO1A 4OX9Y 3OQ1A 3X2FA 3KJZA 5F7JA 1D0SA 4LWQA 1QHEA 3WAKA 3ZDZB 4RTKA 4JB2A 4RL4A 3GYGA 2EYUA 4CR6A 1KJIA 1VTKA 3AHGA 4GIBA 4MRAA 4PHHA 2FQYA 2P0EA 5KCMA 3NUGA 3NBFA 3TNYA 1T8UA 2ANCA 2CYCA 1U4SA 5AXDA 1T3SA 4MMXB 5IUNC 1CP3A 5T4BA 4TKMA 1L5LA 3EPJA 2PKQO 4NCBA 1XHLA 2ZT6A 5JNSA 4DNXA 2OCKA 3ZJ5A 3REFA 2GJ4A 3WX0A 3AGPA 1PRYA 4RVSA 2JGRA 2PUEA 1KYTA 2QRPA 3WDKA 4JXXA 4WLNA 5L7TA 3JSAA 4UTOA 3UTDA 3BBLA 3VNSA 7ADHA 4L0QA 2YZGA 3L8HA 4IIVA 3RWBA 2XI4A 3FHOA 1WUTA 5LYJF 1O54A 4G0MA 3O73A 4MV3A 3QPUA 4OI4A 1D0VA 1XQ6A 4DGSA 3QUBA 3AKCA 3KQKA 1Q77A 5JXWA 3UAOA 4PC6A 1PTJA 5BN4B 3VUEA 3OF2A 1WMSA 1XGKA 4J0JA 3GT7A 4EHKA 5BVHB 4GI3A 1P8AA 4BNJA 5CJJA 1ABBA 3M3DA 2VJCA 5AM2A 2XMGA 1YL5A 2R9VA 4GI7A 4B3BA 2O7SA 1EHCA 4HEHA 3WDSA 3V7FA 3F46A 4POOA 3JQ8A 5EHGA 1ZMRA 2RH4A 2B9VA 5E6UB 1DINA 2CDCA 2WP8J 5HS6A 5MGNA 3ENVA 1F2TA 4HN4B 1U7XA 1QGAA 1IQUA 4YRIA 2O8CB 1GTG1 3RS8A 3GFQA 3B6KA 2OHJA 2XUQA 4BKUA 1WMFA 2GO1A 3CF2A 3QMMA 4IXTA 3X1KA 1UC9A 2YYZA 1Z6AA 1VI6A 1H5QA 1NMZA 3GLRA 3PDCA 3QYJA 4A9AA 3LUPA 3W9BA 1IXSB 1Q0QA 1JXMA 2H6EA 4BVLA 4AKGA 3QE2A 3AI7A 2ZR0A 3DUFA 1L8QA 4TRNA 2FZVA 4ZARA 4WBNF 4KBGA 1AHNA 3R8XA 3D7KA 1SCAA 4L28A 1F0KA 4F4HA 4AQYB 3M1YA 4LQCA 2PZ8A 1PSZA 3KAPA 3IULA 3TI7A 1T3ZA 1Q0SA 1NRWA 2VT2A 5AK6A 2VT7A 3NRBA 3R6DA 1YI1A 1QLJA 1L5WA 4PAOA 5BSUA 4BTLA 4K9OA 5CEJA 5KQMA 5DBGA 1GAQA 1BCSA 3SZLA 5AW4A 2VP3A 2OPHA 4OM7A 1VL8A 2ODNA 3ADPA 2CNWA 2ZJ4A 1P7YA 1HE3A 1CEEA 3BA6A 2I1QA 2KJQA 2TMDA 3EXHB 2Q4RA 4GUAA 3SSOA 1XTJA 1OKKD 2QN6A 3FHJA 4HSGA 3I4LA 4B33A 2OV1A 3FG9A 3RRXA 3LDAA 1H1DA 2IYWA 1USGA 2VBIA 4QTUB 4QUAA 5IU6A 5TPZD 2HX1A 2XMRA 2YY7A 4DDTA 3CWCA 2EGHA 4JB8A 5SY9A 3TKYA 1JEYA 3TZEA 4XIIA 3Q15C 1KZ7B 3D3WA 4H1TA 1HFWA 1Z4KA 1B43A 2JZOA 4XJSA 3T1TA 2E85A 5DHAA 3D2CA 4W1QA 4JOBA 4R98A 3PSAA 2XUGA 4KYUA 1MABB 4H4EA 1EGVB 2E5FA 5D1NA 2V1XA 3FKSD 3N8NA 4MW7A 2CNBA 3PU6A 2QMUA 3BKWA 4CM9A 5BUQA 1BOFA 1YCDA 2P2SA 1UZLA 1PJLA 3CPHA 4ITVA 1GGFA 3GRAA 4R2IA 2UKDA 5T4HA 3I2FA 4YT4A 1E58A 5HNKA 1BMDA 4E51A 2FN7A 1E2LA 5AJZA 4U7HA 2Q3FA 4MVJF 3R0IA 3ZHZA 4RVUA 1W29A 1PX2A 1F6BA 2HDWA 1ULUA 4G8JA 4PZLA 4XW2A 2OTCA 4UULA 4UREA 1BD3A 2WAYA 1Z6XA 4FFMA 4EI9A 1CIPA 4KL8S 2C2WA 3NC4A 4M49A 4MUFA 2G82A 5EVCA 5DP1A 3M34A 3VVLA 4EKNB 1M72A 2JD2A 5IZ4A 4F71A 5JS6A 2IKSA 4GSYA 7GPBA 4ZN6A 3OQ6A 1FFSA 5EAIA 4E5SA 4FEYA 3MTDA 5IARA 5BORA 5M34A 4MZDA 3DA8A 3P20A 2IOFK 2QVCA 3U4QA 1Y63A 2ZWPA 5DI3B 1THMA 3U3MA 5KQRA 1Z33A 1CNMA 2FN3A 4NL4H 1XRSB 3IE2A 1FYEA 2IXBA 2WZBA 1BMTA 4HUQA 2MR5A 4X1IA 5HFJA 2MIIA 5IKPA 4WK4B 1SIOA 1EQ2A 2HGSA 2HRBA 3H5AA 4IILA 5AHOA 4D74A 2PBFA 3F73A 1UZMA 3OM9A 1ZSYA 2WI8A 3SNKA 2C8LA 5COBA 2QI9C 2XRMA 3TQIA 2X9GA 4Y0VA 3NBAA 1N5MA 3AZPA 3ANYB 5KSPA 1TZJA 3DKIA 1CDEA 3NUQA 3EGIA 2X7XA 4YNBA 4DLZA 1DQZA 3GLHA 5BP7A 2YV4A 3G7SA 5F2KA 1UBNA 5FTWA 5A4JA 2OLJA 1K6MA 4ER5A 4MKRA 4R05A 3WTBA 1UL1X 621PA 1C3JA 1WY5A 1NW5A 3EFEA 3L8DA 4KHZA 4UHCA 4XWTA 1OBOA 1Q3KA 1QHHA 1OGIA 2EWMA 2HMUA 3F9IA 4GHWA 4BCBA 3IQDB 1JAZA 1FLAA 4MP3A 5GZ1A 4Y6RA 2RGRA 4IZOA 5JI2E 4UJ5A 4BVEA 1CDZA 4X6XA 2LUOA 2IYUA 2YOHA 4EWLA 2RCYA 4XWAA 4HQNA 2ILTA 4WCDA 5I45A 3A10A 5K4AA 1XLTC 3MRVA 1XCGB 4XASA 5CEEA 5EJ8A 3IT2A 3E5MA 2GHRA 1ZNWA 1FUEA 4YMHA 1V9CA 1UOOA 5BQOA 1J8MF 4MYTA 2R84A 3CUWA 4P5EA 3OJOA 4LCBA 1HT3A 3HJRA 1KZGB 5JPCA 2TECE 1GLNA 4X1KB 2Z1DA 2C54A 1WKCA 2GCOB 2RGDA 4FFDA 4JIGA 2I1LA 3WGZA 1XF9A 1GL7A 4V38A 3UNXA 5IAAA 1UK6A 1XRPA 1YB1A 4ZV7A 4C06A 4LDJA 1FRNA 3JATA 3P45A 4RGYA 2ZRLA 1FSSA 3N07A 1DAMA 3OT1A 4LRSB 3VV2A 4IJVA 5EIEA 3DE5X 2IUYA 3EVZA 4MLDA 3KETA 5CCDA 2JLVA 3GU3A 4GBMA 4JELA 3DP9A 2IEGA 4MI6A 3OEHD 3A4MA 2WFLB 3SMQA 3OZGA 4L15A 3F78A 721PA 5AK5A 4I1OA 1DEKA 2IWRA 3AI3A 1YA8A 3FCAA 2YCBA 3DLPX 1SUCA 1YQXA 1I6WA 2VLBA 1LK0A 2Z8YM 5IN4A 2DY1A 2GRUA 3MRXA 5K8VA 1GZUA 3S2IA 1A69A 1ESEA 2JDIA 1ZX1A 2DWOA 3JQGB 4YDRA 1EX1A 4D0SA 1E89A 2RE8A 1J22A 2FH5B 4LVUA 4NI5A 5T8KC 3DWIA 2VPIA 4ZWNA 1W4RA 3T15A 4LOJA 4AN4A 4IUCS 3SJZA 2J0VA 4DAOA 4DMFA 5E6RA 2F8MA 5T3YA 3QFCA 3O8CA 3AVPA 3SQXA 1GAJA 2PWYA 2Q3JA 2C3YA 2FPKA 3F7OA 3HY4A 3JD3A 3OKCA 1ML3A 2J9GA 2O1WA 3Q0TA 2B1GA 1FTWA 3EGXA 1LNZA 2GBGA 1AM4D 1DPGA 4MW5A 1EWTA 1JT9A 3UJ6A 3H1FA 4FNMA 3W0LB 4PQYA 4INAA 4YGXB 4H17A 2NNLD 1FJXA 3A32A 3TZBA 4EMUA 3R5SA 4H77A 1E9CA 1X1CA 1XQXA 3IMFA 1CUHA 1MQAA 3CZ9A 3W7BA 2XRZA 1VBFA 1X42A 4LC1A 1EGMB 3HWSA 3R24A 4MQFB 3AQ4A 5EUMA 4BMNA 2VRCA 5A4KA 1JXAA 4NBWA 1RPAA 5DMHA 3ZOZA 3VOAA 3FPJA 1GAXA 1V1MB 4GPTA 4F3RA 1AZWA 1JWLA 1C41A 1O8BA 4KXLA 4DWOA 3AU8A 1W4CA 1AA9A 1DXQA 1L7RA 2IYVA 3FKJA 3KK0A 1Q12A 3QEBZ 3NP9A 4BLSA 1G9TA 1NUHA 3AW9A 4IYRA 1ACMA 1FP6A 1OLUA 1XO1A 1TU4A 1YQEA 2IYAA 2X3YA 3AKEA 4R1SA 5AOCA 3RPEA 4DWWA 2BL4A 4RHXA 1D1SA 3W8NA 4Z49A 2VZLA 2VHZA 3GPLA 2JGDA 3N2ZB 4YS6A 2XV1A 1SN7A 4Z4CA 1EWQA 5C3MA 2XUPA 3EZGA 4PCAA 4F2DA 5DK6A 1PQUA 1N2BA 4JXJA 1QQAA 2YYAA 5H1YA 4F21A 2NADA 3HXPA 4XUEA 1EFTA 2RHCA 5EPUA 5EXSA 4CDGA 2QTAA 1VDZA 3DQQA 5CVJA 4AUMA 3I05A 2PKYX 4BUZA 2Z8ZA 3OZXA 1EVLA 2P9ZA 1Z34A 2GJ9A 3PA8A 4HZIA 3SDSA 4DOMA 4QNMA 4URXR 2HHAA 4TGLA 2CYBA 1CZHA 2R6HA 3Q4GA 2Z5GA 3KVYA 3LPDA 2AOTB 1LPNA 1V16B 2J5RA 2VSFA 3K0CA 2ID7A 4PX9A 5IZCC 2Z3WA 1S3IA 4JI2B 1FW6A 1F12A 3CRMA 3L4BC 1OYWA 3AB7A 3UK6A 3DTVA 3I5XA 1RCTE 3C6MA 2NZXA 2HQBA 3ETEA 3K9CA 5JFGA 1FU4A 4DY6A 3L4KA 5IF3A 1NP7A 1D5WA 1FX0B 4Y2RA 4GDMA 4H0FA 4ND4A 1NBOA 2W6PA 1AG9A 3IOCA 4JAVC 1RJFA 4AUKA 2JJ8A 2JZNA 1PJ4A 3BWXA 3FVQA 3P2OA 4OY3A 3ZD9A 1M33A 1Z5NA 4CIXA 4CWAA 4Z7NB 3CU5A 3LC2O 3RNLA 4DA8A 4Y1RA 1NZJA 4YCSA 1B8OA 3V4OA 3JX9A 4IV8A 1L4MA 1DT3A 4ZHQA 1D1TA 4HF7A 4E2XA 2WM9B 3LGAA 1O7JA 3H4VA 3PHCA 3QY9A 1I3CA 3PA6A 5JWRA 4Y1GA 3PJDA 2JCVA 2V7QD 3IIIA 3KKKA 4CPDA 1GCGA 2BKUA 4HB0A 4US2R 1O4VA 4I5EA 1YV9A 4MDYA 4RGQA 1WM1A 3ZHBA 2JI7A 2R1VB 4TLDA 4NTZA 2CEAA 2LTAA 2CUTA 4C4AA 4DIDA 1OFIA 1CB0A 1FJHA 1ATIA 1SXJB 2VF5X 3D2BA 4P9NA 1GKUB 3OIWA 3OE5A 2DJ5A 1W88B 2YYSA 2X77A 1DBPA 1KAGA 2BGKA 1Y34E 5F9MA 3GLGA 2O9JA 4I55F 3WGTA 1R5JA 4I1YA 3IIJA 3IUYA 3L1VA 5IVPA 5JUWA 3RUDA 1PS9A 2YC4C 3KL2A 3L1IA 3L4JA 1ESDA 3W7VA 3H2SA 1B0ZA 1GQSA 3Q8WA 2XX3A 1ZA2A 4UTVA 5L8VA 5JC1A 4HGYA 4TMTA 2H16A 4P4TA 3WL6A 1F7UA 3OCCA 4HGZA 4FLFA 1G1MA 1KERA 5CNKA 5LA6F 2AN4A 5EZYB 4UTRA 1PP4A 3BCSA 5IPFA 3GDFA 3HJNA 1JGTA 2BGWA 4QASA 4YO8A 1T1EA 2VA9A 3WFIA 3CZQA 3EXAA 5KNBD 1WCIA 4H7HA 1Z7EA 3KZVA 8ABPA 2G07A 2ZZMA 3WYEA 5IKEA 3C7DB 3P5BA 3OT5A 2AX3A 4HS4A 1AB6A 1VOTA 2PD6A 4L8GA 3UJ8A 4M8SA 4GEKA 1T9GR 4W5HA 1R27A 1MP0A 3HKCA 3TD2A 1IIBA 4C29A 1G6OA 1AS3A 1J39A 1QRSA 4JKIA 4W9NC 3KTAB 5HTOA 2R7LA 1H6DA 2D8MA 3V3KA 2Q1YA 4RTSA 2C2KA 1IOWA 4GQAA 4RTJA 4JBNA 5CP8A 3R41A 2FPPB 2VP6A 3SE0A 2PRJA 2VQSA 4W8GA 3K09C 1GTVA 1G8SA 1W5SA 3BF8A 5CT4A 4CM7A 2GZMA 4S1NA 3SJUA 3UUGA 1V11A 2HKIA 2P2LA 3WWEA 3RFTA 1J21A 1D6MA 2FZEA 5DU2A 5GZ6A 3T3NA 4AB1A 1U2DA 3B8HA 2QR5A 1A7JA 4MITA 1G63A 3KLOA 5KZMB 1TMGE 3I6MA 3QI2A 4MB0A 4LXYA 5AJUA 5BV0A 1IH8A 3WLKX 5LXTA 1NVGA 2ZWVA 2GM5A 4Y9TA 2G04A 2ON6A 1DELA 4QGGA 3HEMA 4UEKA 2EARA 1H0SA 3LHFA 4L2IB 4LW8A 4LVOA 4PZUA 3RWMB 1E0AA 3FOWA 1VJCA 3E15A 2P2GA 1RTKA 2JASA 3UKJA 4FCWA 4LYYA 2XNHA 3BOSA 4J2HA 3VHLB 3I9V1 4B48A 1FNSA 4CM1A 4HNUA 1NXSA 4QG7A 3QJ5A 2E87A 2ZATA 1PLLA 2ZS8A 5ALNA 3VYTB 3AVTA 3HKDA 2XXBA 4L1KA 4ZICA 3WNVA 2FDCA 5ALJA 4R51A 4JLDA 3JCZA 3QLJA 4YAWA 1X86B 1ZU5A 1ZJ5A 3K30A 2G76A 2ZIXA 2BM8A 3V3TA 3AF5A 4ZQHA 1JLMA 2WM2A 3QVKA 4PYKA 4UCFA 5UKDA 4QEZA 3ETNA 2PUCA 2WYWA 1UXIA 4US0R 2QTBA 3RSCA 4EKDA 1SUWA 4KITB 3COZA 3DMPA 3GZ4A 3UW3A 1HZJA 2FFRA 1JKXA 3F4LA 3VPHA 4BMYA 1E2NA 4GKAA 4Q5IA 1IPFA 3NTOA 2G80A 2D54A 3WMEA 4HY3A 4MO9A 5EWJB 1A95A 5JHHB 2Z58A 2XKBA 4PE5B 5FT9A 1GQ2A 1OHHD 2CCKA 3CJRA 3MXOA 5K3CA 4EG4A 3BQNB 1BQ4A 3CEAA 5IYZF 3ILXA 1DLIA 3IR5A 1VFNA 5CLFA 2G71A 1GPBA 4HQRA 1QQ5A 3TGLA 4B3GA 1VE9A 2N46A 4NJEA 4OHWA 3EGEA 5G02A 2R4UA 2CFOA 4FNGA 1G8AA 1TJ3A 4TWZA 1FLVA 1T6NA 2EVWX 3JPWA 3LDHA 1MTZA 5JT1A 1ZM9A 1NVVR 4D8UA 4U9IS 5M5BA 3QKSA 4FOSA 1LK5A 1ZL0A 3KOOA 2GFHA 5TJHA 2XNJA 3RKUA 5ULLA 5FL7D 4UM9B 4S1TA 2XDWA 4QBHA 3H6HA 1V1RB 2WTXA 4OXKA 3NJRA 4AULA 4ON9A 5MGBA 2O8BA 3HY6A 4EENA 4P36A 4KRYA 3FZQA 4P0TA 4D6XA 1WD7A 1DTWA 1KK2A 2AUNA 3H9GA 2VAMA 3RROA 3TBFA 3I52A 3CVOA 3O75A 3ZK7A 2CCGA 3UWKA 4LZJA 1HLPA 1T0IA 1PYOA 4I1RA 4ZMBA 3NAQA 3GGPA 4JUAA 5AH0A 3BFVA 2W9XA 1XTVA 3C5HA 2HA7A 3AYXB 3R0JA 1SOUA 1MH1A 2CFIA 3EMKA 4YWHA 3FMIA 3QWBA 3TVTA 3HVUA 2DT5A 5JLJA 1J8QA 1O9GA 1O8CA 4TSKA 2ZRQA 3TK1A 3VHXA 3T1YB 1JFTA 1T26A 3AKDA 8MHTA 2H1HA 2O8VA 1RI3A 5KBYA 3KM0A 1ISMA 1E32A 4TL9A 2CLSA 3KEFA 4ZPXA 4BLQA 4EY3A 1ZN2A 3CEMA 1PN3A 2X8JB 3ADOA 3M6LA 2JC3A 3KYDA 3LECA 4I36A 4K9KA 3IJ5A 4UBMA 1KETA 2JIBA 1I30A 2HK7A 4NZOA 2O3QA 1N7JA 1SHLA 2OHXA 3KJNA 3OPYI 1L5HB 2QL5A 3HU5A 4QD3A 4BMZA 4QVIA 2ZM6B 3LY8A 4UM9D 3LWZA 1U8EA 4PO8A 3T0IA 2UUBB 2J3KA 3R40A 4C2BA 4E4RA 2BTQB 4K2HA 4RK6A 3PFWO 2B37A 3DXFA 4XVUA 3FWPA 4RM3A 1YZFA 1VI5A 4JJ7A 4L4XA 5TE9A 3V2GA 2VZEA 3CVVA 2VR1A 3JASA 1W5TA 4OQZA 4WCFC 3OUTA 3JQ9C 2ZRIA 2VJMB 4AN0A 3JQRA 4CTKA 4IGKA 2GN0A 2RHRA 3MMXA 3K09A 2MJLA 3N0XA 3B7PA 1W4ZA 4IS2A 3FJ1A 4LOLA 3WR5A 3OZIA 4JDUA 4WFIA 1PK8A 1YMVA 4UD6A 4D3ZA 1YZUA 5B30A 1CUCA 5JALA 1YGPA 1VGQA 1X1QA 3SR0A 3WC4A 3N1UA 3T1QA 1DVRA 2O2JA 3L1KA 1T2AA 4G56A 1KK1A 3NYQA 4G0ZA 1VPDA 4YRRA 3O0TA 3KR2A 4HRAA 3L6UA 1PCXA 4GBGA 3E9CA 5SYMA 3L04A 4UJ3A 1N9KA 3QENA 4N0QA 1GSIA 2VQ3A 2ZI6A 5AJWA 3DF9A 5CM8B 3RBVA 3JQ6A 3LU1A 4ALLA 2WWXA 4B2LA 2YXBA 2W6MA 3IPXA 4JUIA 4LJSA 1ZIXA 4RFSA 5DASA 2MTBA 2VRWA 1XCJA 1ZH0A 2XA9A 3VR4A 1USKA 1K7XB 1KMHA 1OX4B 2NPIA 3FNGA 4ZEVA 4WZZA 1BYUA 3V4SA 2PM8A 4Y9DA 3ZE1B 1P0PA 1FDTA 3KX2A 4H1UA 2DE0X 4O2BB 3SC6A 1XJWA 3HJCA 4BY9E 2DTEA 1AHPA 5DHFA 3W5IA 2CXTA 1M7HA 5A3JA 1E3IA 2ZVQX 4U63A 3ZGVA 3K8OE 1Z7YA 3FWZA 3RIHA 1VE1A 2F3QA 3VVMA 2OXTA 3I30X 2L82A 4QGSA 4MI9A 5JW6A 1M8PA 4F2PA 4F6RA 2C2MA 4WJKB 4CCYB 3DE3X 2ATVA 2B92A 2ZUUA 5EZ5A 2C4WA 1SXJD 3BHJA 2ONKA 3EDQA 3RT1A 3TQFA 1P5ZB 1RWMA 2HGZA 3HL4A 3TRIA 1GP2A 3BRWD 4FNAA 1SIBE 3OECA 1H1LA 4J2OA 3G2LA 1Z6QA 2IV2X 2VDVE 3OESA 1WZCA 4I3GA 4ZZ2A 3T5TA 1OLOA 2C97A 2VDPB 3IIKA 3BFKA 4R2KA 5DT9A 1UMKA 3WMRA 5BNZA 5C7OO 3BGVA 2AH5A 4RTQA 1X6VA 3AEQB 4X0EA 1QCCA 4DVJA 2XZTA 4YYZA 1WWKA 4XX0A 1CXZA 4PRLA 3VO1A 1XP8A 3O2SB 1ZN7A 2J6IA 1EXWA 1GZSA 4G67A 4L57A 1NW4A 2BDEA 2II6A 4ZMRA 2ZB3A 2R96A 3FOFC 4Q7KA 2P9YA 3NHYA 3LVQE 3P2MA 5EJMA 5T64A 2ZAYA 5A9RA 3RIGA 1D9ZA 4ND6A 4RY0A 2C2YA 4AU1A 1HOTA 2EF0A 1YUBA 4B7CA 4YRZA 2I55A 4ZYXA 2BOVA 4LZNA 3CRW1 3DUWA 2Q0XA 2C0QA 1I24A 2HRCA 4B32A 3P32A 3UIEA 1C8VB 3E5HA 3M9LA 3GJ8A 1BW9A 3RK0A 3W5DA 5B58C 2NSLA 2Z2ZA 4K0KB 4HQKA 1I1QB 1GQOA 1T0BA 4C7OA 3I6YA 4RKFA 5FO1A 4YRDA 4ARBA 4G24A 1MU0A 1AUQA 3FPLA 2HQRA 3WB9A 5BOSB 4X95A 1BKSB 3A1VA 2I91A 4B8ZA 4JBHA 1O4WA 1X1BA 2ANBA 2QVXX 3D4IA 3T7SA 2PUVA 3I5MA 2Q6KA 1PJQA 1VLVA 2Q3DA 1W1UA 1KI3A 5BN3B 1E20A 3WA7A 1URPA 2H1OA 1T8SA 4JI4B 4KREA 4AI6A 4K5QA 4ILEA 5AW8A 4B6GA 1QIEA 3OHSX 1CQXA 2P0AA 5DOZA 1F5NA 3I04M 1T36B 3CVUA 4M0FA 1U7TA 5CT9A 4FE4A 4LTNA 4LMBA 1BX3A 3JWEA 1X0XA 2AQKA 5IHXA 3OZRA 2PD4A 3RQSA 1VJDA 1CUJA 3A1TA 1X0VA 1IMOA 2V03A 5IWCA 3EQ2A 1Z7GA 4HWKA 4N40A 4PQEA 3CTPA 3NKFA 5AKHA 5A3VA 1NP6A 3NYWA 1S4QA 2DQYA 2BGLA 5KYWA 4BWGA 4ZRDA 2VL7A 4X8MA 2VT3A 2BM9A 2D1QA 3OI7A 3WTCA 2ZR8A 2XF2A 5F5XA 4A1OA 2XVXA 1MOPA 3EULA 4MS1B 3N2EA 4PIVA 4WFKA 3CISA 2JB9A 5LD2B 4EB6A 4GD3Q 1G7CA 4QX6A 2HMAA 2FLKA 1MO2A 3I9NA