1SEMA

Structural determinants of peptide-binding orientation and of sequence specificity in sh3 domains
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEM-5
publication title Structural determinants of peptide-binding orientation and of sequence specificity in SH3 domains.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signal transduction protein
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1semA00
5IHKA 4D8KA 2LJ1A 2B86A 2YDLA 4HCKA 2BZYA 3VS3A 1AEYA 2DE0X 4JZ4A 2FO0A 2EPDA 3VS0A 2JTEA 2KRNA 4RTYA 2KXDA 2DF6A 2L3PA 3H0HA 1Y57A 2EYWA 2GBQA 2RQRA 2DMOA 1ZX6A 3H0FA 1J3TA 2GQIA 2EGEA 4LUDA 2F2VA 1NLOC 4ZNXA 1SEMA 3IQLA 3VS1A 2KE9A 1X27A 3GBQA 3NPFA 4J9GA 2RF0A 2KYMA 1UHFA 1ZUKA 2LJ0A 4LNPA 3PVLA 4JPBW 2J7IA 1ABOA 2EYXA 4DEXA 1UG1A 2CUBA 4J9BA 2KROA 3UATA 3REAB 1WI7A 2KRMA 4D8DA 2LQNA 1X69A 2EW3A 4CC3A 2DLPA 1RUWA 2OI3A 4AG2C 1VA7A 4K11A 4F17A 2SEMA 4HVVA 4JJCA 4ORZA 5ECAA 1VYTA 2FRYA 1WIEA 1G83A 2MIOA 2MCNA 4FSSA 1SHGA 1GFCA 2DRKA 1NG2A 2K7AA 2DBKA 3M0TA 2H8HA 1K1ZA 4RTZA 1OV3A 1BU1A 1YCSB 4OMPA 3REBB 2YUOA 4AFSC 2BZ8A 1K76A 2LNHB 1JXMA 1MUZA 2RQVA 2DA9A 1AWJA 3NHNA 4LN2A 1JXOA 2LCSA 3VRZA 1QKWA 2KR3A 2C0TA 2D0NA 1W1FA 2ESWA 1QLYA 2JS0A 3O5ZA 2RPNA 3UF4A 2O9VA 2PZ1A 4RTXA 2GNCA 5HCKA 2KYBA 4Z8AA 5FWCA 2HCKA 4Z88A 4GBQA 1QKXA 3A98A 2ENMA 2L0AA 2E5KA 1BBZA 2YSQA 3EG2A 2NUZA 1U06A 1QWEA 2DM1A 2I0NA 2ABLA 4JJDA 4EIKA 1E6GA 2XMFA 2JM9A 2L3QA 1CSKA 1GRIA 2YT6A 2DNUA 1WXUA 3VS5A 2EGAA 2VVKA 4CC7A 1WLPB 1UECA 4M4ZA 1GFDA 2DRMA 1ABQA 1JEGA 1PHTA 4RUGA 1TG0A 4J9IA 4ESRA 1OPKA 4IIOA 4R0KA 1YWPA 1Z9ZA 3U23A 1UFFA 2DL4A 2ED0A 4J9DA 1PRLC 2KT1A 1UDLA 1E6HA 1SSHA 2PTKA 3FJ5A 1NLPC 1W6XA 1ZLMA 1PRMC 2C0IA 2KT8A 1UUEA 2NWMA 1VYUA 1GBRA 2D8HA 3SHWA 4A63B 1M8MA 5GJVB 2RQUA 4AG1C 2K79A 3THKA 2CH4A 2KBTA 1U3OA 1ZUUA 2LMJA 2HEQA 1E7OA 4LUEA 3VS4A 1H8KA 1UTIA 2F2WA 4HVUA 2JMAA 1HSQA 4DEYA 3I5SA 4OMOA 2YUNA 2SRCA 3VS7A 2AZSA 5IXFA 5IXBA 2ROLA 2DBMA 3H0IA 1NYFA 1W70A 1N5ZA 4OMNA 3TSWA 4AFZC 1GL5A 2LX7A 2EKHA 1KIKA 2AZVA 2D8JA 5IH2A 1RI9A 3TSZA 1T3SA 2FRWA 1AWXA 2MOXA 1GCQC 2FG0A 4AFUC 3ULRB 1YP5A 1QWFA 2LZ6B 2X3WD 4F16A 2KNBB 4RTVA 2RN8A 2HBWA 1QCFA 2VWFA 1SRMA 1WX6A 2OJ2A 1NEBA 1AVZC 1B07A 2KGTA 4OMMA 1X43A 4AFQC 2CDTA 2F2XA 4QT7A 1OEBA 4J9HA 1PKSA 4KRTA 2DJQA 1OOTA 1I07A 2A37A 1OPLA 1RLQC 4X1VA 1B3QA 2CT4A 2JT4A 1UGVA 2LJ3A 2CREA 2DL5A 2EGCA 1ZSGA 2GGRA 3SEMA 3NMZC 2JM8A 1I1JA 2YUPA 2A36A 1GCQA 1K0XA 2P4RA 4JZ3A 1CKAA 2JMCA 3PE0A 1BK2A 2DL8A 2KXCA 2J05A 4OMLA 1RLPC 3NGPA 1HJDA 2CSIA 2GTJA 3EGUA 5IHIA 2M0YA 2BTTA 2JS2A 2O88A 2K3BA 1CKBA 1WFWA 1X2KA 2O31A 4CC2A 1K0SA 3EG0A 2K9GA 1SHFA 2J6FA 1H3HA 1G2BA 1JU5C 2HSPA 1SRLA 3R6NA 2VKNA 2X3XD 2W0ZA 3LH5A 3VRYA 1GCPA 1WA7A 1JQQA 3QWXX 5L23A 1YNZA 1GBQA 1AD5A 1I0CA 2G6FX 3I5RA 3EG1A 1PKTA 2JXBA 1NM7A 1KSWA 5I11A 2J06A 2M51A 3M0RA 4E6RA 1WXTA 3RBBB 1T0HA 3UA6A 5FW9A 4OMQA 2K6DA 1AOJA 1Z9QA 2OAWA 1M3AA 2J6OA 2DL7A 4J9CA 1LCKA 1M3CA 1VYVA 1ZBJA 2CT3A 4J9EA 2CSQA 2RQWA 2ROTA 3M0QA 5I22A 5FWBA 2D1XA 2W10A 1T0JA 3I35A 2A28A 1SPKA 2DILA 4J9FA 2L3SA 2DYBA 2AKLA 4HVWA 4LE9A 1UHCA 1FMKA 1ZUYA 5GJWB 3TVTA 2LQWA 3CQTA 2FPFA 1X6BA 4F14A 2LP5A 2EVRA 5EC7A 1H92A 1BB9A 2V1QA 5IHNA 1KFZA 2JW4A 1S1NA 1EFNA 2KEAA 2PNIA 1KJWA 1TUDA 1WDXA 1X6GA 2EQIA 3KFVA 2A08A 4GLMA 1V1CA 2FPEA 4RTWA 3I9QA 1U5SA 2V1RA 1FYNA 1JO8A 1M27C 2EYYA 2ED1A 3C0CA 4Z89A 1UJ0A 4CC4B 1WYXA 3EG3A 3M0PA 3M0SA 1MV0B 1UE9A 2HDAA 2EBPA 2RQTA 2BZXA 1XOVA 2QDLA 1K9AA 2FPDA 2DX1A 2J6KA 2YUQA 3RNJA 1ARKA 2AK5A 1MV3A 1TUCA 2CUDA 4RTTA 3ZL7C 4IIMA 3H41A 2IIMA 2GTOA 2C0OA 2RMOA 1NEGA 1PNJA 2EYZA 2FEIA 1M3BA 4JJBA 1AZEA 4WCIA 3VS2A 4HXJA 2O9SA 1A0NB 3PVQA 1NYGA 1Y0MA 2O2OA 1YN8A 1WXBA 2AKKA 2DVJA 3QWYA 2K2MA 3EHRA 4RTUA 2DL3A 3JV3A 2L2PA 1AWWA 2CH4W 1UJYA 1IO6A 2ECZA 2KRSA 1PWTA 1T3LA 2RNAA 3M0UA 1HD3A 4Y92A 3VS6A 1X2QA 3EHQA 1AWOA 3UA7A 1K4US 1AZGB 1M30A 1YWOA
chains in the Genus database with same CATH superfamily
5IHKA 3FC3A 1ZA1B 2B86A 2BZYA 1AEYA 5KYXA 4FSXA 4M78A 3JCMJ 4M75E 2EPDA 3EFOB 3VS0A 2JTEA 3TQ7P 4XK8E 5CKBA 2K57A 5GAN8 1RAEB 4RCCA 2QASA 1BYMA 3C95A 2DXUA 2EYWA 2GBQA 2RJCA 2DMOA 5KYUB 2BKDN 5GAN7 3NTHA 5FU7B 1LNXA 1RAHB 1PCXA 4C8QB 1SEMA 1PSEA 2ATCB 1RABB 3NPFA 5CKEA 1UHFA 4EMKC 1ZUKA 4HA8A 2LJ0A 1Q81U 1MMDA 1ABOA 4BY6C 1I5LA 3MHXA 3REAB 3QYHB 3CCMT 2LQNA 2XDDA 2EW3A 3QZ5B 3CCLQ 4CC3A 2YHTA 2YLBA 2YRVA 2QDYB 1SKUB 1VQPA 1VQ5T 4AG2C 1YITA 1MMNA 1YFNA 2SEMA 4JJCA 4F7UE 3CCJT 2JVVA 2FRYA 2QEXA 1OU9A 2MIOA 2QQ9A 3RIRA 2MCNA 1U1TA 5DLQE 4LD9K 3M0TA 2RJFA 1WJQA 1R0CB 4OB0B 1KD1R 2ZCFB 4ELZC 4OMPA 3REBB 1Q7YC 3OS2A 3BDLA 3CXCP 4AFSC 2BZ8A 1N9RA 4PK4A 1K76A 2LNHB 4OB2B 1ZSZC 2KDSA 2DA9A 3RDVA 2XIDA 3G71A 3ASKA 4JLGA 3PGGA 1MNDA 1NZ9A 3SWNB 1YHQT 1QKWA 1M1KC 2KR3A 3QDRB 2YWWA 3CCQQ 1W1FA 3RKYA 3J81E 3CCSQ 3X24B 2DXTA 2GQVA 2KVQG 3JCMd 2QA4Q 4E7LA 5FLXE 2DTHA 4Z8AA 1TWBA 5FWCA 2P84A 1QVPA 3CCLT 1QKXA 2L0AA 4B9XA 4BE2A 2EQMA 1BBZA 3LWIA 2NUZA 4HCCA 4JJDA 1QWEA 4EIKA 2DK3A 3I55Q 1AHJB 3GOXA 2QAZA 1K73U 4OB3B 2JTMA 4ZGDB 3JCMV 2NYSA 1WLPB 1GFDA 1RADB 4MDWA 1QP3A 2I2LA 1JEGA 3FIFA 4RUGA 4Y91A 4C5GA 4A4GA 1UFFA 2ED0A 4J9DA 2YLCA 2KT1A 5CR2A 4A53A 3C12A 2K2VA 2HD0A 2XU8A 1W6XA 1PRMC 2C0IA 1LJOA 3CD6A 5FU6B 3M57A 4UC4A 3G4ST 1VQ6A 4ME7A 2D8HA 3SHWA 1UGRB 2K79A 3CC7T 3CCQT 3ZFJA 2XI9A 4JS4A 1ZQ1A 2K5IA 2RM4A 5D6XA 5LJ3f 3CCST 1OZ3A 3M55A 2LTOA 1UTIA 4XU3A 4HVUA 2JMAA 2VGNA 1U1SA 2R57A 2OTJA 3JCMf 1KC8R 1P92A 2YUNA 3VS7A 5IXBA 2QQSA 2H3JA 4ZGEB 4DBHA 2LX7A 2ZPFB 4IKFA 3CMEQ 4IUPA 4R56A 1Q81C 3OYIA 1G3SA 5GANe 5LJ3e 2KY9A 3M59A 5I2SA 1NJIU 2FG0A 4EMKA 1YP5A 1KD1U 1Y07A 3RMQA 5GAOq 1I8FA 3SFMA 2VWFA 4C92E 4M77G 5GAN2 2KGTA 1VQKA 1TOVA 1X43A 4M77F 1K8AU 4KH0B 1BCOA 4QT7A 1VQ9A 4KRTA 2WSEE 2RHZA 1D3BB 3M4YA 2A37A 4X1VA 1B3QA 1I81A 1UGVA 3JCMQ 2HMAA 2LJ3A 2E64A 2MWOA 2EGCA 3CCEA 1FWZA 3NMZC 3LYIA 1I1JA 2P0PA 2VXEA 3OMCA 3OQ5A 1K0XA 1CKAA 2RI2A 5FRNA 1BK2A 1M2OA 2ZPGB 4OMLA 1HJDA 4L59A 4PL6A 3QBYA 3OYNA 2CSIA 1Q95G 2GTJA 3EGUA 3QXEB 2M0YA 1ZSZA 1M4ZA 2DXCA 3CMET 1WFWA 2VGMA 4M7DF 2MWPA 4N0AC 4XTVA 4M7AD 2K9GA 4L5GA 1H3HA 4ATOA 3LH0A 3LH5A 3VRYA 1GCPA 1OX9A 1QCNA 1WA7A 3RUXA 4CRIA 2A7YA 1JQQA 3QWXX 5L23A 1QVFS 1S72A 1YNZA 1GBQA 1AD5A 1I0CA 4O5VA 3EFRA 1K73C 2XHCA 2ZAEA 4E6RA 4C8QG 3CC2T 1T0HA 4E7JA 4OMQA 2RK1A 5FU7C 4C8QF 5GAN5 3URGA 3WVEB 4PJOF 1QVGA 2DL7A 4J9CA 1Y71A 1O9SA 1VYVA 4C8QC 3O8VA 1KC8U 2V8KA 2VC8A 5I22A 3EGDA 5KH6A 3EH1A 1PD0A 1NE8A 1SPKA 1WPYA 2DILA 4FYYB 1VQ4T 1PM3A 2QQBA 1UEBA 4LE9A 1Q7YR 3MEAA 2FPFA 2E3IA 4F14A 1TSFA 2LP5A 3JAME 1YJ9A 5EC7A 1OQKA 2V1QA 3UT1A 5KE2A 1C6VX 2EFIA 3OYAA 3I9QA 1UB4A 2V1RA 2KMTA 1M27C 2RA2A 3X20B 1N9SA 3VKIA 2X35A 1UJ0A 4OB1B 3S3NA 3E9FA 2E4HA 4B9WA 4X9DA 2HDAA 2EBPA 2BZXA 4M75D 1LVKA 2ZPIB 1WNLA 1ARKA 1D1BA 1NJIC 4MZTA 1TUCA 2OTLA 2CS7A 4KGZB 4FCYA 3H41A 5AYFA 4XTWA 1KQ1A 2D9TA 2EYZA 1PNJA 2EWNA 1W2BP 3QG1A 4XTYA 3SWNC 5GAMe 1NBEB 4WCIA 1VQOQ 3VS2A 2LC4A 2O2OA 1K9MU 1K8AC 2R5MA 5AT1B 5J3BA 2L2PA 1TH7A 5LJ3g 3CCVA 2ECZA 2RNAA 1HD3A 4PLLA 2QGGA 3JCMg 3EHQA 4XQ3A 3OYJA 3VU3C 4M77A 1YWOA 3SDZA 3KXTA 2D6FA 4D8KA 4E7ZA 2YDLA 1G8XA 3G6EQ 2FO0A 4C5IA 2V26A 1D0XA 5CKHA 4C0GA 4FYXB 2DF6A 1FMVA 3FB9A 5LJ5j 3H0HA 4KUDK 3LLRA 3QJYA 4JS5A 2F69A 4VUBA 4ZN3A 3PIPA 1J3TA 4P5NA 2GQIA 2EGEA 3CPFA 2E3HA 3JCMP 1NLOC 3CBMA 5KYWA 4N0AA 1SSFA 3OYHA 5FU6C 3MPUB 3S6WA 1YIJQ 1BKBA 2KYMA 4M7DA 3AT1B 1Q81R 1M1GA 1VQ7Q 3VYHB 3PVLA 4FM4B 1VQOT 2J7IA 2EYXA 1LPLA 4DEXA 2CUBA 4J9BA 2HL3A 3A8OB 3OYEA 4OGCA 4DBRA 4D8DA 4M75F 1R0BG 1Q7YU 3CCRQ 3OYCA 1VIFA 2D0QB 2DLPA 4NL2A 3OYYA 1RUWA 2OI3A 4JDSA 4B6MA 4F17A 4HVVA 4ORZA 5KYYA 2KI7A 4MMKA 1YI2Q 1WIEA 4GY5A 4M78E 3RKWA 1RACB 4FSSA 1WJRA 1SHGA 3G6ET 2DD5A 4C8QA 2ZPEB 3CPWA 2H8HA 1K1ZA 1BU1A 1OV3A 3MEWA 4Z02A 2RO0A 4FW2A 3FEOA 4M77B 2YUOA 2K3YA 4LDUA 1ZHIA 4HCBA 1RAIB 3H8ZA 1AWJA 4XTZA 2A3LA 1YIJT 2D0NA 4F7UF 1JJ2P 1NPRA 2NUPA 1WGSA 4DOVA 2HSEB 5M9OA 2LRQA 2RPNA 5GMKj 3GNFB 3CCMQ 1GXIE 2KK4A 4J8OA 1QQJA 1WQWA 3CCRT 4GBQA 1XTDA 1N6AA 4M7DB 2ENMA 6AT1B 4JRPA 3GIBA 1U06A 2I0NA 1YI2T 1K73R 2JM9A 4XAXB 3HSBA 2EGAA 3G7ZA 2X4YA 4M4ZA 4KBMB 2DRMA 9ATCB 1K9MC 1ABQA 4A4EA 3SD4A 1WZOA 1TG0A 3ZBDA 4J7FA 1X6OA 3SWNA 4ESRA 2Y4XA 5KYYB 3HRTA 3H6ZA 5L8RE 3OW2P 5A0LA 1M1FA 3A8MB 1SSHA 2R58A 2E6NA 1ZLMA 5CKDA 3JB9F 2CYZB 4PJOB 3OYLA 3WVDB 2MYSA 1YHQQ 4A63B 2AIRB 2JN0A 1M8MA 3TREA 4C92D 1WHKA 3OMGA 4AG1C 2JTFA 5IAYA 5GAMg 3THKA 2CH4A 4O6JA 2FVUA 2CP7A 1E7OA 2Z0WA 4LUEA 3VS4A 3TCJA 3OS0A 2F2WA 3G71Q 2M1HA 4OMOA 2SRCA 1MHNA 2XK0A 3HPWA 1VQ5A 1NYFA 1HK9A 1W70A 1KQSP 2NUPB 4XTUA 3TSWA 1D1CA 1WHHA 1EX4A 3VUBA 4XTXA 2ZGWA 2EKHA 3HFNA 3A1PA 5KYNA 1KIKA 2E41A 2IG0A 3HKSA 1T3SA 4FYVB 2B8AA 1NJIR 4KT0E 2HQEA 1QWFA 2KNBB 4RTVA 5KE3A 2RN8A 4M7AB 2HAXA 1X01A 2OJ2A 1OYXA 3PMTA 2HQXA 1K8AR 3G4SQ 3V8KA 2FZCB 2FL7A 2VASA 3CC7Q 1PKSA 3V8JA 2DJQA 1PSFA 2H3EB 2IPOB 2X4XA 1KQ2A 3G71T 2JM8A 4OP0A 2MK5A 3QUIA 1BIBA 1GCQA 4JZ3A 2P4RA 2JMCA 3PE0A 3CCUQ 2JUFA 4NOYA 2QXFA 3M4GA 2J05A 4N4HA 2DTOA 3HRUA 2O88A 2K3BA 2OTJQ 1CKBA 2CKKA 1SHFA 2J6FA 3MEUA 3L2UA 4LDXA 1G2BA 2NUTA 3E9GA 2VKNA 1UGPB 2FHDA 2DETA 4RCBA 1AT1B 4F7UA 1D3BA 1QVGS 3A8LB 3QSUA 3L2VA 2XDBA 3E19A 1OX8A 3MCAB 3I5RA 4BDYA 3N5BB 5LJ5d 1QCOA 5IT9E 4QQ6A 2HZYA 2HBPA 2J06A 3M0RA 2MPXC 3EAEA 5GAOn 2EYQA 3UA6A 3CCQA 3G1JA 5FW9A 1G3YA 2K6DA 1B34A 1ZBXA 4QKUA 2WSFE 3H9NA 3CCSA 2ZZDA 2CT3A 2QA4A 3CD6T 3MP6A 5GAOr 1Q86C 4M75B 4J9EA 1VQ6T 2Y4YA 1D0ZA 3JRZA 1OZ2A 3M0QA 1VQ9Q 2D1XA 2QTXA 4PFZA 4C0DB 3CCUT 3I35A 2A28A 3KBGA 4IURA 3I55A 1RAAB 2AKLA 4HVWA 5KCHA 3P8BB 3CCEQ 1LOJA 1VQNQ 1FMKA 1TTHB 2OTJT 4X9CA 2LQWA 2VUBA 2RJEA 1X6BA 3HTRA 2QGFB 3OS5A 2M9UA 4PNOA 3JCMe 1H92A 4A4FA 1KFZA 2DIQA 2F5KA 5CKFA 3KFVA 2A08A 1V1CA 1BI0A 5GAN6 3S3OA 4R55A 2ED1A 3LW5E 2K3XA 3OYGA 5HY6A 3J7AF 4NL3A 2E12A 3EG3A 5FROA 5GMKi 4J6WA 2NUTB 2RQTA 3CC2Q 1XOVA 4M77C 1K9AA 4JLIA 2J6KA 5I21A 4F7UB 1S72Q 2DXBA 2QTVA 2CUDA 1JB0E 4RTTA 2DEUA 3QHSA 2EAYA 2C0OA 2RMOA 2O4XB 2LCCA 4JJBA 3DLLA 4AT1B 2JOYA 3AHUA 2FB7A 2V8JA 4YTLA 1VQ9T 2LNVA 1K9MR 1WHLA 1W2BA 1Y0MA 1VQ4Q 1B34B 1YN8A 1WXBA 2EQKA 4M7DG 3LGLA 3P8DA 2QI2A 4E7IA 1VQNT 3CCET 8AT1B 2K4YA 1IO6A 2KRSA 1PWTA 3JCMb 2QQAA 4M7DC 4Y92A 3VS6A 1X75C 1AWOA 3UA7A 1K4US 2RHIA 3PFSA 2AHJB 2JNGA 1M30A 4IUQA 2CGHA 2LJ1A 3I56A 3VS3A 4HT8A 4JZ4A 1YJWA 1VQMA 3C94A 2KRNA 3CMAQ 4LDYA 3OYKA 2EQUA 3QJ6A 4M78D 2VXFA 4RTYA 2L3PA 4JRKA 2KQWA 2DJZA 3JB9H 3META 4PJOG 1OI1A 5GAN3 4PJMA 4LUDA 1YCYA 5CAIA 1S72T 4D6WA 3HP9A 1Y96A 3VS1A 3IQLA 2VYTA 4PJOC 1VQLQ 1WJSA 1X27A 4KULA 3OSSC 4J9GA 2RF0A 3M9QA 4FW1A 4LNPA 4CI0C 3NFCA 1UG1A 2PVGB 1PD1A 1WI7A 3HRSA 4LDVA 3DB3A 3M54A 1VQ8A 3CPWS 1IGUA 1X69A 1YJNA 4LXCA 1IHWA 4M77E 2RHUA 2VB6A 3JB9I 2KAFA 1VA7A 3LGFA 4DQ2A 5D7UA 4FIBA 1GFCA 1HXDA 3CXCS 1NG2A 1YJ9T 3A5ZB 3EH2A 3CMAT 4ANJA 4M7AG 2CZ0B 2EJFA 3A8GB 4M7AF 2NLUA 1UGQB 3MP8A 4QVZA 4M7AC 1JXMA 1MUZA 2RQVA 1C1AA 5KCOA 2CZ1B 4QQDA 4LN2A 1VQLT 2JZ2A 4MMLA 2LCSA 3JCMc 2DKGA 5DY9A 1QLYA 5GANj 2PUOB 4M78F 3GLXA 4X34A 2JS0A 3CBOA 1Y7XA 3O5ZA 1JJ2A 3UF4A 2OTLT 1Q82C 1Y96B 4RTXA 2GNCA 3M56A 3OBYA 5HCKA 2HCKA 2DZCA 1KK7A 1FMWA 2VV5A 4RKUE 2E5KA 2YSQA 3E1SA 5LL6S 2ZPBB 4EDUA 1G3TA 3CC4Q 5GANh 2XMFA 1MMAA 2L3QA 1CSKA 4C8QE 1VOMA 1GRIA 1C0MA 2PUKB 2ZPHB 5CVIA 4CC7A 4E7SA 1TS9A 1OULA 2E6ZA 1D09B 1N8RC 5CO7A 4J9IA 1QW1A 3L1AA 1OPKA 4IIOA 4R0KA 3HL8A 3S3MA 3OBWA 3U23A 1Q86R 2DL4A 4N4GA 5GAOm 1PRLC 3QPHA 3RERA 2GFUA 1E6HA 2PTKA 3FJ5A 4J6XA 4A54A 2E70A 2X9HA 5CQYA 3MJXA 4FL6A 2LVMA 2NWMA 1ACMB 3A8HB 4ZTJA 3M58A 5LJ5h 3CEYA 1M2VB 2CP0A 2KBTA 5CIUA 4M75G 5CQXA 2HEQA 5CCAA 4BB7A 3PTAA 4DEYA 1HSQA 3OYBA 4OGEA 3NTKA 5IXFA 4M75C 2ROLA 2MI6A 1N5ZA 4C0DC 1JRIA 1PC0A 3PNWC 4OVAA 2CP2A 3CC4T 1KQSA 3UPUA 1M8VA 2DD4A 4FT2A 3TSZA 3VUZA 1M90U 4PLIA 1YBYA 2L8DA 4PJOA 2FRWA 2LX9A 1AWXA 1GCQC 1NPPA 2E65A 2LZ6B 1QCFA 1SRMA 1WX6A 2COZA 3CXCA 1NEBA 1AVZC 1WQ7A 2F5TX 4EMGA 1IRXA 1B07A 1G5VA 1RI0A 4F7UG 4C5HA 4AFQC 2CDTA 3FRNA 1YIJA 4C0FA 1BI3A 2RH2A 3CBPA 1VQ7A 4F04B 1I07A 1SF9A 2EQJA 1RLQC 1O75A 2BE9B 3TEEA 2LQ8A 2DL5A 1ZSGA 2GGRA 3SEMA 3L2ZA 3CCRA 2X4WA 5GAOl 4MZMA 3BY7A 1XJWB 1KHCA 2BIVA 1YI2A 3QDFA 1IREB 5GMKh 4M7AA 2JS2A 4BE1A 2O31A 3EG0A 1VQPQ 2MMPA 1I4K1 1YITQ 1JU5C 4BI8B 3RKXA 2X3XD 3RESA 3Q1JA 2W0ZA 2QEXQ 2L3RA 5J26A 4J83A 1Q86U 3JB9G 1F1BB 4ZTFA 2JJ9A 4A4KA 5GAMj 2G6FX 1D0YA 2RHXA 3VJPA 2XD0A 3EG1A 2JXBA 1NM7A 2C06A 1KSWA 1ZA2B 4QQGA 3WXMB 5I11A 4Y28E 1QVFP 3EGXB 4FU6A 1H641 1Z9QA 1M3AA 1SG5A 2OAWA 3FJPA 2J6OA 3EG9B 1LCKA 2QG9B 1M3CA 3CCMA 2LQKA 5GAMh 2X51A 1WHGA 1W4SA 4HKEA 5D6YA 3VYGA 2CSQA 4EMHA 2RQWA 1U8RA 2W10A 3CCJA 1EZZB 3FDRA 2L3SA 3VV0A 2DYBA 1M5Q1 2P4TA 5HK3A 3PT9A 4BE0A 4JJNK 1VQPT 1OU8A 2FZGB 1YITT 2DIGA 5IHNA 2JW4A 3C4SA 4IUTA 1EFNA 3L42A 1KJWA 2LT4A 1TUDA 1X6GA 2EQIA 2QEXT 4GLMA 2FPEA 2GF7A 3CPWP 1MNEA 2WSCE 1JO8A 3NTIA 1KHIA 3C0CA 2DERA 4CC4B 1WYXA 3M0PA 4M75A 1Q82R 1WHJA 1MV0B 2QYZA 2HQHA 1UE9A 1YHQA 3QZ9B 1D1AA 2QDLA 2EJ9A 1M90C 2DX1A 2YUQA 3X26B 3OA6A 1W2BS 3RNJA 2AK5A 2CP5A 3UWNA 1H3ZA 5J39A 5KYXB 1MV3A 4M78B 3CD6Q 4IIMA 3V7CA 1VQ6Q 3CCLA 2RK2A 2RD1A 4HXJA 5LJ3d 5GANd 3PVQA 1NYGA 1N8RR 4C92G 2CZ7B 2AKKA 3QWYA 3EHRA 1FX7A 4C92F 2DL3A 3JV3A 4II1A 2CH4W 4C92C 1T3LA 5D6WA 1X2QA 4RMOA 1MGQA 2CZ6B 2HKNA 2XKOC 4BD3A 2BUDA 1AZGB 2DO3A 4XU0A 3L2QA 3FLGA 4M77D 4HCKA 2E1HA 4C5EA 2DE0X 3OYFA 4IUVA 2XG8D 2YRCA 2KXDA 2O4XA 3G4SA 1Y57A 2RQRA 4BI3A 4E7HA 3CC7A 1ZX6A 3DLMA 5DLOA 2Y90A 3H0FA 1BIAA 2RI3A 4MDXA 3GNGA 2F2VA 3LX7A 1G3WA 4ZNXA 1VQKQ 2G3RA 4BI4A 3MEVA 2KE9A 4J5YA 3GBQA 2A0FB 4WTOB 4JPBW 3CCUA 4M7DD 2KROA 5A0DA 3UATA 4PJJA 5GANf 2KRMA 3OY9A 2DPPB 1V29B 2QA4T 3GP8A 2QK0A 5FRMA 1QP2A 2WACA 2LT1A 4K11A 5ECAA 3UDCA 1JBMA 1VYTA 3ER0A 2HNIA 1G83A 2GCXA 3I55T 3GF5A 1TU0B 4QVDA 2DRKA 2FZKB 2K7AA 4ZN1A 2DBKA 2F1LA 4RTZA 3OB9A 1YCSB 4C8QD 4PJOD 1Q82U 4DOWA 2COWA 5LJ5f 4A4HA 2E5QA 2KSSA 3JCMX 2DAQA 4PJLA 3I56Q 2PVDB 2DFUA 4QW2A 1JJ2S 1YJWQ 1HYOA 1VQMQ 3NHNA 5GAOp 1VQKT 4BUGA 4PFPA 4HCZA 1JXOA 2RB6A 4J6YA 3VRZA 4KUIA 2C0TA 4PJNA 2ESWA 2DTIA 1EIFA 1N8RU 3QO3A 5LJ5e 4KH1B 3QKJA 2O9VA 2PZ1A 3P8HA 3CMEA 2KYBA 4TVRA 1VQNA 3E2UA 3QYGB 4V2SA 1PG5B 5HK0A 4Z88A 1RAGB 3A98A 2IVWA 4MZPA 3EG2A 2DM1A 2ABLA 3DKMA 1E6GA 2EKOA 2QQRA 2DVEA 2YT6A 3OW2S 2DNUA 1VQ8Q 1WXUA 3VS5A 2VVKA 4ELYC 1UECA 1YJNQ 2DEQA 1YJ9Q 4LD6A 1PHTA 5C0MA 4N4IA 2GFAA 2RI5A 1YWPA 4HT9A 1Z9ZA 3CC2A 3MKDA 3ZEHA 3I56T 1UDLA 1IZ6A 1TXQA 1YJWT 2PU9B 1VQMT 5GAMd 5A0GA 3OS1A 1NLPC 3LWHA 4C92A 2KT8A 1UUEA 1QMCA 1VYUA 1GBRA 4EMKB 2MAMA 5GJVB 8ATCB 2RQUA 4FYWB 4BY6B 1U3OA 1ZUUA 2LMJA 2XDPA 5I2MA 2OTLQ 1VQ4A 1KQSS 1H8KA 1N27A 1FXXA 3I5SA 3ME9A 4AMCA 3T9NA 3BE3A 2AZSA 2DBMA 3H0IA 3INZA 3KUFA 4OMNA 2P0KA 4C0ZA 1XNIA 4AFZC 2V8IA 1R77A 2E10A 1GL5A 2OAUA 3QIIA 4DBQA 3SB2A 5HKCA 2COYA 4OMFB 2AZVA 2D8JA 5IH2A 3CCVQ 1RI9A 1M90R 1IGQA 1VQ8T 1YJNT 3HFOA 5GMKe 4PKCC 4JUVA 4E7KA 3CMAA 2MOXA 4AFUC 3ULRB 1UGSB 2MF2A 1M2VA 1IB8A 2X3WD 4F16A 1M1KR 2HBWA 1ZSZB 2M16A 1VIEA 3X28B 3OYDA 5GMKm 4DBFA 4M7DE 4KGXB 4OMMA 4PFOA 5GAMf 2EJGA 1VQLA 2F2XA 3OSVA 1OEBA 4M78G 4J9HA 4IUUA 3RR6A 4OF1A 5LJ3j 1KG1A 3L2RA 5GAN4 1OOTA 1R8OB 3D7SB 1OPLA 2CT4A 2JT4A 4M78C 3J80E 3PIOA 1KD1C 2CREA 4C92B 2HKQB 4GLKA 2YUPA 2HL5C 2A36A 4RG8A 4FT4A 4XU2A 1MMGA 3V8LA 2DL8A 2O01E 4J7IA 2KXCA 2YRDA 3BFMA 5IN1A 4NS5A 1RLPC 3NGPA 3JCMW 5LJ3h 3BW1A 5IHIA 2BTTA 4PJOE 3EFSA 3JCMh 1X2KA 3MP1A 3CCVT 4L6V5 3JSCA 4XU1A 4CC2A 5GANg 1K0SA 2EIFA 4WF2A 1M9SA 2AT1B 1B7TA 2HSPA 2DZ9A 3EGDB 1SRLA 3M5AA 3R6NA 1RAFB 1BI2A 2RHYA 1IXDA 4EPCA 1RL2A 2CP6A 3OW2A 3RMSA 5C6SA 1PKTA 2LDMA 3GPLA 5A2QE 1DJ7B 2M51A 1WXTA 3RBBB 1QVGP 1VQOA 1V76A 1AOJA 5LJ5g 4DA4A 1QVFA 1WHMA 3V7SA 1ZBJA 7AT1B 3JB9J 4Q5WA 2ROTA 2M0OA 5FWBA 3R6OA 1T0JA 2PVOB 4M7AE 5GMKl 5DM7R 3CC4A 4J9FA 2FYKA 2M02A 2PQWA 1BCMA 1UHCA 3G6EA 1ZUYA 2RJDA 4LDWA 5GJWB 4E2FB 3TVTA 3EFOA 3CQTA 3TU4K 2R5AA 2EVRA 5EG2A 1BB9A 1S1NA 2PNIA 2KEAA 5KYUA 3JB9D 1I5OB 1WDXA 2LCLA 3EGXA 4RG2A 1XQHA 1KC8C 4RTWA 1U5SA 1BI1A 2DYIA 3PMIA 1FYNA 1M1KU 2EYYA 3EG9A 4KGVB 2X4JA 3L2WA 4Z89A 2BE7D 2CP3A 3X25B 3M0SA 1IHVA 2K5FA 2L89A 2FPDA 2XICA 3MO8A 3V7RA 3DB4A 3ZL7C 4ZGJB 2IIMA 2OX7A 3M53A 1TUGB 2GTOA 4JRIA 1NEGA 2FEIA 1M3BA 4BDZA 1AZEA 3F70A 2O9SA 1A0NB 1VQ7T 4BACA 2DVJA 5CK9A 2K2MA 4RTUA 5KYWB 1AWWA 1UJYA 4E47A 4QVCA 3M0UA 2L5QA 1VQ5Q 1VUBA 3HHTB 3BDUA 4JRQA 3OYMA 2K5LA 3CCJQ 2P0QA 2YXYA
chains in the Genus database with same CATH topology
5IHKA 4D8KA 2LJ1A 2B86A 2YDLA 4HCKA 2BZYA 3VS3A 1AEYA 2DE0X 4JZ4A 2FO0A 2EPDA 3VS0A 2JTEA 2KRNA 4RTYA 2KXDA 2DF6A 2L3PA 3H0HA 1Y57A 2EYWA 2GBQA 2RQRA 2DMOA 1ZX6A 3H0FA 1J3TA 2GQIA 2EGEA 4LUDA 2F2VA 1NLOC 4ZNXA 1SEMA 3IQLA 3VS1A 2KE9A 1X27A 3GBQA 3NPFA 4J9GA 2RF0A 2KYMA 1UHFA 1ZUKA 2LJ0A 4LNPA 3PVLA 4JPBW 2J7IA 1ABOA 2EYXA 4DEXA 1UG1A 2CUBA 4J9BA 2KROA 3UATA 3REAB 1WI7A 2KRMA 4D8DA 2LQNA 1X69A 2EW3A 4CC3A 2DLPA 1RUWA 2OI3A 4AG2C 1VA7A 4K11A 4F17A 2SEMA 4HVVA 4JJCA 4ORZA 5ECAA 1VYTA 2FRYA 1WIEA 1G83A 2MIOA 2MCNA 4FSSA 1SHGA 1GFCA 2DRKA 1NG2A 2K7AA 2DBKA 3M0TA 2H8HA 1K1ZA 4RTZA 1OV3A 1BU1A 1YCSB 4OMPA 3REBB 2YUOA 4AFSC 2BZ8A 1K76A 2LNHB 1JXMA 1MUZA 2RQVA 2DA9A 1AWJA 3NHNA 4LN2A 1JXOA 2LCSA 3VRZA 1QKWA 2KR3A 2C0TA 2D0NA 1W1FA 2ESWA 1QLYA 2JS0A 3O5ZA 2RPNA 3UF4A 2O9VA 2PZ1A 4RTXA 2GNCA 5HCKA 2KYBA 4Z8AA 5FWCA 2HCKA 4Z88A 4GBQA 1QKXA 3A98A 2ENMA 2L0AA 2E5KA 1BBZA 2YSQA 3EG2A 2NUZA 1U06A 1QWEA 2DM1A 2I0NA 2ABLA 4JJDA 4EIKA 1E6GA 2XMFA 2JM9A 2L3QA 1CSKA 1GRIA 2YT6A 2DNUA 1WXUA 3VS5A 2EGAA 2VVKA 4CC7A 1WLPB 1UECA 4M4ZA 1GFDA 2DRMA 1ABQA 1JEGA 1PHTA 4RUGA 1TG0A 4J9IA 4ESRA 1OPKA 4IIOA 4R0KA 1YWPA 1Z9ZA 3U23A 1UFFA 2DL4A 2ED0A 4J9DA 1PRLC 2KT1A 1UDLA 1E6HA 1SSHA 2PTKA 3FJ5A 1NLPC 1W6XA 1ZLMA 1PRMC 2C0IA 2KT8A 1UUEA 2NWMA 1VYUA 1GBRA 2D8HA 3SHWA 4A63B 1M8MA 5GJVB 2RQUA 4AG1C 2K79A 3THKA 2CH4A 2KBTA 1U3OA 1ZUUA 2LMJA 2HEQA 1E7OA 4LUEA 3VS4A 1H8KA 1UTIA 2F2WA 4HVUA 2JMAA 1HSQA 4DEYA 3I5SA 4OMOA 2YUNA 2SRCA 3VS7A 2AZSA 5IXFA 5IXBA 2ROLA 2DBMA 3H0IA 1NYFA 1W70A 1N5ZA 4OMNA 3TSWA 4AFZC 1GL5A 2LX7A 2EKHA 1KIKA 2AZVA 2D8JA 5IH2A 1RI9A 3TSZA 1T3SA 2FRWA 1AWXA 2MOXA 1GCQC 2FG0A 4AFUC 3ULRB 1YP5A 1QWFA 2LZ6B 2X3WD 4F16A 2KNBB 4RTVA 2RN8A 2HBWA 1QCFA 2VWFA 1SRMA 1WX6A 2OJ2A 1NEBA 1AVZC 1B07A 2KGTA 4OMMA 1X43A 4AFQC 2CDTA 2F2XA 4QT7A 1OEBA 4J9HA 1PKSA 4KRTA 2DJQA 1OOTA 1I07A 2A37A 1OPLA 1RLQC 4X1VA 1B3QA 2CT4A 2JT4A 1UGVA 2LJ3A 2CREA 2DL5A 2EGCA 1ZSGA 2GGRA 3SEMA 3NMZC 2JM8A 1I1JA 2YUPA 2A36A 1GCQA 1K0XA 2P4RA 4JZ3A 1CKAA 2JMCA 3PE0A 1BK2A 2DL8A 2KXCA 2J05A 4OMLA 1RLPC 3NGPA 1HJDA 2CSIA 2GTJA 3EGUA 5IHIA 2M0YA 2BTTA 2JS2A 2O88A 2K3BA 1CKBA 1WFWA 1X2KA 2O31A 4CC2A 1K0SA 3EG0A 2K9GA 1SHFA 2J6FA 1H3HA 1G2BA 1JU5C 2HSPA 1SRLA 3R6NA 2VKNA 2X3XD 2W0ZA 3LH5A 3VRYA 1GCPA 1WA7A 1JQQA 3QWXX 5L23A 1YNZA 1GBQA 1AD5A 1I0CA 2G6FX 3I5RA 3EG1A 1PKTA 2JXBA 1NM7A 1KSWA 5I11A 2J06A 2M51A 3M0RA 4E6RA 1WXTA 3RBBB 1T0HA 3UA6A 5FW9A 4OMQA 2K6DA 1AOJA 1Z9QA 2OAWA 1M3AA 2J6OA 2DL7A 4J9CA 1LCKA 1M3CA 1VYVA 1ZBJA 2CT3A 4J9EA 2CSQA 2RQWA 2ROTA 3M0QA 5I22A 5FWBA 2D1XA 2W10A 1T0JA 3I35A 2A28A 1SPKA 2DILA 4J9FA 2L3SA 2DYBA 2AKLA 4HVWA 4LE9A 1UHCA 1FMKA 1ZUYA 5GJWB 3TVTA 2LQWA 3CQTA 2FPFA 1X6BA 4F14A 2LP5A 2EVRA 5EC7A 1H92A 1BB9A 2V1QA 5IHNA 1KFZA 2JW4A 1S1NA 1EFNA 2KEAA 2PNIA 1KJWA 1TUDA 1WDXA 1X6GA 2EQIA 3KFVA 2A08A 4GLMA 1V1CA 2FPEA 4RTWA 3I9QA 1U5SA 2V1RA 1FYNA 1JO8A 1M27C 2EYYA 2ED1A 3C0CA 4Z89A 1UJ0A 4CC4B 1WYXA 3EG3A 3M0PA 3M0SA 1MV0B 1UE9A 2HDAA 2EBPA 2RQTA 2BZXA 1XOVA 2QDLA 1K9AA 2FPDA 2DX1A 2J6KA 2YUQA 3RNJA 1ARKA 2AK5A 1MV3A 1TUCA 2CUDA 4RTTA 3ZL7C 4IIMA 3H41A 2IIMA 2GTOA 2C0OA 2RMOA 1NEGA 1PNJA 2EYZA 2FEIA 1M3BA 4JJBA 1AZEA 4WCIA 3VS2A 4HXJA 2O9SA 1A0NB 3PVQA 1NYGA 1Y0MA 2O2OA 1YN8A 1WXBA 2AKKA 2DVJA 3QWYA 2K2MA 3EHRA 4RTUA 2DL3A 3JV3A 2L2PA 1AWWA 2CH4W 1UJYA 1IO6A 2ECZA 2KRSA 1PWTA 1T3LA 2RNAA 3M0UA 1HD3A 4Y92A 3VS6A 1X2QA 3EHQA 1AWOA 3UA7A 1K4US 1AZGB 1M30A 1YWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IHK A;  4D8K A;  2LJ1 A;  2B86 A;  2YDL A;  4HCK A;  2BZY A;  3VS3 A;  1AEY A;  2DE0 X;  4JZ4 A;  2FO0 A;  2EPD A;  3VS0 A;  2JTE A;  2KRN A;  4RTY A;  2KXD A;  2DF6 A;  2L3P A;  3H0H A;  1Y57 A;  2EYW A;  2GBQ A;  2RQR A;  2DMO A;  1ZX6 A;  3H0F A;  1J3T A;  2GQI A;  2EGE A;  4LUD A;  2F2V A;  1NLO C;  4ZNX A;  1SEM A;  3IQL A;  3VS1 A;  2KE9 A;  1X27 A;  3GBQ A;  3NPF A;  4J9G A;  2RF0 A;  2KYM A;  1UHF A;  1ZUK A;  2LJ0 A;  4LNP A;  3PVL A;  4JPB W;  2J7I A;  1ABO A;  2EYX A;  4DEX A;  1UG1 A;  2CUB A;  4J9B A;  2KRO A;  3UAT A;  3REA B;  1WI7 A;  2KRM A;  4D8D A;  2LQN A;  1X69 A;  2EW3 A;  4CC3 A;  2DLP A;  1RUW A;  2OI3 A;  4AG2 C;  1VA7 A;  4K11 A;  4F17 A;  2SEM A;  4HVV A;  4JJC A;  4ORZ A;  5ECA A;  1VYT A;  2FRY A;  1WIE A;  1G83 A;  2MIO A;  2MCN A;  4FSS A;  1SHG A;  1GFC A;  2DRK A;  1NG2 A;  2K7A A;  2DBK A;  3M0T A;  2H8H A;  1K1Z A;  4RTZ A;  1OV3 A;  1BU1 A;  1YCS B;  4OMP A;  3REB B;  2YUO A;  4AFS C;  2BZ8 A;  1K76 A;  2LNH B;  1JXM A;  1MUZ A;  2RQV A;  2DA9 A;  1AWJ A;  3NHN A;  4LN2 A;  1JXO A;  2LCS A;  3VRZ A;  1QKW A;  2KR3 A;  2C0T A;  2D0N A;  1W1F A;  2ESW A;  1QLY A;  2JS0 A;  3O5Z A;  2RPN A;  3UF4 A;  2O9V A;  2PZ1 A;  4RTX A;  2GNC A;  5HCK A;  2KYB A;  4Z8A A;  5FWC A;  2HCK A;  4Z88 A;  4GBQ A;  1QKX A;  3A98 A;  2ENM A;  2L0A A;  2E5K A;  1BBZ A;  2YSQ A;  3EG2 A;  2NUZ A;  1U06 A;  1QWE A;  2DM1 A;  2I0N A;  2ABL A;  4JJD A;  4EIK A;  1E6G A;  2XMF A;  2JM9 A;  2L3Q A;  1CSK A;  1GRI A;  2YT6 A;  2DNU A;  1WXU A;  3VS5 A;  2EGA A;  2VVK A;  4CC7 A;  1WLP B;  1UEC A;  4M4Z A;  1GFD A;  2DRM A;  1ABQ A;  1JEG A;  1PHT A;  4RUG A;  1TG0 A;  4J9I A;  4ESR A;  1OPK A;  4IIO A;  4R0K A;  1YWP A;  1Z9Z A;  3U23 A;  1UFF A;  2DL4 A;  2ED0 A;  4J9D A;  1PRL C;  2KT1 A;  1UDL A;  1E6H A;  1SSH A;  2PTK A;  3FJ5 A;  1NLP C;  1W6X A;  1ZLM A;  1PRM C;  2C0I A;  2KT8 A;  1UUE A;  2NWM A;  1VYU A;  1GBR A;  2D8H A;  3SHW A;  4A63 B;  1M8M A;  5GJV B;  2RQU A;  4AG1 C;  2K79 A;  3THK A;  2CH4 A;  2KBT A;  1U3O A;  1ZUU A;  2LMJ A;  2HEQ A;  1E7O A;  4LUE A;  3VS4 A;  1H8K A;  1UTI A;  2F2W A;  4HVU A;  2JMA A;  1HSQ A;  4DEY A;  3I5S A;  4OMO A;  2YUN A;  2SRC A;  3VS7 A;  2AZS A;  5IXF A;  5IXB A;  2ROL A;  2DBM A;  3H0I A;  1NYF A;  1W70 A;  1N5Z A;  4OMN A;  3TSW A;  4AFZ C;  1GL5 A;  2LX7 A;  2EKH A;  1KIK A;  2AZV A;  2D8J A;  5IH2 A;  1RI9 A;  3TSZ A;  1T3S A;  2FRW A;  1AWX A;  2MOX A;  1GCQ C;  2FG0 A;  4AFU C;  3ULR B;  1YP5 A;  1QWF A;  2LZ6 B;  2X3W D;  4F16 A;  2KNB B;  4RTV A;  2RN8 A;  2HBW A;  1QCF A;  2VWF A;  1SRM A;  1WX6 A;  2OJ2 A;  1NEB A;  1AVZ C;  1B07 A;  2KGT A;  4OMM A;  1X43 A;  4AFQ C;  2CDT A;  2F2X A;  4QT7 A;  1OEB A;  4J9H A;  1PKS A;  4KRT A;  2DJQ A;  1OOT A;  1I07 A;  2A37 A;  1OPL A;  1RLQ C;  4X1V A;  1B3Q A;  2CT4 A;  2JT4 A;  1UGV A;  2LJ3 A;  2CRE A;  2DL5 A;  2EGC A;  1ZSG A;  2GGR A;  3SEM A;  3NMZ C;  2JM8 A;  1I1J A;  2YUP A;  2A36 A;  1GCQ A;  1K0X A;  2P4R A;  4JZ3 A;  1CKA A;  2JMC A;  3PE0 A;  1BK2 A;  2DL8 A;  2KXC A;  2J05 A;  4OML A;  1RLP C;  3NGP A;  1HJD A;  2CSI A;  2GTJ A;  3EGU A;  5IHI A;  2M0Y A;  2BTT A;  2JS2 A;  2O88 A;  2K3B A;  1CKB A;  1WFW A;  1X2K A;  2O31 A;  4CC2 A;  1K0S A;  3EG0 A;  2K9G A;  1SHF A;  2J6F A;  1H3H A;  1G2B A;  1JU5 C;  2HSP A;  1SRL A;  3R6N A;  2VKN A;  2X3X D;  2W0Z A;  3LH5 A;  3VRY A;  1GCP A;  1WA7 A;  1JQQ A;  3QWX X;  5L23 A;  1YNZ A;  1GBQ A;  1AD5 A;  1I0C A;  2G6F X;  3I5R A;  3EG1 A;  1PKT A;  2JXB A;  1NM7 A;  1KSW A;  5I11 A;  2J06 A;  2M51 A;  3M0R A;  4E6R A;  1WXT A;  3RBB B;  1T0H A;  3UA6 A;  5FW9 A;  4OMQ A;  2K6D A;  1AOJ A;  1Z9Q A;  2OAW A;  1M3A A;  2J6O A;  2DL7 A;  4J9C A;  1LCK A;  1M3C A;  1VYV A;  1ZBJ A;  2CT3 A;  4J9E A;  2CSQ A;  2RQW A;  2ROT A;  3M0Q A;  5I22 A;  5FWB A;  2D1X A;  2W10 A;  1T0J A;  3I35 A;  2A28 A;  1SPK A;  2DIL A;  4J9F A;  2L3S A;  2DYB A;  2AKL A;  4HVW A;  4LE9 A;  1UHC A;  1FMK A;  1ZUY A;  5GJW B;  3TVT A;  2LQW A;  3CQT A;  2FPF A;  1X6B A;  4F14 A;  2LP5 A;  2EVR A;  5EC7 A;  1H92 A;  1BB9 A;  2V1Q A;  5IHN A;  1KFZ A;  2JW4 A;  1S1N A;  1EFN A;  2KEA A;  2PNI A;  1KJW A;  1TUD A;  1WDX A;  1X6G A;  2EQI A;  3KFV A;  2A08 A;  4GLM A;  1V1C A;  2FPE A;  4RTW A;  3I9Q A;  1U5S A;  2V1R A;  1FYN A;  1JO8 A;  1M27 C;  2EYY A;  2ED1 A;  3C0C A;  4Z89 A;  1UJ0 A;  4CC4 B;  1WYX A;  3EG3 A;  3M0P A;  3M0S A;  1MV0 B;  1UE9 A;  2HDA A;  2EBP A;  2RQT A;  2BZX A;  1XOV A;  2QDL A;  1K9A A;  2FPD A;  2DX1 A;  2J6K A;  2YUQ A;  3RNJ A;  1ARK A;  2AK5 A;  1MV3 A;  1TUC A;  2CUD A;  4RTT A;  3ZL7 C;  4IIM A;  3H41 A;  2IIM A;  2GTO A;  2C0O A;  2RMO A;  1NEG A;  1PNJ A;  2EYZ A;  2FEI A;  1M3B A;  4JJB A;  1AZE A;  4WCI A;  3VS2 A;  4HXJ A;  2O9S A;  1A0N B;  3PVQ A;  1NYG A;  1Y0M A;  2O2O A;  1YN8 A;  1WXB A;  2AKK A;  2DVJ A;  3QWY A;  2K2M A;  3EHR A;  4RTU A;  2DL3 A;  3JV3 A;  2L2P A;  1AWW A;  2CH4 W;  1UJY A;  1IO6 A;  2ECZ A;  2KRS A;  1PWT A;  1T3L A;  2RNA A;  3M0U A;  1HD3 A;  4Y92 A;  3VS6 A;  1X2Q A;  3EHQ A;  1AWO A;  3UA7 A;  1K4U S;  1AZG B;  1M30 A;  1YWO A; 
#chains in the Genus database with same CATH topology
 5IHK A;  3FC3 A;  1ZA1 B;  2B86 A;  2BZY A;  1AEY A;  5KYX A;  4FSX A;  4M78 A;  3JCM J;  4M75 E;  2EPD A;  3EFO B;  3VS0 A;  2JTE A;  3TQ7 P;  4XK8 E;  5CKB A;  2K57 A;  5GAN 8;  1RAE B;  4RCC A;  2QAS A;  1BYM A;  3C95 A;  2DXU A;  2EYW A;  2GBQ A;  2RJC A;  2DMO A;  5KYU B;  2BKD N;  5GAN 7;  3NTH A;  5FU7 B;  1LNX A;  1RAH B;  1PCX A;  4C8Q B;  1SEM A;  1PSE A;  2ATC B;  1RAB B;  3NPF A;  5CKE A;  1UHF A;  4EMK C;  1ZUK A;  4HA8 A;  2LJ0 A;  1Q81 U;  1MMD A;  1ABO A;  4BY6 C;  1I5L A;  3MHX A;  3REA B;  3QYH B;  3CCM T;  2LQN A;  2XDD A;  2EW3 A;  3QZ5 B;  3CCL Q;  4CC3 A;  2YHT A;  2YLB A;  2YRV A;  2QDY B;  1SKU B;  1VQP A;  1VQ5 T;  4AG2 C;  1YIT A;  1MMN A;  1YFN A;  2SEM A;  4JJC A;  4F7U E;  3CCJ T;  2JVV A;  2FRY A;  2QEX A;  1OU9 A;  2MIO A;  2QQ9 A;  3RIR A;  2MCN A;  1U1T A;  5DLQ E;  4LD9 K;  3M0T A;  2RJF A;  1WJQ A;  1R0C B;  4OB0 B;  1KD1 R;  2ZCF B;  4ELZ C;  4OMP A;  3REB B;  1Q7Y C;  3OS2 A;  3BDL A;  3CXC P;  4AFS C;  2BZ8 A;  1N9R A;  4PK4 A;  1K76 A;  2LNH B;  4OB2 B;  1ZSZ C;  2KDS A;  2DA9 A;  3RDV A;  2XID A;  3G71 A;  3ASK A;  4JLG A;  3PGG A;  1MND A;  1NZ9 A;  3SWN B;  1YHQ T;  1QKW A;  1M1K C;  2KR3 A;  3QDR B;  2YWW A;  3CCQ Q;  1W1F A;  3RKY A;  3J81 E;  3CCS Q;  3X24 B;  2DXT A;  2GQV A;  2KVQ G;  3JCM d;  2QA4 Q;  4E7L A;  5FLX E;  2DTH A;  4Z8A A;  1TWB A;  5FWC A;  2P84 A;  1QVP A;  3CCL T;  1QKX A;  2L0A A;  4B9X A;  4BE2 A;  2EQM A;  1BBZ A;  3LWI A;  2NUZ A;  4HCC A;  4JJD A;  1QWE A;  4EIK A;  2DK3 A;  3I55 Q;  1AHJ B;  3GOX A;  2QAZ A;  1K73 U;  4OB3 B;  2JTM A;  4ZGD B;  3JCM V;  2NYS A;  1WLP B;  1GFD A;  1RAD B;  4MDW A;  1QP3 A;  2I2L A;  1JEG A;  3FIF A;  4RUG A;  4Y91 A;  4C5G A;  4A4G A;  1UFF A;  2ED0 A;  4J9D A;  2YLC A;  2KT1 A;  5CR2 A;  4A53 A;  3C12 A;  2K2V A;  2HD0 A;  2XU8 A;  1W6X A;  1PRM C;  2C0I A;  1LJO A;  3CD6 A;  5FU6 B;  3M57 A;  4UC4 A;  3G4S T;  1VQ6 A;  4ME7 A;  2D8H A;  3SHW A;  1UGR B;  2K79 A;  3CC7 T;  3CCQ T;  3ZFJ A;  2XI9 A;  4JS4 A;  1ZQ1 A;  2K5I A;  2RM4 A;  5D6X A;  5LJ3 f;  3CCS T;  1OZ3 A;  3M55 A;  2LTO A;  1UTI A;  4XU3 A;  4HVU A;  2JMA A;  2VGN A;  1U1S A;  2R57 A;  2OTJ A;  3JCM f;  1KC8 R;  1P92 A;  2YUN A;  3VS7 A;  5IXB A;  2QQS A;  2H3J A;  4ZGE B;  4DBH A;  2LX7 A;  2ZPF B;  4IKF A;  3CME Q;  4IUP A;  4R56 A;  1Q81 C;  3OYI A;  1G3S A;  5GAN e;  5LJ3 e;  2KY9 A;  3M59 A;  5I2S A;  1NJI U;  2FG0 A;  4EMK A;  1YP5 A;  1KD1 U;  1Y07 A;  3RMQ A;  5GAO q;  1I8F A;  3SFM A;  2VWF A;  4C92 E;  4M77 G;  5GAN 2;  2KGT A;  1VQK A;  1TOV A;  1X43 A;  4M77 F;  1K8A U;  4KH0 B;  1BCO A;  4QT7 A;  1VQ9 A;  4KRT A;  2WSE E;  2RHZ A;  1D3B B;  3M4Y A;  2A37 A;  4X1V A;  1B3Q A;  1I81 A;  1UGV A;  3JCM Q;  2HMA A;  2LJ3 A;  2E64 A;  2MWO A;  2EGC A;  3CCE A;  1FWZ A;  3NMZ C;  3LYI A;  1I1J A;  2P0P A;  2VXE A;  3OMC A;  3OQ5 A;  1K0X A;  1CKA A;  2RI2 A;  5FRN A;  1BK2 A;  1M2O A;  2ZPG B;  4OML A;  1HJD A;  4L59 A;  4PL6 A;  3QBY A;  3OYN A;  2CSI A;  1Q95 G;  2GTJ A;  3EGU A;  3QXE B;  2M0Y A;  1ZSZ A;  1M4Z A;  2DXC A;  3CME T;  1WFW A;  2VGM A;  4M7D F;  2MWP A;  4N0A C;  4XTV A;  4M7A D;  2K9G A;  4L5G A;  1H3H A;  4ATO A;  3LH0 A;  3LH5 A;  3VRY A;  1GCP A;  1OX9 A;  1QCN A;  1WA7 A;  3RUX A;  4CRI A;  2A7Y A;  1JQQ A;  3QWX X;  5L23 A;  1QVF S;  1S72 A;  1YNZ A;  1GBQ A;  1AD5 A;  1I0C A;  4O5V A;  3EFR A;  1K73 C;  2XHC A;  2ZAE A;  4E6R A;  4C8Q G;  3CC2 T;  1T0H A;  4E7J A;  4OMQ A;  2RK1 A;  5FU7 C;  4C8Q F;  5GAN 5;  3URG A;  3WVE B;  4PJO F;  1QVG A;  2DL7 A;  4J9C A;  1Y71 A;  1O9S A;  1VYV A;  4C8Q C;  3O8V A;  1KC8 U;  2V8K A;  2VC8 A;  5I22 A;  3EGD A;  5KH6 A;  3EH1 A;  1PD0 A;  1NE8 A;  1SPK A;  1WPY A;  2DIL A;  4FYY B;  1VQ4 T;  1PM3 A;  2QQB A;  1UEB A;  4LE9 A;  1Q7Y R;  3MEA A;  2FPF A;  2E3I A;  4F14 A;  1TSF A;  2LP5 A;  3JAM E;  1YJ9 A;  5EC7 A;  1OQK A;  2V1Q A;  3UT1 A;  5KE2 A;  1C6V X;  2EFI A;  3OYA A;  3I9Q A;  1UB4 A;  2V1R A;  2KMT A;  1M27 C;  2RA2 A;  3X20 B;  1N9S A;  3VKI A;  2X35 A;  1UJ0 A;  4OB1 B;  3S3N A;  3E9F A;  2E4H A;  4B9W A;  4X9D A;  2HDA A;  2EBP A;  2BZX A;  4M75 D;  1LVK A;  2ZPI B;  1WNL A;  1ARK A;  1D1B A;  1NJI C;  4MZT A;  1TUC A;  2OTL A;  2CS7 A;  4KGZ B;  4FCY A;  3H41 A;  5AYF A;  4XTW A;  1KQ1 A;  2D9T A;  2EYZ A;  1PNJ A;  2EWN A;  1W2B P;  3QG1 A;  4XTY A;  3SWN C;  5GAM e;  1NBE B;  4WCI A;  1VQO Q;  3VS2 A;  2LC4 A;  2O2O A;  1K9M U;  1K8A C;  2R5M A;  5AT1 B;  5J3B A;  2L2P A;  1TH7 A;  5LJ3 g;  3CCV A;  2ECZ A;  2RNA A;  1HD3 A;  4PLL A;  2QGG A;  3JCM g;  3EHQ A;  4XQ3 A;  3OYJ A;  3VU3 C;  4M77 A;  1YWO A;  3SDZ A;  3KXT A;  2D6F A;  4D8K A;  4E7Z A;  2YDL A;  1G8X A;  3G6E Q;  2FO0 A;  4C5I A;  2V26 A;  1D0X A;  5CKH A;  4C0G A;  4FYX B;  2DF6 A;  1FMV A;  3FB9 A;  5LJ5 j;  3H0H A;  4KUD K;  3LLR A;  3QJY A;  4JS5 A;  2F69 A;  4VUB A;  4ZN3 A;  3PIP A;  1J3T A;  4P5N A;  2GQI A;  2EGE A;  3CPF A;  2E3H A;  3JCM P;  1NLO C;  3CBM A;  5KYW A;  4N0A A;  1SSF A;  3OYH A;  5FU6 C;  3MPU B;  3S6W A;  1YIJ Q;  1BKB A;  2KYM A;  4M7D A;  3AT1 B;  1Q81 R;  1M1G A;  1VQ7 Q;  3VYH B;  3PVL A;  4FM4 B;  1VQO T;  2J7I A;  2EYX A;  1LPL A;  4DEX A;  2CUB A;  4J9B A;  2HL3 A;  3A8O B;  3OYE A;  4OGC A;  4DBR A;  4D8D A;  4M75 F;  1R0B G;  1Q7Y U;  3CCR Q;  3OYC A;  1VIF A;  2D0Q B;  2DLP A;  4NL2 A;  3OYY A;  1RUW A;  2OI3 A;  4JDS A;  4B6M A;  4F17 A;  4HVV A;  4ORZ A;  5KYY A;  2KI7 A;  4MMK A;  1YI2 Q;  1WIE A;  4GY5 A;  4M78 E;  3RKW A;  1RAC B;  4FSS A;  1WJR A;  1SHG A;  3G6E T;  2DD5 A;  4C8Q A;  2ZPE B;  3CPW A;  2H8H A;  1K1Z A;  1BU1 A;  1OV3 A;  3MEW A;  4Z02 A;  2RO0 A;  4FW2 A;  3FEO A;  4M77 B;  2YUO A;  2K3Y A;  4LDU A;  1ZHI A;  4HCB A;  1RAI B;  3H8Z A;  1AWJ A;  4XTZ A;  2A3L A;  1YIJ T;  2D0N A;  4F7U F;  1JJ2 P;  1NPR A;  2NUP A;  1WGS A;  4DOV A;  2HSE B;  5M9O A;  2LRQ A;  2RPN A;  5GMK j;  3GNF B;  3CCM Q;  1GXI E;  2KK4 A;  4J8O A;  1QQJ A;  1WQW A;  3CCR T;  4GBQ A;  1XTD A;  1N6A A;  4M7D B;  2ENM A;  6AT1 B;  4JRP A;  3GIB A;  1U06 A;  2I0N A;  1YI2 T;  1K73 R;  2JM9 A;  4XAX B;  3HSB A;  2EGA A;  3G7Z A;  2X4Y A;  4M4Z A;  4KBM B;  2DRM A;  9ATC B;  1K9M C;  1ABQ A;  4A4E A;  3SD4 A;  1WZO A;  1TG0 A;  3ZBD A;  4J7F A;  1X6O A;  3SWN A;  4ESR A;  2Y4X A;  5KYY B;  3HRT A;  3H6Z A;  5L8R E;  3OW2 P;  5A0L A;  1M1F A;  3A8M B;  1SSH A;  2R58 A;  2E6N A;  1ZLM A;  5CKD A;  3JB9 F;  2CYZ B;  4PJO B;  3OYL A;  3WVD B;  2MYS A;  1YHQ Q;  4A63 B;  2AIR B;  2JN0 A;  1M8M A;  3TRE A;  4C92 D;  1WHK A;  3OMG A;  4AG1 C;  2JTF A;  5IAY A;  5GAM g;  3THK A;  2CH4 A;  4O6J A;  2FVU A;  2CP7 A;  1E7O A;  2Z0W A;  4LUE A;  3VS4 A;  3TCJ A;  3OS0 A;  2F2W A;  3G71 Q;  2M1H A;  4OMO A;  2SRC A;  1MHN A;  2XK0 A;  3HPW A;  1VQ5 A;  1NYF A;  1HK9 A;  1W70 A;  1KQS P;  2NUP B;  4XTU A;  3TSW A;  1D1C A;  1WHH A;  1EX4 A;  3VUB A;  4XTX A;  2ZGW A;  2EKH A;  3HFN A;  3A1P A;  5KYN A;  1KIK A;  2E41 A;  2IG0 A;  3HKS A;  1T3S A;  4FYV B;  2B8A A;  1NJI R;  4KT0 E;  2HQE A;  1QWF A;  2KNB B;  4RTV A;  5KE3 A;  2RN8 A;  4M7A B;  2HAX A;  1X01 A;  2OJ2 A;  1OYX A;  3PMT A;  2HQX A;  1K8A R;  3G4S Q;  3V8K A;  2FZC B;  2FL7 A;  2VAS A;  3CC7 Q;  1PKS A;  3V8J A;  2DJQ A;  1PSF A;  2H3E B;  2IPO B;  2X4X A;  1KQ2 A;  3G71 T;  2JM8 A;  4OP0 A;  2MK5 A;  3QUI A;  1BIB A;  1GCQ A;  4JZ3 A;  2P4R A;  2JMC A;  3PE0 A;  3CCU Q;  2JUF A;  4NOY A;  2QXF A;  3M4G A;  2J05 A;  4N4H A;  2DTO A;  3HRU A;  2O88 A;  2K3B A;  2OTJ Q;  1CKB A;  2CKK A;  1SHF A;  2J6F A;  3MEU A;  3L2U A;  4LDX A;  1G2B A;  2NUT A;  3E9G A;  2VKN A;  1UGP B;  2FHD A;  2DET A;  4RCB A;  1AT1 B;  4F7U A;  1D3B A;  1QVG S;  3A8L B;  3QSU A;  3L2V A;  2XDB A;  3E19 A;  1OX8 A;  3MCA B;  3I5R A;  4BDY A;  3N5B B;  5LJ5 d;  1QCO A;  5IT9 E;  4QQ6 A;  2HZY A;  2HBP A;  2J06 A;  3M0R A;  2MPX C;  3EAE A;  5GAO n;  2EYQ A;  3UA6 A;  3CCQ A;  3G1J A;  5FW9 A;  1G3Y A;  2K6D A;  1B34 A;  1ZBX A;  4QKU A;  2WSF E;  3H9N A;  3CCS A;  2ZZD A;  2CT3 A;  2QA4 A;  3CD6 T;  3MP6 A;  5GAO r;  1Q86 C;  4M75 B;  4J9E A;  1VQ6 T;  2Y4Y A;  1D0Z A;  3JRZ A;  1OZ2 A;  3M0Q A;  1VQ9 Q;  2D1X A;  2QTX A;  4PFZ A;  4C0D B;  3CCU T;  3I35 A;  2A28 A;  3KBG A;  4IUR A;  3I55 A;  1RAA B;  2AKL A;  4HVW A;  5KCH A;  3P8B B;  3CCE Q;  1LOJ A;  1VQN Q;  1FMK A;  1TTH B;  2OTJ T;  4X9C A;  2LQW A;  2VUB A;  2RJE A;  1X6B A;  3HTR A;  2QGF B;  3OS5 A;  2M9U A;  4PNO A;  3JCM e;  1H92 A;  4A4F A;  1KFZ A;  2DIQ A;  2F5K A;  5CKF A;  3KFV A;  2A08 A;  1V1C A;  1BI0 A;  5GAN 6;  3S3O A;  4R55 A;  2ED1 A;  3LW5 E;  2K3X A;  3OYG A;  5HY6 A;  3J7A F;  4NL3 A;  2E12 A;  3EG3 A;  5FRO A;  5GMK i;  4J6W A;  2NUT B;  2RQT A;  3CC2 Q;  1XOV A;  4M77 C;  1K9A A;  4JLI A;  2J6K A;  5I21 A;  4F7U B;  1S72 Q;  2DXB A;  2QTV A;  2CUD A;  1JB0 E;  4RTT A;  2DEU A;  3QHS A;  2EAY A;  2C0O A;  2RMO A;  2O4X B;  2LCC A;  4JJB A;  3DLL A;  4AT1 B;  2JOY A;  3AHU A;  2FB7 A;  2V8J A;  4YTL A;  1VQ9 T;  2LNV A;  1K9M R;  1WHL A;  1W2B A;  1Y0M A;  1VQ4 Q;  1B34 B;  1YN8 A;  1WXB A;  2EQK A;  4M7D G;  3LGL A;  3P8D A;  2QI2 A;  4E7I A;  1VQN T;  3CCE T;  8AT1 B;  2K4Y A;  1IO6 A;  2KRS A;  1PWT A;  3JCM b;  2QQA A;  4M7D C;  4Y92 A;  3VS6 A;  1X75 C;  1AWO A;  3UA7 A;  1K4U S;  2RHI A;  3PFS A;  2AHJ B;  2JNG A;  1M30 A;  4IUQ A;  2CGH A;  2LJ1 A;  3I56 A;  3VS3 A;  4HT8 A;  4JZ4 A;  1YJW A;  1VQM A;  3C94 A;  2KRN A;  3CMA Q;  4LDY A;  3OYK A;  2EQU A;  3QJ6 A;  4M78 D;  2VXF A;  4RTY A;  2L3P A;  4JRK A;  2KQW A;  2DJZ A;  3JB9 H;  3MET A;  4PJO G;  1OI1 A;  5GAN 3;  4PJM A;  4LUD A;  1YCY A;  5CAI A;  1S72 T;  4D6W A;  3HP9 A;  1Y96 A;  3VS1 A;  3IQL A;  2VYT A;  4PJO C;  1VQL Q;  1WJS A;  1X27 A;  4KUL A;  3OSS C;  4J9G A;  2RF0 A;  3M9Q A;  4FW1 A;  4LNP A;  4CI0 C;  3NFC A;  1UG1 A;  2PVG B;  1PD1 A;  1WI7 A;  3HRS A;  4LDV A;  3DB3 A;  3M54 A;  1VQ8 A;  3CPW S;  1IGU A;  1X69 A;  1YJN A;  4LXC A;  1IHW A;  4M77 E;  2RHU A;  2VB6 A;  3JB9 I;  2KAF A;  1VA7 A;  3LGF A;  4DQ2 A;  5D7U A;  4FIB A;  1GFC A;  1HXD A;  3CXC S;  1NG2 A;  1YJ9 T;  3A5Z B;  3EH2 A;  3CMA T;  4ANJ A;  4M7A G;  2CZ0 B;  2EJF A;  3A8G B;  4M7A F;  2NLU A;  1UGQ B;  3MP8 A;  4QVZ A;  4M7A C;  1JXM A;  1MUZ A;  2RQV A;  1C1A A;  5KCO A;  2CZ1 B;  4QQD A;  4LN2 A;  1VQL T;  2JZ2 A;  4MML A;  2LCS A;  3JCM c;  2DKG A;  5DY9 A;  1QLY A;  5GAN j;  2PUO B;  4M78 F;  3GLX A;  4X34 A;  2JS0 A;  3CBO A;  1Y7X A;  3O5Z A;  1JJ2 A;  3UF4 A;  2OTL T;  1Q82 C;  1Y96 B;  4RTX A;  2GNC A;  3M56 A;  3OBY A;  5HCK A;  2HCK A;  2DZC A;  1KK7 A;  1FMW A;  2VV5 A;  4RKU E;  2E5K A;  2YSQ A;  3E1S A;  5LL6 S;  2ZPB B;  4EDU A;  1G3T A;  3CC4 Q;  5GAN h;  2XMF A;  1MMA A;  2L3Q A;  1CSK A;  4C8Q E;  1VOM A;  1GRI A;  1C0M A;  2PUK B;  2ZPH B;  5CVI A;  4CC7 A;  4E7S A;  1TS9 A;  1OUL A;  2E6Z A;  1D09 B;  1N8R C;  5CO7 A;  4J9I A;  1QW1 A;  3L1A A;  1OPK A;  4IIO A;  4R0K A;  3HL8 A;  3S3M A;  3OBW A;  3U23 A;  1Q86 R;  2DL4 A;  4N4G A;  5GAO m;  1PRL C;  3QPH A;  3RER A;  2GFU A;  1E6H A;  2PTK A;  3FJ5 A;  4J6X A;  4A54 A;  2E70 A;  2X9H A;  5CQY A;  3MJX A;  4FL6 A;  2LVM A;  2NWM A;  1ACM B;  3A8H B;  4ZTJ A;  3M58 A;  5LJ5 h;  3CEY A;  1M2V B;  2CP0 A;  2KBT A;  5CIU A;  4M75 G;  5CQX A;  2HEQ A;  5CCA A;  4BB7 A;  3PTA A;  4DEY A;  1HSQ A;  3OYB A;  4OGE A;  3NTK A;  5IXF A;  4M75 C;  2ROL A;  2MI6 A;  1N5Z A;  4C0D C;  1JRI A;  1PC0 A;  3PNW C;  4OVA A;  2CP2 A;  3CC4 T;  1KQS A;  3UPU A;  1M8V A;  2DD4 A;  4FT2 A;  3TSZ A;  3VUZ A;  1M90 U;  4PLI A;  1YBY A;  2L8D A;  4PJO A;  2FRW A;  2LX9 A;  1AWX A;  1GCQ C;  1NPP A;  2E65 A;  2LZ6 B;  1QCF A;  1SRM A;  1WX6 A;  2COZ A;  3CXC A;  1NEB A;  1AVZ C;  1WQ7 A;  2F5T X;  4EMG A;  1IRX A;  1B07 A;  1G5V A;  1RI0 A;  4F7U G;  4C5H A;  4AFQ C;  2CDT A;  3FRN A;  1YIJ A;  4C0F A;  1BI3 A;  2RH2 A;  3CBP A;  1VQ7 A;  4F04 B;  1I07 A;  1SF9 A;  2EQJ A;  1RLQ C;  1O75 A;  2BE9 B;  3TEE A;  2LQ8 A;  2DL5 A;  1ZSG A;  2GGR A;  3SEM A;  3L2Z A;  3CCR A;  2X4W A;  5GAO l;  4MZM A;  3BY7 A;  1XJW B;  1KHC A;  2BIV A;  1YI2 A;  3QDF A;  1IRE B;  5GMK h;  4M7A A;  2JS2 A;  4BE1 A;  2O31 A;  3EG0 A;  1VQP Q;  2MMP A;  1I4K 1;  1YIT Q;  1JU5 C;  4BI8 B;  3RKX A;  2X3X D;  3RES A;  3Q1J A;  2W0Z A;  2QEX Q;  2L3R A;  5J26 A;  4J83 A;  1Q86 U;  3JB9 G;  1F1B B;  4ZTF A;  2JJ9 A;  4A4K A;  5GAM j;  2G6F X;  1D0Y A;  2RHX A;  3VJP A;  2XD0 A;  3EG1 A;  2JXB A;  1NM7 A;  2C06 A;  1KSW A;  1ZA2 B;  4QQG A;  3WXM B;  5I11 A;  4Y28 E;  1QVF P;  3EGX B;  4FU6 A;  1H64 1;  1Z9Q A;  1M3A A;  1SG5 A;  2OAW A;  3FJP A;  2J6O A;  3EG9 B;  1LCK A;  2QG9 B;  1M3C A;  3CCM A;  2LQK A;  5GAM h;  2X51 A;  1WHG A;  1W4S A;  4HKE A;  5D6Y A;  3VYG A;  2CSQ A;  4EMH A;  2RQW A;  1U8R A;  2W10 A;  3CCJ A;  1EZZ B;  3FDR A;  2L3S A;  3VV0 A;  2DYB A;  1M5Q 1;  2P4T A;  5HK3 A;  3PT9 A;  4BE0 A;  4JJN K;  1VQP T;  1OU8 A;  2FZG B;  1YIT T;  2DIG A;  5IHN A;  2JW4 A;  3C4S A;  4IUT A;  1EFN A;  3L42 A;  1KJW A;  2LT4 A;  1TUD A;  1X6G A;  2EQI A;  2QEX T;  4GLM A;  2FPE A;  2GF7 A;  3CPW P;  1MNE A;  2WSC E;  1JO8 A;  3NTI A;  1KHI A;  3C0C A;  2DER A;  4CC4 B;  1WYX A;  3M0P A;  4M75 A;  1Q82 R;  1WHJ A;  1MV0 B;  2QYZ A;  2HQH A;  1UE9 A;  1YHQ A;  3QZ9 B;  1D1A A;  2QDL A;  2EJ9 A;  1M90 C;  2DX1 A;  2YUQ A;  3X26 B;  3OA6 A;  1W2B S;  3RNJ A;  2AK5 A;  2CP5 A;  3UWN A;  1H3Z A;  5J39 A;  5KYX B;  1MV3 A;  4M78 B;  3CD6 Q;  4IIM A;  3V7C A;  1VQ6 Q;  3CCL A;  2RK2 A;  2RD1 A;  4HXJ A;  5LJ3 d;  5GAN d;  3PVQ A;  1NYG A;  1N8R R;  4C92 G;  2CZ7 B;  2AKK A;  3QWY A;  3EHR A;  1FX7 A;  4C92 F;  2DL3 A;  3JV3 A;  4II1 A;  2CH4 W;  4C92 C;  1T3L A;  5D6W A;  1X2Q A;  4RMO A;  1MGQ A;  2CZ6 B;  2HKN A;  2XKO C;  4BD3 A;  2BUD A;  1AZG B;  2DO3 A;  4XU0 A;  3L2Q A;  3FLG A;  4M77 D;  4HCK A;  2E1H A;  4C5E A;  2DE0 X;  3OYF A;  4IUV A;  2XG8 D;  2YRC A;  2KXD A;  2O4X A;  3G4S A;  1Y57 A;  2RQR A;  4BI3 A;  4E7H A;  3CC7 A;  1ZX6 A;  3DLM A;  5DLO A;  2Y90 A;  3H0F A;  1BIA A;  2RI3 A;  4MDX A;  3GNG A;  2F2V A;  3LX7 A;  1G3W A;  4ZNX A;  1VQK Q;  2G3R A;  4BI4 A;  3MEV A;  2KE9 A;  4J5Y A;  3GBQ A;  2A0F B;  4WTO B;  4JPB W;  3CCU A;  4M7D D;  2KRO A;  5A0D A;  3UAT A;  4PJJ A;  5GAN f;  2KRM A;  3OY9 A;  2DPP B;  1V29 B;  2QA4 T;  3GP8 A;  2QK0 A;  5FRM A;  1QP2 A;  2WAC A;  2LT1 A;  4K11 A;  5ECA A;  3UDC A;  1JBM A;  1VYT A;  3ER0 A;  2HNI A;  1G83 A;  2GCX A;  3I55 T;  3GF5 A;  1TU0 B;  4QVD A;  2DRK A;  2FZK B;  2K7A A;  4ZN1 A;  2DBK A;  2F1L A;  4RTZ A;  3OB9 A;  1YCS B;  4C8Q D;  4PJO D;  1Q82 U;  4DOW A;  2COW A;  5LJ5 f;  4A4H A;  2E5Q A;  2KSS A;  3JCM X;  2DAQ A;  4PJL A;  3I56 Q;  2PVD B;  2DFU A;  4QW2 A;  1JJ2 S;  1YJW Q;  1HYO A;  1VQM Q;  3NHN A;  5GAO p;  1VQK T;  4BUG A;  4PFP A;  4HCZ A;  1JXO A;  2RB6 A;  4J6Y A;  3VRZ A;  4KUI A;  2C0T A;  4PJN A;  2ESW A;  2DTI A;  1EIF A;  1N8R U;  3QO3 A;  5LJ5 e;  4KH1 B;  3QKJ A;  2O9V A;  2PZ1 A;  3P8H A;  3CME A;  2KYB A;  4TVR A;  1VQN A;  3E2U A;  3QYG B;  4V2S A;  1PG5 B;  5HK0 A;  4Z88 A;  1RAG B;  3A98 A;  2IVW A;  4MZP A;  3EG2 A;  2DM1 A;  2ABL A;  3DKM A;  1E6G A;  2EKO A;  2QQR A;  2DVE A;  2YT6 A;  3OW2 S;  2DNU A;  1VQ8 Q;  1WXU A;  3VS5 A;  2VVK A;  4ELY C;  1UEC A;  1YJN Q;  2DEQ A;  1YJ9 Q;  4LD6 A;  1PHT A;  5C0M A;  4N4I A;  2GFA A;  2RI5 A;  1YWP A;  4HT9 A;  1Z9Z A;  3CC2 A;  3MKD A;  3ZEH A;  3I56 T;  1UDL A;  1IZ6 A;  1TXQ A;  1YJW T;  2PU9 B;  1VQM T;  5GAM d;  5A0G A;  3OS1 A;  1NLP C;  3LWH A;  4C92 A;  2KT8 A;  1UUE A;  1QMC A;  1VYU A;  1GBR A;  4EMK B;  2MAM A;  5GJV B;  8ATC B;  2RQU A;  4FYW B;  4BY6 B;  1U3O A;  1ZUU A;  2LMJ A;  2XDP A;  5I2M A;  2OTL Q;  1VQ4 A;  1KQS S;  1H8K A;  1N27 A;  1FXX A;  3I5S A;  3ME9 A;  4AMC A;  3T9N A;  3BE3 A;  2AZS A;  2DBM A;  3H0I A;  3INZ A;  3KUF A;  4OMN A;  2P0K A;  4C0Z A;  1XNI A;  4AFZ C;  2V8I A;  1R77 A;  2E10 A;  1GL5 A;  2OAU A;  3QII A;  4DBQ A;  3SB2 A;  5HKC A;  2COY A;  4OMF B;  2AZV A;  2D8J A;  5IH2 A;  3CCV Q;  1RI9 A;  1M90 R;  1IGQ A;  1VQ8 T;  1YJN T;  3HFO A;  5GMK e;  4PKC C;  4JUV A;  4E7K A;  3CMA A;  2MOX A;  4AFU C;  3ULR B;  1UGS B;  2MF2 A;  1M2V A;  1IB8 A;  2X3W D;  4F16 A;  1M1K R;  2HBW A;  1ZSZ B;  2M16 A;  1VIE A;  3X28 B;  3OYD A;  5GMK m;  4DBF A;  4M7D E;  4KGX B;  4OMM A;  4PFO A;  5GAM f;  2EJG A;  1VQL A;  2F2X A;  3OSV A;  1OEB A;  4M78 G;  4J9H A;  4IUU A;  3RR6 A;  4OF1 A;  5LJ3 j;  1KG1 A;  3L2R A;  5GAN 4;  1OOT A;  1R8O B;  3D7S B;  1OPL A;  2CT4 A;  2JT4 A;  4M78 C;  3J80 E;  3PIO A;  1KD1 C;  2CRE A;  4C92 B;  2HKQ B;  4GLK A;  2YUP A;  2HL5 C;  2A36 A;  4RG8 A;  4FT4 A;  4XU2 A;  1MMG A;  3V8L A;  2DL8 A;  2O01 E;  4J7I A;  2KXC A;  2YRD A;  3BFM A;  5IN1 A;  4NS5 A;  1RLP C;  3NGP A;  3JCM W;  5LJ3 h;  3BW1 A;  5IHI A;  2BTT A;  4PJO E;  3EFS A;  3JCM h;  1X2K A;  3MP1 A;  3CCV T;  4L6V 5;  3JSC A;  4XU1 A;  4CC2 A;  5GAN g;  1K0S A;  2EIF A;  4WF2 A;  1M9S A;  2AT1 B;  1B7T A;  2HSP A;  2DZ9 A;  3EGD B;  1SRL A;  3M5A A;  3R6N A;  1RAF B;  1BI2 A;  2RHY A;  1IXD A;  4EPC A;  1RL2 A;  2CP6 A;  3OW2 A;  3RMS A;  5C6S A;  1PKT A;  2LDM A;  3GPL A;  5A2Q E;  1DJ7 B;  2M51 A;  1WXT A;  3RBB B;  1QVG P;  1VQO A;  1V76 A;  1AOJ A;  5LJ5 g;  4DA4 A;  1QVF A;  1WHM A;  3V7S A;  1ZBJ A;  7AT1 B;  3JB9 J;  4Q5W A;  2ROT A;  2M0O A;  5FWB A;  3R6O A;  1T0J A;  2PVO B;  4M7A E;  5GMK l;  5DM7 R;  3CC4 A;  4J9F A;  2FYK A;  2M02 A;  2PQW A;  1BCM A;  1UHC A;  3G6E A;  1ZUY A;  2RJD A;  4LDW A;  5GJW B;  4E2F B;  3TVT A;  3EFO A;  3CQT A;  3TU4 K;  2R5A A;  2EVR A;  5EG2 A;  1BB9 A;  1S1N A;  2PNI A;  2KEA A;  5KYU A;  3JB9 D;  1I5O B;  1WDX A;  2LCL A;  3EGX A;  4RG2 A;  1XQH A;  1KC8 C;  4RTW A;  1U5S A;  1BI1 A;  2DYI A;  3PMI A;  1FYN A;  1M1K U;  2EYY A;  3EG9 A;  4KGV B;  2X4J A;  3L2W A;  4Z89 A;  2BE7 D;  2CP3 A;  3X25 B;  3M0S A;  1IHV A;  2K5F A;  2L89 A;  2FPD A;  2XIC A;  3MO8 A;  3V7R A;  3DB4 A;  3ZL7 C;  4ZGJ B;  2IIM A;  2OX7 A;  3M53 A;  1TUG B;  2GTO A;  4JRI A;  1NEG A;  2FEI A;  1M3B A;  4BDZ A;  1AZE A;  3F70 A;  2O9S A;  1A0N B;  1VQ7 T;  4BAC A;  2DVJ A;  5CK9 A;  2K2M A;  4RTU A;  5KYW B;  1AWW A;  1UJY A;  4E47 A;  4QVC A;  3M0U A;  2L5Q A;  1VQ5 Q;  1VUB A;  3HHT B;  3BDU A;  4JRQ A;  3OYM A;  2K5L A;  3CCJ Q;  2P0Q A;  2YXY A; 
#chains in the Genus database with same CATH homology
 5IHK A;  4D8K A;  2LJ1 A;  2B86 A;  2YDL A;  4HCK A;  2BZY A;  3VS3 A;  1AEY A;  2DE0 X;  4JZ4 A;  2FO0 A;  2EPD A;  3VS0 A;  2JTE A;  2KRN A;  4RTY A;  2KXD A;  2DF6 A;  2L3P A;  3H0H A;  1Y57 A;  2EYW A;  2GBQ A;  2RQR A;  2DMO A;  1ZX6 A;  3H0F A;  1J3T A;  2GQI A;  2EGE A;  4LUD A;  2F2V A;  1NLO C;  4ZNX A;  1SEM A;  3IQL A;  3VS1 A;  2KE9 A;  1X27 A;  3GBQ A;  3NPF A;  4J9G A;  2RF0 A;  2KYM A;  1UHF A;  1ZUK A;  2LJ0 A;  4LNP A;  3PVL A;  4JPB W;  2J7I A;  1ABO A;  2EYX A;  4DEX A;  1UG1 A;  2CUB A;  4J9B A;  2KRO A;  3UAT A;  3REA B;  1WI7 A;  2KRM A;  4D8D A;  2LQN A;  1X69 A;  2EW3 A;  4CC3 A;  2DLP A;  1RUW A;  2OI3 A;  4AG2 C;  1VA7 A;  4K11 A;  4F17 A;  2SEM A;  4HVV A;  4JJC A;  4ORZ A;  5ECA A;  1VYT A;  2FRY A;  1WIE A;  1G83 A;  2MIO A;  2MCN A;  4FSS A;  1SHG A;  1GFC A;  2DRK A;  1NG2 A;  2K7A A;  2DBK A;  3M0T A;  2H8H A;  1K1Z A;  4RTZ A;  1OV3 A;  1BU1 A;  1YCS B;  4OMP A;  3REB B;  2YUO A;  4AFS C;  2BZ8 A;  1K76 A;  2LNH B;  1JXM A;  1MUZ A;  2RQV A;  2DA9 A;  1AWJ A;  3NHN A;  4LN2 A;  1JXO A;  2LCS A;  3VRZ A;  1QKW A;  2KR3 A;  2C0T A;  2D0N A;  1W1F A;  2ESW A;  1QLY A;  2JS0 A;  3O5Z A;  2RPN A;  3UF4 A;  2O9V A;  2PZ1 A;  4RTX A;  2GNC A;  5HCK A;  2KYB A;  4Z8A A;  5FWC A;  2HCK A;  4Z88 A;  4GBQ A;  1QKX A;  3A98 A;  2ENM A;  2L0A A;  2E5K A;  1BBZ A;  2YSQ A;  3EG2 A;  2NUZ A;  1U06 A;  1QWE A;  2DM1 A;  2I0N A;  2ABL A;  4JJD A;  4EIK A;  1E6G A;  2XMF A;  2JM9 A;  2L3Q A;  1CSK A;  1GRI A;  2YT6 A;  2DNU A;  1WXU A;  3VS5 A;  2EGA A;  2VVK A;  4CC7 A;  1WLP B;  1UEC A;  4M4Z A;  1GFD A;  2DRM A;  1ABQ A;  1JEG A;  1PHT A;  4RUG A;  1TG0 A;  4J9I A;  4ESR A;  1OPK A;  4IIO A;  4R0K A;  1YWP A;  1Z9Z A;  3U23 A;  1UFF A;  2DL4 A;  2ED0 A;  4J9D A;  1PRL C;  2KT1 A;  1UDL A;  1E6H A;  1SSH A;  2PTK A;  3FJ5 A;  1NLP C;  1W6X A;  1ZLM A;  1PRM C;  2C0I A;  2KT8 A;  1UUE A;  2NWM A;  1VYU A;  1GBR A;  2D8H A;  3SHW A;  4A63 B;  1M8M A;  5GJV B;  2RQU A;  4AG1 C;  2K79 A;  3THK A;  2CH4 A;  2KBT A;  1U3O A;  1ZUU A;  2LMJ A;  2HEQ A;  1E7O A;  4LUE A;  3VS4 A;  1H8K A;  1UTI A;  2F2W A;  4HVU A;  2JMA A;  1HSQ A;  4DEY A;  3I5S A;  4OMO A;  2YUN A;  2SRC A;  3VS7 A;  2AZS A;  5IXF A;  5IXB A;  2ROL A;  2DBM A;  3H0I A;  1NYF A;  1W70 A;  1N5Z A;  4OMN A;  3TSW A;  4AFZ C;  1GL5 A;  2LX7 A;  2EKH A;  1KIK A;  2AZV A;  2D8J A;  5IH2 A;  1RI9 A;  3TSZ A;  1T3S A;  2FRW A;  1AWX A;  2MOX A;  1GCQ C;  2FG0 A;  4AFU C;  3ULR B;  1YP5 A;  1QWF A;  2LZ6 B;  2X3W D;  4F16 A;  2KNB B;  4RTV A;  2RN8 A;  2HBW A;  1QCF A;  2VWF A;  1SRM A;  1WX6 A;  2OJ2 A;  1NEB A;  1AVZ C;  1B07 A;  2KGT A;  4OMM A;  1X43 A;  4AFQ C;  2CDT A;  2F2X A;  4QT7 A;  1OEB A;  4J9H A;  1PKS A;  4KRT A;  2DJQ A;  1OOT A;  1I07 A;  2A37 A;  1OPL A;  1RLQ C;  4X1V A;  1B3Q A;  2CT4 A;  2JT4 A;  1UGV A;  2LJ3 A;  2CRE A;  2DL5 A;  2EGC A;  1ZSG A;  2GGR A;  3SEM A;  3NMZ C;  2JM8 A;  1I1J A;  2YUP A;  2A36 A;  1GCQ A;  1K0X A;  2P4R A;  4JZ3 A;  1CKA A;  2JMC A;  3PE0 A;  1BK2 A;  2DL8 A;  2KXC A;  2J05 A;  4OML A;  1RLP C;  3NGP A;  1HJD A;  2CSI A;  2GTJ A;  3EGU A;  5IHI A;  2M0Y A;  2BTT A;  2JS2 A;  2O88 A;  2K3B A;  1CKB A;  1WFW A;  1X2K A;  2O31 A;  4CC2 A;  1K0S A;  3EG0 A;  2K9G A;  1SHF A;  2J6F A;  1H3H A;  1G2B A;  1JU5 C;  2HSP A;  1SRL A;  3R6N A;  2VKN A;  2X3X D;  2W0Z A;  3LH5 A;  3VRY A;  1GCP A;  1WA7 A;  1JQQ A;  3QWX X;  5L23 A;  1YNZ A;  1GBQ A;  1AD5 A;  1I0C A;  2G6F X;  3I5R A;  3EG1 A;  1PKT A;  2JXB A;  1NM7 A;  1KSW A;  5I11 A;  2J06 A;  2M51 A;  3M0R A;  4E6R A;  1WXT A;  3RBB B;  1T0H A;  3UA6 A;  5FW9 A;  4OMQ A;  2K6D A;  1AOJ A;  1Z9Q A;  2OAW A;  1M3A A;  2J6O A;  2DL7 A;  4J9C A;  1LCK A;  1M3C A;  1VYV A;  1ZBJ A;  2CT3 A;  4J9E A;  2CSQ A;  2RQW A;  2ROT A;  3M0Q A;  5I22 A;  5FWB A;  2D1X A;  2W10 A;  1T0J A;  3I35 A;  2A28 A;  1SPK A;  2DIL A;  4J9F A;  2L3S A;  2DYB A;  2AKL A;  4HVW A;  4LE9 A;  1UHC A;  1FMK A;  1ZUY A;  5GJW B;  3TVT A;  2LQW A;  3CQT A;  2FPF A;  1X6B A;  4F14 A;  2LP5 A;  2EVR A;  5EC7 A;  1H92 A;  1BB9 A;  2V1Q A;  5IHN A;  1KFZ A;  2JW4 A;  1S1N A;  1EFN A;  2KEA A;  2PNI A;  1KJW A;  1TUD A;  1WDX A;  1X6G A;  2EQI A;  3KFV A;  2A08 A;  4GLM A;  1V1C A;  2FPE A;  4RTW A;  3I9Q A;  1U5S A;  2V1R A;  1FYN A;  1JO8 A;  1M27 C;  2EYY A;  2ED1 A;  3C0C A;  4Z89 A;  1UJ0 A;  4CC4 B;  1WYX A;  3EG3 A;  3M0P A;  3M0S A;  1MV0 B;  1UE9 A;  2HDA A;  2EBP A;  2RQT A;  2BZX A;  1XOV A;  2QDL A;  1K9A A;  2FPD A;  2DX1 A;  2J6K A;  2YUQ A;  3RNJ A;  1ARK A;  2AK5 A;  1MV3 A;  1TUC A;  2CUD A;  4RTT A;  3ZL7 C;  4IIM A;  3H41 A;  2IIM A;  2GTO A;  2C0O A;  2RMO A;  1NEG A;  1PNJ A;  2EYZ A;  2FEI A;  1M3B A;  4JJB A;  1AZE A;  4WCI A;  3VS2 A;  4HXJ A;  2O9S A;  1A0N B;  3PVQ A;  1NYG A;  1Y0M A;  2O2O A;  1YN8 A;  1WXB A;  2AKK A;  2DVJ A;  3QWY A;  2K2M A;  3EHR A;  4RTU A;  2DL3 A;  3JV3 A;  2L2P A;  1AWW A;  2CH4 W;  1UJY A;  1IO6 A;  2ECZ A;  2KRS A;  1PWT A;  1T3L A;  2RNA A;  3M0U A;  1HD3 A;  4Y92 A;  3VS6 A;  1X2Q A;  3EHQ A;  1AWO A;  3UA7 A;  1K4U S;  1AZG B;  1M30 A;  1YWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...