1SELA

Crystal structure of selenosubtilisin at 2.0-angstroms resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
274
structure length
273
Chain Sequence
b'AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SELENOSUBTILISIN
publication title Crystal structure of selenosubtilisin at 2.0-A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase(serine protease)
total genus 88
structure length 273
sequence length 274
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1993-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1selA00
3DE5X 4K8RB 2WUWE 3DE6X 1V5IA 1SVNA 3GCXA 3DVSX 4NE7A 5JMOA 3I2YX 1SCDA 1VSBA 4KG7A 4Z2AA 1GNSA 3DE3X 4CFYA 4FONA 1AU9A 1SCAA 1SN7A 2HPZA 3DW1X 1KDYA 4JP8A 4OMCA 3QMPA 1BH6A 1R6VA 2G4VA 3A3OA 2W2MA 5CW1A 1PEKE 3DVQX 1Y1KE 4I0WB 2HD4A 1SUPA 5AMXA 5JXHA 1R64A 1SIUA 4BWGA 1LW6E 1T1EA 5B1DA 5AQEA 1SUBA 2ST1A 5I9SA 3SICE 3ZXYA 4B5LA 1SIOA 5ARCA 2WV7A 2Z2XA 1GA6A 5AVKA 1T1GA 1OT5A 1SBIA 1TM5E 1AQNA 3UNXA 1SBNE 1SIBE 3P5BA 3LXUX 3ZXXA 1ST3A 1DUIA 1S02A 4LVNA 3VSBA 3I34X 3TI7A 1KE1A 5AVJA 2Z2ZA 3VHQA 4AKSA 4CG0A 3OSZA 1PFGA 3DE0X 1WSDA 1V6CA 1ST2A 3DDZX 1TM1E 1Y3CE 1IAVA 1GTJ1 2W2PA 1IC6A 1TM3E 2PKCA 2GKOA 4OMDA 1YJCA 1SBHA 2PYZA 1GTG1 1C9MA 3TI9A 2P4EA 1S2NA 3WHIA 5FFNA 3CO0S 3T41A 2W2QA 3DE2X 3WIUA 3BX1A 4CFZA 3DWEX 2ZWOA 3D9QX 4YN3A 1MEEA 3F49S 3AJ8A 4WOCA 3CNQS 2Z2YA 3HJRA 1WMEA 4HVLA 1CNMA 3L1KA 2X8JB 4OV6B 1Y48E 4ZARA 2PWBA 3LPCA 3EIFA 3DE4X 5K7SA 5JXIA 1TO2E 2X8JA 1SCJA 1BFUA 4H6XA 1C9JA 1BJRE 2IXTA 3DW3X 3F7MA 1TO1E 4DZTA 1ZVKA 1SCBA 4ZOQI 1A2QA 3DE1X 1WVMA 1NDQA 2SECE 1EGQA 1BFKA 1TMGE 1DBIA 3VYVA 2Z58A 2PRKA 5ARBA 3A3PA 1YU6A 4J94A 2Z57A 4M1ZA 2IY9A 2ID8A 2DQKA 3DE7X 1SPBS 2W2OA 2PQ2A 3VV2A 3LPAA 5JXJA 2SICE 2ID4A 4H6VA 4WOBA 1YJBA 1NLUA 3VTAA 2ZWPA 1WMDA 4DWWA 2PWAA 5FBZA 2WUVA 3BGOS 1GT91 2QTWB 1Y3FE 3AFGA 3EDYA 1TM4E 2DP4E 3I30X 2SBTA 4KPGA 1C3LA 1P8JA 5JXGA 4NE9A 4C3VA 1KDVA 2WWTA 1TK2A 3AJ9A 3H42B 1TM7E 1GCIA 2XRMA 3PRKE 1PJ8A 3PTLA 1THMA 4H6WA 3WIVA 3SQOA 1OYVA 1GTL1 1WMFA 1Y34E 1GA4A 1TECE 1Y4DE 1AF4A 1AV7A 1T1IA 1UBNA 2SNIE 1EA7A 3D43A 4LVOA 3GT4A 1YJAA 2XTJA 3Q5GA 1AH2A 1Y3DE 3F7OA 3LPDA 4C3UA 1SH7A 1KDZA 3EE6A 3I37X 3TECE 1Q5PA 1Y33E 2ZRQA 4RYDA 1P7VA 1AVTA 1BE6A 1GA1A 1PTKA 1KE2A 1SBTA 3DYBA 2Z56A 1HT3A 1SELA 1R0RE 2DUJA 4HX2A 5SICE 1SUCA 3QFHA 4NMXB 1Y4AE 4KB5A 3GCWA 1OYOA 2PMWB 1Y3BE 3A3NA 2V8BA 4AKTA 3DVRX 2B6NA 3BPSA 2Z30A 2TECE 5FAXA 4MZDA 5B1EA 1SUDA 1SCNE 2E1PA 1NDUA 1C9NA 1S01A 1SUEA 4DJ5X 5ARDA 1SBCA 1BE8A 3GT3A 2W2NA 4GI3A 1Y9ZA 3WQBA 1SUAA 1ZVJA 1P7WA 1AK9A 1XF1A 3Q40A 1JEAA 3QTLA 3VV3A 1MPTA 1CSEE 1GNVA
chains in the Genus database with same CATH superfamily
1RXWA 1OA0A 4NHEA 2PMKA 3EH2A 3OHSX 1X8KA 1CVIA 1MP0A 3PEVA 5EL0A 1YB6A 2XCOA 1CRQA 2WABA 3EWSA 3FPEA 4N8EA 1TCUA 5IDVA 5DWVA 4TXHA 2NZXA 2HJSA 2IGBA 2NU7B 2P2CA 3CH5A 3NFYA 3NAQA 3PYLA 2GYYA 4K6GA 2PUVA 3E58A 4PNPA 4WGFA 4V0QA 4XUEA 2PH7A 3U7JA 4AMBA 3OM9A 3E7PA 4EG7A 2BFCA 1KZYC 2C96A 4OMFG 3TEFA 4BHTA 2NZ2A 2N1BA 4RESA 3FA2A 3NHFA 4KOEC 4WY2A 2J3DA 2BIFA 3G7NA 5DGXA 2QS9A 2Y1WA 3KT3A 2FF7A 1XZDA 4DKXA 1IATA 1QKIA 1WZCA 2XIJA 3WLIA 1ETHA 5JVDF 1VGVA 2PBRA 2R4QA 2A8YA 1M5RA 3KXDA 5BN1A 4MI1A 1UDCA 2PLAA 3HNOA 4N5HX 4AICA 4RY2A 4GSLA 2VP3A 3TUJC 2JAXA 3ZH2A 5K0FA 1D04A 1XAJA 4M49A 3EXG2 5D87A 1LK5A 1CKEA 3V3TA 2VUTA 1VBMA 4G5XA 2G4VA 5FJIA 3ZYZA 1KWGA 1Z2AA 3MBOA 3OWHA 4KPUB 4JIGA 4R68A 4EG8A 2V3VA 1R0BA 2PR7A 3MEQA 5A06A 5B12A 2XDAA 2E5FA 4QRHA 2ANBA 3IUMA 3VVBA 1QTNA 3WGHA 4MVCA 4OBXA 1U9ZA 4AG6A 4F4UA 2MMCA 2QUAA 4FQ5A 4YRKA 2FN9A 1DWOA 4O4HB 2YASA 4FHZA 4MUAA 1K6EA 5DI9A 5ES4B 1E5TA 4X92A 4E33A 4EFLA 4MYSA 1X7GA 2GM9A 5L4NA 2ZAMA 2WINI 2CCGA 4LXTA 4X6UA 4JX8A 1ZGJA 3TNYA 1L4MA 1QFZA 1W0KA 3VAZA 4AMZA 4ZI5A 4PG6A 5FTMA 5KNDH 1N5RA 3O31A 3JATB 2AC4A 3ND7A 1DKMA 3ZTYA 4AUEA 1FF9A 1X7WB 5CA0A 2X2EA 3ZZTA 4GMFA 3T9EA 4HX5A 5H5JA 3AFOA 4ROSA 1H2FA 2P6UA 1GCAA 3R5HA 4ZI3A 2JARA 3SJUA 1EVLA 3D1LA 4MLDA 3RLFA 4A15A 1OF1A 5AVKA 2Q3HA 1QU2A 2GA8A 3DZJA 2BTEA 3WTBA 4DQUA 3MJSA 1XRLA 2YH2A 3HCCA 4CKWB 1CUEA 5CW2A 4HVCA 4L4ZA 1AK1A 3S70A 1SBIA 3CVOA 1AQNA 3O1HB 3L84A 1FW6A 2WPDD 4DRYA 1C1HA 2NO0A 1OWOA 1TB4A 2JGNA 3MWFA 4LI0A 2AMJA 5DYTA 4D4MA 3P5BA 1GY8A 1DIAA 7MHTA 2WAOA 1JHZA 3EVEA 4D45A 4X3CA 4OP1A 3RVQA 2XNCA 3VSBA 2JIOA 1A76A 1D6JA 2AEMA 4ZVOA 2ONYA 2ZR7A 5TF0A 3X43A 1KP9A 4RZQA 1NTOA 4IVPA 4NBKA 3SNKA 3ZK9A 1X7YB 5G2OA 3ZQJA 5JY1A 2WT4A 1S4QA 1PQYA 4FSHA 3L41A 3H0CA 4W5OA 2FZWA 3LGAA 4UXHA 3OTHA 1V1JA 4RVHA 4TROA 1Y8AA 2BW0A 3PNMA 3FGOA 4LGMA 3VR4A 1RLJA 4JVNA 3VKHA 3RNOA 5ED4A 2FR8A 3AEUA 4G56A 2QXTA 2QL6A 3O82A 3DL7A 4L3OA 1V45E 1PFYA 4YJ3A 5JJCA 2VLBA 3LT0A 2O50A 2C0PA 1Y3CE 1PEYA 2C61A 4FLFA 3RTEA 3GP5A 5F2NA 1Q0TA 2ZJ6A 2WEKA 2GAOA 3ELDA 3IBYA 1A8SA 3EJ6A 4EB0A 3ROGA 2R86A 2YOFA 4MVJD 1J8DA 2ZRKA 4LBWA 1IYZA 4Q15A 5FBQB 1BX0A 1R8YA 2C9ZA 4CV1A 2VP6A 5FX2A 3LO5A 3R0ZA 4WEOA 2XTAA 1E2IA 3HK2A 1XTIA 3VVCA 3CX8A 4CEHB 5EFZA 3MC1A 3ROFA 1TCAA 2J8ZA 1XMIA 1N6KA 3EQ9A 4P34A 1L1FA 4D9KA 4K9LA 4DG9A 3IUPA 3R23A 4EP1A 1TIBA 3E8XA 3TVDA 3RTDA 3ZXSA 4MUHA 1YFJA 4A0HA 2VVTA 2VNJA 2PFGA 3RADC 4P4SA 2BMAA 5DNEA 5B64A 1TTTA 1SQSA 4CI0B 3PEYA 4YRBA 1WW2A 3NVKI 4TVBA 3WTCA 3KQPA 4AZWA 5AW6A 1J6UA 3C39A 3ZLBA 3I09A 1AURA 1PNTA 1FSFA 1KEUA 1LI5A 1UJBA 1KVSA 2SKDA 2W0MA 5AJVB 5F51A 5FYDA 2YZGA 4XWTA 5DH9A 3T9CA 3I6QA 1PZMA 1WKVA 1T24A 2WUEA 3ABZA 4NYIQ 3JQ6A 3IDQA 2G4CA 3NYWA 4JI0B 2I22A 1J7JA 1NN0A 2X5OA 4C01A 2XPCA 2ZXUA 4ND8B 4KR6A 4A27A 2VYQA 1KZ7B 1SKYB 4HCJA 4C05A 4M0FA 1T2CA 2PH5A 5IJAA 1QZXA 2D00A 1NZDA 5K0ZA 1HMPA 3HCDA 4GT1A 4HHEA 4Y6RA 3WX0A 5BN3B 4RK1A 3WRXA 2FDXA 5L4LA 3RUHA 5HIIA 4RK6A 4JX9A 4RM3A 2H1FA 5AVXA 3DONA 4G5RA 3OEHA 4KI7A 2CMFA 1NAIA 1XZJA 5CDSA 1G2IA 1TFUA 3UUGA 1LK0A 3Q41A 3NTLA 4NEQA 4ASUD 5EJAA 4LJSA 4RTQA 4AUNA 4ZCMA 4AJHA 1EDOA 2J48A 2LUOA 4KPUA 4EPWA 2BYTA 3P97A 1AKRA 1SXJD 3WMGA 1E2DA 4GP9A 5JISA 1U0RA 2FEXA 2GCEA 3IIEA 4NONA 2IXBA 4ZVRA 5B58T 4B09A 5JCPA 1NI5A 3D81A 3A11A 3ZWBA 1VIYA 4ETWA 2X9NA 4DZTA 5LP6A 1P81A 1IU9A 3CNNA 1EVEA 2PL1A 3D3NA 2HSEA 2AQKA 1X2BA 1YL6A 1YV9A 3CUTA 4O4HA 2QVGA 2QRPA 3WYCA 2AX3A 3N8HA 4Q1VA 4UHDA 4Q4JB 5E4TA 2QVZX 3SY8A 3TIGA 3PLAE 2FETA 2YCLA 3JYNA 4AN0A 4UVGA 4YV0A 1CQXA 1LU9A 1EJ6A 2BFFB 4KRXA 3AM5A 4Z4CA 4RVSA 4CUKA 3D6HA 4DVGA 1YF3A 2Y92A 1CR0A 1JKMA 2HHHB 4D9GA 3IMGA 1EGQA 3JATA 5HDQA 5F98A 1DHRA 3G8BA 2YL2A 5E3JA 4ZXPA 3D3JA 2VF4X 4WFKA 2Q8PA 4LOAA 3FCEA 3QNWA 3UV3A 1UBGA 3ZTTA 2GMWA 2NUAB 4XPZA 5KQRA 1A9TA 5LL6P 4O2BB 4RVCA 1CWUA 3WFZA 2ZVJA 3A3PA 1YU6A 1HE8B 3O4GA 4FNMA 4EX7A 5EY5B 1E60A 4CKWA 1Q50A 2VJAA 2F2TA 4OBBA 1GFIA 2C20A 5DGCA 3DEHA 2GAFA 4OHOA 4XGRA 5KYGA 2H1WA 2PPLA 3KQSA 1RKUA 1P5ZB 5COQA 1YZKA 4MQBA 2HQ1A 4LY0A 4YHBA 4U6NA 3A9SA 1QSGA 1RLTA 3LHDA 2W6CX 4CDRA 4UUNA 2IDZA 4ENWA 3JW8A 2R85A 2WFMA 1C4WA 3P2YA 3GR6A 3TRDA 2WHRA 1UFQA 1Q95A 4BMPB 2IYVA 3D6UA 3C3BA 3DZHA 2IDKA 1T29A 1I7NA 1X7YA 2J09A 4ZZ2A 3M4NA 3OOSA 1SCQA 3A58B 4MUYA 1DCTA 2CV1A 1QE3A 4WGGA 2BLLA 4E2XA 2FPLA 1ZAYA 3S44A 3IQWA 3PGVA 1RQRA 4AZ3B 1U8XX 3I6BA 3K6RA 2O2GA 3VXKA 1X80B 4ID3A 2CYBA 1NBHA 2HIMA 2IA5A 1W96A 2NPOA 3ZJ5A 1AUPA 3TINA 1XQXA 2WG2A 3HO6A 5JZOA 3ZNNA 5EOVA 2DLDA 5L7TA 4NOJA 1LPPA 1UBTS 2Q5CA 3RFVA 1NTRA 2V4MA 4MW6A 2PWAA 1BGWA 2GM3A 3LA8A 1N6OA 3OM1A 3QXXA 4GKJB 2XIQA 2J33A 2RGUA 2PPVA 1MXFA 1OXBB 5BT8A 1V9SA 2R4TA 2BCJQ 2FQYA 3AFGA 4GVLA 1JAYA 2G09A 3RJTA 3U7EB 1C8VB 4CCWA 1CNFA 2CHUA 2BHTA 3BG5A 4HQOA 3BJMA 4BMZA 3V8NA 4ZFNA 3LDFA 4CEHA 3FB1A 2UAGA 2QI9C 3DGEC 3SHWA 5D7NA 1RXCA 2I8CA 3C1UA 3C70A 1IN6A 2W6ZA 4J75A 2GN4A 4LBVA 4AM8A 1SC9A 1P4RA 1DAFA 3H6GA 5IVKA 1QGDA 4EBBA 2RD2A 2VP2A 1B74A 5B1YA 4LK2A 4I46A 2NPIA 1KO8A 2GVDC 4PPFA 4LFCB 3R3JA 4F5WA 5FUXA 1X1CA 4MYUA 3BFKA 4MP8A 5LA6A 4L50A 3TGWA 3ZWWA 2O2CA 1SVMA 1QAMA 2JGMA 4FHCA 2NVOA 4LDQA 4KFUA 2WTUA 1MW8X 2R1ZA 1JA1A 3SQOA 4I3FA 5TT0A 1N5MA 2ISQA 3HCPA 3FOAA 2MTBA 1PUXA 3T35A 3TTTA 1ZRHA 3EPHA 3GMSA 5F7ZA 4FYXA 3ZBTA 3MCVA 1TECE 1UOPA 2VQSA 2ECFA 4FJ0A 5HCUA 3IXMA 2CGEA 1Y4DE 1FOEB 2DWCA 1L5YA 2VCYA 4GOLD 5JJLA 1AV7A 4NPAA 2WSMA 2LIPA 1NSFA 1SVKA 1ZCAA 3HV2A 4DUPA 5AW3A 1Z35A 5BN3A 5IAAA 1DXOA 1JSXA 2FOXA 2JJ8A 1Z75A 1B8OA 2IFTA 1C8BA 3LW7A 1HDCA 4JC0A 1SKBA 4DDUA 4MKHA 5GWXA 2FKNA 5CXQA 3B6IA 1NV9A 1KZHA 1L8AA 2QI9F 3DD1A 1P3Y1 1LLCA 4E5VA 3SHQA 1AHIA 4UPVA 4ZCSA 4HDMB 1I32A 4PVDA 3AEQB 1F2TB 1ULUA 3FWNA 1SWWA 1QP8A 1Z08A 3N8IA 1IJBA 3DMGA 1DO8A 2V7VA 4OB8A 4BUCA 4XEHA 3KSUA 4EA7A 4EHBA 2UUCB 4MVJI 5EE1A 3O1JC 1AQYA 1U8FO 2ZUFA 1X42A 3WDMA 4Q4JA 1ENZA 3RU7A 5AJTA 2AX4A 5KTSA 3ROKA 1OA1A 1MJHA 1QZZA 2E85A 3ZDFA 2BFFA 3R6LA 2HU7A 1HM5A 1PD1A 1GU0A 4ZO6A 2RJNA 1KE2A 5JZBA 2Q2VA 5E3HA 1YQDA 2P6PA 1I1HA 3H4TA 2QDKA 5ED0A 4L4YA 3A2LA 1ZUNB 4G5OA 3LL7A 1GGKA 4BOYA 4KQMA 1C9KA 1T5BA 4B48A 2HJGA 1E2PA 4CRWB 2RG7A 4FFVA 1UEXC 2QSYA 3ZWYA 1UP6A 4GR5A 2IUYA 2UDPA 3OCZA 4EI2A 4I1PA 3VI3B 5AVVA 3FZQA 4GFDA 4LYFA 3JQAD 5BP7A 2A0UA 4WESA 3SOZA 2A9FA 1TEVA 5EZ5A 2RHLA 1J2RA 3DDNA 3IOEA 3K20A 2COUA 3PXDA 3Q8XB 2WD7B 1OYOA 1YA8A 4K8OA 4KMMA 3ZYCA 5F4ZA 4AZTA 4E31A 4EHKA 2CV0A 4O3FA 3EA0A 3HXKA 3COYA 4J1TC 1OPXA 1RYZA 2Q8NA 4GUDA 4RX1A 3I5XA 2IHNA 3I0MA 2Q4DA 3KB2A 3UA4A 4CV2A 1A0OA 1S8NA 4ZYYA 1JDTA 4E5UA 5LLDA 3L8GA 3DNMA 1QANA 5I9TA 4IDHA 1IY1A 1TQ8A 4XIIA 1UDBA 1HDIA 5KNBH 2D1QA 4QVGA 3VC2A 4YPVA 4BGIA 4X95A 1IY9A 1CJMA 3G5LA 3W4JA 3RQIA 2I2CA 4U39A 1G7SA 4X65B 4N5LA 2A9OA 2CMHA 3W3AD 3H04A 4MRNA 2AKYA 1KJYA 5C1IA 3GG9A 1U81A 4AZ3A 4F3YA 1X3SA 4LMRA 5CGQB 3NQ41 4OXNA 5JADA 4MNTA 4BE4A 4HD8A 2KSQA 4EW6A 3BIXA 3W9BA 2PT6A 4E51A 4NG5A 1SQ5A 4IG9A 3B89A 4O5OA 3QKSA 5D6NA 1J20A 1VHTA 5FPPA 2EERA 2VJMA 1JEYB 2PLFA 2VL7A 4BLSA 2JIZD 4AL4A 1U9IA 3KR1A 4ER5A 4FHDA 2JPDA 2CVFA 1POWA 1DIRA 1CHDA 5BR1A 1ZWKA 2O06A 5KYWA 5HP4A 10MHA 1RWXA 4MYDA 2IEYA 1LLFA 3B1XA 3QFFA 1K88A 2BLNA 1WXHA 3Q40A 1XQWA 2IIBA 1U90A 1QG2A 4X97A 1UK9A 1PN3A 2WICA 2VNAA 1XQ1A 1P4JA 2HRRA 2ZULA 4MDHA 1WNTA 5AI9A 1IBLB 5H7XA 3GP3A 2IXFA 1KHTA 1NP6A 2FXVA 2O7VA 3DT9A 5IG2A 5JI2E 1QWOA 1YZLA 2GBFA 4JSTA 1N1GA 3P2IA 4Q3CA 5JR3A 1RWKA 4RSHA 5JC8A 2FNAA 2D62A 3V6LA 2DMRA 3WLQA 3ZGOA 1KFCB 4TTSA 3AI7A 4BNMA 2WJIA 3RO7A 4F91B 2ZTUA 3ONVA 3R5JA 1NU8A 3CEMA 2JFZA 1VJTA 4FYPA 2WY2D 5DYNA 1ZIDA 3GDHA 4WSOA 3QVUA 4TRJA 3T7JA 1N2CA 3NAMA 3UV6A 3AVQA 3W5VA 4D0LB 3PS9A 5AK4A 2YWHA 2HMSA 4IZIA 2XMGA 3TLYA 1SN7A 1ZNQO 2UKDA 3KQKA 3GVCA 3I9V6 3E9EA 3R3YA 1T8UA 2JKVA 4ZK6A 4D4GA 2AZ4A 3P9RA 1DOHA 5AVWA 4QNNA 4LXIA 3S2UA 3TF5A 3MJTA 4MV9A 3ZDDA 1KDYA 4M38A 2ZU6A 5G41A 1SKQA 4CTJA 4ZV9A 2O8BB 2WUFA 3QJYA 1IVYA 1F0NA 3AV3A 3QQPA 1HFEL 2HV9A 2IYZA 4IDEA 4JFRA 5JCJA 1JQKA 4QLOA 1Q6ZA 1KI3A 1DS6A 4KV7A 3VPFA 4XGKA 4J16A 2QX4A 2WWVD 1A8IA 3HN6A 4HDMA 4LNUA 1YTUA 5CUQA 1F2TA 4DLNA 1RQNA 5EIAA 3E9DA 4M83A 1W2HA 4LE0A 2RHMA 1XQVA 4HPXB 4Z4HA 1D8AA 3HDQA 2ZUTA 3VUEA 3TPCA 3ZTWA 3G1TA 3FETA 3I0ZA 1T1EA 2AR7A 1ZSVA 2JJYA 2GYWA 1NMQA 3S99A 4CKCA 1JH9A 2G40A 1UZLA 2EFGA 1O0CA 1SUBA 4B3JA 4WN3A 3RHFA 5EUQB 1EDDA 2CHEA 3CUEF 2YFYA 3DV0B 4YAUA 4ZZ0A 5ITVA 4X7PA 5ALEA 1Q20A 2EYUA 3ZWOA 1NQTA 2JD0A 4GDFA 4I19A 3LT5A 2VSQA 4C04A 5CG2A 2FPIB 2GI4A 4D8VA 4E12A 5HK9A 4ZDKA 2LR0A 2QU8A 2P8SA 3F9RA 4HUQB 1R4AA 3BJIC 2RI6A 3E23A 4PC2A 3C7KA 1WF6A 4PYQA 5ITZB 2VI5A 1A5TA 2DPMA 3SDSA 5AW1A 4MP3A 5ICCA 4PLYA 1DRJA 1EFRD 1U9JA 4MTLA 1D2HA 1HT0A 4Z9XA 1OIXA 1FVHA 1OIWA 1E79D 1XALA 1OXTA 1VIDA 4EIWA 1VMEA 3DT6A 3WI7A 1A2OA 4PG4A 4R4JA 5M3BA 3URKA 1NFFA 2OSVA 1D2NA 3EFHA 3R5FA 4CKEB 5BR8B 1YB4A 1W30A 3BCRA 4P33A 5JHHB 3ZD6A 3KZNA 3HJGA 3RBAA 4I36A 2FJUA 3DMTA 2XRFA 3UHPA 1F0KA 2O9JA 3ADOA 1VLQA 1MW9X 2EJBA 4M9RA 9ATCA 2I3ZA 1SMKA 1VMIA 3H7AA 4JLBA 4ZODA 3VC3A 3WQRA 1C7ZA 4PE5B 3FCUB 1XPJA 3BJZA 3LBYA 3PF8A 1PWYE 4HDAA 1LC3A 1OMOA 1V8ZA 2Z1MA 4KZKA 4AKSA 4CUJA 3C5EA 5AK6A 3MGKA 1OXKB 3N76A 4BE9A 5KCZA 4MIYA 1HK7A 1U99A 2O0MA 2GD0A 3A4VA 4FN5A 3H84A 4G84A 3SIRA 3ZXIA 2ZRPA 4PIVA 2XUJA 1WD7A 3QVLA 4NU6A 5ENDA 4R0VA 1T3ZA 4G07A 1E0JA 1ONNA 3IIJA 4Z7QB 3PL5A 5L4SA 1L7PA 1RP1A 2P9YA 1KMCA 4YRPA 4EHAA 4OHPA 2I65A 1HV8A 5TQJA 2VYFA 3R7NA 2XYRA 4MR7B 3TAHA 1IC6A 3AK4A 4ZVTA 3RCBA 1ZD8A 2AT1A 3DV9A 4IH4A 2YWFA 2I6TA 2VDKB 2PE5A 5F3WB 3ASVA 4L22A 4EABA 2D13A 2XGOA 4EY6A 3ZE8A 4BVFA 3LKZA 3GLGB 2OAP1 2VH2A 1FSPA 2FMXA 1JBQA 2Y4NA 1E8DA 1F2UB 1DIHA 1V5FA 2ORVA 3WJAA 4ZZ1A 1D3AA 3LUAA 2OO5A 5COBA 3WIUA 5TS3A 3EDCA 1VCHA 1EVQA 3PVZA 1T9BA 2GCOA 3EGXB 3GVHA 3EMKA 1THZA 2PCLA 2GAJA 3OURA 1B6RA 1WCV1 3AU9A 3AZQA 4R40A 4CFZA 4DLLA 4GLJA 1KH2A 2IHVA 2XUIA 2QQGA 1GNPA 2GD1O 3C8DA 2K6GA 1X15A 1ZD9A 2RGYA 3AJ8A 3BIFA 3KUDA 4DV4B 2B36A 4O1IA 2V98A 3IVXA 4LX0A 5BWMA 4LCEA 4ZCQA 1Z2EA 4LYGA 1NKTA 3MLBA 3QIVA 4D9FA 4EG4A 2GZ2A 1PL8A 2JF0A 2GX6A 3D6FA 3DCYA 4QGBA 3JRXA 3HBAA 3R7WB 4ND2A 3WGLA 1XE3A 1ZKDA 1E98A 3U3MA 4EEZA 5JDCA 3ROTA 4ZARA 3WGVA 4N1AA 1LFAA 1CY1A 1NJ8A 1XI2A 1JQLB 2Y1OA 3HDYA 2BBWA 1QRRA 3AR6A 3T1NA 1HMYA 1RI2A 3AIOA 3WDSA 1TZJA 4YP9A 3TCKA 1XA4A 2YOHA 2KLBA 4EO7A 1ZJWA 3WWPA 2A9JA 4DRZA 4GH5A 3WK5A 3K4QA 1UWKA 3LTEA 3NASA 2NVWA 1SKYE 2E48A 2PAAA 3FCOA 1AXGA 1OXUA 4B9EA 5B53A 3LY9A 1NUSA 3RKRA 2O8BA 2P62A 2CVOA 1CJSA 4C0KA 2FPXA 3HB7A 2YXLA 2PUFA 3RROA 5A9TA 4BV2A 2W6MA 3EGOA 4JNKA 4JLSA 1ZZGA 4Z5XA 2IEZA 5A5GA 1OI7A 4LK3A 1DWPA 2E4VA 4RTLA 5C5EA 4HDCA 3QLUA 4Z3KA 5KPDA 3ZE6A 2QMQA 3ZZNA 1AKTA 5EJMA 2W8BA 4OM8A 3ZU4A 1YBVA 4KBFA 1DQPA 3L7IA 1O77A 2DU8A 4XIJA 2ZSKA 1G9XA 1QOPB 3QF4B 1SZPA 1T3TA 3MTIA 4RABA 5BUQA 1L7OA 4YA6A 3QFRA 2A57A 3ETCA 5L8VA 4Y1RA 3GJ8A 4TXMA 2OZEA 3DAGA 1EVKA 1LZLA 4BAZA 1G5HA 1U65A 1VCMA 1NDQA 2I4RA 3KYJB 3I62A 5LB4A 3LXMA 3MGCA 2O3QA 2RJOA 2BTQB 2ODEA 1B2LA 4TLEA 1G59A 1K7CA 3H2BA 1EWTA 1PV2A 4FGSA 3HRHA 2X2FA 3LDGA 3TNDA 5LU8A 3PRHA 1OX4B 4LTMA 4HUQA 4JXKA 4F2GA 5F3RA 1IXZA 1VE6A 4U9UA 1VI5A 3VU0A 1FLVA 2R8BA 4K40A 5K8UA 5CFZA 2IZ5A 1HL3A 3EGDB 2B37A 2B5OA 3OJ0A 3ZE2B 5A0FA 3CQ9A 4P5PA 3SVZA 3C3DA 1IEXA 4I4CA 2M2IA 2IIPA 2ZVDA 1F6DA 4QPDA 2BRUC 2QIPA 3VKUA 1SPBS 2W2OA 4PC3A 4URHA 4WKCA 5ICFA 3FWYA 4JB3A 1CUXA 2VPWA 4C7XA 2NYRA 1RHJA 4H16A 3ZHRA 4CKEA 3FJYA 5BRNA 1QGZA 1D7OA 3M6IA 1Z5UA 3LPAA 4QXOA 1ODJA 1ZJJA 3SXPA 3OWXA 3PHJA 4DEXA 4GAEA 1IQ0A 2AXEA 2HMTA 4FNGA 4F3TA 2X77A 2CSUA 4D56A 1NMZA 2EYQA 1Z63A 1OZAA 2CHFA 1VL1A 3JU3A 1NLUA 3WNVA 2BKLA 4OL9A 2RAPA 6CHYA 1Q7BA 1W4BA 3FDFA 2ON6A 5F1PA 4F3RA 2AIRA 2N46A 3DA8A 3KOXA 5AXCA 1JPJA 2VDUE 3LY5A 2OK7A 4PCUA 3UCXA 4BO1A 3C3WA 1IMOA 4M9XA 4NICA 3EA4A 3PRYA 4OHKA 4BNFA 1X1TA 4ZZ3A 3NVAA 1JR3A 1ZIOA 2QPLA 2RGBA 2JBAB 1U7WA 2PVCA 5FWYB 3EZ9A 1P9RA 4B3FX 1KOJA 5ALLA 3WYNA 1NVUQ 2Q9AA 2QTWB 2V7QD 4YWJA 5SZIA 1JYSA 1SXIA 1FJ2A 1P5RA 2IHTA 2OGWA 1H2RS 3GLQA 1IN8A 2NVBA 2JFWA 2J3QA 3G2NA 4GX5A 1DAOA 3PPXA 5A0TA 1QS0A 3UJBA 4AG5A 4DJDC 1MDFA 5JD6A 3GLGA 1OLXB 1CNEA 3M5DA 3MCAA 2EW1A 5KJEA 3HXMA 2AXPA 3BTUA 2P6RA 1CXZA 1CUHA 3WICA 4AIIA 4BX2A 1H4VB 4HAIA 2KQUA 2ZJZA 4CDNA 5H1YA 1L4LA 1TM7E 3GXBA 3QYAA 4QPNA 4UEQA 4IR7A 3JYHA 3L49A 4M1WA 3BOSA 3EGXA 3LOQA 1CVLA 3QKIA 5TRTA 3RVKA 2Q27A 4X20B 3KIPA 2OGTA 3C3MA 1XNHA 1YR2A 3RS5A 5K2OA 2QTAA 4DHEA 3L4SO 4Z7JA 3QF7A 3UWDA 1ZD5A 4FXOA 3R5SA 1GLVA 3GPIA 4MO9A 1DI0A 3EIWA 4YYZA 4E21A 5JS1A 2HDWA 4IDBA 5KNCH 4BC0A 1JPNA 5EE0A 3C48A 1OYVA 2PZLA 4D5GA 2DUMA 3RUPA 3WK6A 1GRVA 4QTZA 5K3SA 4C0AC 4F9TA 2VHWA 5EHQA 2FSVC 4RPIA 3I2IA 2ET6A 1YU9A 2JA1A 3GZTB 1MAUA 4IIXA 3R7WA 2JJ1D 1C3OB 4N03A 4M9CA 1X94A 3ZJTA 5J40A 1H1DA 1SWVA 1EM6A 1GZ5A 3ZW8A 4ZJPA 4HEHA 1SK9A 1F3LA 3K9NA 2JGAA 2ILVA 4V03A 4WACA 3GPCA 2EIHA 1N2CE 4KFTA 4GSKA 4E07A 4IIJA 1JYEA 1Z8NA 1SB8A 4D8TA 3UBTA 4PBTA 4F46A 3MMPA 1U0EA 3W79A 1ZOSA 1XP8A 4RPKA 3EG5A 1RSZA 3IEIA 3OZCA 3EZNA 3JQ7B 2OKGA 3KQOA 1YB7A 4FYWA 3RSZA 3T99A 3WL6A 4DLBA 4GXTA 3HI6A 4YCNA 2WVHA 3ON5A 4HDOB 5H16A 1W48A 2Q29A 2ES4A 2I8AA 3A26A 1Q5PA 3EY4A 4Q1CA 3V1TC 5U4XA 4XQGA 2IW3A 4QHSA 5C1OA 1N2JA 2PZKA 4G1BA 4Z9BA 4PLWA 3NUZA 3LX5A 3PFBA 3P4XA 2R87A 3VH1A 3HUUA 1M1XB 1OGJA 2VWGA 2MMGA 1KO5A 2VTBB 4BKRA 3ZDCA 4YGXB 1I1OA 1OJLA 1ZESA 2ZT6A 3OX3A 1PNRA 2FRDA 1ZL2A 3IUEA 5I4BA 4P98A 3RR2A 4Z8YA 1TAHA 2ZSEA 5BQOA 4IOMA 3V4ZA 2Q6OA 5AI6A 4EOGA 2ZQ5A 1A3CA 3OO1A 1XEWY 3Q0IA 3K1AB 4DBVO 1GP2A 4KQEA 4DJEC 5LQCA 3W8DA 2BTQA 4OOEA 1UZMA 4IGAA 2IK8A 2W9XA 5SICE 3V7UA 3MTEA 1H0RA 1Y1LA 3SZ3A 1VYUA 3IAUA 1OX4A 1QF7A 3NKVA 3HCRA 3OI7A 4DXDA 4YAWA 1H1TA 2PXHA 2VTDA 3QVGB 1H6DA 3ECSA 3NANA 4IQFA 5F5NA 3UW1A 1DAEA 4WH0A 5F52A 1QIDA 3GCWA 1JF8A 3OX4A 3NOOA 4LJ5A 3EGDA 4EHFA 2QTHA 3A3NA 4TSFA 3UTCA 2QYHA 3EEOA 3CVJA 5CCXA 1JSZA 4OQZA 4G0UA 2QPOA 3PE6A 3HNRA 2JJ2D 4G37A 4BO9A 4K9DA 2VOEA 4HS4A 1T35A 3EFOA 4H3HB 3V55A 2C7BA 2VSXA 4K9QA 5J5VA 2WJGA 2ZBUA 1WF3A 2J6BA 4E30A 1Y42X 4TGLA 5K4AA 5A1JA 1OC2A 1RAFA 1QDUA 3OBBA 3KDSE 4HWKA 1E0AA 3ICQB 4V2UA 4NIMA 1C81A 5JLAA 1SCNE 1VE7A 4DXHA 3C6QA 1KH1A 4C4AA 2QUZA 3PBKA 2A88A 1XAHA 1SUSA 1T9GR 1Z7WA 4ED9A 4GOOD 3TKYA 4R0MA 1TKCA 3HO1A 1A82A 1ZIPA 1O97C 3WK8A 3EVFA 1NKSA 1UIMA 2UXCB 2C77A 1KZ4A 1LDMA 3KEGA 3RAGA 3IE1A 3Q98A 4IX1A 2YXPX 4KLCA 2JAWA 4TKVB 1YIDA 5TGZA 1IOWA 1J99A 2HWKA 3E7FA 4UDXX 1KBZA 3FROA 4QAJA 5BNTA 1KAOA 5IVHA 4Z53A 1VCOA 4XM0A 3FPFA 5I01A 2P2LA 3V8VA 3LXXA 4WBXC 1NN5A 4CWAA 3O3OB 4K6OA 5EWLB 4ARZB 2ORIA 4OF4A 1XTKA 1XF1A 3IPCA 5HOEA 4B71A 1BNCA 1OLXA 3D3WB 4CIXA 4IH1A 5HQ3B 1CSEE 1A2BA 1R9NA 2VNHA 1W93A 3BWBA 3TB4A 2CLIB 4AS3A 1ZCJA 2JH3A 1IONA 1F3OA 4R9UC 3CNLA 1J1IA 4KX3A 5FL7D 4OHUA 1VDZA 4P58A 1KAQA 3QVWA 1WTAA 2RGNA 4MS1B 3LRXA 2V6GA 4UPEA 4YJDA 4G85A 4MVJM 5AHXA 1YDWA 2GM5A 4X20A 4U5QA 4E1BA 2XB2A 4LXQA 1M0SA 1I3MA 4LZPA 4E88A 3LI2A 5A4FS 4C7VA 5KC8A 3DMNA 3NIDB 3LX6A 3M9LA 4ZAWA 1UADA 5EN4A 5BR7A 4RTPA 4OCZA 3GN2A 3FTCA 3TGPA 2AG6A 4ZOLF 2IEBA 3ANYB 3KJZA 2GO1A 3CSDA 1YZNA 4KE7A 2YWJA 1R37A 4HLCA 1X1BA 4RETA 5E0KB 1SCAA 2ZE8A 4ND7A 2VHZA 3DLAA 5EQFA 1C3OA 4QM7A 3ADCA 2VDOB 2YX1A 4KDFA 3C3KA 3FTDA 4RADA 5U1PA 3TLAA 4A73A 4HB2A 3DKIA 3P8ZA 4U00A 3R7BA 1Z3CA 3Q8MA 3ITEA 1JZTA 3NTRA 1I4EB 4G5YA 4KXYA 1QCCA 4XPIB 4TYWA 1KRWA 2HK9A 1Z6QA 4N01A 1N6HA 1AN9A 2AWOA 2ZSUA 4OMCA 4A26A 5DSXA 3QMPA 4EYKA 3KUXA 5DGIA 1HG0A 1KDRA 3KKNA 1J0XO 3SX4A 2BONA 2C07A 3JQ7A 2PGNA 2RAFA 3S29A 5IULC 2CZQA 2IKSA 1X7DA 4C22A 1WAMA 2AD5A 2OAGA 4CQMD 1Y98A 4IHJF 5HF8A 4MKIA 5MFPA 2VJYA 3GLTA 5FP0A 2O2EA 2O2DA 3NAZA 1GLGA 5CM8B 4JR1A 1FSGA 1KP2A 1YB2A 1SULA 4BWGA 1CQIB 1YR1A 2QN3A 4K6CA 4AO7A 4PC6A 3CLRD 3PCRB 4QL3A 3HJAA 1UBCA 4RWEA 2QRZA 3HDJA 3HXTA 1T91A 2FG7C 3HY3A 2OPHA 2ZJ5A 3NKLA 4AMYA 2VTBA 1YR9A 3RE1A 1BZYA 3M33A 4EI8A 2D0PB 1L4NA 4YP6A 3UMCA 2IOFK 2H17A 2R5WA 4HADA 4CCSA 1YR6A 3AXTA 3IAXA 5P8WA 4ZTUB 4LNAA 1P1HA 1KEEA 3FSGA 1CJKC 3QNMA 1WA5A 1NHGA 2BUBA 1ZXBA 1T4BA 1S8FA 1G3MA 1N3LA 1N92A 3K1AA 4KBYA 4YK7A 2VO1A 3F8TA 2FPGA 3X44A 1MAWA 1A97A 2AG0A 1TW3A 1LDEA 4AUKA 3W1VA 4EDHA 4XASA 1OQAA 2D3TA 4GOMD 2Z2IA 5THQA 2PUAA 1NY5A 1JIVA 5JAIA 1IE3A 3SF0A 4RH0A 2B82A 5AKYA 4YRIA 1FFDA 1PJBA 1VE9A 5F1YA 1FYXA 4P7KA 3D2LA 3QVGA 3B53X 1R4MB 3E27A 4YRJA 3ME5A 3RG8A 3I4FA 1C8LA 1FJGB 2C5SA 2VWQA 5DYIA 2DLCX 2YVQA 1DMRA 3B1VA 4IBOA 2XMSA 3WGTA 4FFMA 1HA3A 2VQFB 1PAUA 3IEUA 3R6DA 3PIDA 5EXSA 1KQOA 1DRWA 1FP4B 1Y6ZA 3FVTA 2I3GA 4FPXA 4X8HA 1L4BA 1L7BA 3ZCQA 2J0UA 1NW9B 3R3WA 3JPWA 4RLFA 1JR6A 3L0DA 3LPLA 5GJWC 3MWYW 5E1DA 2XCUA 1JLSA 1TNDA 3I34X 4X6YA 3AEYA 4J4TA 1RXUA 2P11A 3I0NA 1NV8A 3B6ZA 1YDHA 1M72A 1OFTA 2JD1A 3A4NA 4L0QA 4Q16A 1XBTA 3S2ZA 2GZ3A 1AKVA 2FYTA 1NRJB 4LSMA 2N42A 4WKOA 4HQLA 1UT5A 1JLLB 4PR3A 5K8TA 3KR0A 5CTAA 1MGOA 3AI2A 1U28C 4MV6A 1KZ1A 1ZD3A 3TWOA 2RGCA 1TD9A 5TDHA 4QUEA 3RVLA 1QCYA 2IPAB 1XNRB 1ZS9A 4H3KB 3WS7A 3L0IB 5G1NA 4YMTA 4DAEA 4MITA 1Y9DA 1VHJA 3EH1A 3K96A 4O4LF 1N0HA 1LWNA 3ZU6A 5CB6A 2AXNA 1N6PA 2CFOA 3HGQA 4TKVA 2W2PA 3H5AA 5CH8A 4B6RA 4YRSA 1UJCA 3KOYA 4L5YA 1NKVA 5B7QA 1GFWA 4CTNA 2PKCA 3OJCA 4N0QA 2HF9A 1M2NA 1Y80A 3B5IA 2GASA 2XUZA 3G02A 3TLMA 2A59A 3LECA 2QZ4A 4TLDA 4BLVA 2C2HA 4YXWD 3SJZA 4M1KA 1JR3E 2PO5A 1NVEA 4Y2HA 3W1EA 4F2DA 1N2BA 5EWLA 2FHSA 3AESB 4ARZA 4KC0A 5KTOA 2GVNA 4LF4B 3VR5H 3CZPA 4LKOA 1T9GS 1P2SA 3D3WA 5FFNA 3AHJA 5HQ3A 2GAAA 4D81A 3S81A 3C16C 3FZEA 3BX1A 2CCKA 4NYIR 2H85A 3V1YA 4OUKX 3GLGE 3IR5A 4QTXA 4HNAB 3VSCA 4D9EA 5JNSA 1YI0A 2BKAA 3VPAA 5C9ZA 2LIVA 4M9QA 4UULA 1WB6A 3A4MA 2O1EA 3JSXA 4KODA 3TIVA 5KWEA 3H0EA 5ALDA 2REXB 1NNI1 4LPKA 3SYKA 3VKVA 2H1OA 5COAA 1RM5A 1N7JA 1DKNA 4P32A 4XJXA 5KQGA 4PPQA 3I9FA 3L06A 2HIHA 3ML1A 4QT0A 2OXCA 3S2GA 1AZLA 1XVTA 2H5IA 2RHJA 2PSHA 3AU8A 2PS9A 3CNEA 2PXCA 4OFZA 2Z95A 3LQFA 1FNCA 1LBSA 2FJ0A 5T6MA 5LBTA 3HWWA 4RKEA 5BSVA 1EQUA 2D2XA 4AMVA 1XGKA 3GA0A 3KQVA 2OCXA 3BA6A 1NUQA 2JDID 2I33A 4QUKA 3VR3D 4D41A 1R15A 1T6XA 4BFTA 2FX5A 5IZ4A 5KU7A 2PJRA 1M54A 1RLIA 4QODA 4FCVA 3JQPA 1N6LA 3CKYA 4H6XA 1Y0BA 1FDTA 4LXXA 4UUQA 5EUMA 4BQNA 2NTNA 3MWEB 2EP8A 3EF3A 1V71A 4AJ2A 2BDTA 1KQNA 4PN3A 5E9JA 4KNYA 4IL5A 1K92A 4NBNA 1JE0A 3FTNA 3H0KA 5G0SA 1FDRA 1SJ9A 1UXKA 4H6PA 3N5KA 2VDRB 4M1TA 3VPDA 1OX6A 1HEYA 1G64A 2B35A 1FNSA 3LQ2A 4B4OA 1LBQA 3PUXA 1DG3A 2PX6A 4Q3NA 4RJKA 1CQIA 1RLMA 5DLEA 1CS4C 3C7AA 1EHIA 1G2QA 1RAHA 2H1HA 5JPCA 4D42A 2IYLD 2NSJA 1I3KA 1GUFA 3DE1X 3HB5X 4UXIA 1J4AA 5EG5A 2WM9B 5BMVB 2YNMA 1TYBE 1J21A 5DHSA 3R76A 2FQQA 1H8HA 2OR3A 1T6YA 3D4NA 3O9VA 4Y6LA 4DHWA 5IVIA 1NVBA 2ZS7A 3EDOA 1A9SA 1CE8B 1B15A 1QZUA 4TSRA 5ER9A 4NU8X 1OXSC 3E9YA 1QJ4A 2IPMA 3F1KA 3OJXA 4MULA 3UAYA 2AGVA 5A9RA 2HYIC 2A9RA 2NUTB 2TYSB 2XCLA 4IGKA 5DCUA 2P6MA 4TYQA 1UK7A 2FN8A 4RVUA 4RFVA 3A4YA 3QH4A 4BMCA 1TQDA 4HEQA 4JJ7A 5DISB 1SOVA 4B43A 5JFTA 2EFJA 4W9MC 1B8UA 1OXMA 2VUHB 1N2HA 1O5IA 2WWIA 4MQMA 3LCJA 5JDIA 1Z5GA 2HF8A 1R4MA 4NMWA 3UV7A 3NDBB 4HJRA 4PYRA 1JKXA 4FEYA 5D7BA 1SO8A 4U2CA 1H0SA 1E94E 2JGKA 5HUJA 5KQSA 3DHYA 1WSAA 2F67A 2VF7A 4OYRA 3PGXA 3BE8A 1FP4A 1PD0A 1E18A 2B0CA 2VUSA 4PV7A 4YMWA 3E2MA 2GCGA 4UOZA 5JWRA 4X66B 4KQ6A 2ZCUA 4LOLA 5HIMA 3GIWA 3IXQA 3KYDB 2AR0A 3D59A 4O4JB 3RGWS 3RK0A 4OREX 5TMPA 2H2IA 4B6GA 3GDOA 1XKTA 1NVFA 3FVQA 2WF7A 2OXRA 4XYGA 1B00A 3OFSA 5DW3A 3H05A 4AJLA 5EJ6A 3M6MD 6ABPA 1OI3A 3MMNA 3EOAI 5E7MA 1PJAA 4XDGA 5CFMA 1JLLA 1P77A 3N0RA 3OLYA 2C4MA 4DR6B 4DQXA 1XCLA 3HQ4O 1WMDA 1IZYA 2O8NA 2G9QA 5EERA 1H9CA 4QXMA 3EIXA 4Q01A 2WM2A 4MQUA 4NZ9A 1QAQA 2YWDA 1RKBA 1NXQA 4W4TA 2VDJA 2YMLA 3F78A 1IRIA 3M89A 4M99A 1W581 1UC4B 4XIGS 5CBKA 5K3AA 2XSZD 3L1VA 1E7QA 3K2EA 4BMVA 4WTOA 1QYRA 4GGPA 1RW4A 5F2EA 1T4GA 1SU6A 5AVZA 1MABB 3BEOA 4E0BA 2XBUA 1A7UA 3SF8B 3CZQA 1J09A 4Z0TA 3AESA 4NE9A 4C3VA 1EX9A 2BC9A 3FYUB 4IVRA 2Y2VA 4CF4A 4R31A 2G8LA 3BH0A 4FFSA 5P21A 4F85A 1RRMA 2DLNA 4IPTA 3W6PA 3U19A 1MA3A 1BE1A 2XRMA 2CKDA 5C1DA 2DM6A 3AI1A 3RWMB 1R4NB 3WHPA 1TA4A 1YRQA 3HBLA 2NVUB 1QHHB 3DOCA 4HNAA 4EF5A 1A7JA 1LF0A 2QZJA 2X5JO 1FPMA 2G82A 4TV8F 3VOSA 4W8GA 1Z17A 1LV8A 5FO1A 5AW9A 3ZIUA 1Z47A 1ZIXA 4E2FA 2E2WA 2NP7A 3BAFA 1EFPB 1V47A 2QN9A 4PO9A 4TQ9A 3N8DA 3U1VA 4DLAA 3CUYA 5BSWA 2TMGA 4G1EB 3QBJA 1D5CA 3AUJB 2IUEA 4I4TA 3KV3O 3S2IA 1G8MA 3WYBA 1STOA 2IU6A 2O4UX 2R8YA 4I14A 2X8WA 4DJTA 3ICOA 2B3DA 4J2TA 3DDSA 4YP5A 4CF6A 4R54A 4EJ6A 3AZPA 3NHMA 4JH0A 4TV9A 4XVRA 2VT3A 3W9SA 3SM3A 4L8VA 2V7WA 3ZHTA 4B1FA 5CIQA 4NVRA 4JXJA 3WOVA 3KKLA 4QNMA 5T4FA 5HJ7A 1PZFA 2NU9B 1YZUA 4WJZA 1XEFA 2H4XA 4BQRA 4DCOA 1FTSA 2RB4A 3D43A 4C87A 1H2YA 3WMEA 2VAXA 4Z0HO 4PGHA 1E3JA 1ISSA 2UV8A 5KNDA 1TEHA 2IVFA 4I1SA 1EU1A 1PLLA 2QBYA 3VM6A 3D4LA 2YYAA 4P22A 3MWEA 2QE7A 2X8LA 5HF6A 4MLPA 3QXJA 3RVDA 2XE4A 2FGJA 1HE4A 4GOKA 1KQFA 5KOHA 3GNSA 4B74A 2DVMA 4IAOA 1YVDA 4OD0A 4TYPA 3WQHA 1YB1A 4YACA 1SHZA 1QCZA 3EEBA 3UFXB 5IM4F 1O89A 1USGA 3LCVB 4DM7A 1AUOA 3BF8A 4C0WA 4HN9A 4EATA 5C80A 4RKYA 1Y8QB 1BYIA 4FFWA 4GPIB 4NYMQ 4WHMA 3LC1O 4RF4A 5CH3A 2I66A 1G5FA 1Q3HA 3H5RA 4JB8A 1IN1A 2DTEA 4GMGA 1K3FA 2OZPA 2UZAA 1SG6A 3KP1A 4L73A 3PXAA 4WIAA 5B3AA 4FGLA 3JTEA 4DQDA 1W6UA 3ILXA 2QP4A 3EHEA 4QGSA 1GQSA 2FZKA 1Y6QA 3NV9A 5BMVA 3QG5A 3QPVA 1SBTA 2FK8A 4TUYB 5KTKA 3RVPA 2FWMX 3KPYA 1OB5A 3O4HA 4FDAA 5ULLA 1CUFA 3GRUA 2GERA 3RHTA 4NMHA 1YQTA 3UZUA 4E1AA 3K70D 1K9SA 1LSJA 4P7BA 4II2A 2NUTA 5DTRA 4ARAA 3TZEA 1YUBA 2EJUA 2R6ZA 1C0IA 5IM5A 2GM4A 4RY9A 4V0RA 2MIIA 3ABRB 5BW6B 4DJJA 5JSZA 2H1CA 3D5EA 2D7JA 3P96A 3Q9SA 4TL7A 2YY5A 1RD4A 3A0UA 1V16A 3B52X 3EQ2A 1N5DA 4RQAA 1UMKA 4HFJA 4RD1A 2H4JA 1FXWF 1TQ4A 5JVDB 1P73A 3OZWA 1LBTA 4D9BA 1QG6A 3THWA 5EEHA 2FWIA 4M8LA 3CB2A 5AI8A 1O0SA 3U9SA 4IJ5A 3I04M 1AGPA 3G8YA 2OVFA 3KYDA 1WCXA 3EF0A 1MQ8B 1PNVA 1Z4OA 3FYCA 3VZBA 4F38A 2C9BA 2F9LA 4G3XA 4WK4B 1MRZA 2H4WA 1MZPA 4H7PA 2WJ3A 4FJ2A 2VKQA 3W9YA 2C5BA 5JZVA 1S9DA 3FPHA 1PJZA 2D0OB 4D80A 3T1HB 3OHMA 2NO7A 4OY3A 3KKOA 2Q1TA 5IK2A 4OQYA 1BE8A 5EGSA 2G04A 2QTNA 5BYKA 2R3SA 4I9GA 3SC3A 2NXEA 3D7LA 5EQDA 4Y2GA 1RKVA 5I7OA 3EDMA 5K3BA 3AUFA 6NULA 1FCJA 2B5WA 3ZPXA 2V0CA 3WWEA 5GIOE 1YWGO 4HATA 3FOWA 3N2EA 4IOJA 2A9QA 3UY4A 5GTDA 1TEZA 4NXMB 3WL5A 4K3UA 2VWPA 4BBZA 2VHEA 1WB9A 3QPDA 1FRFS 3ESAA 3PQ3A 2E49A 1UWCA 1S1CA 4J0CA 3PDCA 4LECA 2G67A 1I01A 4MVJP 3UHOA 3AFMA 3BKWA 4FIZA 3SF8A 4GF5A 3H9BA 2B30A 2A9VA 3NHBA 4P86A 1N57A 1XJQA 3C3AA 4RC9A 4MEAA 3QE0A 3FYUA 3T1YB 2OE2A 2V7BA 1DU4A 2I8LA 3CR8A 1P5FA 3LVRE 2HCFA 4R7TA 2UVDA 3CRZA 1X87A 1H69A 2FQ1A 4RKQA 5DHTA 2VA9A 3CX4A 3IILA 2WAXA 1I80A 2H51A 3PHIA 5EMNA 4A8JA 1U63A 4U0KA 5B7NA 4F3KA 1QB8A 1R4NA 2NVUA 4P80A 1V3VA 1QHHA 4ZI2A 1V5IA 2EL7A 4NECA 3GCXA 5TEWA 4MGYR 2ZI9A 5DHQA 1VG0B 1C4KA 3CPHA 3PLNA 4BFVA 1SZJG 4E4YA 2BUAA 4MPJA 3WK9A 4FYJA 1G9SA 4RGBA 4B3BA 1TCCA 3O4FA 4PRLA 5AR1A 1NF2A 2FSIA 1J42A 2E4UA 4EQ6B 1LNQA 4TMXA 3DE3X 2JFNA 3HN7A 5DU2A 1FFXB 1RBMA 3NTOA 3RS7A 2D6FA 5JS2A 3IUNA 3O8DA 2R8EA 4L78A 4AI6A 3I6ZA 1UJMA 5BNFA 4IYJA 5AVOA 4BJ5A 5B7PA 1BXGB 2NNWB 2OBNA 5JMTA 1KR2A 4Y2XA 1X1AA 4BMDA 3OIGA 4U3JB 3ETGA 1DQZA 3A6EA 4O6VA 1EVYA 1H2EA 1F6WA 4NH4A 3RODA 1J90A 1X0XA 2WF9A 4C4XA 3T3OA 5A2GA 4FGKA 3O1IC 4B8ZA 3NHYA 5WRFA 1EGAA 2Q46A 4WZAB 1JAXA 1HT2E 2AC7A 2CNWA 3I52A 1R6XA 2HLDA 2NSYA 3Q7SA 1NJ5A 4MWOA 4W7HA 4BKMA 4YV1A 2I1VB 3E5RA 4Q4CA 2FZCA 1JDVA 2PFKA 1CZLA 1N1MA 1SUWA 4JJ8A 4TMTA 5ERYA 5TGTA 1UPCA 1NLMA 4Y7CA 3SBXA 3ANXA 2WF8A 4Y0AA 1WQ4A 4PSVA 5C8YB 3D0QA 1GD1O 2O3UA 4C6SA 4BMNA 3NBMA 2I1QA 4XVHA 1W0KD 5GVRA 5D00A 1Z0FA 4LGVA 1ZG3A 2GFQA 5A5DA 3N74A 4CGYA 3GUYA 3O4IA 3U3XA 5AICA 1Y8QA 5C7LO 3RUIA 4ZOAA 4DGSA 1TAGA 1ZMTA 2HN9A 4P2GA 1NJ1A 3UUEA 1P2VA 4L9AA 3IUBA 5AM1A 5ILOA 4RANA 2A14A 2BGMA 4Q0MA 4QTTB 3O8RA 1RWMA 2ZYSA 3AR5A 4JLOA 3CCCA 4KK3A 5AHKA 3WZMA 4TUYA 4C0BA 1KO4A 1XDZA 3DDUA 1BHQ1 1VKHA 3RYFA 3JQFC 5LUBA 1ZMBA 1Z3IX 3LU1A 6ADHA 4PXSA 1IDN1 3HVUA 3RS4A 3I2FA 3ZNPA 2QORA 2QTLA 1Z18A 1DJOA 2HJWA 1CC1S 4N3BA 4QGAA 3ZGXA 1PDVA 1GPMA 2SKCA 2ZRHA 3JQGA 3TRHA 5DXAA 1CHNA 1RS0A 2JFBA 3OLQA 1Z4IA 4MPDA 4EGAA 3FHTA 1IBSA 1O95C 2N47A 5CMLA 3LG2A 4G09A 3ZWCA 2O1XA 3MELA 4GLFA 3CISA 1G2PA 2RHDA 1I6LA 4YRZA 2QNBA 2QD3A 3LXUX 4DPKA 1LTQA 1GUYA 4IHAA 4OLJA 5IYZF 5CRIA 8OHMA 1VLZA 3DH0A 1U3CA 3VR4D 1ZRNA 3LUPA 4ZTBA 4AKGA 2GF9A 2IPLA 1AB6A 3KVNA 2Q3DA 4ZRNA 1J5XA 5HTKA 3ZWKA 3H5WA 5KJ6A 3H9UA 3AY6A 1E9EA 2RONA 4O02B 3EZ7A 4JBLA 4PG7A 2QQEA 2ZE6A 3WG9A 4CMEA 4NC9A 4B79A 3K0SA 4MICA 1T1RA 4DCTA 3I53A 4TVKA 2OG1A 1RCUA 3ENQA 2JBHA 1G8FA 1PYDA 3DZ8A 2AFIB 1GDDA 3H5VA 3I9KA 2KB0A 1K75A 4NS4A 4ENRA 1NZFA 2FPSA 4EG0A 1FDOA 1DX4A 2CHVA 4DB2A 1XEXB 4RA6B 2Q3CA 2J9FB 4PW0A 5EMMA 4EGQA 4HWTA 2GK4A 4UVDA 8ADHA 3U4GA 2IOFA 3BHNA 4FZ3A 2YXBA 5KJFA 3UPTA 1TM3E 1P1RA 4JJIA 3KT8A 4IUCS 3F46A 4X1YB 5KHAA 1WP9A 2V58A 2QZ9A 1E92A 2EWWA 3WNDA 2HSDA 2DEUA 3PFFA 2FFBA 4B3DA 4ZVVA 1R0WA 2VXCA 2ERCA 3C6BA 4KNVA 5A03A 4NK5A 2LKDA 3NEAA 2VT7A 3A4TA 5E2AA 5MGBA 1NXSA 1CY4A 4II7A 1E8NA 4X93A 3NH9A 2YJNA 3E9MA 5E38A 4MV5A 4ZGGA 1N32B 1QFMA 4I66A 2ENWA 3G9TA 4DV2B 1A9PA 3HKDB 2PGLA 3R4VA 4MCJA 4QFMA 3VKWA 4GGMX 2HXGA 3B12A 3OU2A 3B5JA 5E4FA 3VVMA 1E61A 2IHYA 4UU7A 5JJIA 5DLYA 5DGDA 2EAUA 1E5XA 4WOCA 1EVZA 1TCBA 4R2KA 1H9BA 3V8BA 4C4OA 1C1DB 4D99A 2CL7X 1FSZA 1GL7A 2BH2A 2GWRA 2ORYA 2VCEA 3A1TA 2ZT8A 3EVDA 3HZRA 2G1JA 4JT2A 3VTKA 4Q4HB 5DCLA 1BVYF 1KI9A 5FB3A 1Y89A 1Z7YA 4Q00A 4F4JA 3OEHD 2H4ZA 5F23A 2R6R1 3FWHA 3L8FA 4WUTA 3CLSC 5CH5A 3QWIA 1HTWA 2GN9A 3OE7A 5G3YA 2CXOA 2ZB7A 5K01A 5JXWA 4HG2A 4GGOA 4YFVA 1S4MA 2V6FA 2VAVA 1VZ2A 3E05A 1KI6A 2DY1A 1BXGA 1GZ6A 3NBQA 3DE4X 1CJUC 1DJMA 2B5VA 2QZPA 2X8JA 1SCJA 2YV5A 1P72A 1L5WA 1PG2A 3CR3C 4KSBA 2EDCA 4P3OA 5HFNA 2ZIFA 1V48A 3CNHA 1I5RA 1K4YA 1N5JA 2O2IA 3LFUA 2QN8A 3Q6IA 3GBPA 3HFRA 4WZAA 2QNRA 5H0IA 3NVMB 3AERB 4BV8A 2VDWB 2M98A 4MVYA 4ZYWA 3T5AA 1WLSA 2FE1A 3AILA 3E7DA 4Y3UA 5FR1A 3P0FA 4UHBA 1HUQA 2CJWA 2Q6IA 4ZC1A 3SEQA 3O3CA 3GBVA 1W4LA 2V6IA 5C8YA 1NIJA 3ZD7A 1LTHR 4B7AA 4JC8A 1VL8A 3L1IA 4MRVA 3WLMA 4IXWA 3KT6A 1Z25A 3CC8A 3KXLA 1JEEA 2J07A 3DQPA 2O7NA 4L0DA 5FBKA 2Z8YM 4REMA 1Y8RB 1SCBA 1YS1X 2EFYA 3QUQA 4G8CA 1A2QA 1ESNA 1BGXT 2NZWA 3UC9A 1XMXA 3Q9LA 5T41A 4ECEA 2XB6A 4P3PA 4D8YA 3QLTA 1CZKA 4MYTA 4TMWA 2AF4C 4DEVA 1W85B 5AM5A 1HT1E 3QXHA 4BEBA 1X7XB 2X14A 1QBKC 1USKA 3LJKA 1W47A 2Z9BA 2RI0A 3RF7A 5KNBA 4CR7A 1P31A 2XNDA 1CEQA 4GKVA 3E9CA 4X84A 3A2NA 4MWSA 3V5NA 4KN6A 3WMWA 1AMNA 3GO4A 4HB0A 5K8CA 2PMBA 3NHLA 1T5TA 2UZ1B 3FIUA 1TL7C 2WWRA 4R81A 3QYJA 2F1KA 3F73A 5AD1A 3GCZA 3UYKA 4PSKA 2R6DA 3AFHA 3VA7A 5LBUA 1LCIA 1P1KA 5ALKA 1QKKA 1I4TD 4JNCA 2B7BA 1QVRA 4RDIA 4OLFA 1NBMA 1HRKA 3P27A 2R44A 4I4IA 3OE1A 4V0MA 3SZOA 2HU2A 4ND1A 3BXEA 4DWVA 1KH3A 4LDAA 3OLWA 4NOLA 1W75A 2GH1A 1AKYA 4K81B 3SM9A 2C3UA 3OX2A 2CXTA 3ZI0A 5ELLA 1FP6A 1RWBA 5A3SA 3V2HA 2XOKA 2WJ4A 4DXAA 5A4IS 5E2BA 2PBLA 5BRJA 5JS7A 2PRIA 4XWGA 3RKSA 4RFSB 4LQLA 2Z6UA 4XCVA 4KGDA 4UNIA 3HWSA 1ORRA 3JX9A 3PLRA 5KX5A 1Y9JA 1QBGA 2Q1SA 1N7HA 2P9JA 1QK4A 3ONDA 4PZEA 5HWSA 2UYHA 4V2IA 4AY6A 2CLKB 4YS6A 1WZUA 3AY0A 1PZNA 3F6PA 1RXYA 4QDJA 4EECA 2V5AA 3INNA 4GL2A 3RJ5A 1NVMB 1UT6A 1QC5B 5B2FA 1XDDA 2P1DA 5EJIA 4E11A 2AFIA 3EBLA 1AHNA 1NM5C 1Y7TA 4IIEA 1K8RA 3K6JA 1RVV1 2FEAA 4EMUA 4OHCA 4R1PA 1KI1A 1JJIA 3OIDA 3ETHA 1MT0A 1XYVA 1XEXA 2VNSA 4RA6A 3IEPA 3SC6A 2J9FA 4CM6A 2X7JA 3RW9A 1PF7E 1ZXXA 1IIRA 2WJ6A 1G8KA 4FINA 2G9RA 3LHKA 3LHSA 3KKMA 4JAVC 2EF0A 5L51A 2JK1A 1TTQB 4ZO4A 2GBLC 4EFKA 2JI7A 1LJ8A 3BB1A 3Q1KA 1U2SA 1WY5A 1G60A 5DCWA 3SEFA 2J0EA 1GYRA 2IXAA 4HDSB 4AG3A 4OJMX 4IQ4A 4EHHA 3Q3IA 2CXUA 3DLPX 4TX1A 2PKQP 3E5NA 2C82A 4LJ4A 1K6IA 2YXDA 4JBGA 4ZHQF 4FDTA 4OQNA 2ZI3A 5EYPB 3QHAA 3KOZA 1GKYA 2GPAA 5F9HA 3NIBA 3HKDA 1Z83A 3AM1A 3PNSA 1K2WA 1TK9A 3G2PA 5HOQA 4OQXA 3ZQ4A 5M04A 2Y93A 4ITVA 2JLSA 2ZB2A 4L8YA 1Q1QA 4DA7A 4MKXA 2BZSA 2V54A 3NGLA 5HMMA 5KTPA 4F4HA 1GQ2A 1C1DA 1LVHA 2A94A 2V6BA 1UXOA 4LHEA 4DV5B 1EEHA 1OJ7A 3LPNA 5BOSB 3ZNQA 2ZTHA 2Z04A 3MAGA 2ZIGA 2KPOA 3EW7A 2NV2B 2OHIA 3VDQA 4NFYA 1WPQA 3KC2A 1UPXA 2SNIE 4HFMA 2PGXA 3BK7A 3TZKA 2GHIA 1G0OA 2WJVA 2B2XA 1YTLA 2IZ1A 2LWIA 1R7RA 1RJDA 1BW9A 3QJ5A 2VTKA 2ORED 5CNJA 5B6IA 2H2DA 1L5FA 3GGSA 3RABA 3MGGA 3A1CA 4PQRA 1ND6A 1F38A 1OZFA 4GX1A 3STXA 1UP4A 4MJXA 5KX5B 3PXXA 4D6XA 4G23A 2HPAA 4L6IA 1S3SA 3AERA 1NI3A 2VDWA 4Y2QA 3TD6A 1FYWA 2UYCA 2H48A 3BD7A 3U3JA 5HRAA 1JJBA 1ZOLA 2RHOA 2DHCA 4JBYA 4KUEA 2LXNA 2XQIA 3CM0A 3I37X 3WFJA 4LYEA 1RP7A 1ICEA 4FB5A 2EW8A 3DOUA 5IWAB 4G8BA 4Y2TA 1E3LA 1E9AA 4KX5A 5L45A 1P19A 2DX7A 1LF5A 3Q0TA 1FFWA 4RLQA 3W5IA 1X19A 2DWOA 3S1LA 4GR9A 1WDTA 3I5UA 4QYSA 1SG9A 4RTKA 1Q92A 4QJ4A 4J2HA 5SYNA 1MVOA 1UDWA 5TJHA 3VSDA 4LOJA 4J1QA 1BMTA 1R16A 2PUCA 5EXPA 4PM4A 2GSWA 2EKZA 3ROEA 4BX9A 1GA1A 2W6JA 3FKSD 1M6VB 4ZZIA 1X7XA 2LE0A 2O2SA 2WKWA 3C87A 1M5UA 3GJ4A 3RVOA 1SKAA 4G5QA 4DLPA 2FEMA 2HTEA 1IM5A 3HUEA 3KR2A 3NRCA 4IGEA 4MW0A 2FVXA 3K15A 4BQIA 2O5VA 2B25A 4RTOA 2GEUA 1O58A 1U6IA 4JA0A 4QYXA 4NYJQ 2YC4C 2UZ1A 4HX2A 2JLYA 1GAEO 4Z51A 4NMXB 4YQFA 1CP2A 4C43A 3FDJA 3L2OB 1Z0JA 3A10A 2YRXA 1TIPA 3OFVA 1E7RA 3EVNA 3R0VA 4HGQA 5IBRA 3MB8A 4US2R 3K53A 4H35A 3W5BA 4P5EA 2XXJA 1L8OA 2UUPA 1HLFA 4BTLA 5K99A 5AXAA 1C0PA 1D6SA 1UQTA 2O52A 3QW4B 4GI7A 1Q7GA 3JZAA 5A3JA 1J9EA 3HHPA 2FQWA 3KJNA 3JWIA 3TH5A 4AKTA 4URWR 2D5IA 3KL2A 1Q16A 3D3QA 3AYZB 1G7CA 4XB6B 3KU4A 5EI5A 1HR0B 2ZSIA 4IJWA 4Y1FA 4DOMA 2YWEA 4LC1A 3OJLA 2ASVA 3GEBA 3T5PA 3LCMA 4DYVA 3HZOA 3GRZA 4LC0A 4MZDA 5T3YA 1GPDG 4EL0A 3OOEA 1UM9B 3DTYA 3WGNA 3VAYA 1ESEA 1WUTA 1C9NA 4LMBA 4RELA 1GTVA 1OUMA 4UBJA 3ROQA 1KBOA 4CG2A 3CBQA 2HPVA 2UUOA 3K8QA 2WKPA 3OLZA 2IX9A 1DDIA 2AZTA 2Z9DA 1NJSA 2ZTLA 1I7PA 2H4HA 3LT1A 5IN5A 1QC5A 1KF0A 3B3GA 3KHSA 4HH1A 1Q0UA 4RDHA 4RKFA 4CM8A 2X2PA 3EW9A 4FWBA 2EJWA 4ZMRA 1DEHA 1PDOA 3O73A 3OQPA 1Y1QA 4IMIB 3NKFA 3L6EA 3BXXA 4BP1A 3L1JA 4LYHA 4NF2A 1UZUA 2O2ZA 1JQ5A 2BPOA 2PQ6A 1RZVA 2ZAIA 1T9HA 3GC6A 1F4VA 5I7SA 3LTNC 1SBQA 4MUJA 3K9HA 4PYMA 4F1JA 5HUQA 5HKBA 5H59A 1AK9A 3L8DA 1QONA 4GNKA 3BD6A 4TXJA 3F5DA 5CGZA 4Q9JA 3PHHA 3V8PA 2ZRFA 1INLA 3EBPA 3ULKA 4BECA 1AM4D 4Q9KA 1ZPDA 5F21A 3RLIA 2R66A 4P7GA 2HEGA 4IIUA 1TUBB 2A5FA 5EYPA 5A05A 2IYTA 4MVJA 1JAZA 1EGVB 3ZK7A 3LOPA 2FP3A 2IY7A 3MM4A 2JZCA 4DARA 1CV2A 3ESDA 3AY3A 1DAKA 3GRPA 1TJNA 2IS1A 3UATA 3RSOA 1X0VA 1QAOA 2J6CA 2JASA 4B0OA 5FF9A 4GNRA 1UBKS 1ZZEA 3IAEA 1FS4A 1P60A 4N65A 5BOSA 3IB6A 1J25A 3CZRA 3PNLA 4L4SA 3A31A 4F2WA 1E5QA 2VPZA 4NCHA 2YZKA 3QSGA 1JXMA 3GJZA 4FFNA 3NHJA 4AY2A 1JDSA 5JCJD 4N54A 2ZTVA 3DFFA 3BERA 4INOA 2D1TA 2WM8A 3KL4A 4JJAA 1P4SA 4MH0R 5AW4A 4J1SA 5EKUA 2ZYDA 1P6QA 3W4KA 1E6EA 3CVYA 4FI3C 1QV7A 2RE8A 3EUWA 2IZ7A 3SJBA 4CLDA 4PX3A 1DQYA 1W76A 2EFDB 1IHYA 1QWSA 3FSEA 3HJBA 1R6VA 3GJYA 3HRIA 1RQ7A 1XMVA 4HH0A 4P84A 3RYHB 2IOHA 1VLHA 1UBUS 2BVNA 1B8VA 2F1JA 2HNKA 2OV3A 4TL6A 2WSSA 3ROPA 4C6RA 2DOKA 3R5XA 4GRIA 4YCLA 1Q7EA 3D7RA 1E3MA 1G4AE 1G8YA 2GN8A 4WECA 5ALGA 2VHYA 2K87A 3G9UA 1F60A 1SUPA 2BE7A 3K1ZA 4WZAE 3EX7C 3MRTA 2QIOA 3HACA 4X8OA 1FU4A 3U16A 4L9WA 3QEAZ 3BH6A 4PSDA 3CWCA 3RJ9A 5FOSA 3LK7A 3EJWA 4K88A 1PJCA 4KMRA 4FYYA 2BR4A 2X3YA 5DHFA 4P36A 5LYJF 2PJUA 1RAAA 2PGAA 1EFDN 3TDKA 1XSEA 1GZVA 1T9KA 1ZUIA 2F9FA 3O90A 5I9SA 4F7WA 1A9OA 3H18A 1SXJA 4F9EA 2W7TA 2WTNA 3TIIA 4L0MA 3TR0A 3TFOA 4J1TA 3V7YA 3K5PA 4JV5B 1FQOA 3AJDA 3BH7A 4J6FA 1MO4A 4C14A 1BIFA 2Z4SA 4YVFA 2H11A 3PWSA 2ZT5A 2EDAA 5KVAA 2ZKLA 2ECQA 4PAGA 1TZCA 3UMSA 3STWA 5YASA 2QY6A 5BW5A 3IQZA 3HLYA 4JLAA 1OT5A 1KI7A 1O9HA 1O4WA 4FI3F 4O1MA 5LOVF 1KY5A 4WZBB 3M6FA 3QEMA 3P0EA 2Q41A 2FN3A 2OHJA 2ZFUA 4NESA 1P2DA 4QGHA 1CUYA 2ZIUB 1NVVQ 2I6XA 3E1SA 1OLSB 3O2NA 1YZFA 3OKAA 4EZBA 1GU1A 4XFDA 1CB0A 1NBME 4V0ME 2W70A 1VSQA 5FYQA 5IKPA 2GLUA 3M6VA 1IK4A 4J3JA 3B6KA 4O4IB 1P9NA 1BXZA 2HLPA 3T6KA 4AN4A 1RADA 4UBOA 1VI6A 1VKOA 4WX2B 4YCCA 1T1JA 1UM9A 4QHTA 3OC6A 2GPNA 4Q3DA 1QXSA 4LRYA 3UPUA 1BMQA 1S2IA 3AF4A 1Y6GA 3BDVA 2H9IA 3F71A 4ZI7F 3W04A 5CB0A 3ETNA 4PBRA 1OYWA 1RHMA 1GDTA 2XYGA 4HQ6A 3IP6A 1Q2UA 1VTKA 3CVWA 5HILA 4RK0A 5JTTA 4H15A 4B76A 1M1UA 2PA0A 1SUIA 1EA5A 1M2GA 1XCBA 3CXRA 5AVQA 4QE3A 3WXMA 3TZLA 1FVXA 4ZTZB 2WSBA 4RMNA 1JEQB 2DHRA 2PL9A 4BRWA 3VISA 4HAVA 1DAPA 1FVFA 1IZ9A 2D5CA 2OZKA 4ISCA 1YA6A 1CUAA 1PWHA 3RK1A 1KGSA 2AFIE 4F8EA 4V1CB 1PGPA 2IS6A 2D5AA 4KPFC 2BDUA 3CURA 2P69A 3LLUA 4ZVPA 3TUIC 1N6IA 5CEJA 3PDIA 3H19A 2BSQA 3NYQA 4MDEA 2IU0A 3DXYA 3GDWA 3B8EA 3ZJYA 1P9OA 4KWCA 4OB6A 3KQUA 2IU4A 1D0SA 1J22A 5JYDA 5KHOC 3NI2A 2E5LB 3GPBA 1Y3AA 3CNOA 4PCAA 4H08A 4R1MA 1ZJ4A 5D5QA 3CLUD 3ER6A 4DPMA 3OQOA 2IP1A 3MAJA 5C3MA 3ZHYA 3ENZA 3SHTA 4KACA 2B83A 4H77A 3WMFA 2G71A 4IX9A 3V1KA 4ENQA 3JWHA 4BFWA 3D8HA 2BFEA 1H9AA 1TUBA 3OFJA 4KK4A 2ZIZA 3WWYA 1F8XA 2BSAA 3BWEA 1QTRA 3K73O 1EIWA 1IBRA 1QG4A 3B78A 2FX2A 4N5NA 2WSLA 3F4LA 4JKOA 3R3VA 4UDNA 3K16A 3K9LA 1BQEA 1O94A 4PO8A 1Z4PX 3LL4A 4A8HA 3EDQA 2C78A 1VKJA 2JEYA 2FMIA 3LVQE 5FBWB 3QWAA 1L4FA 1CNMA 1MJGM 2O0HA 3AH8A 3GEMA 1LJLA 3F74A 3GIDA 3MRXA 4FBLA 2C42A 4OQQA 2VRWA 5F1OA 4EG3A 7YASA 2F9MA 1V3QE 2FPPB 4WJKB 3S1SA 1O1YA 4RNCA 2GEBA 3E84A 1FMLA 1N25A 1FP7A 1QV6A 1GLNA 2HQSA 4FMDF 4PZCA 3B70A 2Y1XA 3OD1A 4Q7LA 2JAOA 3WNZA 5AKLA 4PLPA 2QMHA 4X24A 3R74A 3TEJA 3K0AB 4QXRA 3DOJA 2GRUA 3WRYC 5HCNA 1UC8A 3SVLA 4J0QA 2DQZA 1C9JA 1GSOA 1BJRE 1NBEA 2JGFA 2ZWIA 3QYFA 3RYIA 5J4KA 5JFOA 1Q19A 3KXPA 1RJGA 4YGYA 3OCVA 3RYHA 4OX9B 3ZE1B 3UT6A 1RPTA 2CEAA 3FNBA 4I4NA 4RXUA 1SXHA 4B82A 2WWWA 1S96A 1FX0B 4TZ6A 1MFZA 1M1ZA 2QM7A 1HFJA 3DM5A 2JVIA 2GPBA 3MMZA 3FF4A 2IYWA 2W2XA 2XBLA 5IM4A 3UOWA 1CQWA 5H70A 1L5VA 2DTXA 3WKDA 2W6ID 2WHPB 2OTCA 3AVOA 3DFMA 4Z9AA 4ZOQI 5DNUA 2QW0X 1NQOA 4I50F 2MCFA 4UXJA 3EODA 1WOYA 3ZE7A 2VTVA 1HE5A 1XV5A 3UXYA 1J39A 1Z4QA 1UKCA 1WZEA 4EO9A 2XCSB 3G5UA 2MSCB 4MJLA 1PQ4A 2D2EA 1TIKA 2ACKA 2Y66A 2ZYIA 3K5WA 4FYIA 3MQ2A 4OGFA 4Y2PA 4HUTA 4ZVQA 1A4RA 4UTZA 2APJA 4IV5A 1J33A 3Q12A 3ZZMA 4N6NA 2ZJYA 4BGDA 4UDOA 5ALUA 2ZZNA 1OFHA 2BGNA 5KS2A 3MXOA 1F0YA 1CULC 2VXBA 5AUNB 1IM8A 2CXNA 3QVMA 1D03A 4ZANA 3PXEA 4XOUA 4ACAA 4BASA 3O84A 2VSOA 4LYDA 3T15A 1YS2X 5FUBA 3FTEA 2JAQA 1C3JA 221PA 4NJEB 5HCIA 1L4KA 1NW7A 1P5JA 1U7HA 2XE6A 3LO8A 4G41A 2YWCA 2XJ9A 1RJEA 2EVWX 2H1VA 2NV6A 4WDRA 4DJFC 2XXBA 1K63A 4P53A 4TRRA 4XFJA 2GZRA 1WUIS 3BAZA 3BS4A 4X9XA 3GCDA 4EHJA 1UH5A 2VHUA 4V0SA 5AJZA 2VRBA 3ZU2A 5K4GA 4N39A 3AXSA 5KIAA 1YFLA 4XLZA 3QV2A 1NSTA 2QL5A 3BIWA 2N75A 4IGIA 4O2AF 5GP1A 3UK2A 4UKDA 3B3AA 2BMDA 3DWFA 5C46F 4OFXA 3LDAA 3EVAA 2HMYB 2PZMA 1IJEA 2WFZA 3COWA 1XDUA 2QG6A 2ZJBA 3GX1A 1CZHA 3PNVA 3K5IA 1VL5A 1XZIA 3E82A 4O4IA 5A4JA 3TNLA 1HYQA 1XDGA 5EVJA 1V5EA 2AMYA 2SICE 3OKCA 3K9FC 3IV6A 1JG2A 3DV2A 4XAQA 5FL3A 4WXPA 4H0CA 4IV0A 1I0ZA 4OK6A 1JR3D 1L8LA 2QM8A 3JD3A 4NCJA 1T2EA 2GF2A 3ZCTA 2OOKA 3RC1A 3CWQA 4JJEA 1QHEA 1B43A 5AO9A 4B9AA 3CXUA 5DBFA 3O2JA 3FPGA 4QA9A 1JILA 3SIWA 3RC7A 2RGWA 1JHOA 2WFAA 3ENKA 1KMHB 3PPWA 5DO9A 4EPYA 4HWOA 4R8LA 5C52B 3JZMA 1RHQA 4OG2A 4QVIA 1JEQA 5IT5A 1Z37A 2LCIA 4L9RA 3E5MA 5DTQA 4Q5IA 4R3WA 4DUGA 3TDNA 2ZAGA 4BZZA 1SOUA 4J7XA 1UBFA 3FW1A 2P3OA 3HA2A 3CLHA 2QB5A 3QFTA 4JT9A 5DBGA 3ZUGA 4CIWA 1Z26A 4QPZA 2P9CA 2PY6A 1RRCA 3HXLA 3ACCA 1DRKA 4PGAA 1NBIA 2HMVA 4P3NA 1VMKA 1UEJA 4REQA 4YDSA 2WYUA 1G42A 1MXHA 3JQEA 3Q3EA 4C2BA 1KJQA 1NUAA 1VMAA 1Y3HA 2ECKA 3NHPA 4JI3B 1Q0QA 2A0KA 1ULHA 1WB4A 2XTMA 3PEUA 3PK0A 2QBYB 1LEHA 2QAGC 4A91A 5KYNA 1ISIA 2AI3A 3DB1A 1XF9A 3OQ1A 1TMYA 3W3AH 4F5EA 3PTLA 1VE1A 1HDYA 1ZA2A 2Y0EA 3IBSA 4IEEA 4OA5A 1C9EA 3S2FA 3E1GA 4C1NA 2W43A 1H94A 3HKCB 4QRIA 4S05A 2H59A 1ZX1A 2QRLA 3BL8A 4JITA 1Q57A 1H66A 4CTKA 5CVEA 3DUFB 3EAFA 3JASB 4KAXA 4DCNA 4B6PA 5HUHA 3FPKA 3T5DA 2EHJA 1DELA 5ESRA 2V7UA 3LNTA 2G0AA 1ADJA 3PNBA 2VPTA 2V3WA 3SBEA 1JLHA 1U1IA 3E1KA 2NIPA 1RYYA 2V9ZA 5F2KA 2FPPA 3AO0B 2D06A 4O59O 3X3HA 1VL2A 1BHJA 1CBUA 2ZUSA 4MRPA 4RHYA 1NW5A 3H9JA 2ZXEA 4DRXB 2E4WA 4KHPB 4LKRA 3QTTA 1C7QA 2X4GA 3O95A 5FLYA 3VDMA 1QRDA 5MHTA 1Z33A 4ZGWA 3K0AA 2PQMA 1E9DA 2EXXA 3MTAA 4NYMR 1YAJA 1AH2A 4NDAA 5EPOA 2Z6VA 4OU5A 1AUQA 2GQ0A 2JGIA 3ADKA 3HCWA 3SKYA 3FLMA 5D3QA 3HYTA 3TLCA 4IF6A 1UDXA 2X9VA 2DFLA 4UMEA 3IT3A 1IZZA 5G3ZA 4EELA 5LKAA 3TNFA 2P9FA 1FX0A 3WB0A 3HHEA 3FOFC 3DMHA 2H1LA 2YVAA 3IP3A 3HYLA 4R2WA 4P92A 4DLVA 4RZSA 5LN1A 2HNAA 2JRCA 3EMVA 2O5RA 2PMFA 1XZHA 4X00A 2WHPA 4BNDA 4RYDA 4KWEA 1NR7A 3ACDA 4QDOA 4J7UA 5J9FA 2YWGA 2G8NA 5FORA 1U0NA 1XQ6A 2OM2A 4KDRA 5IKMA 2E4YA 2BRUA 4YCSA 3O8CA 1IJFA 4HXFB 4ZOBA 1KFJB 4U63A 4E5KA 2VJOA 4QO8A 4MHTA 3WLTA 4BN5A 2QLJA 1U80A 4HZUB 4TSFD 2XJ4A 3KWMA 4Z9FA 1K7FB 3OE5A 3PXUA 5CVVA 4TM7A 5ALWA 2ZR9A 4YPOA 4F7DA 4NJEA 1TKBA 4GRDA 1ISJA 3LOUA 1Y5LA 1W4RA 3P4UA 5JYCA 3S55A 4Y6QA 4TOIA 4YT4A 1EUDB 1HEIA 4ZOLB 4QU0A 5LZ8A 3NM5A 4K86A 2BGGA 2O20A 4ND6A 3EULA 3N2GA 3T5GA 4N7RA 3FMGA 2B7CA 3HVKA 2JFGA 2R1VB 1GR0A 2UZ3A 2GXUA 5B2EA 1R3UA 3C6YA 4MCIA 3EF1A 4ISBA 3SE7A 2C8LA 3WBJA 2X23A 5JPDA 3DKRA 3I04A 1I7SB 1N2XA 1KAEA 2W00A 3DOEA 1KO7A 4TMZA 2Y1CA 4CNQA 3D64A 3A32A 4BXOB 4RJLA 2VJCA 4PGMA 4HLUA 4DCMA 4JYAB 2FFHA 3TMYA 2H2GA 5FA5A 4AXXA 4PYJA 1A71A 3PC8C 2ZK7A 1SUEA 2BKVA 2OEPA 4MTCA 4HWRA 3R75A 4M7RA 4CXMA 5J2TF 5GJBA 4L51A 4W1PA 1KMQA 3KJIA 1KMHA 4IHJB 4M7PA 3I58A 3Q3HA 2E0IA 4K6MA 3ONFA 2IHKA 4B4DA 1TX4B 5HVNA 1BA2A 4MUKA 3THYA 3F3YA 2P27A 3B6MA 3CF2A 1VRWA 1X92A 4LRSB 4UBMA 3RV4A 3SXUB 4BJ1A 4CEJA 2BEJA 4GBMA 4CL3A 4A23A 1KMIY 1P7WA 5BV7A 3GYBA 2Q6TA 5ALNA 1KSJA 4O2LA 5EC8A 1NC3A 4R51A 2BHLA 3SJCA 1Z28A 2BGLA 1AD2A 1JEAA 4JEUA 4PG8A 5I45A 3OMLA 1DLJA 1OD6A 3E9NA 4Q82A 5ECDA 3RUEA 3U6BA 2JCGA 3OMWA 1GAJA 3EG9B 3D31A 2O1WA 3DE5X 3DFIA 4TWZA 1U7DA 3OZDA 4YQEA 1JFFA 4BC1A 1DC6A 1JSCA 1MB9A 3HJTA 3GJQA 1JTVA 2JAHA 3Q8KA 2JVKA 3GGCA 1UKEA 1JN0A 1QNLA 5EKDA 1ABBA 2J41A 3L77A 2B3TA 4TWIA 4YLGA 2VJQA 2WWHA 4O5AA 5C7IO 5IUNC 5JMOA 3I2YX 3E15A 5IDYA 2PJDA 1SCDA 1V5WA 2QRHA 4KG7A 1F7VA 2N0SA 5TXGA 3DUFA 4WN9B 4JHLA 2QTMA 4F6CA 5T7BA 3Q2IA 3QA9A 4X3PA 3V32A 2AYZA 1TT7A 3VSEA 3G7SA 3WAKA 2IF0A 4FDLA 3V8MA 4HGOA 3CB4A 5DW0A 2GJ9A 1KJIA 3NBXX 1IQRA 2OB1A 4MO2A 5LP6C 4TS4A 4DAOA 1AXRA 1Q84A 4PFKA 2C4UA 4E7PA 4ENTA 5B4TA 1VPTA 2F1IA 1DZIA 4C20A 1SQFA 3GVXA 1EG7A 3NCTA 1GPUA 4OQLA 3PE4A