1SEMA

Structural determinants of peptide-binding orientation and of sequence specificity in sh3 domains
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
b'ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEM-5
publication title Structural determinants of peptide-binding orientation and of sequence specificity in SH3 domains.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signal transduction protein
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1semA00
3H0IA 1YN8A 4RUGA 2GTJA 2DE0X 2KNBB 2PTKA 1AD5A 1TUDA 1VYTA 2DL7A 2D1XA 4J9GA 2OAWA 1U5SA 1SEMA 2F2XA 1WXBA 1UUEA 1JXOA 3UA6A 3EG3A 4DEYA 2KYMA 1GL5A 2EGEA 4ESRA 4F14A 1OPKA 2F2WA 2LJ1A 5IH2A 1S1NA 1JO8A 2JT4A 1PRMC 2ABLA 1HSQA 1CSKA 1ZBJA 1GFCA 2GQIA 1KJWA 1WIEA 1WI7A 1UECA 1H92A 1BBZA 2ECZA 4Y92A 2RF0A 3M0RA 1CKBA 3VRYA 2DNUA 4A63B 2EPDA 1PKSA 2ED0A 1VYUA 5I11A 3UF4A 3VS3A 1NYFA 2KYBA 1X2KA 2D8JA 3QWYA 2KROA 1SRMA 1AWXA 2CDTA 4RTZA 4EIKA 2DJQA 3ZL7C 3NMZC 4GBQA 5EC7A 2RQRA 1H3HA 3A98A 2EW3A 2PZ1A 2RQTA 3KFVA 3EG1A 4K11A 1I07A 2YSQA 1UTIA 5GJVB 2JM9A 2O9VA 2DYBA 1UDLA 2EGAA 1EFNA 3TSZA 2DRMA 2A28A 4HVUA 2O2OA 2KR3A 2L3SA 2BZYA 2DM1A 2FG0A 4J9BA 2CH4W 2OJ2A 1K4US 5IHKA 1NLPC 3VS0A 3EGUA 1B3QA 2FO0A 4OMOA 2YUPA 1M3BA 1T0HA 1V1CA 2YUQA 2ENMA 3EG0A 2JS2A 4AG2C 3REAB 1U3OA 1WYXA 2DL4A 3FJ5A 1AOJA 1T3LA 2O88A 1SRLA 1K1ZA 1Y57A 1WFWA 2KE9A 2RQUA 3SHWA 2KBTA 2C0IA 2CT3A 2J6FA 1AWOA 2W10A 1HJDA 1WXTA 1WLPB 4CC2A 2EKHA 1GBRA 3PVLA 5IHNA 2A37A 4OMNA 4CC4B 1MUZA 3M0QA 4D8DA 2JS0A 2KEAA 1MV0B 1M30A 2VVKA 1KIKA 4JJDA 2EVRA 1K0SA 1UJ0A 2JTEA 2ROLA 2RQVA 3EHRA 1U06A 3VS1A 4IIOA 3NPFA 1K0XA 1SPKA 1X6GA 1GCPA 3U23A 1KSWA 2FRWA 2K6DA 1E7OA 2YUOA 2ROTA 2YT6A 5FWBA 1PNJA 2EYXA 2LJ3A 4E6RA 1YP5A 4WCIA 2J6OA 4CC7A 2JXBA 2M51A 2LMJA 2RNAA 1TG0A 1UFFA 2K7AA 2ED1A 2CUBA 2J06A 2K3BA 3C0CA 1GCQA 2AKLA 2YDLA 1WDXA 1GCQC 1VYVA 2KGTA 1HD3A 2LQNA 2EYYA 2K9GA 2LCSA 3UATA 1UHFA 1MV3A 1WXUA 2P4RA 2DL3A 3PVQA 1LCKA 1NLOC 1YWOA 1JQQA 4HXJA 3I9QA 4OMPA 1OEBA 1GFDA 2CSQA 3VS7A 2C0TA 2FRYA 2KT8A 1JXMA 5ECAA 1PKTA 4QT7A 3GBQA 2X3WD 4OMLA 4J9IA 2J6KA 2D8HA 2RPNA 2DBKA 2L2PA 3I5SA 1GRIA 1FMKA 2X3XD 2BZXA 4KRTA 2B86A 1M3CA 1NYGA 3IQLA 5GJWB 4AFZC 2F2VA 1SHFA 1QKWA 4ORZA 4AG1C 1AZGB 1M3AA 2CUDA 3RBBB 1JU5C 4X1VA 1UG1A 1AZEA 1QWEA 2AZVA 5L23A 3ULRB 2L0AA 4IIMA 1OPLA 1BK2A 2I0NA 2RN8A 3LH5A 2ESWA 2L3PA 5FW9A 1RI9A 2KRSA 4RTWA 1K9AA 2H8HA 4FSSA 1OV3A 3H0FA 4Z89A 1PHTA 1NG2A 1UE9A 1I0CA 4RTUA 4J9EA 4ZNXA 2DL5A 2O31A 2PNIA 4LUDA 1T3SA 1UGVA 2KXCA 2FEIA 2GGRA 3EG2A 1RLQC 2JMCA 3VS4A 1E6GA 3PE0A 1ABOA 4RTYA 1ZUUA 1WA7A 1Z9ZA 4J9CA 4Z88A 4JPBW 3THKA 1AVZC 1H8KA 1ZUKA 1J3TA 2CT4A 3O5ZA 1K76A 2LX7A 2RMOA 5HCKA 2E5KA 4JZ3A 2LP5A 2DL8A 2MOXA 2VKNA 2AZSA 1VA7A 4AFQC 2KRMA 2DX1A 4OMQA 2AK5A 2FPEA 3VS2A 2CH4A 2DBMA 1W6XA 2JM8A 1WX6A 1ZSGA 2DF6A 5IXFA 1QKXA 2K2MA 2NWMA 3EHQA 3TVTA 2D0NA 2MIOA 1M8MA 1PWTA 2KXDA 2J7IA 2DLPA 2J05A 3H0HA 2QDLA 4JJBA 2DVJA 2LQWA 4GLMA 1PRLC 4J9FA 3VS6A 1KFZA 2A08A 4JJCA 2W0ZA 2K79A 2YUNA 2BZ8A 2GNCA 2JMAA 4LNPA 2V1QA 4LN2A 2MCNA 3CQTA 2HBWA 1ARKA 4JZ4A 4RTTA 1XOVA 4Z8AA 1FYNA 1M27C 1W1FA 1NM7A 2HEQA 4HCKA 2JW4A 4OMMA 3I35A 3M0TA 2DILA 1BU1A 2VWFA 4F17A 2KT1A 3I5RA 1AEYA 1X27A 2OI3A 2HDAA 1N5ZA 1IO6A 4J9HA 1OOTA 3VS5A 3NHNA 3M0SA 1YCSB 2BTTA 1UHCA 2V1RA 3TSWA 1SSHA 3RNJA 1X69A 1RLPC 1ZX6A 3SEMA 3REBB 1CKAA 1A0NB 2EQIA 4HVWA 2KRNA 1I1JA 3M0PA 2FPFA 2CREA 2G6FX 3M0UA 2O9SA 2SRCA 4R0KA 4CC3A 3QWXX 1QWFA 2GBQA 2EYZA 4AFUC 2M0YA 4HVVA 4D8KA 4RTVA 1B07A 2IIMA 2EBPA 4DEXA 3VRZA 5IHIA 3R6NA 2LZ6B 1Y0MA 5FWCA 1QLYA 1ZUYA 1JEGA 1RUWA 1G2BA 1QCFA 1SHGA 1T0JA 2HSPA 2DRKA 2DMOA 1X6BA 4LUEA 1ABQA 1YWPA 2SEMA 2L3QA 1YNZA 1W70A 1E6HA 1ZLMA 1AWWA 1AWJA 1NEGA 2RQWA 2DA9A 2AKKA 1UJYA 3UA7A 2CSIA 2FPDA 5IXBA 1X2QA 2A36A 3JV3A 3H41A 3NGPA 4LE9A 2HCKA 4M4ZA 1TUCA 4RTXA 2LNHB 4F16A 1X43A 1G83A 2LJ0A 2NUZA 2XMFA 2EGCA 2C0OA 5I22A 1Z9QA 4J9DA 2EYWA 1BB9A 1GBQA 1NEBA 2GTOA 4AFSC
chains in the Genus database with same CATH superfamily
1YN8A 3FIFA 1RAAB 1QVFP 1TTHB 4ME7A 1TUDA 1VYTA 5LL6S 3CCVA 3JCMe 4OGCA 2D1XA 1MMAA 2HKNA 1D1AA 1UUEA 3EG3A 3EG9A 4LD6A 4XTZA 2KYMA 4BE1A 1G5VA 4M75E 2ZPHB 2DXBA 4BY6C 1PRMC 3M53A 2ABLA 1HSQA 1R0BG 2R5AA 1B34A 2GQIA 1EX4A 4KGZB 4Y92A 1KQ2A 2RF0A 1CKBA 2DNUA 1M8VA 1KQSS 5KCHA 3LYIA 2ED0A 3TREA 2DVEA 1D3BB 1NYFA 3JSCA 4C92F 4M75B 3GIBA 1LJOA 3QWYA 1YITQ 1QW1A 2KDSA 4BE0A 4EIKA 3CCVT 2DJQA 2DPPB 1XQHA 4NS5A 1Q81C 3SWNB 1D0ZA 4HA8A 1H3HA 4FW1A 1BI2A 1K73U 2RQTA 2PZ1A 4FW2A 1S72T 1I4K1 4PLLA 1I07A 4N0AA 3MEWA 3AHUA 4BE2A 1SSFA 5CKFA 2O9VA 2DYBA 2E10A 3TSZA 5GAN3 2DM1A 1KD1U 5I21A 1ZA2B 2CH4W 1K4US 1NLPC 2FO0A 1AT1B 2YUPA 1M3BA 1V1CA 2WSFE 2YUQA 2LTOA 3REAB 1U3OA 4M7DB 1WYXA 2CP5A 1TXQA 2HNIA 1VQ8Q 2O88A 1SRLA 1JJ2P 1V76A 1LNXA 3QO3A 1N8RC 3MEUA 4MDWA 2LQKA 4DOWA 5AYFA 3S3NA 2VVKA 5AT1B 3META 2ROLA 2RQVA 4XU3A 3G6EA 4C8QD 4NL3A 4C0DB 1QCNA 1FMWA 3NPFA 1VQNQ 2IPOB 5J3BA 4DOVA 1BCMA 1GCPA 2R58A 2F5TX 2FB7A 5CCAA 1Q82R 2K3YA 2LJ3A 3S6WA 3T9NA 2XD0A 3HSBA 2XKOC 4CC7A 1KC8U 2CP0A 2M51A 2COZA 2EKOA 3CBOA 3CC7A 1YIJA 3RKYA 2EQKA 1M4ZA 5FU6B 1GCQA 1H3ZA 2YDLA 1WDXA 4ATOA 3CBPA 4BACA 4QQ6A 4PJMA 3G6ET 4DA4A 4EMKB 2P0KA 1YBYA 4O5VA 2K5LA 3UATA 1MV3A 5LJ3d 1M90U 1G3SA 3VS7A 5DLQE 2QG9B 2EQMA 1Y71A 3CC7T 4R55A 1YIJT 3OYGA 2J6KA 1WQWA 3CCLA 3CD6A 2DBKA 2BE9B 4DBRA 4N0AC 4MMLA 3CMAA 5GJWB 3MKDA 4KULA 4BI3A 3JCMd 1QKWA 4C92A 1UB4A 3J80E 2CUDA 3HPWA 5CR2A 2DD4A 2V8JA 3SD4A 1YI2A 4HCBA 4X34A 3SFMA 4M7AC 1MMDA 1RABB 4UC4A 3CCRQ 2HZYA 1NJIC 1N9RA 1OPLA 4ZTFA 3LWHA 1R8OB 2QEXQ 2RJFA 1KQ1A 4A4GA 4FIBA 1WHHA 1VQ7A 3HRTA 3CCLT 3CD6T 3G71A 3CXCA 1NG2A 3C12A 4RTUA 1KQSP 4B9XA 2DEQA 5M9OA 2DL5A 2PNIA 2DTOA 3CMAT 1UGVA 3H9NA 3HP9A 2FEIA 2JTMA 1ZUUA 1WZOA 1YI2T 4Z88A 4M75G 3M5AA 1OX9A 3THKA 1ZUKA 3HRUA 1QVGA 4GLKA 4PJOC 5CKDA 2CT4A 3H6ZA 3E19A 2ZPBB 1NZ9A 4E7HA 2LP5A 4M78D 3OSSC 2OTLQ 2MOXA 2VKNA 1VQ7T 2D6FA 4AFQC 2KRMA 4FSXA 2AK5A 2FPEA 3G71T 1Q86U 2CH4A 2VASA 3CCVQ 2DF6A 5IXFA 3FJPA 4PJLA 3EHQA 5HK0A 5FROA 3URGA 1PWTA 5GAOq 2J7IA 3Q1JA 4JJBA 2DVJA 2LQWA 3JAME 5DY9A 1M1KC 4J9FA 1KFZA 2A08A 1Q7YU 2Y4XA 1R0CB 4A54A 4DBHA 2JMAA 4LNPA 3BDLA 2HBPA 2V1QA 5A0LA 3P8HA 1ARKA 4IUUA 4OB2B 1XOVA 2A7YA 2LCCA 2O01E 5GAN5 2E6NA 4EMHA 1W1FA 1NM7A 3HKSA 3QIIA 2JW4A 4C0ZA 4E7LA 3I35A 1VQ9Q 2DILA 5C6SA 1AEYA 2FZCB 1X27A 9ATCB 3OSVA 1N5ZA 2X35A 1OOTA 2YHTA 3UWNA 1HK9A 3M0SA 1YCSB 1R77A 3TSWA 3JCMV 4M77D 1ZX6A 2KK4A 3REBB 2M0OA 1A0NB 2XICA 3M0PA 2FPFA 2CREA 2EYQA 3P8BB 4C92C 3OYJA 3M0UA 4C8QE 5KYYB 2RHYA 2PU9B 3QWXX 4OB3B 2E65A 4RG8A 3QSUA 1K9MR 1RAHB 3OS5A 2EQJA 1MHNA 5KYWB 2XDDA 1K8AU 2LRQA 3VYGA 3QJYA 2NUPA 4OP0A 3CCEA 4C8QB 3TU4K 1ZBXA 1ZUYA 1JEGA 2KMTA 3CCUA 1G2BA 1QCFA 3JB9G 2DRKA 2M16A 1M2VA 3OW2S 3FLGA 1UGRB 1YNZA 3G7ZA 1E6HA 1ZLMA 1AWWA 4OGEA 2DXTA 3UA7A 2CSIA 2FPDA 3V8JA 5CKHA 3G6EQ 3H41A 4LE9A 1TUCA 4IKFA 1XTDA 1IXDA 2LNHB 5GAOn 2DETA 1G83A 2EJ9A 2XMFA 1VQOA 3CCET 2EGCA 4KBMB 1PM3A 2C0OA 5I22A 5KYUA 3CCUT 1NEBA 5A2QE 2DTHA 4HCCA 1IHWA 3QG1A 3OYIA 2LCLA 3EGXA 2DL7A 2OAWA 1U5SA 1PD1A 2F2XA 2HL3A 3GLXA 3OMCA 3RDVA 1YJNA 1W4SA 4DEYA 1GL5A 1OPKA 2LJ1A 1S1NA 3P8DA 2MWOA 5LJ5g 1ZBJA 1GFCA 4IUTA 1UECA 3OYLA 3A8HB 3JCMX 3X28B 5LJ3f 1X75C 5GANf 2ATCB 2EPDA 1QVFA 1VYUA 5I11A 2VB6A 3UF4A 3EFSA 2D8JA 2WSEE 2CZ7B 4EPCA 1SRMA 3JCMP 1VUBA 2CDTA 4RTZA 3CD6Q 3ZL7C 4CRIA 2V8IA 4C0GA 5EC7A 4ELZC 1N27A 1YJNT 2AT1B 3CMAQ 3QBYA 1I81A 4VUBA 4A4EA 3KFVA 3EG1A 5LJ3h 1BCOA 5GANh 5GJVB 4GY5A 5CKBA 1UDLA 2EGAA 1YI2Q 2CZ1B 3OW2A 2KR3A 2L3SA 2LVMA 3R6OA 4M78E 3MP6A 4J9BA 1VIFA 3CBMA 1K73R 1B7TA 2DO3A 1B3QA 4OMOA 3OB9A 2QTVA 1VQ7Q 2ENMA 3PTAA 4AG2C 4F7UE 3G71Q 2FL7A 2GFUA 1KD1R 3FJ5A 4HT9A 4M78B 1T3LA 3PIOA 4OB0B 2MPXC 1K1ZA 2RQUA 3BW1A 2C0IA 2CT3A 1JB0E 2W10A 1OULA 3PIPA 2RK1A 1WXTA 4PJJA 3FC3A 4C5HA 1M1GA 2COYA 5IHNA 3UT1A 2A37A 4CC4B 4QVCA 4D8DA 3L2ZA 3PFSA 1M30A 2EVRA 1K0SA 3CCRT 1RAFB 3A8GB 2X4XA 5GAMd 3M58A 4QQDA 1LPLA 2QEXT 1JJ2A 2P4TA 4IIOA 3RERA 2QQRA 1G3TA 2RM4A 1KSWA 3QYHB 2YUOA 2ROTA 2CZ0B 4PKCC 2J6OA 4M77E 4LDVA 2DK3A 1XNIA 2RNAA 1TG0A 5KYXB 3I55Q 3CCQA 3LX7A 2NLUA 2ED1A 3L2UA 5J26A 1OU8A 1U8RA 3C95A 1KC8R 4M7AD 1Y07A 4M77B 4XTWA 3OYEA 1N9SA 1VIEA 3C4SA 1JRIA 2KGTA 3X26B 4A4HA 4C8QG 2DIGA 1TSFA 2OTLT 3OW2P 2K9GA 3UDCA 3DKMA 2LCSA 1UHFA 2P4RA 3GNFB 1TH7A 1ZSZB 4MZTA 1JQQA 1RAEB 4HXJA 2YXYA 1PCXA 4OMPA 2CSQA 1VQ9A 2E4HA 5DM7R 2BUDA 5HK3A 3CCJA 2X3WD 4OMLA 1OQKA 2DZCA 1RACB 3CCQT 1VQ6A 1M90R 2VGNA 3M4GA 3OYHA 1D1BA 4PJNA 2M1HA 1NYGA 3IQLA 4M7DE 4AFZC 4PJOD 1ZHIA 3MEVA 2JNGA 2NUTB 3TQ7P 2ZCFB 1MMGA 4AG1C 2RHIA 1AZGB 1M3AA 3RBBB 3LWIA 2P0QA 4M7AA 4FM4B 4XU1A 4OVAA 1UG1A 1QWEA 5I2SA 3MO8A 1O9SA 5L23A 4RKUE 1Q82C 3CCEQ 1VQ9T 1BK2A 2RN8A 5LJ3g 5GANg 3LH5A 2ESWA 3OA6A 3CCJT 3CCUQ 1K9AA 4FSSA 4Z89A 2X51A 3OBWA 4EMGA 1VQ6T 4II1A 1WHGA 1UE9A 1I0CA 1IHVA 2RI3A 5FLXE 4ZNXA 2O31A 3GPLA 4KT0E 2DAQA 5CQXA 4CI0C 4BDZA 2WSCE 1BI1A 2JMCA 4KUIA 4PNOA 1WA7A 2PVDB 3QZ9B 1Z9ZA 2JOYA 4PJOA 2JUFA 3EFOB 3V8KA 4BB7A 1H8KA 2E64A 1PG5B 2Y90A 3EGDA 3RMQA 1VQOQ 2LX7A 3FB9A 2QXFA 5GANj 1FMVA 1KQSA 2O4XA 1D09B 2DX1A 4OMQA 4XAXB 1BI0A 4J6YA 4Y28E 3VS2A 1VQLA 1WX6A 2X4JA 2K2MA 3CEYA 4QKUA 2MIOA 1F1BB 3OS2A 4PFOA 4FYWB 1YJNQ 2JJ9A 2DLPA 3HFNA 4C92D 2QDLA 1Q86R 1X01A 3JCMW 1VOMA 4QVDA 1PRLC 3QZ5B 3VS6A 3DB4A 4ZGEB 4QQGA 2B8AA 1YCYA 4A53A 2W0ZA 2YWWA 2K79A 3CPWS 5GAN7 2DEUA 2GNCA 2RO0A 4M78G 4LN2A 2E12A 1IRXA 4JZ4A 4FL6A 1FYNA 3GF5A 4YTLA 1Y96A 3JRZA 1Q7YR 4F7UF 1VQLT 2HEQA 3E9FA 1VQ4A 5GMKm 4F7UG 4MZPA 1FX7A 2YLCA 4F17A 2KT1A 2DYIA 3QPHA 1TU0B 2HDAA 4KH1B 3GOXA 4J9HA 4FYVB 1EZZB 2XG8D 2BTTA 1SG5A 2HD0A 3EG9B 1RLPC 4B6MA 1D0YA 2XHCA 2EQIA 3LGLA 2KRNA 3CCSQ 2QQBA 2CP3A 2RHZA 3M54A 4DBQA 2PVGB 1B34B 5HKCA 5CK9A 3DLLA 3LW5E 2GBQA 1WHMA 2CP6A 5GAOl 4D8KA 3GP8A 1VQ4T 2MK5A 3HHTB 4RTVA 4LDWA 2IIMA 2QI2A 4Q5WA 3VRZA 4JRKA 5IHIA 1Q81U 2DXCA 3OYMA 2QGGA 1BI3A 5D6XA 1Y0MA 2D9TA 3L2RA 4V2SA 5FWCA 1XJWB 1WJSA 4M77G 5GAOr 1K8AR 4M75F 5LJ5f 3MPUB 1W70A 4IUVA 2V8KA 2DTIA 1FWZA 3FDRA 4P5NA 2DA9A 1D0XA 4E7KA 4AT1B 3PMTA 1I8FA 5GAMf 1OYXA 4BI4A 4M7AB 3CCMA 2NUZA 3OYBA 2QQ9A 2COWA 1YJWA 2VYTA 5LJ5h 3SDZA 4J9DA 4AFSC 5C0MA 3CC4Q 2GTOA 1N8RU 3H0IA 4RUGA 2DE0X 3A8LB 4RG2A 2L5QA 2KNBB 3JCMb 3CCQQ 3WVDB 3BDUA 4JRPA 3V7SA 3X25B 2KQWA 3I55A 5GAOp 1OZ2A 5GAMh 1JXOA 2QA4A 4M7DF 2EGEA 4Y91A 4M7DG 5IH2A 2XI9A 2VGMA 3VJPA 3FEOA 3CMEA 2K57A 2JT4A 1VQ5A 4PFZA 4XTYA 1K9MC 4OF1A 4PJOB 4N4GA 1H92A 1BBZA 2CP7A 3VUZA 1PC0A 1WNLA 3VRYA 1YJWT 1PKSA 2RJDA 3VS3A 4LD9K 3CCJQ 4ELYC 1AHJB 4XK8E 1M5Q1 1VQ6Q 1AWXA 4J83A 4E7IA 3NMZC 3I55T 1WQ7A 2RQRA 1U1TA 2QA4T 4C0FA 3JCMJ 1YJ9A 3A98A 1KHIA 2EW3A 2VXFA 3CMET 3A8OB 2YSQA 1UTIA 4E7ZA 4BD3A 2JM9A 3AT1B 2DRMA 2O2OA 4F7UA 3VUBA 2BZYA 3M59A 2FG0A 5GAN8 5EG2A 3EGUA 1T0HA 3F70A 2X4WA 2JS2A 5IT9E 3JB9F 3CPWP 3E9GA 2DL4A 4C92E 2KE9A 1NPRA 1IREB 1Y57A 3SHWA 1YJ9T 2J6FA 1AWOA 4LDXA 3J7AF 2EKHA 4JJNK 2HQEA 3NTKA 3DLMA 4OMNA 1KK7A 1MUZA 1W2BS 2E6ZA 3M0QA 2A0FB 2KEAA 2DZ9A 4C92B 3VU3C 1QQJA 4PFPA 3V7CA 1NJIU 3S3OA 1UJ0A 1UGQB 2JTEA 2MWPA 2MAMA 2FZGB 3EHRA 3VS1A 2YRDA 1K0XA 4XTUA 1VQLQ 3C94A 3OYCA 3U23A 1D3BA 2K6DA 4M75A 1E7OA 1PNJA 2JN0A 3N5BB 5FRNA 4KH0B 4WCIA 3NFCA 4E7JA 2OAUA 3M56A 5GMKh 3SWNA 1UFFA 3DB3A 1IGQA 4L59A 4QVZA 2QASA 4X9CA 5FU7C 1WGSA 2J06A 2K3BA 3C0CA 2VXEA 4JRIA 1K73C 3L2QA 2PUKB 1M2OA 1VQOT 5FRMA 2QYZA 4LDUA 2EAYA 2R57A 2EYYA 1N6AA 1O75A 3TEEA 5IN1A 1VQ4Q 1WXUA 5GAMg 2DL3A 1NLOC 3BFMA 2E41A 2DKGA 1GFDA 2KT8A 4J6WA 1JXMA 5ECAA 4M7DA 4QT7A 4IUPA 1M1FA 4J9IA 3OYKA 4FT4A 2CKKA 2RPNA 1M1KU 1KHCA 1V29B 5LJ5j 2RD1A 1GRIA 1FMKA 2GQVA 2X3XD 3EH1A 4KRTA 2B86A 3JCMf 2IG0A 3CCSA 1EIFA 3V8LA 2F2VA 3OYAA 2BE7D 4R56A 5GMKe 3L2VA 4L5GA 3FRNA 4JLIA 3KUFA 1JU5C 3WVEB 2RJCA 2AZVA 3ZBDA 4B9WA 3ULRB 2L0AA 2GF7A 2XDBA 1MMNA 2I0NA 1RAIB 1QCOA 2L3PA 2ZGWA 5FW9A 3BY7A 4RTWA 1KG1A 1SKUB 3JCMh 5A0DA 2QAZA 4ZGJB 2PQWA 4J9EA 3JB9J 2OX7A 1G3WA 3CCST 2FZKB 1KC8C 2DJZA 2GGRA 3EG2A 3VS4A 3INZA 3PE0A 1ABOA 2CYZB 2RI5A 3RR6A 2CGHA 4JPBW 3H8ZA 3CC2A 1AVZC 4E7SA 5GANe 5LJ3e 3CCMQ 1D1CA 1WHJA 3O5ZA 3L1AA 4DBFA 4EMKA 1RI0A 4JZ3A 1YJWQ 2L8DA 2RHXA 2QTXA 1VQPA 2AZSA 1VA7A 2NUPB 4M75C 1VQKA 4ZGDB 2JTFA 4NL2A 4PL6A 4J8OA 1W6XA 3RKXA 1M90C 3CC4A 1M9SA 2GCXA 2OTJA 1UGPB 4FU6A 4WF2A 1QKXA 3QJ6A 2PVOB 2NWMA 3RMSA 2DERA 3SWNC 1M8MA 4KGXB 2QA4Q 1HXDA 1M2VB 1VQMQ 2P84A 2J05A 4DQ2A 3OYYA 2Z0WA 3CMEQ 4C8QF 1VQ5Q 3E1SA 3CC2T 3OBYA 2F69A 4MMKA 2NYSA 1NE8A 2BZ8A 3L42A 1S72A 2K4YA 1VQPT 2ZPIB 1PSFA 2HBWA 3CQTA 4JS5A 4RTTA 4Z8AA 1VQKT 1M27C 2QGFB 3CC4T 1W2BP 4IURA 2OTJT 1NBEB 3OS0A 5KYUB 2DXUA 4TVRA 1P92A 2K5IA 4XTXA 5I2MA 5CAIA 1BIAA 3M0TA 4M7DC 1BU1A 4JUVA 2HL5C 1TWBA 3I5RA 1YJ9Q 1QMCA 3MCAB 3EGXB 4C92G 1IO6A 1Y7XA 3OMGA 4J7IA 3CPFA 1UHCA 2F1LA 2V1RA 2ZPGB 1SSHA 1NPPA 4BI8B 4E2FB 3SEMA 2DFUA 4J7FA 3LGFA 4BY6B 4HVWA 2F5KA 5GAN2 4C5EA 2G6FX 5GMKj 3JCMQ 2EJFA 1X6OA 3UPUA 4R0KA 2SRCA 5CIUA 4F04B 4OMFB 4AFUC 2M0YA 5KCOA 3QDRB 1C6VX 4C0DC 1B07A 1ZQ1A 4J5YA 2EBPA 4DEXA 3R6NA 5HY6A 1Q86C 4RCBA 1SHGA 3A5ZB 1T0JA 2CS7A 2RH2A 2JVVA 1ABQA 4LXCA 1Q81R 1YWPA 2SEMA 2L3QA 2AIRB 4ZN3A 2D0QB 5FU6C 3JCMg 2ZPEB 2AKKA 2H3EB 1UJYA 1WHLA 5LJ3j 5GAN6 2A36A 4N4IA 3NGPA 2KSSA 3OQ5A 4EMKC 4M4ZA 1Q7YC 4RTXA 4F16A 1X43A 3OYDA 2RA2A 3I56Q 5CKEA 1SF9A 1QP3A 2RHUA 4HKEA 4X9DA 2EYWA 1GBQA 3KBGA 3PGGA 3CXCS 2GTJA 4J6XA 4N4HA 2PTKA 2A3LA 2X9HA 1AD5A 1WHKA 4J9GA 1YFNA 2MMPA 1SEMA 1WXBA 4NOYA 3UA6A 4C5GA 2C06A 2ZPFB 4M78F 1N8RR 4ESRA 4F14A 1MNDA 2KI7A 2F2WA 5L8RE 1JO8A 1IZ6A 1QVGS 1LOJA 1CSKA 1OI1A 5KYYA 1KJWA 1WIEA 2FVUA 1WI7A 3RIRA 1QP2A 2ECZA 3M0RA 4A63B 2P0PA 5KYWA 2KYBA 4BUGA 1X2KA 3ER0A 5GANd 2VC8A 3E2UA 4WTOB 2KROA 2FHDA 2EIFA 3VKIA 1K8AC 4C8QA 4GBQA 3G4SQ 1RAGB 3HRSA 2LNVA 3WXMB 3EH2A 4E47A 2KY9A 1OX8A 4FYYB 3OY9A 4K11A 2KVQG 4EDUA 1EFNA 3M9QA 2A28A 4HVUA 3S3MA 2QK0A 4JDSA 4Z02A 2OJ2A 5KE2A 3LLRA 5IHKA 3VS0A 1UEBA 2EJGA 2X4YA 3MEAA 1YHQA 3HL8A 3EG0A 4M77F 2XK0A 2MF2A 2E3IA 4FYXB 3V7RA 2M02A 3A1PA 1AOJA 3D7SB 1WFWA 4KGVB 1QVPA 2KBTA 4M7AE 4MZMA 2RI2A 1IGUA 5IAYA 5D6YA 2E70A 3A8MB 4XQ3A 1HJDA 2HQHA 3QHSA 1WLPB 4CC2A 1GBRA 3ZEHA 3PVLA 1RADB 3PMIA 1WPYA 3CC2Q 2DD5A 5GAN4 2JS0A 2HAXA 1MV0B 3ME9A 1KIKA 4JJDA 3CPWA 1Q82U 3NTIA 2DIQA 1VQPQ 2EWNA 2LC4A 1YHQT 1U06A 1VQKQ 2QQAA 2OTJQ 1C0MA 1RL2A 1SPKA 1X6GA 3QKJA 3J81E 4ZTJA 2FRWA 2YT6A 1ACMB 5FWBA 1NJIR 2EYXA 4E6RA 4PJOE 1YP5A 3M55A 3ZFJA 2E3HA 2JXBA 3MJXA 2LMJA 2LQ8A 3KXTA 1VQMA 3SB2A 1BKBA 4A4FA 2K7AA 3PNWC 2CUBA 1MNEA 4HCZA 4XU0A 3CCMT 2AKLA 1S72Q 1TUGB 1GCQC 1VYVA 4L6V5 3EGDB 1HD3A 3HFOA 2QQSA 2LQNA 2MYSA 3OS1A 2HMAA 2YRCA 7AT1B 2K5FA 2O4XB 4IUQA 3PVQA 1LCKA 3O8VA 1YWOA 3I9QA 1OEBA 2VUBA 2C0TA 2FRYA 2ZZDA 4C8QC 1PKTA 3GBQA 4M78A 1Q95G 2L3RA 1VQMT 5LJ5e 1YITA 2D8HA 2L2PA 4RMOA 5CQYA 1VQ5T 2XU8A 3I5SA 8AT1B 2BZXA 1HYOA 1LVKA 4HT8A 1M3CA 3JB9H 2LT1A 3CXCP 3RESA 2E1HA 3M4YA 3MHXA 5GAMe 3VYHB 1SHFA 1G3YA 4ORZA 2K3XA 2WACA 1M1KR 5KE3A 3RUXA 4X1VA 4M75D 3JB9I 1AZEA 1QVFS 4O6JA 1Y96B 2BIVA 4IIMA 1I5LA 3OYFA 1OU9A 2E5QA 4FCYA 1RI9A 2KRSA 1QVGP 3QXEB 2H8HA 1OV3A 3H0FA 2CZ6B 2FYKA 1JBMA 1PHTA 1WJQA 5D6WA 1YITT 1C1AA 1VQ8A 4LUDA 5KYXA 1T3SA 2KXCA 2QDYB 1RLQC 1E6GA 2ZAEA 2HQXA 3PT9A 4RTYA 2MI6A 3M57A 5DLOA 4J9CA 4D6WA 2YRVA 1GXIE 4M77A 4JLGA 1J3TA 1K76A 1U1SA 2RMOA 4PLIA 3JCMc 5HCKA 4MDXA 4M7DD 2E5KA 6AT1B 4LDYA 2AHJB 2K2VA 2DL8A 3I56A 4RCCA 4C5IA 2LX9A 1ZSZA 2H3JA 5KYNA 2JZ2A 4KUDK 1BIBA 5KH6A 1VQNA 2DBMA 3TCJA 2JM8A 1ZSGA 3LH0A 3QDFA 3L2WA 1VQ8T 5GMKl 2VV5A 3TVTA 3MP8A 2D0NA 1TOVA 1FXXA 2KXDA 3CC7Q 1YIJQ 2V26A 2HSEB 2G3RA 2EQUA 3H0HA 4GLMA 2RK2A 4JJCA 5A0GA 1OZ3A 2NUTA 2YUNA 1PSEA 1BYMA 1KD1C 3I56T 2MCNA 1I5OB 1JJ2S 3EFRA 5GMKi 1VQNT 3X24B 3G1JA 3QYGB 4HCKA 3OYNA 3BE3A 4OMMA 2IVWA 2HKQB 3MP1A 2VWFA 4M78C 2BKDN 4M7AF 4PK4A 1PD0A 2OI3A 3G4SA 3QUIA 4M7AG 3VS5A 3CCLQ 3NHNA 2RJEA 3RNJA 1IB8A 4ZN1A 1X69A 5FU7B 3GNGA 3JB9D 2LT4A 1K9MU 1CKAA 2PUOB 4XTVA 4QW2A 1WJRA 1I1JA 2XDPA 5GAMj 2XIDA 1W2BA 2M9UA 4XU2A 5D7UA 2I2LA 3VV0A 3EFOA 2O9SA 3ASKA 4CC3A 1QWFA 2EYZA 1YHQQ 2EFIA 2RB6A 3HTRA 4HVVA 2CP2A 2GFAA 5CO7A 4JS4A 3CCRA 5J39A 2YLBA 2LZ6B 4PJOF 3G4ST 3X20B 8ATCB 2QEXA 4OB1B 1QLYA 3EAEA 5CVIA 2KAFA 1RUWA 4PJOG 1G8XA 2HSPA 4BDYA 4JRQA 4FT2A 2DMOA 1X6BA 4LUEA 3NTHA 2LDMA 2R5MA 2L89A 2Y4YA 1AWJA 5LJ5d 4AMCA 4F7UB 1NEGA 1TS9A 4M77C 2RQWA 5IXBA 5GAOm 1X2QA 3JV3A 2HCKA 1H641 2LJ0A 1MGQA 1ZSZC 4A4KA 3RKWA 1Z9QA 1ZA1B 1DJ7B 1BB9A 2OTLA 4ANJA 1UGSB
chains in the Genus database with same CATH topology
3H0IA 1YN8A 4RUGA 2GTJA 2DE0X 2KNBB 2PTKA 1AD5A 1TUDA 1VYTA 2DL7A 2D1XA 4J9GA 2OAWA 1U5SA 1SEMA 2F2XA 1WXBA 1UUEA 1JXOA 3UA6A 3EG3A 4DEYA 2KYMA 1GL5A 2EGEA 4ESRA 4F14A 1OPKA 2F2WA 2LJ1A 5IH2A 1S1NA 1JO8A 2JT4A 1PRMC 2ABLA 1HSQA 1CSKA 1ZBJA 1GFCA 2GQIA 1KJWA 1WIEA 1WI7A 1UECA 1H92A 1BBZA 2ECZA 4Y92A 2RF0A 3M0RA 1CKBA 3VRYA 2DNUA 4A63B 2EPDA 1PKSA 2ED0A 1VYUA 5I11A 3UF4A 3VS3A 1NYFA 2KYBA 1X2KA 2D8JA 3QWYA 2KROA 1SRMA 1AWXA 2CDTA 4RTZA 4EIKA 2DJQA 3ZL7C 3NMZC 4GBQA 5EC7A 2RQRA 1H3HA 3A98A 2EW3A 2PZ1A 2RQTA 3KFVA 3EG1A 4K11A 1I07A 2YSQA 1UTIA 5GJVB 2JM9A 2O9VA 2DYBA 1UDLA 2EGAA 1EFNA 3TSZA 2DRMA 2A28A 4HVUA 2O2OA 2KR3A 2L3SA 2BZYA 2DM1A 2FG0A 4J9BA 2CH4W 2OJ2A 1K4US 5IHKA 1NLPC 3VS0A 3EGUA 1B3QA 2FO0A 4OMOA 2YUPA 1M3BA 1T0HA 1V1CA 2YUQA 2ENMA 3EG0A 2JS2A 4AG2C 3REAB 1U3OA 1WYXA 2DL4A 3FJ5A 1AOJA 1T3LA 2O88A 1SRLA 1K1ZA 1Y57A 1WFWA 2KE9A 2RQUA 3SHWA 2KBTA 2C0IA 2CT3A 2J6FA 1AWOA 2W10A 1HJDA 1WXTA 1WLPB 4CC2A 2EKHA 1GBRA 3PVLA 5IHNA 2A37A 4OMNA 4CC4B 1MUZA 3M0QA 4D8DA 2JS0A 2KEAA 1MV0B 1M30A 2VVKA 1KIKA 4JJDA 2EVRA 1K0SA 1UJ0A 2JTEA 2ROLA 2RQVA 3EHRA 1U06A 3VS1A 4IIOA 3NPFA 1K0XA 1SPKA 1X6GA 1GCPA 3U23A 1KSWA 2FRWA 2K6DA 1E7OA 2YUOA 2ROTA 2YT6A 5FWBA 1PNJA 2EYXA 2LJ3A 4E6RA 1YP5A 4WCIA 2J6OA 4CC7A 2JXBA 2M51A 2LMJA 2RNAA 1TG0A 1UFFA 2K7AA 2ED1A 2CUBA 2J06A 2K3BA 3C0CA 1GCQA 2AKLA 2YDLA 1WDXA 1GCQC 1VYVA 2KGTA 1HD3A 2LQNA 2EYYA 2K9GA 2LCSA 3UATA 1UHFA 1MV3A 1WXUA 2P4RA 2DL3A 3PVQA 1LCKA 1NLOC 1YWOA 1JQQA 4HXJA 3I9QA 4OMPA 1OEBA 1GFDA 2CSQA 3VS7A 2C0TA 2FRYA 2KT8A 1JXMA 5ECAA 1PKTA 4QT7A 3GBQA 2X3WD 4OMLA 4J9IA 2J6KA 2D8HA 2RPNA 2DBKA 2L2PA 3I5SA 1GRIA 1FMKA 2X3XD 2BZXA 4KRTA 2B86A 1M3CA 1NYGA 3IQLA 5GJWB 4AFZC 2F2VA 1SHFA 1QKWA 4ORZA 4AG1C 1AZGB 1M3AA 2CUDA 3RBBB 1JU5C 4X1VA 1UG1A 1AZEA 1QWEA 2AZVA 5L23A 3ULRB 2L0AA 4IIMA 1OPLA 1BK2A 2I0NA 2RN8A 3LH5A 2ESWA 2L3PA 5FW9A 1RI9A 2KRSA 4RTWA 1K9AA 2H8HA 4FSSA 1OV3A 3H0FA 4Z89A 1PHTA 1NG2A 1UE9A 1I0CA 4RTUA 4J9EA 4ZNXA 2DL5A 2O31A 2PNIA 4LUDA 1T3SA 1UGVA 2KXCA 2FEIA 2GGRA 3EG2A 1RLQC 2JMCA 3VS4A 1E6GA 3PE0A 1ABOA 4RTYA 1ZUUA 1WA7A 1Z9ZA 4J9CA 4Z88A 4JPBW 3THKA 1AVZC 1H8KA 1ZUKA 1J3TA 2CT4A 3O5ZA 1K76A 2LX7A 2RMOA 5HCKA 2E5KA 4JZ3A 2LP5A 2DL8A 2MOXA 2VKNA 2AZSA 1VA7A 4AFQC 2KRMA 2DX1A 4OMQA 2AK5A 2FPEA 3VS2A 2CH4A 2DBMA 1W6XA 2JM8A 1WX6A 1ZSGA 2DF6A 5IXFA 1QKXA 2K2MA 2NWMA 3EHQA 3TVTA 2D0NA 2MIOA 1M8MA 1PWTA 2KXDA 2J7IA 2DLPA 2J05A 3H0HA 2QDLA 4JJBA 2DVJA 2LQWA 4GLMA 1PRLC 4J9FA 3VS6A 1KFZA 2A08A 4JJCA 2W0ZA 2K79A 2YUNA 2BZ8A 2GNCA 2JMAA 4LNPA 2V1QA 4LN2A 2MCNA 3CQTA 2HBWA 1ARKA 4JZ4A 4RTTA 1XOVA 4Z8AA 1FYNA 1M27C 1W1FA 1NM7A 2HEQA 4HCKA 2JW4A 4OMMA 3I35A 3M0TA 2DILA 1BU1A 2VWFA 4F17A 2KT1A 3I5RA 1AEYA 1X27A 2OI3A 2HDAA 1N5ZA 1IO6A 4J9HA 1OOTA 3VS5A 3NHNA 3M0SA 1YCSB 2BTTA 1UHCA 2V1RA 3TSWA 1SSHA 3RNJA 1X69A 1RLPC 1ZX6A 3SEMA 3REBB 1CKAA 1A0NB 2EQIA 4HVWA 2KRNA 1I1JA 3M0PA 2FPFA 2CREA 2G6FX 3M0UA 2O9SA 2SRCA 4R0KA 4CC3A 3QWXX 1QWFA 2GBQA 2EYZA 4AFUC 2M0YA 4HVVA 4D8KA 4RTVA 1B07A 2IIMA 2EBPA 4DEXA 3VRZA 5IHIA 3R6NA 2LZ6B 1Y0MA 5FWCA 1QLYA 1ZUYA 1JEGA 1RUWA 1G2BA 1QCFA 1SHGA 1T0JA 2HSPA 2DRKA 2DMOA 1X6BA 4LUEA 1ABQA 1YWPA 2SEMA 2L3QA 1YNZA 1W70A 1E6HA 1ZLMA 1AWWA 1AWJA 1NEGA 2RQWA 2DA9A 2AKKA 1UJYA 3UA7A 2CSIA 2FPDA 5IXBA 1X2QA 2A36A 3JV3A 3H41A 3NGPA 4LE9A 2HCKA 4M4ZA 1TUCA 4RTXA 2LNHB 4F16A 1X43A 1G83A 2LJ0A 2NUZA 2XMFA 2EGCA 2C0OA 5I22A 1Z9QA 4J9DA 2EYWA 1BB9A 1GBQA 1NEBA 2GTOA 4AFSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0I A;  1YN8 A;  4RUG A;  2GTJ A;  2DE0 X;  2KNB B;  2PTK A;  1AD5 A;  1TUD A;  1VYT A;  2DL7 A;  2D1X A;  4J9G A;  2OAW A;  1U5S A;  1SEM A;  2F2X A;  1WXB A;  1UUE A;  1JXO A;  3UA6 A;  3EG3 A;  4DEY A;  2KYM A;  1GL5 A;  2EGE A;  4ESR A;  4F14 A;  1OPK A;  2F2W A;  2LJ1 A;  5IH2 A;  1S1N A;  1JO8 A;  2JT4 A;  1PRM C;  2ABL A;  1HSQ A;  1CSK A;  1ZBJ A;  1GFC A;  2GQI A;  1KJW A;  1WIE A;  1WI7 A;  1UEC A;  1H92 A;  1BBZ A;  2ECZ A;  4Y92 A;  2RF0 A;  3M0R A;  1CKB A;  3VRY A;  2DNU A;  4A63 B;  2EPD A;  1PKS A;  2ED0 A;  1VYU A;  5I11 A;  3UF4 A;  3VS3 A;  1NYF A;  2KYB A;  1X2K A;  2D8J A;  3QWY A;  2KRO A;  1SRM A;  1AWX A;  2CDT A;  4RTZ A;  4EIK A;  2DJQ A;  3ZL7 C;  3NMZ C;  4GBQ A;  5EC7 A;  2RQR A;  1H3H A;  3A98 A;  2EW3 A;  2PZ1 A;  2RQT A;  3KFV A;  3EG1 A;  4K11 A;  1I07 A;  2YSQ A;  1UTI A;  5GJV B;  2JM9 A;  2O9V A;  2DYB A;  1UDL A;  2EGA A;  1EFN A;  3TSZ A;  2DRM A;  2A28 A;  4HVU A;  2O2O A;  2KR3 A;  2L3S A;  2BZY A;  2DM1 A;  2FG0 A;  4J9B A;  2CH4 W;  2OJ2 A;  1K4U S;  5IHK A;  1NLP C;  3VS0 A;  3EGU A;  1B3Q A;  2FO0 A;  4OMO A;  2YUP A;  1M3B A;  1T0H A;  1V1C A;  2YUQ A;  2ENM A;  3EG0 A;  2JS2 A;  4AG2 C;  3REA B;  1U3O A;  1WYX A;  2DL4 A;  3FJ5 A;  1AOJ A;  1T3L A;  2O88 A;  1SRL A;  1K1Z A;  1Y57 A;  1WFW A;  2KE9 A;  2RQU A;  3SHW A;  2KBT A;  2C0I A;  2CT3 A;  2J6F A;  1AWO A;  2W10 A;  1HJD A;  1WXT A;  1WLP B;  4CC2 A;  2EKH A;  1GBR A;  3PVL A;  5IHN A;  2A37 A;  4OMN A;  4CC4 B;  1MUZ A;  3M0Q A;  4D8D A;  2JS0 A;  2KEA A;  1MV0 B;  1M30 A;  2VVK A;  1KIK A;  4JJD A;  2EVR A;  1K0S A;  1UJ0 A;  2JTE A;  2ROL A;  2RQV A;  3EHR A;  1U06 A;  3VS1 A;  4IIO A;  3NPF A;  1K0X A;  1SPK A;  1X6G A;  1GCP A;  3U23 A;  1KSW A;  2FRW A;  2K6D A;  1E7O A;  2YUO A;  2ROT A;  2YT6 A;  5FWB A;  1PNJ A;  2EYX A;  2LJ3 A;  4E6R A;  1YP5 A;  4WCI A;  2J6O A;  4CC7 A;  2JXB A;  2M51 A;  2LMJ A;  2RNA A;  1TG0 A;  1UFF A;  2K7A A;  2ED1 A;  2CUB A;  2J06 A;  2K3B A;  3C0C A;  1GCQ A;  2AKL A;  2YDL A;  1WDX A;  1GCQ C;  1VYV A;  2KGT A;  1HD3 A;  2LQN A;  2EYY A;  2K9G A;  2LCS A;  3UAT A;  1UHF A;  1MV3 A;  1WXU A;  2P4R A;  2DL3 A;  3PVQ A;  1LCK A;  1NLO C;  1YWO A;  1JQQ A;  4HXJ A;  3I9Q A;  4OMP A;  1OEB A;  1GFD A;  2CSQ A;  3VS7 A;  2C0T A;  2FRY A;  2KT8 A;  1JXM A;  5ECA A;  1PKT A;  4QT7 A;  3GBQ A;  2X3W D;  4OML A;  4J9I A;  2J6K A;  2D8H A;  2RPN A;  2DBK A;  2L2P A;  3I5S A;  1GRI A;  1FMK A;  2X3X D;  2BZX A;  4KRT A;  2B86 A;  1M3C A;  1NYG A;  3IQL A;  5GJW B;  4AFZ C;  2F2V A;  1SHF A;  1QKW A;  4ORZ A;  4AG1 C;  1AZG B;  1M3A A;  2CUD A;  3RBB B;  1JU5 C;  4X1V A;  1UG1 A;  1AZE A;  1QWE A;  2AZV A;  5L23 A;  3ULR B;  2L0A A;  4IIM A;  1OPL A;  1BK2 A;  2I0N A;  2RN8 A;  3LH5 A;  2ESW A;  2L3P A;  5FW9 A;  1RI9 A;  2KRS A;  4RTW A;  1K9A A;  2H8H A;  4FSS A;  1OV3 A;  3H0F A;  4Z89 A;  1PHT A;  1NG2 A;  1UE9 A;  1I0C A;  4RTU A;  4J9E A;  4ZNX A;  2DL5 A;  2O31 A;  2PNI A;  4LUD A;  1T3S A;  1UGV A;  2KXC A;  2FEI A;  2GGR A;  3EG2 A;  1RLQ C;  2JMC A;  3VS4 A;  1E6G A;  3PE0 A;  1ABO A;  4RTY A;  1ZUU A;  1WA7 A;  1Z9Z A;  4J9C A;  4Z88 A;  4JPB W;  3THK A;  1AVZ C;  1H8K A;  1ZUK A;  1J3T A;  2CT4 A;  3O5Z A;  1K76 A;  2LX7 A;  2RMO A;  5HCK A;  2E5K A;  4JZ3 A;  2LP5 A;  2DL8 A;  2MOX A;  2VKN A;  2AZS A;  1VA7 A;  4AFQ C;  2KRM A;  2DX1 A;  4OMQ A;  2AK5 A;  2FPE A;  3VS2 A;  2CH4 A;  2DBM A;  1W6X A;  2JM8 A;  1WX6 A;  1ZSG A;  2DF6 A;  5IXF A;  1QKX A;  2K2M A;  2NWM A;  3EHQ A;  3TVT A;  2D0N A;  2MIO A;  1M8M A;  1PWT A;  2KXD A;  2J7I A;  2DLP A;  2J05 A;  3H0H A;  2QDL A;  4JJB A;  2DVJ A;  2LQW A;  4GLM A;  1PRL C;  4J9F A;  3VS6 A;  1KFZ A;  2A08 A;  4JJC A;  2W0Z A;  2K79 A;  2YUN A;  2BZ8 A;  2GNC A;  2JMA A;  4LNP A;  2V1Q A;  4LN2 A;  2MCN A;  3CQT A;  2HBW A;  1ARK A;  4JZ4 A;  4RTT A;  1XOV A;  4Z8A A;  1FYN A;  1M27 C;  1W1F A;  1NM7 A;  2HEQ A;  4HCK A;  2JW4 A;  4OMM A;  3I35 A;  3M0T A;  2DIL A;  1BU1 A;  2VWF A;  4F17 A;  2KT1 A;  3I5R A;  1AEY A;  1X27 A;  2OI3 A;  2HDA A;  1N5Z A;  1IO6 A;  4J9H A;  1OOT A;  3VS5 A;  3NHN A;  3M0S A;  1YCS B;  2BTT A;  1UHC A;  2V1R A;  3TSW A;  1SSH A;  3RNJ A;  1X69 A;  1RLP C;  1ZX6 A;  3SEM A;  3REB B;  1CKA A;  1A0N B;  2EQI A;  4HVW A;  2KRN A;  1I1J A;  3M0P A;  2FPF A;  2CRE A;  2G6F X;  3M0U A;  2O9S A;  2SRC A;  4R0K A;  4CC3 A;  3QWX X;  1QWF A;  2GBQ A;  2EYZ A;  4AFU C;  2M0Y A;  4HVV A;  4D8K A;  4RTV A;  1B07 A;  2IIM A;  2EBP A;  4DEX A;  3VRZ A;  5IHI A;  3R6N A;  2LZ6 B;  1Y0M A;  5FWC A;  1QLY A;  1ZUY A;  1JEG A;  1RUW A;  1G2B A;  1QCF A;  1SHG A;  1T0J A;  2HSP A;  2DRK A;  2DMO A;  1X6B A;  4LUE A;  1ABQ A;  1YWP A;  2SEM A;  2L3Q A;  1YNZ A;  1W70 A;  1E6H A;  1ZLM A;  1AWW A;  1AWJ A;  1NEG A;  2RQW A;  2DA9 A;  2AKK A;  1UJY A;  3UA7 A;  2CSI A;  2FPD A;  5IXB A;  1X2Q A;  2A36 A;  3JV3 A;  3H41 A;  3NGP A;  4LE9 A;  2HCK A;  4M4Z A;  1TUC A;  4RTX A;  2LNH B;  4F16 A;  1X43 A;  1G83 A;  2LJ0 A;  2NUZ A;  2XMF A;  2EGC A;  2C0O A;  5I22 A;  1Z9Q A;  4J9D A;  2EYW A;  1BB9 A;  1GBQ A;  1NEB A;  2GTO A;  4AFS C; 
#chains in the Genus database with same CATH topology
 1YN8 A;  3FIF A;  1RAA B;  1QVF P;  1TTH B;  4ME7 A;  1TUD A;  1VYT A;  5LL6 S;  3CCV A;  3JCM e;  4OGC A;  2D1X A;  1MMA A;  2HKN A;  1D1A A;  1UUE A;  3EG3 A;  3EG9 A;  4LD6 A;  4XTZ A;  2KYM A;  4BE1 A;  1G5V A;  4M75 E;  2ZPH B;  2DXB A;  4BY6 C;  1PRM C;  3M53 A;  2ABL A;  1HSQ A;  1R0B G;  2R5A A;  1B34 A;  2GQI A;  1EX4 A;  4KGZ B;  4Y92 A;  1KQ2 A;  2RF0 A;  1CKB A;  2DNU A;  1M8V A;  1KQS S;  5KCH A;  3LYI A;  2ED0 A;  3TRE A;  2DVE A;  1D3B B;  1NYF A;  3JSC A;  4C92 F;  4M75 B;  3GIB A;  1LJO A;  3QWY A;  1YIT Q;  1QW1 A;  2KDS A;  4BE0 A;  4EIK A;  3CCV T;  2DJQ A;  2DPP B;  1XQH A;  4NS5 A;  1Q81 C;  3SWN B;  1D0Z A;  4HA8 A;  1H3H A;  4FW1 A;  1BI2 A;  1K73 U;  2RQT A;  2PZ1 A;  4FW2 A;  1S72 T;  1I4K 1;  4PLL A;  1I07 A;  4N0A A;  3MEW A;  3AHU A;  4BE2 A;  1SSF A;  5CKF A;  2O9V A;  2DYB A;  2E10 A;  3TSZ A;  5GAN 3;  2DM1 A;  1KD1 U;  5I21 A;  1ZA2 B;  2CH4 W;  1K4U S;  1NLP C;  2FO0 A;  1AT1 B;  2YUP A;  1M3B A;  1V1C A;  2WSF E;  2YUQ A;  2LTO A;  3REA B;  1U3O A;  4M7D B;  1WYX A;  2CP5 A;  1TXQ A;  2HNI A;  1VQ8 Q;  2O88 A;  1SRL A;  1JJ2 P;  1V76 A;  1LNX A;  3QO3 A;  1N8R C;  3MEU A;  4MDW A;  2LQK A;  4DOW A;  5AYF A;  3S3N A;  2VVK A;  5AT1 B;  3MET A;  2ROL A;  2RQV A;  4XU3 A;  3G6E A;  4C8Q D;  4NL3 A;  4C0D B;  1QCN A;  1FMW A;  3NPF A;  1VQN Q;  2IPO B;  5J3B A;  4DOV A;  1BCM A;  1GCP A;  2R58 A;  2F5T X;  2FB7 A;  5CCA A;  1Q82 R;  2K3Y A;  2LJ3 A;  3S6W A;  3T9N A;  2XD0 A;  3HSB A;  2XKO C;  4CC7 A;  1KC8 U;  2CP0 A;  2M51 A;  2COZ A;  2EKO A;  3CBO A;  3CC7 A;  1YIJ A;  3RKY A;  2EQK A;  1M4Z A;  5FU6 B;  1GCQ A;  1H3Z A;  2YDL A;  1WDX A;  4ATO A;  3CBP A;  4BAC A;  4QQ6 A;  4PJM A;  3G6E T;  4DA4 A;  4EMK B;  2P0K A;  1YBY A;  4O5V A;  2K5L A;  3UAT A;  1MV3 A;  5LJ3 d;  1M90 U;  1G3S A;  3VS7 A;  5DLQ E;  2QG9 B;  2EQM A;  1Y71 A;  3CC7 T;  4R55 A;  1YIJ T;  3OYG A;  2J6K A;  1WQW A;  3CCL A;  3CD6 A;  2DBK A;  2BE9 B;  4DBR A;  4N0A C;  4MML A;  3CMA A;  5GJW B;  3MKD A;  4KUL A;  4BI3 A;  3JCM d;  1QKW A;  4C92 A;  1UB4 A;  3J80 E;  2CUD A;  3HPW A;  5CR2 A;  2DD4 A;  2V8J A;  3SD4 A;  1YI2 A;  4HCB A;  4X34 A;  3SFM A;  4M7A C;  1MMD A;  1RAB B;  4UC4 A;  3CCR Q;  2HZY A;  1NJI C;  1N9R A;  1OPL A;  4ZTF A;  3LWH A;  1R8O B;  2QEX Q;  2RJF A;  1KQ1 A;  4A4G A;  4FIB A;  1WHH A;  1VQ7 A;  3HRT A;  3CCL T;  3CD6 T;  3G71 A;  3CXC A;  1NG2 A;  3C12 A;  4RTU A;  1KQS P;  4B9X A;  2DEQ A;  5M9O A;  2DL5 A;  2PNI A;  2DTO A;  3CMA T;  1UGV A;  3H9N A;  3HP9 A;  2FEI A;  2JTM A;  1ZUU A;  1WZO A;  1YI2 T;  4Z88 A;  4M75 G;  3M5A A;  1OX9 A;  3THK A;  1ZUK A;  3HRU A;  1QVG A;  4GLK A;  4PJO C;  5CKD A;  2CT4 A;  3H6Z A;  3E19 A;  2ZPB B;  1NZ9 A;  4E7H A;  2LP5 A;  4M78 D;  3OSS C;  2OTL Q;  2MOX A;  2VKN A;  1VQ7 T;  2D6F A;  4AFQ C;  2KRM A;  4FSX A;  2AK5 A;  2FPE A;  3G71 T;  1Q86 U;  2CH4 A;  2VAS A;  3CCV Q;  2DF6 A;  5IXF A;  3FJP A;  4PJL A;  3EHQ A;  5HK0 A;  5FRO A;  3URG A;  1PWT A;  5GAO q;  2J7I A;  3Q1J A;  4JJB A;  2DVJ A;  2LQW A;  3JAM E;  5DY9 A;  1M1K C;  4J9F A;  1KFZ A;  2A08 A;  1Q7Y U;  2Y4X A;  1R0C B;  4A54 A;  4DBH A;  2JMA A;  4LNP A;  3BDL A;  2HBP A;  2V1Q A;  5A0L A;  3P8H A;  1ARK A;  4IUU A;  4OB2 B;  1XOV A;  2A7Y A;  2LCC A;  2O01 E;  5GAN 5;  2E6N A;  4EMH A;  1W1F A;  1NM7 A;  3HKS A;  3QII A;  2JW4 A;  4C0Z A;  4E7L A;  3I35 A;  1VQ9 Q;  2DIL A;  5C6S A;  1AEY A;  2FZC B;  1X27 A;  9ATC B;  3OSV A;  1N5Z A;  2X35 A;  1OOT A;  2YHT A;  3UWN A;  1HK9 A;  3M0S A;  1YCS B;  1R77 A;  3TSW A;  3JCM V;  4M77 D;  1ZX6 A;  2KK4 A;  3REB B;  2M0O A;  1A0N B;  2XIC A;  3M0P A;  2FPF A;  2CRE A;  2EYQ A;  3P8B B;  4C92 C;  3OYJ A;  3M0U A;  4C8Q E;  5KYY B;  2RHY A;  2PU9 B;  3QWX X;  4OB3 B;  2E65 A;  4RG8 A;  3QSU A;  1K9M R;  1RAH B;  3OS5 A;  2EQJ A;  1MHN A;  5KYW B;  2XDD A;  1K8A U;  2LRQ A;  3VYG A;  3QJY A;  2NUP A;  4OP0 A;  3CCE A;  4C8Q B;  3TU4 K;  1ZBX A;  1ZUY A;  1JEG A;  2KMT A;  3CCU A;  1G2B A;  1QCF A;  3JB9 G;  2DRK A;  2M16 A;  1M2V A;  3OW2 S;  3FLG A;  1UGR B;  1YNZ A;  3G7Z A;  1E6H A;  1ZLM A;  1AWW A;  4OGE A;  2DXT A;  3UA7 A;  2CSI A;  2FPD A;  3V8J A;  5CKH A;  3G6E Q;  3H41 A;  4LE9 A;  1TUC A;  4IKF A;  1XTD A;  1IXD A;  2LNH B;  5GAO n;  2DET A;  1G83 A;  2EJ9 A;  2XMF A;  1VQO A;  3CCE T;  2EGC A;  4KBM B;  1PM3 A;  2C0O A;  5I22 A;  5KYU A;  3CCU T;  1NEB A;  5A2Q E;  2DTH A;  4HCC A;  1IHW A;  3QG1 A;  3OYI A;  2LCL A;  3EGX A;  2DL7 A;  2OAW A;  1U5S A;  1PD1 A;  2F2X A;  2HL3 A;  3GLX A;  3OMC A;  3RDV A;  1YJN A;  1W4S A;  4DEY A;  1GL5 A;  1OPK A;  2LJ1 A;  1S1N A;  3P8D A;  2MWO A;  5LJ5 g;  1ZBJ A;  1GFC A;  4IUT A;  1UEC A;  3OYL A;  3A8H B;  3JCM X;  3X28 B;  5LJ3 f;  1X75 C;  5GAN f;  2ATC B;  2EPD A;  1QVF A;  1VYU A;  5I11 A;  2VB6 A;  3UF4 A;  3EFS A;  2D8J A;  2WSE E;  2CZ7 B;  4EPC A;  1SRM A;  3JCM P;  1VUB A;  2CDT A;  4RTZ A;  3CD6 Q;  3ZL7 C;  4CRI A;  2V8I A;  4C0G A;  5EC7 A;  4ELZ C;  1N27 A;  1YJN T;  2AT1 B;  3CMA Q;  3QBY A;  1I81 A;  4VUB A;  4A4E A;  3KFV A;  3EG1 A;  5LJ3 h;  1BCO A;  5GAN h;  5GJV B;  4GY5 A;  5CKB A;  1UDL A;  2EGA A;  1YI2 Q;  2CZ1 B;  3OW2 A;  2KR3 A;  2L3S A;  2LVM A;  3R6O A;  4M78 E;  3MP6 A;  4J9B A;  1VIF A;  3CBM A;  1K73 R;  1B7T A;  2DO3 A;  1B3Q A;  4OMO A;  3OB9 A;  2QTV A;  1VQ7 Q;  2ENM A;  3PTA A;  4AG2 C;  4F7U E;  3G71 Q;  2FL7 A;  2GFU A;  1KD1 R;  3FJ5 A;  4HT9 A;  4M78 B;  1T3L A;  3PIO A;  4OB0 B;  2MPX C;  1K1Z A;  2RQU A;  3BW1 A;  2C0I A;  2CT3 A;  1JB0 E;  2W10 A;  1OUL A;  3PIP A;  2RK1 A;  1WXT A;  4PJJ A;  3FC3 A;  4C5H A;  1M1G A;  2COY A;  5IHN A;  3UT1 A;  2A37 A;  4CC4 B;  4QVC A;  4D8D A;  3L2Z A;  3PFS A;  1M30 A;  2EVR A;  1K0S A;  3CCR T;  1RAF B;  3A8G B;  2X4X A;  5GAM d;  3M58 A;  4QQD A;  1LPL A;  2QEX T;  1JJ2 A;  2P4T A;  4IIO A;  3RER A;  2QQR A;  1G3T A;  2RM4 A;  1KSW A;  3QYH B;  2YUO A;  2ROT A;  2CZ0 B;  4PKC C;  2J6O A;  4M77 E;  4LDV A;  2DK3 A;  1XNI A;  2RNA A;  1TG0 A;  5KYX B;  3I55 Q;  3CCQ A;  3LX7 A;  2NLU A;  2ED1 A;  3L2U A;  5J26 A;  1OU8 A;  1U8R A;  3C95 A;  1KC8 R;  4M7A D;  1Y07 A;  4M77 B;  4XTW A;  3OYE A;  1N9S A;  1VIE A;  3C4S A;  1JRI A;  2KGT A;  3X26 B;  4A4H A;  4C8Q G;  2DIG A;  1TSF A;  2OTL T;  3OW2 P;  2K9G A;  3UDC A;  3DKM A;  2LCS A;  1UHF A;  2P4R A;  3GNF B;  1TH7 A;  1ZSZ B;  4MZT A;  1JQQ A;  1RAE B;  4HXJ A;  2YXY A;  1PCX A;  4OMP A;  2CSQ A;  1VQ9 A;  2E4H A;  5DM7 R;  2BUD A;  5HK3 A;  3CCJ A;  2X3W D;  4OML A;  1OQK A;  2DZC A;  1RAC B;  3CCQ T;  1VQ6 A;  1M90 R;  2VGN A;  3M4G A;  3OYH A;  1D1B A;  4PJN A;  2M1H A;  1NYG A;  3IQL A;  4M7D E;  4AFZ C;  4PJO D;  1ZHI A;  3MEV A;  2JNG A;  2NUT B;  3TQ7 P;  2ZCF B;  1MMG A;  4AG1 C;  2RHI A;  1AZG B;  1M3A A;  3RBB B;  3LWI A;  2P0Q A;  4M7A A;  4FM4 B;  4XU1 A;  4OVA A;  1UG1 A;  1QWE A;  5I2S A;  3MO8 A;  1O9S A;  5L23 A;  4RKU E;  1Q82 C;  3CCE Q;  1VQ9 T;  1BK2 A;  2RN8 A;  5LJ3 g;  5GAN g;  3LH5 A;  2ESW A;  3OA6 A;  3CCJ T;  3CCU Q;  1K9A A;  4FSS A;  4Z89 A;  2X51 A;  3OBW A;  4EMG A;  1VQ6 T;  4II1 A;  1WHG A;  1UE9 A;  1I0C A;  1IHV A;  2RI3 A;  5FLX E;  4ZNX A;  2O31 A;  3GPL A;  4KT0 E;  2DAQ A;  5CQX A;  4CI0 C;  4BDZ A;  2WSC E;  1BI1 A;  2JMC A;  4KUI A;  4PNO A;  1WA7 A;  2PVD B;  3QZ9 B;  1Z9Z A;  2JOY A;  4PJO A;  2JUF A;  3EFO B;  3V8K A;  4BB7 A;  1H8K A;  2E64 A;  1PG5 B;  2Y90 A;  3EGD A;  3RMQ A;  1VQO Q;  2LX7 A;  3FB9 A;  2QXF A;  5GAN j;  1FMV A;  1KQS A;  2O4X A;  1D09 B;  2DX1 A;  4OMQ A;  4XAX B;  1BI0 A;  4J6Y A;  4Y28 E;  3VS2 A;  1VQL A;  1WX6 A;  2X4J A;  2K2M A;  3CEY A;  4QKU A;  2MIO A;  1F1B B;  3OS2 A;  4PFO A;  4FYW B;  1YJN Q;  2JJ9 A;  2DLP A;  3HFN A;  4C92 D;  2QDL A;  1Q86 R;  1X01 A;  3JCM W;  1VOM A;  4QVD A;  1PRL C;  3QZ5 B;  3VS6 A;  3DB4 A;  4ZGE B;  4QQG A;  2B8A A;  1YCY A;  4A53 A;  2W0Z A;  2YWW A;  2K79 A;  3CPW S;  5GAN 7;  2DEU A;  2GNC A;  2RO0 A;  4M78 G;  4LN2 A;  2E12 A;  1IRX A;  4JZ4 A;  4FL6 A;  1FYN A;  3GF5 A;  4YTL A;  1Y96 A;  3JRZ A;  1Q7Y R;  4F7U F;  1VQL T;  2HEQ A;  3E9F A;  1VQ4 A;  5GMK m;  4F7U G;  4MZP A;  1FX7 A;  2YLC A;  4F17 A;  2KT1 A;  2DYI A;  3QPH A;  1TU0 B;  2HDA A;  4KH1 B;  3GOX A;  4J9H A;  4FYV B;  1EZZ B;  2XG8 D;  2BTT A;  1SG5 A;  2HD0 A;  3EG9 B;  1RLP C;  4B6M A;  1D0Y A;  2XHC A;  2EQI A;  3LGL A;  2KRN A;  3CCS Q;  2QQB A;  2CP3 A;  2RHZ A;  3M54 A;  4DBQ A;  2PVG B;  1B34 B;  5HKC A;  5CK9 A;  3DLL A;  3LW5 E;  2GBQ A;  1WHM A;  2CP6 A;  5GAO l;  4D8K A;  3GP8 A;  1VQ4 T;  2MK5 A;  3HHT B;  4RTV A;  4LDW A;  2IIM A;  2QI2 A;  4Q5W A;  3VRZ A;  4JRK A;  5IHI A;  1Q81 U;  2DXC A;  3OYM A;  2QGG A;  1BI3 A;  5D6X A;  1Y0M A;  2D9T A;  3L2R A;  4V2S A;  5FWC A;  1XJW B;  1WJS A;  4M77 G;  5GAO r;  1K8A R;  4M75 F;  5LJ5 f;  3MPU B;  1W70 A;  4IUV A;  2V8K A;  2DTI A;  1FWZ A;  3FDR A;  4P5N A;  2DA9 A;  1D0X A;  4E7K A;  4AT1 B;  3PMT A;  1I8F A;  5GAM f;  1OYX A;  4BI4 A;  4M7A B;  3CCM A;  2NUZ A;  3OYB A;  2QQ9 A;  2COW A;  1YJW A;  2VYT A;  5LJ5 h;  3SDZ A;  4J9D A;  4AFS C;  5C0M A;  3CC4 Q;  2GTO A;  1N8R U;  3H0I A;  4RUG A;  2DE0 X;  3A8L B;  4RG2 A;  2L5Q A;  2KNB B;  3JCM b;  3CCQ Q;  3WVD B;  3BDU A;  4JRP A;  3V7S A;  3X25 B;  2KQW A;  3I55 A;  5GAO p;  1OZ2 A;  5GAM h;  1JXO A;  2QA4 A;  4M7D F;  2EGE A;  4Y91 A;  4M7D G;  5IH2 A;  2XI9 A;  2VGM A;  3VJP A;  3FEO A;  3CME A;  2K57 A;  2JT4 A;  1VQ5 A;  4PFZ A;  4XTY A;  1K9M C;  4OF1 A;  4PJO B;  4N4G A;  1H92 A;  1BBZ A;  2CP7 A;  3VUZ A;  1PC0 A;  1WNL A;  3VRY A;  1YJW T;  1PKS A;  2RJD A;  3VS3 A;  4LD9 K;  3CCJ Q;  4ELY C;  1AHJ B;  4XK8 E;  1M5Q 1;  1VQ6 Q;  1AWX A;  4J83 A;  4E7I A;  3NMZ C;  3I55 T;  1WQ7 A;  2RQR A;  1U1T A;  2QA4 T;  4C0F A;  3JCM J;  1YJ9 A;  3A98 A;  1KHI A;  2EW3 A;  2VXF A;  3CME T;  3A8O B;  2YSQ A;  1UTI A;  4E7Z A;  4BD3 A;  2JM9 A;  3AT1 B;  2DRM A;  2O2O A;  4F7U A;  3VUB A;  2BZY A;  3M59 A;  2FG0 A;  5GAN 8;  5EG2 A;  3EGU A;  1T0H A;  3F70 A;  2X4W A;  2JS2 A;  5IT9 E;  3JB9 F;  3CPW P;  3E9G A;  2DL4 A;  4C92 E;  2KE9 A;  1NPR A;  1IRE B;  1Y57 A;  3SHW A;  1YJ9 T;  2J6F A;  1AWO A;  4LDX A;  3J7A F;  2EKH A;  4JJN K;  2HQE A;  3NTK A;  3DLM A;  4OMN A;  1KK7 A;  1MUZ A;  1W2B S;  2E6Z A;  3M0Q A;  2A0F B;  2KEA A;  2DZ9 A;  4C92 B;  3VU3 C;  1QQJ A;  4PFP A;  3V7C A;  1NJI U;  3S3O A;  1UJ0 A;  1UGQ B;  2JTE A;  2MWP A;  2MAM A;  2FZG B;  3EHR A;  3VS1 A;  2YRD A;  1K0X A;  4XTU A;  1VQL Q;  3C94 A;  3OYC A;  3U23 A;  1D3B A;  2K6D A;  4M75 A;  1E7O A;  1PNJ A;  2JN0 A;  3N5B B;  5FRN A;  4KH0 B;  4WCI A;  3NFC A;  4E7J A;  2OAU A;  3M56 A;  5GMK h;  3SWN A;  1UFF A;  3DB3 A;  1IGQ A;  4L59 A;  4QVZ A;  2QAS A;  4X9C A;  5FU7 C;  1WGS A;  2J06 A;  2K3B A;  3C0C A;  2VXE A;  4JRI A;  1K73 C;  3L2Q A;  2PUK B;  1M2O A;  1VQO T;  5FRM A;  2QYZ A;  4LDU A;  2EAY A;  2R57 A;  2EYY A;  1N6A A;  1O75 A;  3TEE A;  5IN1 A;  1VQ4 Q;  1WXU A;  5GAM g;  2DL3 A;  1NLO C;  3BFM A;  2E41 A;  2DKG A;  1GFD A;  2KT8 A;  4J6W A;  1JXM A;  5ECA A;  4M7D A;  4QT7 A;  4IUP A;  1M1F A;  4J9I A;  3OYK A;  4FT4 A;  2CKK A;  2RPN A;  1M1K U;  1KHC A;  1V29 B;  5LJ5 j;  2RD1 A;  1GRI A;  1FMK A;  2GQV A;  2X3X D;  3EH1 A;  4KRT A;  2B86 A;  3JCM f;  2IG0 A;  3CCS A;  1EIF A;  3V8L A;  2F2V A;  3OYA A;  2BE7 D;  4R56 A;  5GMK e;  3L2V A;  4L5G A;  3FRN A;  4JLI A;  3KUF A;  1JU5 C;  3WVE B;  2RJC A;  2AZV A;  3ZBD A;  4B9W A;  3ULR B;  2L0A A;  2GF7 A;  2XDB A;  1MMN A;  2I0N A;  1RAI B;  1QCO A;  2L3P A;  2ZGW A;  5FW9 A;  3BY7 A;  4RTW A;  1KG1 A;  1SKU B;  3JCM h;  5A0D A;  2QAZ A;  4ZGJ B;  2PQW A;  4J9E A;  3JB9 J;  2OX7 A;  1G3W A;  3CCS T;  2FZK B;  1KC8 C;  2DJZ A;  2GGR A;  3EG2 A;  3VS4 A;  3INZ A;  3PE0 A;  1ABO A;  2CYZ B;  2RI5 A;  3RR6 A;  2CGH A;  4JPB W;  3H8Z A;  3CC2 A;  1AVZ C;  4E7S A;  5GAN e;  5LJ3 e;  3CCM Q;  1D1C A;  1WHJ A;  3O5Z A;  3L1A A;  4DBF A;  4EMK A;  1RI0 A;  4JZ3 A;  1YJW Q;  2L8D A;  2RHX A;  2QTX A;  1VQP A;  2AZS A;  1VA7 A;  2NUP B;  4M75 C;  1VQK A;  4ZGD B;  2JTF A;  4NL2 A;  4PL6 A;  4J8O A;  1W6X A;  3RKX A;  1M90 C;  3CC4 A;  1M9S A;  2GCX A;  2OTJ A;  1UGP B;  4FU6 A;  4WF2 A;  1QKX A;  3QJ6 A;  2PVO B;  2NWM A;  3RMS A;  2DER A;  3SWN C;  1M8M A;  4KGX B;  2QA4 Q;  1HXD A;  1M2V B;  1VQM Q;  2P84 A;  2J05 A;  4DQ2 A;  3OYY A;  2Z0W A;  3CME Q;  4C8Q F;  1VQ5 Q;  3E1S A;  3CC2 T;  3OBY A;  2F69 A;  4MMK A;  2NYS A;  1NE8 A;  2BZ8 A;  3L42 A;  1S72 A;  2K4Y A;  1VQP T;  2ZPI B;  1PSF A;  2HBW A;  3CQT A;  4JS5 A;  4RTT A;  4Z8A A;  1VQK T;  1M27 C;  2QGF B;  3CC4 T;  1W2B P;  4IUR A;  2OTJ T;  1NBE B;  3OS0 A;  5KYU B;  2DXU A;  4TVR A;  1P92 A;  2K5I A;  4XTX A;  5I2M A;  5CAI A;  1BIA A;  3M0T A;  4M7D C;  1BU1 A;  4JUV A;  2HL5 C;  1TWB A;  3I5R A;  1YJ9 Q;  1QMC A;  3MCA B;  3EGX B;  4C92 G;  1IO6 A;  1Y7X A;  3OMG A;  4J7I A;  3CPF A;  1UHC A;  2F1L A;  2V1R A;  2ZPG B;  1SSH A;  1NPP A;  4BI8 B;  4E2F B;  3SEM A;  2DFU A;  4J7F A;  3LGF A;  4BY6 B;  4HVW A;  2F5K A;  5GAN 2;  4C5E A;  2G6F X;  5GMK j;  3JCM Q;  2EJF A;  1X6O A;  3UPU A;  4R0K A;  2SRC A;  5CIU A;  4F04 B;  4OMF B;  4AFU C;  2M0Y A;  5KCO A;  3QDR B;  1C6V X;  4C0D C;  1B07 A;  1ZQ1 A;  4J5Y A;  2EBP A;  4DEX A;  3R6N A;  5HY6 A;  1Q86 C;  4RCB A;  1SHG A;  3A5Z B;  1T0J A;  2CS7 A;  2RH2 A;  2JVV A;  1ABQ A;  4LXC A;  1Q81 R;  1YWP A;  2SEM A;  2L3Q A;  2AIR B;  4ZN3 A;  2D0Q B;  5FU6 C;  3JCM g;  2ZPE B;  2AKK A;  2H3E B;  1UJY A;  1WHL A;  5LJ3 j;  5GAN 6;  2A36 A;  4N4I A;  3NGP A;  2KSS A;  3OQ5 A;  4EMK C;  4M4Z A;  1Q7Y C;  4RTX A;  4F16 A;  1X43 A;  3OYD A;  2RA2 A;  3I56 Q;  5CKE A;  1SF9 A;  1QP3 A;  2RHU A;  4HKE A;  4X9D A;  2EYW A;  1GBQ A;  3KBG A;  3PGG A;  3CXC S;  2GTJ A;  4J6X A;  4N4H A;  2PTK A;  2A3L A;  2X9H A;  1AD5 A;  1WHK A;  4J9G A;  1YFN A;  2MMP A;  1SEM A;  1WXB A;  4NOY A;  3UA6 A;  4C5G A;  2C06 A;  2ZPF B;  4M78 F;  1N8R R;  4ESR A;  4F14 A;  1MND A;  2KI7 A;  2F2W A;  5L8R E;  1JO8 A;  1IZ6 A;  1QVG S;  1LOJ A;  1CSK A;  1OI1 A;  5KYY A;  1KJW A;  1WIE A;  2FVU A;  1WI7 A;  3RIR A;  1QP2 A;  2ECZ A;  3M0R A;  4A63 B;  2P0P A;  5KYW A;  2KYB A;  4BUG A;  1X2K A;  3ER0 A;  5GAN d;  2VC8 A;  3E2U A;  4WTO B;  2KRO A;  2FHD A;  2EIF A;  3VKI A;  1K8A C;  4C8Q A;  4GBQ A;  3G4S Q;  1RAG B;  3HRS A;  2LNV A;  3WXM B;  3EH2 A;  4E47 A;  2KY9 A;  1OX8 A;  4FYY B;  3OY9 A;  4K11 A;  2KVQ G;  4EDU A;  1EFN A;  3M9Q A;  2A28 A;  4HVU A;  3S3M A;  2QK0 A;  4JDS A;  4Z02 A;  2OJ2 A;  5KE2 A;  3LLR A;  5IHK A;  3VS0 A;  1UEB A;  2EJG A;  2X4Y A;  3MEA A;  1YHQ A;  3HL8 A;  3EG0 A;  4M77 F;  2XK0 A;  2MF2 A;  2E3I A;  4FYX B;  3V7R A;  2M02 A;  3A1P A;  1AOJ A;  3D7S B;  1WFW A;  4KGV B;  1QVP A;  2KBT A;  4M7A E;  4MZM A;  2RI2 A;  1IGU A;  5IAY A;  5D6Y A;  2E70 A;  3A8M B;  4XQ3 A;  1HJD A;  2HQH A;  3QHS A;  1WLP B;  4CC2 A;  1GBR A;  3ZEH A;  3PVL A;  1RAD B;  3PMI A;  1WPY A;  3CC2 Q;  2DD5 A;  5GAN 4;  2JS0 A;  2HAX A;  1MV0 B;  3ME9 A;  1KIK A;  4JJD A;  3CPW A;  1Q82 U;  3NTI A;  2DIQ A;  1VQP Q;  2EWN A;  2LC4 A;  1YHQ T;  1U06 A;  1VQK Q;  2QQA A;  2OTJ Q;  1C0M A;  1RL2 A;  1SPK A;  1X6G A;  3QKJ A;  3J81 E;  4ZTJ A;  2FRW A;  2YT6 A;  1ACM B;  5FWB A;  1NJI R;  2EYX A;  4E6R A;  4PJO E;  1YP5 A;  3M55 A;  3ZFJ A;  2E3H A;  2JXB A;  3MJX A;  2LMJ A;  2LQ8 A;  3KXT A;  1VQM A;  3SB2 A;  1BKB A;  4A4F A;  2K7A A;  3PNW C;  2CUB A;  1MNE A;  4HCZ A;  4XU0 A;  3CCM T;  2AKL A;  1S72 Q;  1TUG B;  1GCQ C;  1VYV A;  4L6V 5;  3EGD B;  1HD3 A;  3HFO A;  2QQS A;  2LQN A;  2MYS A;  3OS1 A;  2HMA A;  2YRC A;  7AT1 B;  2K5F A;  2O4X B;  4IUQ A;  3PVQ A;  1LCK A;  3O8V A;  1YWO A;  3I9Q A;  1OEB A;  2VUB A;  2C0T A;  2FRY A;  2ZZD A;  4C8Q C;  1PKT A;  3GBQ A;  4M78 A;  1Q95 G;  2L3R A;  1VQM T;  5LJ5 e;  1YIT A;  2D8H A;  2L2P A;  4RMO A;  5CQY A;  1VQ5 T;  2XU8 A;  3I5S A;  8AT1 B;  2BZX A;  1HYO A;  1LVK A;  4HT8 A;  1M3C A;  3JB9 H;  2LT1 A;  3CXC P;  3RES A;  2E1H A;  3M4Y A;  3MHX A;  5GAM e;  3VYH B;  1SHF A;  1G3Y A;  4ORZ A;  2K3X A;  2WAC A;  1M1K R;  5KE3 A;  3RUX A;  4X1V A;  4M75 D;  3JB9 I;  1AZE A;  1QVF S;  4O6J A;  1Y96 B;  2BIV A;  4IIM A;  1I5L A;  3OYF A;  1OU9 A;  2E5Q A;  4FCY A;  1RI9 A;  2KRS A;  1QVG P;  3QXE B;  2H8H A;  1OV3 A;  3H0F A;  2CZ6 B;  2FYK A;  1JBM A;  1PHT A;  1WJQ A;  5D6W A;  1YIT T;  1C1A A;  1VQ8 A;  4LUD A;  5KYX A;  1T3S A;  2KXC A;  2QDY B;  1RLQ C;  1E6G A;  2ZAE A;  2HQX A;  3PT9 A;  4RTY A;  2MI6 A;  3M57 A;  5DLO A;  4J9C A;  4D6W A;  2YRV A;  1GXI E;  4M77 A;  4JLG A;  1J3T A;  1K76 A;  1U1S A;  2RMO A;  4PLI A;  3JCM c;  5HCK A;  4MDX A;  4M7D D;  2E5K A;  6AT1 B;  4LDY A;  2AHJ B;  2K2V A;  2DL8 A;  3I56 A;  4RCC A;  4C5I A;  2LX9 A;  1ZSZ A;  2H3J A;  5KYN A;  2JZ2 A;  4KUD K;  1BIB A;  5KH6 A;  1VQN A;  2DBM A;  3TCJ A;  2JM8 A;  1ZSG A;  3LH0 A;  3QDF A;  3L2W A;  1VQ8 T;  5GMK l;  2VV5 A;  3TVT A;  3MP8 A;  2D0N A;  1TOV A;  1FXX A;  2KXD A;  3CC7 Q;  1YIJ Q;  2V26 A;  2HSE B;  2G3R A;  2EQU A;  3H0H A;  4GLM A;  2RK2 A;  4JJC A;  5A0G A;  1OZ3 A;  2NUT A;  2YUN A;  1PSE A;  1BYM A;  1KD1 C;  3I56 T;  2MCN A;  1I5O B;  1JJ2 S;  3EFR A;  5GMK i;  1VQN T;  3X24 B;  3G1J A;  3QYG B;  4HCK A;  3OYN A;  3BE3 A;  4OMM A;  2IVW A;  2HKQ B;  3MP1 A;  2VWF A;  4M78 C;  2BKD N;  4M7A F;  4PK4 A;  1PD0 A;  2OI3 A;  3G4S A;  3QUI A;  4M7A G;  3VS5 A;  3CCL Q;  3NHN A;  2RJE A;  3RNJ A;  1IB8 A;  4ZN1 A;  1X69 A;  5FU7 B;  3GNG A;  3JB9 D;  2LT4 A;  1K9M U;  1CKA A;  2PUO B;  4XTV A;  4QW2 A;  1WJR A;  1I1J A;  2XDP A;  5GAM j;  2XID A;  1W2B A;  2M9U A;  4XU2 A;  5D7U A;  2I2L A;  3VV0 A;  3EFO A;  2O9S A;  3ASK A;  4CC3 A;  1QWF A;  2EYZ A;  1YHQ Q;  2EFI A;  2RB6 A;  3HTR A;  4HVV A;  2CP2 A;  2GFA A;  5CO7 A;  4JS4 A;  3CCR A;  5J39 A;  2YLB A;  2LZ6 B;  4PJO F;  3G4S T;  3X20 B;  8ATC B;  2QEX A;  4OB1 B;  1QLY A;  3EAE A;  5CVI A;  2KAF A;  1RUW A;  4PJO G;  1G8X A;  2HSP A;  4BDY A;  4JRQ A;  4FT2 A;  2DMO A;  1X6B A;  4LUE A;  3NTH A;  2LDM A;  2R5M A;  2L89 A;  2Y4Y A;  1AWJ A;  5LJ5 d;  4AMC A;  4F7U B;  1NEG A;  1TS9 A;  4M77 C;  2RQW A;  5IXB A;  5GAO m;  1X2Q A;  3JV3 A;  2HCK A;  1H64 1;  2LJ0 A;  1MGQ A;  1ZSZ C;  4A4K A;  3RKW A;  1Z9Q A;  1ZA1 B;  1DJ7 B;  1BB9 A;  2OTL A;  4ANJ A;  1UGS B; 
#chains in the Genus database with same CATH homology
 3H0I A;  1YN8 A;  4RUG A;  2GTJ A;  2DE0 X;  2KNB B;  2PTK A;  1AD5 A;  1TUD A;  1VYT A;  2DL7 A;  2D1X A;  4J9G A;  2OAW A;  1U5S A;  1SEM A;  2F2X A;  1WXB A;  1UUE A;  1JXO A;  3UA6 A;  3EG3 A;  4DEY A;  2KYM A;  1GL5 A;  2EGE A;  4ESR A;  4F14 A;  1OPK A;  2F2W A;  2LJ1 A;  5IH2 A;  1S1N A;  1JO8 A;  2JT4 A;  1PRM C;  2ABL A;  1HSQ A;  1CSK A;  1ZBJ A;  1GFC A;  2GQI A;  1KJW A;  1WIE A;  1WI7 A;  1UEC A;  1H92 A;  1BBZ A;  2ECZ A;  4Y92 A;  2RF0 A;  3M0R A;  1CKB A;  3VRY A;  2DNU A;  4A63 B;  2EPD A;  1PKS A;  2ED0 A;  1VYU A;  5I11 A;  3UF4 A;  3VS3 A;  1NYF A;  2KYB A;  1X2K A;  2D8J A;  3QWY A;  2KRO A;  1SRM A;  1AWX A;  2CDT A;  4RTZ A;  4EIK A;  2DJQ A;  3ZL7 C;  3NMZ C;  4GBQ A;  5EC7 A;  2RQR A;  1H3H A;  3A98 A;  2EW3 A;  2PZ1 A;  2RQT A;  3KFV A;  3EG1 A;  4K11 A;  1I07 A;  2YSQ A;  1UTI A;  5GJV B;  2JM9 A;  2O9V A;  2DYB A;  1UDL A;  2EGA A;  1EFN A;  3TSZ A;  2DRM A;  2A28 A;  4HVU A;  2O2O A;  2KR3 A;  2L3S A;  2BZY A;  2DM1 A;  2FG0 A;  4J9B A;  2CH4 W;  2OJ2 A;  1K4U S;  5IHK A;  1NLP C;  3VS0 A;  3EGU A;  1B3Q A;  2FO0 A;  4OMO A;  2YUP A;  1M3B A;  1T0H A;  1V1C A;  2YUQ A;  2ENM A;  3EG0 A;  2JS2 A;  4AG2 C;  3REA B;  1U3O A;  1WYX A;  2DL4 A;  3FJ5 A;  1AOJ A;  1T3L A;  2O88 A;  1SRL A;  1K1Z A;  1Y57 A;  1WFW A;  2KE9 A;  2RQU A;  3SHW A;  2KBT A;  2C0I A;  2CT3 A;  2J6F A;  1AWO A;  2W10 A;  1HJD A;  1WXT A;  1WLP B;  4CC2 A;  2EKH A;  1GBR A;  3PVL A;  5IHN A;  2A37 A;  4OMN A;  4CC4 B;  1MUZ A;  3M0Q A;  4D8D A;  2JS0 A;  2KEA A;  1MV0 B;  1M30 A;  2VVK A;  1KIK A;  4JJD A;  2EVR A;  1K0S A;  1UJ0 A;  2JTE A;  2ROL A;  2RQV A;  3EHR A;  1U06 A;  3VS1 A;  4IIO A;  3NPF A;  1K0X A;  1SPK A;  1X6G A;  1GCP A;  3U23 A;  1KSW A;  2FRW A;  2K6D A;  1E7O A;  2YUO A;  2ROT A;  2YT6 A;  5FWB A;  1PNJ A;  2EYX A;  2LJ3 A;  4E6R A;  1YP5 A;  4WCI A;  2J6O A;  4CC7 A;  2JXB A;  2M51 A;  2LMJ A;  2RNA A;  1TG0 A;  1UFF A;  2K7A A;  2ED1 A;  2CUB A;  2J06 A;  2K3B A;  3C0C A;  1GCQ A;  2AKL A;  2YDL A;  1WDX A;  1GCQ C;  1VYV A;  2KGT A;  1HD3 A;  2LQN A;  2EYY A;  2K9G A;  2LCS A;  3UAT A;  1UHF A;  1MV3 A;  1WXU A;  2P4R A;  2DL3 A;  3PVQ A;  1LCK A;  1NLO C;  1YWO A;  1JQQ A;  4HXJ A;  3I9Q A;  4OMP A;  1OEB A;  1GFD A;  2CSQ A;  3VS7 A;  2C0T A;  2FRY A;  2KT8 A;  1JXM A;  5ECA A;  1PKT A;  4QT7 A;  3GBQ A;  2X3W D;  4OML A;  4J9I A;  2J6K A;  2D8H A;  2RPN A;  2DBK A;  2L2P A;  3I5S A;  1GRI A;  1FMK A;  2X3X D;  2BZX A;  4KRT A;  2B86 A;  1M3C A;  1NYG A;  3IQL A;  5GJW B;  4AFZ C;  2F2V A;  1SHF A;  1QKW A;  4ORZ A;  4AG1 C;  1AZG B;  1M3A A;  2CUD A;  3RBB B;  1JU5 C;  4X1V A;  1UG1 A;  1AZE A;  1QWE A;  2AZV A;  5L23 A;  3ULR B;  2L0A A;  4IIM A;  1OPL A;  1BK2 A;  2I0N A;  2RN8 A;  3LH5 A;  2ESW A;  2L3P A;  5FW9 A;  1RI9 A;  2KRS A;  4RTW A;  1K9A A;  2H8H A;  4FSS A;  1OV3 A;  3H0F A;  4Z89 A;  1PHT A;  1NG2 A;  1UE9 A;  1I0C A;  4RTU A;  4J9E A;  4ZNX A;  2DL5 A;  2O31 A;  2PNI A;  4LUD A;  1T3S A;  1UGV A;  2KXC A;  2FEI A;  2GGR A;  3EG2 A;  1RLQ C;  2JMC A;  3VS4 A;  1E6G A;  3PE0 A;  1ABO A;  4RTY A;  1ZUU A;  1WA7 A;  1Z9Z A;  4J9C A;  4Z88 A;  4JPB W;  3THK A;  1AVZ C;  1H8K A;  1ZUK A;  1J3T A;  2CT4 A;  3O5Z A;  1K76 A;  2LX7 A;  2RMO A;  5HCK A;  2E5K A;  4JZ3 A;  2LP5 A;  2DL8 A;  2MOX A;  2VKN A;  2AZS A;  1VA7 A;  4AFQ C;  2KRM A;  2DX1 A;  4OMQ A;  2AK5 A;  2FPE A;  3VS2 A;  2CH4 A;  2DBM A;  1W6X A;  2JM8 A;  1WX6 A;  1ZSG A;  2DF6 A;  5IXF A;  1QKX A;  2K2M A;  2NWM A;  3EHQ A;  3TVT A;  2D0N A;  2MIO A;  1M8M A;  1PWT A;  2KXD A;  2J7I A;  2DLP A;  2J05 A;  3H0H A;  2QDL A;  4JJB A;  2DVJ A;  2LQW A;  4GLM A;  1PRL C;  4J9F A;  3VS6 A;  1KFZ A;  2A08 A;  4JJC A;  2W0Z A;  2K79 A;  2YUN A;  2BZ8 A;  2GNC A;  2JMA A;  4LNP A;  2V1Q A;  4LN2 A;  2MCN A;  3CQT A;  2HBW A;  1ARK A;  4JZ4 A;  4RTT A;  1XOV A;  4Z8A A;  1FYN A;  1M27 C;  1W1F A;  1NM7 A;  2HEQ A;  4HCK A;  2JW4 A;  4OMM A;  3I35 A;  3M0T A;  2DIL A;  1BU1 A;  2VWF A;  4F17 A;  2KT1 A;  3I5R A;  1AEY A;  1X27 A;  2OI3 A;  2HDA A;  1N5Z A;  1IO6 A;  4J9H A;  1OOT A;  3VS5 A;  3NHN A;  3M0S A;  1YCS B;  2BTT A;  1UHC A;  2V1R A;  3TSW A;  1SSH A;  3RNJ A;  1X69 A;  1RLP C;  1ZX6 A;  3SEM A;  3REB B;  1CKA A;  1A0N B;  2EQI A;  4HVW A;  2KRN A;  1I1J A;  3M0P A;  2FPF A;  2CRE A;  2G6F X;  3M0U A;  2O9S A;  2SRC A;  4R0K A;  4CC3 A;  3QWX X;  1QWF A;  2GBQ A;  2EYZ A;  4AFU C;  2M0Y A;  4HVV A;  4D8K A;  4RTV A;  1B07 A;  2IIM A;  2EBP A;  4DEX A;  3VRZ A;  5IHI A;  3R6N A;  2LZ6 B;  1Y0M A;  5FWC A;  1QLY A;  1ZUY A;  1JEG A;  1RUW A;  1G2B A;  1QCF A;  1SHG A;  1T0J A;  2HSP A;  2DRK A;  2DMO A;  1X6B A;  4LUE A;  1ABQ A;  1YWP A;  2SEM A;  2L3Q A;  1YNZ A;  1W70 A;  1E6H A;  1ZLM A;  1AWW A;  1AWJ A;  1NEG A;  2RQW A;  2DA9 A;  2AKK A;  1UJY A;  3UA7 A;  2CSI A;  2FPD A;  5IXB A;  1X2Q A;  2A36 A;  3JV3 A;  3H41 A;  3NGP A;  4LE9 A;  2HCK A;  4M4Z A;  1TUC A;  4RTX A;  2LNH B;  4F16 A;  1X43 A;  1G83 A;  2LJ0 A;  2NUZ A;  2XMF A;  2EGC A;  2C0O A;  5I22 A;  1Z9Q A;  4J9D A;  2EYW A;  1BB9 A;  1GBQ A;  1NEB A;  2GTO A;  4AFS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...