1SEMA

Structural determinants of peptide-binding orientation and of sequence specificity in sh3 domains
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEM-5
publication title Structural determinants of peptide-binding orientation and of sequence specificity in SH3 domains.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signal transduction protein
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1semA00
4AFZC 1M8MA 3REAB 2VKNA 2CREA 2DYBA 2HDAA 3TSZA 2E5KA 4RTVA 2PZ1A 3QWXX 4Z88A 1K4US 1GBRA 1RUWA 1NLOC 2GTOA 4LE9A 1ABQA 3EGUA 5FWBA 4F14A 1UFFA 2DJQA 4IIMA 3VS0A 2OI3A 3EHQA 1V1CA 2CT4A 1AVZC 2DNUA 3SEMA 3THKA 1WI7A 1KSWA 1OV3A 2LNHB 1NEBA 2L3QA 2ECZA 3GBQA 1RLPC 1UDLA 3NPFA 3PE0A 1NYFA 2EYXA 4GBQA 3UA7A 2GNCA 1GL5A 1BBZA 2HBWA 2O2OA 4RTYA 3UATA 2LX7A 2JS2A 2CDTA 1I0CA 1MV0B 2QDLA 1ABOA 2L2PA 4HVVA 4Z8AA 1WIEA 2DLPA 1B07A 1HSQA 1AWOA 3I9QA 4DEXA 1AEYA 4D8DA 1W1FA 2RNAA 1OPKA 2SRCA 2JW4A 2X3WD 2VWFA 1M30A 3ZL7C 1QCFA 2D1XA 1ARKA 3I5SA 2YUPA 2B86A 2K6DA 2HCKA 4EIKA 1ZLMA 1Z9ZA 2ED1A 3H0FA 2EQIA 1K0XA 2JXBA 2KEAA 1ZBJA 2W0ZA 1ZUKA 4RUGA 4F17A 2LJ1A 3M0SA 1N5ZA 2GTJA 1PHTA 1QLYA 3VS7A 4LN2A 1IO6A 4OMNA 1WXBA 2KROA 2NUZA 2LCSA 4X1VA 3NHNA 2YUOA 1T0HA 1GCQA 2ED0A 2KXDA 2DRMA 2CUBA 2VVKA 5ECAA 2CT3A 2RMOA 2C0IA 3RBBB 1SSHA 2RPNA 1ZUYA 1EFNA 4OMMA 1E6HA 5IHNA 2JT4A 1YNZA 2CH4A 4J9HA 3UA6A 2RQTA 2DL4A 2CSQA 2EPDA 2H8HA 2FRYA 4OMLA 1WX6A 4ORZA 2K2MA 2KE9A 2GBQA 1UJ0A 1SRLA 2FEIA 3UF4A 2KRSA 4LNPA 3M0QA 4CC4B 1JQQA 1VYVA 1PKSA 5FW9A 2JM8A 3VS4A 2O88A 2RQUA 2LJ3A 2F2VA 3REBB 1AZGB 1S1NA 1AOJA 2DVJA 5GJWB 4HXJA 2A28A 1JO8A 2C0TA 2EW3A 2EYZA 2DF6A 2EBPA 2DBKA 5HCKA 1X6GA 1G2BA 2AKKA 1UJYA 1K76A 1HJDA 4J9FA 2XMFA 1GCPA 2MIOA 1SPKA 1W70A 2KT8A 3H0IA 4Z89A 1A0NB 2ESWA 2P4RA 3M0PA 1WXUA 1X69A 1JU5C 4CC3A 3ULRB 3M0UA 4FSSA 2G6FX 1VA7A 2RQVA 1AD5A 3O5ZA 1E6GA 2J6FA 4OMQA 1RI9A 3VS1A 2YSQA 1YWOA 1KJWA 1SRMA 4HVWA 1Y0MA 1PWTA 3LH5A 1YWPA 1U3OA 2CH4W 2DA9A 1UGVA 4OMPA 1SHFA 2ROTA 1GRIA 4Y92A 5IHIA 4J9DA 1YN8A 2CSIA 2JS0A 2CUDA 1BB9A 1HD3A 1SHGA 1UTIA 2D0NA 4KRTA 4JPBW 1X2KA 4JZ3A 3VS2A 4J9EA 1CKBA 2MOXA 2YDLA 3VRYA 4JZ4A 2LZ6B 1CSKA 4LUDA 3VRZA 5EC7A 2RQRA 3PVQA 1U06A 2AZSA 2AK5A 1H3HA 4RTXA 4K11A 2EYWA 2YUQA 3KFVA 1TUCA 2L3SA 1JXOA 2M51A 2V1QA 1X27A 1RLQC 2EYYA 2HEQA 1OOTA 2EVRA 2LMJA 2BTTA 2LP5A 2DL8A 5I11A 1WXTA 2F2WA 4CC2A 2KRNA 1UG1A 1UUEA 2J7IA 1I07A 1UHCA 1PRLC 1X43A 4ZNXA 4E6RA 2O31A 5IHKA 1YCSB 1B3QA 2FG0A 1ZX6A 1AWJA 2DX1A 1XOVA 1BU1A 2DL7A 1WYXA 2EKHA 2EGEA 1E7OA 2M0YA 2DE0X 1J3TA 1KFZA 2KYMA 3VS5A 2F2XA 3IQLA 2FPDA 2A37A 2FRWA 1U5SA 2RN8A 2D8JA 1GFDA 1NG2A 2K9GA 1AWXA 1PKTA 2ABLA 1GBQA 2BZ8A 2KYBA 2KRMA 1MV3A 2DMOA 2FO0A 3TSWA 1LCKA 2OAWA 2ROLA 4J9CA 4JJDA 1H92A 2J06A 2KXCA 3M0TA 5IH2A 4DEYA 3NGPA 4HCKA 1GFCA 2SEMA 1QKXA 3EG3A 2A36A 3I5RA 1JXMA 2W10A 2LQWA 4JJBA 2KGTA 4IIOA 3FJ5A 2HSPA 5L23A 3EG0A 4ESRA 4RTUA 1OPLA 1UE9A 3I35A 2K7AA 3QWYA 1NYGA 2FPFA 1OEBA 1QWFA 1QKWA 2IIMA 1I1JA 1T0JA 2FPEA 1TG0A 2PNIA 1AZEA 2JMAA 3JV3A 3VS3A 4AFQC 1WA7A 2AZVA 1Z9QA 3M0RA 2ENMA 1W6XA 3RNJA 1GCQC 3CQTA 4OMOA 4RTZA 2YT6A 2DILA 2MCNA 2DBMA 4RTTA 1M3BA 2K79A 2A08A 1PRMC 1VYTA 2RF0A 1K1ZA 2AKLA 2YUNA 4AFSC 5I22A 2I0NA 1FMKA 2L0AA 2DRKA 1KIKA 2DL5A 4R0KA 2O9SA 1G83A 1WLPB 4AG2C 3A98A 1T3LA 4JJCA 2O9VA 1X6BA 2KR3A 3EHRA 2L3PA 2LJ0A 4J9GA 1M3AA 1NLPC 1Y57A 2JM9A 1UHFA 3NMZC 5GJVB 2GGRA 1M27C 2X3XD 3TVTA 3C0CA 4LUEA 4A63B 1H8KA 2GQIA 5FWCA 5IXBA 2KNBB 2LQNA 4AFUC 1K0SA 4J9IA 1WDXA 4CC7A 2KT1A 4QT7A 2PTKA 1X2QA 1JEGA 1NM7A 5IXFA 3R6NA 4F16A 2EGCA 2J6OA 1CKAA 3H41A 3H0HA 2C0OA 1MUZA 2J05A 2BZYA 4D8KA 3U23A 1PNJA 1AWWA 4AG1C 4HVUA 3SHWA 2KBTA 2EGAA 3EG1A 4M4ZA 1VYUA 2J6KA 1T3SA 1ZUUA 2K3BA 2JMCA 1FYNA 2OJ2A 2NWMA 1SEMA 4WCIA 2D8HA 4J9BA 1WFWA 1NEGA 2BZXA 3EG2A 1QWEA 2V1RA 1M3CA 1K9AA 4GLMA 1TUDA 3PVLA 4RTWA 1ZSGA 1BK2A 2DL3A 2RQWA 2JTEA 1UECA 2DM1A 1YP5A 3VS6A
chains in the Genus database with same CATH superfamily
1G3YA 1M8MA 3REAB 3OS0A 2A0FB 2E5KA 4RTVA 2LX9A 4XAXB 5I2MA 3S3NA 4HCZA 1GBRA 1EX4A 2KMTA 1G3TA 1NLOC 3CC4T 4EMGA 1IXDA 4ELYC 1MNDA 5IAYA 2LQKA 4B9WA 3EHQA 4MZPA 2CT4A 3PNWC 4ME7A 4J6WA 3THKA 2WSFE 1MHNA 5LJ5g 1NEBA 2HAXA 1RLPC 4IKFA 1NYFA 5KYXA 3I56Q 3A5ZB 2DTHA 5HK3A 1YITT 2HBWA 1K9MU 1R0CB 5J39A 2CDTA 2YLBA 4ELZC 4HVVA 4Z8AA 2P0QA 2DLPA 2CZ1B 4UC4A 3I9QA 2X4JA 1AEYA 2V26A 4D8DA 3MEAA 3KBGA 4R56A 2SRCA 1M30A 3I5SA 2DD5A 3MCAB 4EIKA 3CXCA 4A4EA 1JJ2A 3PFSA 2EAYA 4A4GA 3QDRB 2X51A 1YFNA 3QZ5B 3JRZA 4MDXA 4M7AG 2LJ1A 1Y96A 1N5ZA 4E7LA 4DBHA 1QLYA 4XQ3A 1VQ4T 3EFOA 4EMKA 1IO6A 3RR6A 2DETA 1UGQB 1BI3A 1QCNA 1YJNT 4M7DD 4PKCC 3CD6Q 3FJPA 1UGSB 2YUOA 1VQPA 2CUBA 2YRCA 4C8QB 4IUVA 1U8RA 2C0IA 3OSSC 3CCVQ 4C92D 3CC4A 1YI2A 1TUGB 5FU7C 4ZGDB 3LH0A 1VQOQ 2RQTA 2DL4A 2H8HA 2FRYA 3CC2Q 2JTMA 3VUBA 2KE9A 1Y07A 4LDVA 2P84A 3QJ6A 3MHXA 3C94A 5EG2A 5LJ5e 1YITA 2YXYA 3NTHA 1VYVA 2PUOB 3F70A 2D6FA 1YJ9T 2RQUA 2JVVA 2NUTB 3REBB 2Z0WA 2DVJA 4C92B 2HD0A 5IN1A 3HRTA 1BIAA 1N8RR 1YIJQ 4ZGEB 3FEOA 2BUDA 4N4GA 2EBPA 2RB6A 2O4XB 2DBKA 2R5AA 3OB9A 4F7UE 2L5QA 1M1KC 4IUUA 2KT8A 1VQ8Q 4A53A 2VASA 3H0IA 1Q86U 3JCMP 3URGA 4ZTJA 3UPUA 1WXUA 4KH1B 4CC3A 4RKUE 4FSSA 3MP8A 1YJNA 2RJEA 3OYLA 3G6ET 5DM7R 3OW2P 1RAGB 4OMQA 1RI9A 1LOJA 1YWOA 1OZ3A 1PWTA 2K3YA 5J3BA 1U3OA 2QEXQ 1M8VA 3BE3A 4OMPA 4NL3A 1RL2A 1BCMA 1KD1U 1RAFB 3LWIA 2KSSA 4J9DA 3CCJA 5LJ5f 4KRTA 2CUDA 1SHGA 1UTIA 2D0NA 2K4YA 2QK0A 2EJ9A 3QIIA 3A8HB 4XTUA 4LXCA 4JZ3A 4C5IA 2Y90A 1HK9A 4KH0B 2P4TA 4LUDA 2OTJT 2DPPB 5EC7A 2RQRA 5CK9A 1WHMA 2AK5A 4YTLA 4N0AA 1H3HA 3OYYA 2EYWA 4FT2A 1D1BA 1ACMB 3JSCA 4ZGJB 2LDMA 4ZN3A 3JB9H 3I55T 3QDFA 3CMAQ 2L3SA 1JXOA 2V1QA 3J7AF 1RLQC 3OYJA 2DAQA 2K5IA 2YRVA 1NZ9A 2EYYA 1OOTA 2LMJA 4XTVA 1QVFA 2K3XA 2LRQA 3L2QA 1WXTA 1VQ7Q 1OZ2A 3RIRA 4CC2A 3MO8A 2KRNA 4EMHA 1PRLC 2IG0A 2E6ZA 2KQWA 1WJRA 2ZCFB 4E2FB 3QUIA 3V8KA 1XOVA 3ER0A 1WYXA 2K5LA 1E7OA 4OB3B 2M0YA 1VQNA 3VS5A 2F2XA 1KC8R 5FU6B 2FPDA 4ZTFA 2A37A 2FRWA 1U5SA 2D8JA 3TQ7P 2C06A 3RKWA 1VQKQ 2KYBA 1QVGA 4J9CA 2MK5A 1LNXA 3L42A 4LDUA 4HCKA 2W10A 4EPCA 4BD3A 2VGNA 2KGTA 4IIOA 2CZ0B 2QQSA 3GPLA 1PD0A 3FJ5A 4ESRA 2AT1B 3CCUT 4E7ZA 1OPLA 3JB9F 5KCHA 2XDDA 1VQ5T 1OEBA 3OYEA 2OTJA 2FPEA 1TG0A 2PNIA 4EMKC 1RADB 2JMAA 1V29B 4BY6C 2YHTA 1Q82C 4AFQC 3I56T 5CR2A 4PJOD 4ZN1A 3I55A 3LGFA 4KGVB 2QA4T 2MCNA 1RAHB 5KYWA 3GF5A 1M3BA 2A08A 2CP5A 1VYTA 2E3IA 2YUNA 5I22A 3G4SA 2L0AA 1P92A 3M56A 1OU9A 3E9FA 1G83A 4WF2A 3RDVA 4AG2C 3A98A 2O9VA 3SFMA 4N4HA 3EGXB 1X01A 3EHRA 2LJ0A 4J9GA 3ZFJA 4M78F 2FZGB 1K9MR 1U1SA 1NPPA 4C8QA 1AT1B 3H9NA 4PJOB 2HMAA 2RHIA 1YCYA 2GQIA 1YBYA 5GAN4 1I4K1 4J9IA 2DZ9A 3EFRA 4DOVA 1PD1A 4QT7A 1ZSZB 2PTKA 3CCRQ 3CCVT 5CIUA 3R6NA 4KGZB 4F16A 2MF2A 4J7IA 3H41A 9ATCB 5KYUB 1WGSA 4JRIA 1MUZA 3CC2T 2QAZA 3OA6A 3RERA 2E41A 2NUTA 4D8KA 4PJJA 1K73C 1W2BA 2K5FA 1C6VX 4HVUA 1BYMA 4L6V5 4C92A 5KE2A 2ZGWA 2EGAA 5CQXA 3I56A 1XNIA 1T3SA 4HT9A 2E4HA 2O01E 3OMGA 2O4XA 4F7UA 2DIQA 1SEMA 2JNGA 3OYIA 3GP8A 2ATCB 4J7FA 2DXUA 2BZXA 2MAMA 1M3CA 1TUDA 1ZSGA 2RQWA 4BI3A 2JTEA 3A8MB 2KVQG 1YP5A 1UB4A 2VKNA 2DTIA 2HDAA 4N4IA 2XU8A 1YJWQ 3X24B 4JS4A 1VQ8T 3UT1A 2OTLQ 2V8IA 3X25B 2JJ9A 1ABQA 3EGUA 5FWBA 4F14A 4M78C 2DJQA 2ZPHB 4IIMA 3OBWA 1K8AC 3EG9B 2JZ2A 4C8QG 1D0ZA 4M77D 3CD6A 1AVZC 4C0ZA 5GAN6 4OB0B 3CXCP 3PMTA 1JJ2P 5LL6S 1KSWA 3KUFA 2L3QA 1TTHB 1UDLA 4Q5WA 3CPFA 2QQBA 4GBQA 3CCVA 3PT9A 2QEXT 2RJFA 4RTYA 3UATA 2JUFA 1VQOA 1ABOA 1FX7A 3OYMA 3CC2A 4KT0E 5LJ5j 1AWOA 4DEXA 4CI0C 5D7UA 1W1FA 3PGGA 1OPKA 1PC0A 5GAOp 2VWFA 3ZL7C 5GANd 1ARKA 1BI0A 1N9RA 4OF1A 1Z9ZA 3VYGA 4F04B 3NFCA 2JXBA 3MPUB 2GQVA 3L2RA 2RI2A 2W0ZA 4RUGA 5LJ5d 2LTOA 4XU1A 1Q81C 1KD1R 2GTJA 4F7UG 3CMAT 3VS7A 1YIJA 3FRNA 1W4SA 5GAOm 1JB0E 4X1VA 2E10A 4A4FA 4M7DF 1T0HA 2KXDA 1SF9A 1RAIB 1YHQQ 3WVDB 2RM4A 4M78B 4BDYA 1VQ8A 4J5YA 3PIOA 4PJNA 4C92F 5GAOr 2PVDB 5IHNA 2RH2A 2CS7A 4O5VA 1VUBA 2D0QB 5GAN5 1B34B 1SRLA 1ZA1B 2FEIA 2E6NA 4LNPA 2QEXA 1PM3A 4J8OA 4QVCA 2RHUA 1VQKT 3JCMQ 1VQ6Q 1PKSA 4JRKA 3OS2A 1RABB 2JM8A 4M75D 2O88A 1JBMA 1AZGB 3FLGA 1VQPT 1AOJA 2FHDA 3OYCA 4HXJA 2C0TA 1JO8A 3SD4A 2EW3A 1IGQA 3JCMW 2EYZA 2DF6A 3VV0A 4C8QC 2HQXA 1YI2T 1BI2A 1KHCA 3CCMQ 2AKKA 2HSEB 3P8DA 4C5EA 1UJYA 1K76A 2F1LA 4J9FA 1IHWA 2XMFA 1LVKA 1SPKA 1V76A 3RESA 3WVEB 5KYNA 4BDZA 2HL5C 2CKKA 4VUBA 4EDUA 3M0PA 3CMAA 5GAN7 4A4KA 1M2VA 1HXDA 1QW1A 3ULRB 4D6WA 3EGXA 1VQLQ 4M75B 2G6FX 1DJ7B 2DXBA 4KUDK 5DLOA 4FU6A 3O5ZA 5HY6A 5CKHA 1VQ7A 1KJWA 1SRMA 4M7DC 1Y0MA 3M4GA 2Y4YA 3LH5A 7AT1B 3X28B 1TU0B 1UGVA 3C4SA 1SHFA 5GAMh 3DLMA 5LJ3h 3H8ZA 4KGXB 3ZEHA 4C92C 5HK0A 2JS0A 1ZSZA 1BB9A 1QVFP 1M90R 4RG8A 4JPBW 2QQRA 1X2KA 2LT4A 3VS2A 4J9EA 1IRXA 5KYUA 1VQKA 3VRYA 4JZ4A 2LZ6B 4O6JA 1U06A 2AZSA 3MJXA 1OULA 3VKIA 3V7SA 3CCRT 2PUKB 3GLXA 4XK8E 2PVOB 3CPWS 1OYXA 2M51A 4C8QE 1D09B 2HEQA 3P8HA 3RMQA 2NUPB 5I11A 1QVGP 1D3BB 5CQYA 2F2WA 2ZPIB 3CCJT 1UUEA 1G8XA 1X75C 3JB9J 2JOYA 4ZNXA 1BU1A 2DL7A 2X4WA 2EGEA 2AIRB 4M7DB 2E70A 2P0KA 5GMKm 2DXTA 2DE0X 1KFZA 1ZBXA 2RA2A 4M7DE 3IQLA 2EJGA 2VXFA 1N9SA 1GFDA 1XTDA 1NJIC 1PKTA 4JLIA 3EG9A 2ABLA 2BZ8A 1MV3A 3TSWA 3HPWA 1LCKA 2OAWA 3NTKA 3A8GB 4C92E 3FDRA 2J06A 1TWBA 5FLXE 5IH2A 3NGPA 3G71Q 3CCSQ 4JDSA 2M16A 2OTLT 1JXMA 5L23A 2HSPA 4RTUA 4J6XA 3QWYA 2EQJA 2FPFA 1QWFA 1QKWA 1QCOA 1ZHIA 3QHSA 2KK4A 4DQ2A 3PMIA 1VQNT 3CCRA 2ENMA 1VQ9Q 2BIVA 3RNJA 3M4YA 5FRMA 4OMOA 4RTZA 4PJOF 2YT6A 3JCMh 2DJZA 4XU0A 3G1JA 2PU9B 4RMOA 1K1ZA 5FU6C 1Q7YU 2L8DA 4L5GA 4L59A 2VYTA 2DL5A 5AYFA 4R0KA 3LW5E 2DD4A 2O9SA 3HFNA 1T3LA 4JJCA 4FYWB 2F5KA 4QQ6A 1VIEA 3UDCA 3VYHB 3JCMc 2DKGA 4M78A 1GXIE 1UHFA 3NMZC 1M27C 2QTVA 2X3XD 4FW2A 1W2BP 4C0FA 3PTAA 1KQSS 1H8KA 5FWCA 2KNBB 4XTWA 2EKOA 1K0SA 1KQ2A 4DBRA 4CC7A 2KT1A 2XDPA 2E1HA 1YJWA 2XI9A 1X2QA 2DIGA 3AT1B 5GMKi 3OYKA 1JEGA 1NM7A 2IVWA 3G4ST 2OTLA 3DKMA 5IXFA 1B34A 2M02A 1XQHA 2RJCA 1R77A 5GAOl 2E5QA 3X26B 3MEVA 1FWZA 1IHVA 1MMDA 1M1KR 2J05A 2QASA 1S72Q 3RKYA 1FMWA 2PQWA 1AWWA 4AG1C 2MYSA 4M7AD 2F69A 2X4YA 3R6OA 3SHWA 1HYOA 3JB9G 1VYUA 2J6KA 2K3BA 3CEYA 1D1AA 1FYNA 2OJ2A 1VQ6T 4JJNK 4PJOC 1X6OA 1QWEA 2V1RA 3CCLQ 1MMAA 4GLMA 2OX7A 1BK2A 3JAME 1Q81U 1RAEB 1ZSZC 2QGGA 3CCMT 4E7KA 3L2VA 3TSZA 1TOVA 3ME9A 2PZ1A 2GFAA 4Z88A 1K4US 2A3LA 1RUWA 4PNOA 2GTOA 3M55A 2XD0A 2EIFA 1UFFA 2ZZDA 2XG8D 2YLCA 2QDYB 1VQLT 3FB9A 2COZA 4Z02A 1V1CA 4M78G 2DNUA 5GAMg 4C0DC 1M90U 3LGLA 5LJ3g 3QZ9B 1YHQA 2ECZA 3GBQA 1AHJB 5GMKh 2COYA 1I8FA 3PE0A 2EYXA 3UA7A 1GL5A 1EIFA 1BBZA 5CKDA 1BIBA 4HA8A 2O2OA 4X9DA 2LX7A 2JS2A 1R0BG 5GANh 1MV0B 2CZ6B 2L2PA 4PL6A 3GIBA 1WIEA 4II1A 2FL7A 1B07A 2RNAA 3QXEB 4QVZA 1KK7A 4C0GA 1WZOA 5GAOn 3HRSA 5IT9E 2HCKA 1ZLMA 2ED1A 3H0FA 4FYVB 4OB1B 3E1SA 4FT4A 3SDZA 1VQ6A 1ZBJA 4PJOE 4JRPA 1EZZB 1ZUKA 3CD6T 2NUPA 4BI4A 1M4ZA 4FSXA 2YRDA 3P8BB 2GCXA 4LD6A 3QYHB 3MP6A 4XTZA 1PHTA 2RO0A 3N5BB 4OMNA 1WXBA 2KROA 4AMCA 2GFUA 2H3JA 2NUZA 3E9GA 3QPHA 1QMCA 5CKFA 3NHNA 3CCMA 1GCQA 4M7DA 1VQOT 1NPRA 1WQ7A 1WJQA 5AT1B 5J26A 1VQ4Q 2CT3A 3HL8A 2RMOA 2VXEA 3RBBB 1SSHA 2RPNA 4B6MA 4FM4B 1TH7A 5A0DA 3OYGA 3OYNA 2XICA 1EFNA 4OMMA 1E6HA 4C0DB 1YNZA 4NL2A 1Q86C 1VQLA 3ZBDA 2CSQA 1Y96B 4OMLA 1OI1A 1WX6A 3QKJA 5GAMe 3CCEQ 2GBQA 1UJ0A 3V8JA 5LJ3e 1OX9A 2DFUA 2ZAEA 3LYIA 1JQQA 1YIJT 5FW9A 3VS4A 4QW2A 5GMKl 4M75F 3CCQQ 3G71T 3OW2S 2X35A 3CCST 1S1NA 2QQAA 2A28A 3OYBA 1F1BB 4WTOB 3CBOA 2WSEE 4MZMA 1IB8A 1YJ9Q 5HCKA 2RI5A 1X6GA 5CKBA 2YWWA 2RK2A 3JCMg 1HJDA 3C12A 5KE3A 2WSCE 3A1PA 3S6WA 4KUIA 3DLLA 3BDUA 4Z89A 3VU3C 2NYSA 1VQ9T 2ESWA 3M58A 1IREB 1SKUB 2BE9B 1X69A 1JU5C 5GAN2 3M0UA 4XTYA 3MKDA 3BFMA 1VA7A 2RQVA 4E7JA 2FYKA 1AD5A 1E6GA 2J6FA 4PJMA 3VS1A 5KYYB 4AT1B 1KQ1A 1YWPA 2CH4W 1OU8A 3G6EQ 1R8OB 4B9XA 4M7DG 4HT8A 2ROTA 5GAMf 4Y92A 1NJIU 4LDYA 5LJ3f 1K73R 2LVMA 4M77B 1UEBA 4BACA 1MMNA 1HD3A 2VV5A 4C92G 2XKOC 3OMCA 1Q7YR 3QJYA 2XK0A 4OGEA 2MPXC 2MOXA 2YDLA 1M1KU 3L1AA 1CSKA 3VRZA 1KG1A 3PVQA 3QO3A 2ZPEB 1Q95G 2JN0A 4RTXA 3G71A 1TS9A 1XJWB 4GY5A 3CCSA 5M9OA 2DEQA 1VQ7T 3TEEA 3KFVA 4M75C 8ATCB 4E7SA 3RUXA 3QBYA 1X27A 2FB7A 3JCMV 4M78E 3L2UA 2HL3A 3OQ5A 1S72T 3JCMe 1UG1A 2J7IA 1I07A 4NOYA 3C95A 4E6RA 1K8AR 2O31A 1VQ9A 3M5AA 1YCSB 1B3QA 1ZX6A 1AWJA 1FXXA 2K57A 3MEUA 2EKHA 5DLQE 2R5MA 1B7TA 1J3TA 1WHJA 3M57A 2XDBA 3CBMA 2FZCB 3GNFB 4BE2A 2RN8A 1NG2A 2K9GA 1AWXA 1M1GA 1WJSA 2DMOA 2ROLA 3OYFA 1RACB 4JJDA 1H92A 3QG1A 2KXCA 2FVUA 1OX8A 4DEYA 2DXCA 2ZPBB 1ZA2B 1GFCA 2SEMA 3EG3A 2A36A 3I5RA 2LQWA 2LCLA 4JJBA 1SG5A 3EG0A 1UE9A 3I35A 2K7AA 2HKNA 2RHZA 5GANg 1Q81R 3CPWA 1AZEA 1WA7A 4MMLA 2RHYA 4M75E 3SWNB 3CCUQ 2VB6A 3WXMB 1GCQC 3CQTA 5HKCA 1VQ5Q 2DILA 5D6YA 4RTTA 2CYZB 3BDLA 1WHKA 4PJOA 2LT1A 3E19A 2G3RA 1G5VA 2K79A 3GNGA 3JCMf 2RF0A 5A0GA 2AKLA 1IGUA 4IUPA 1FMKA 1KIKA 1S72A 2EWNA 2QA4Q 4Y28E 1WLPB 1O75A 2WACA 4FL6A 4P5NA 4PLLA 5C6SA 1N8RC 4XU2A 2B8AA 1X6BA 2BKDN 2L3PA 1VQMQ 2MI6A 4C8QD 3OS5A 3LWHA 2AHJB 3CCLA 2JM9A 2HZYA 3G7ZA 2H3EB 5GJVB 2E12A 2GGRA 5KYWB 3OYAA 3TU4K 3C0CA 5I2SA 2E64A 1ZQ1A 5DY9A 4A63B 3MEWA 5IXBA 1D1CA 2LQNA 4AFUC 3T9NA 4DA4A 1M1FA 2OAUA 1Q82U 1WDXA 4IUQA 1MGQA 3CMEQ 1BKBA 3CC7Q 4MZTA 1H641 3PIPA 5C0MA 1CKAA 3H0HA 1WHGA 5GMKe 2C0OA 2BZYA 2VC8A 2D9TA 1PNJA 3CCET 3EFSA 5GANe 5CCAA 2KBTA 3EG1A 4M7AF 4M4ZA 4KBMB 2DYIA 2QG9B 1ZUUA 4OVAA 2JMCA 3FC3A 4J6YA 2NWMA 4DBFA 1Y7XA 3O8VA 2CGHA 4WCIA 4J9BA 3CCQT 1O9SA 2DERA 3HSBA 3CXCS 2QYZA 1JJ2S 4FCYA 3ASKA 1K9AA 2I2LA 4PJOG 1YJWT 1UECA 3GOXA 2DM1A 3VS6A 3TCJA 1C1AA 4AFZC 1D0XA 1MMGA 2CREA 2DYBA 3V7RA 2KDSA 1PG5B 3JCMX 3QWXX 2CP0A 2RHXA 1G3SA 3M9QA 1KQSA 2V8JA 1H3ZA 3JB9I 2QGFB 4LE9A 4F7UB 5KYYA 4OB2B 3VS0A 2BE7D 2OI3A 2CP6A 1K73U 4Y91A 4E7IA 3SEMA 1WI7A 1OV3A 4M77A 2LNHB 4BE0A 2HQHA 1VQ4A 2R58A 3TREA 3NPFA 2EQMA 2HNIA 2A7YA 2GNCA 1KC8C 3OS1A 2XIDA 3A8OB 2NLUA 3S3MA 1I5OB 5GAMj 1I0CA 2QDLA 5LJ3j 4BE1A 2DO3A 4LD9K 5GANf 1HSQA 5FU7B 2X3WD 2JW4A 3CCEA 1QCFA 2D1XA 2VGMA 4FYXB 2YUPA 5GAN8 2B86A 4R55A 2K6DA 4GLKA 2X4XA 2EQIA 1K0XA 2KEAA 1LPLA 4M7AC 2EFIA 5GAMd 2DK3A 3SB2A 4E7HA 5LJ3d 4F17A 3CCQA 1KHIA 4JUVA 3HRUA 3M0SA 3M54A 1K8AU 1YHQT 4BUGA 1JRIA 5CO7A 1NJIR 4HCBA 3OSVA 3M59A 4LN2A 2LCSA 1YJ9A 1IZ6A 3CBPA 2DVEA 2ED0A 2DRMA 1M5Q1 1NE8A 2VVKA 5ECAA 4OP0A 3J80E 1UGPB 2FZKB 1ZUYA 4QQDA 4QQGA 3L2WA 1U1TA 6AT1B 2JT4A 2CH4A 3EGDB 4J9HA 3UA6A 2EPDA 3J81E 3NTIA 2RJDA 4ORZA 2K2MA 4ANJA 1K9MC 3UF4A 2KRSA 4LDXA 3M0QA 3G6EA 4CC4B 2F5TX 4M77G 1WHLA 4JS5A 5KCOA 5A2QE 1WHHA 2LJ3A 4PK4A 2F2VA 2LNVA 4ATOA 4M75A 5CAIA 5GJWB 3E2UA 5FROA 2M9UA 3SWNA 4M7AB 3LLRA 2EYQA 4A54A 3JCMJ 3JCMb 4M7AE 1G2BA 1VQPQ 5D6WA 1GCPA 2MIOA 1VIFA 1W70A 4C5GA 1QP3A 4M77F 2CP7A 1QVFS 4C5HA 3CC4Q 1A0NB 1QP2A 2P4RA 2MMPA 1YI2Q 2M1HA 4XU3A 1FMVA 1N27A 2LC4A 2YSQA 4HVWA 4BB7A 2E3HA 1LJOA 4KULA 2DA9A 1YITQ 2ZPFB 3VJPA 2QXFA 3EH2A 2DTOA 4FYYB 5FRNA 4PFOA 1VQMT 1GRIA 5LJ5h 3JCMd 2EQUA 5IHIA 1YN8A 1WQWA 2CSIA 4LDWA 1QVGS 4BI8B 3OY9A 1M2VB 5KYXB 2CP3A 4MDWA 4RCBA 3VUZA 5I21A 2RI3A 1I5LA 2DEUA 1D3BA 1G3WA 4V2SA 2QTXA 3OW2A 1CKBA 4PLIA 4FIBA 2HKQB 4X34A 3KXTA 3L2ZA 1SSFA 3RKXA 1TSFA 3CMET 4K11A 2YUQA 2COWA 4E47A 3CC7T 3AHUA 2ZPGB 1TUCA 4PJLA 1Y71A 2PVGB 4TVRA 1YJNQ 4JRQA 4M75G 1MNEA 3HKSA 2X9HA 2EVRA 3MP1A 3S3OA 2BTTA 2LP5A 5KH6A 2DL8A 1BI1A 1QQJA 1UHCA 1X43A 1Q82R 2P0PA 3EFOB 4EMKB 4OGCA 3CCUA 5IHKA 4CRIA 3HFOA 4BY6B 2FG0A 1VQ5A 2DX1A 4M77C 4HKEA 2KY9A 2MWOA 3INZA 1N8RU 3FIFA 3CCJQ 2L89A 2KYMA 1PSFA 4X9CA 5A0LA 1Q7YC 1NBEB 2QA4A 2R57A 4FW1A 3CPWP 1KD1C 2JTFA 5D6XA 1GBQA 2LCCA 2KRMA 2FO0A 3HP9A 2KAFA 1VQMA 3HTRA 3M0TA 1M9SA 8AT1B 1QKXA 3QYGB 1I81A 2E65A 3JB9D 1RI0A 2QQ9A 1WNLA 2EQKA 2KI7A 5GAOq 1NYGA 3BY7A 2IPOB 1UGRB 1TXQA 2IIMA 1I1JA 3OYHA 1T0JA 4PFZA 3V7CA 1PCXA 3CMEA 3JV3A 3VS3A 2AZVA 1Z9QA 3OBYA 3M0RA 4N0AC 3CC7A 5GMKj 1W6XA 2RK1A 3D7SB 3RMSA 2HQEA 1W2BS 2DBMA 2GF7A 2VUBA 1WPYA 5CVIA 1PRMC 4MMKA 5GANj 1VQNQ 4AFSC 2I0NA 2LQ8A 2XHCA 2DRKA 3UWNA 2M0OA 3A8LB 4QKUA 4DBQA 1D0YA 1Q86R 2HBPA 3OYDA 4M77E 2KR3A 4OMFB 3M53A 4DOWA 4M78D 4C8QF 1N6AA 4RCCA 1M3AA 3DB3A 1NLPC 2V8KA 1Y57A 3X20B 4IUTA 2CP2A 2QI2A 2DZCA 4HCCA 3TVTA 2RD1A 4LUEA 4QVDA 3HHTB 3EH1A 2EJFA 3EGDA 1PSEA 2OTJQ 2K2VA 3SWNC 5CKEA 2CZ7B 4IURA 1M2OA 4A4HA 3I55Q 2EGCA 3BW1A 2J6OA 1RAAB 1BCOA 3DB4A 1KC8U 4JLGA 4RG2A 3META 3H6ZA 3G4SQ 3Q1JA 3U23A 4XTXA 1M90C 3LX7A 3CCLT 1KQSP 4F7UF 4M7AA 3V8LA 5GAN3 3EAEA 2D8HA 1WFWA 3QSUA 1NEGA 3EG2A 4PFPA 3PVLA 4RTWA 1VOMA 2Y4XA 1OQKA 2DL3A 4J83A 1C0MA 2L3RA 4NS5A 5L8RE 2MWPA 1QVPA
chains in the Genus database with same CATH topology
4AFZC 1M8MA 3REAB 2VKNA 2CREA 2DYBA 2HDAA 3TSZA 2E5KA 4RTVA 2PZ1A 3QWXX 4Z88A 1K4US 1GBRA 1RUWA 1NLOC 2GTOA 4LE9A 1ABQA 3EGUA 5FWBA 4F14A 1UFFA 2DJQA 4IIMA 3VS0A 2OI3A 3EHQA 1V1CA 2CT4A 1AVZC 2DNUA 3SEMA 3THKA 1WI7A 1KSWA 1OV3A 2LNHB 1NEBA 2L3QA 2ECZA 3GBQA 1RLPC 1UDLA 3NPFA 3PE0A 1NYFA 2EYXA 4GBQA 3UA7A 2GNCA 1GL5A 1BBZA 2HBWA 2O2OA 4RTYA 3UATA 2LX7A 2JS2A 2CDTA 1I0CA 1MV0B 2QDLA 1ABOA 2L2PA 4HVVA 4Z8AA 1WIEA 2DLPA 1B07A 1HSQA 1AWOA 3I9QA 4DEXA 1AEYA 4D8DA 1W1FA 2RNAA 1OPKA 2SRCA 2JW4A 2X3WD 2VWFA 1M30A 3ZL7C 1QCFA 2D1XA 1ARKA 3I5SA 2YUPA 2B86A 2K6DA 2HCKA 4EIKA 1ZLMA 1Z9ZA 2ED1A 3H0FA 2EQIA 1K0XA 2JXBA 2KEAA 1ZBJA 2W0ZA 1ZUKA 4RUGA 4F17A 2LJ1A 3M0SA 1N5ZA 2GTJA 1PHTA 1QLYA 3VS7A 4LN2A 1IO6A 4OMNA 1WXBA 2KROA 2NUZA 2LCSA 4X1VA 3NHNA 2YUOA 1T0HA 1GCQA 2ED0A 2KXDA 2DRMA 2CUBA 2VVKA 5ECAA 2CT3A 2RMOA 2C0IA 3RBBB 1SSHA 2RPNA 1ZUYA 1EFNA 4OMMA 1E6HA 5IHNA 2JT4A 1YNZA 2CH4A 4J9HA 3UA6A 2RQTA 2DL4A 2CSQA 2EPDA 2H8HA 2FRYA 4OMLA 1WX6A 4ORZA 2K2MA 2KE9A 2GBQA 1UJ0A 1SRLA 2FEIA 3UF4A 2KRSA 4LNPA 3M0QA 4CC4B 1JQQA 1VYVA 1PKSA 5FW9A 2JM8A 3VS4A 2O88A 2RQUA 2LJ3A 2F2VA 3REBB 1AZGB 1S1NA 1AOJA 2DVJA 5GJWB 4HXJA 2A28A 1JO8A 2C0TA 2EW3A 2EYZA 2DF6A 2EBPA 2DBKA 5HCKA 1X6GA 1G2BA 2AKKA 1UJYA 1K76A 1HJDA 4J9FA 2XMFA 1GCPA 2MIOA 1SPKA 1W70A 2KT8A 3H0IA 4Z89A 1A0NB 2ESWA 2P4RA 3M0PA 1WXUA 1X69A 1JU5C 4CC3A 3ULRB 3M0UA 4FSSA 2G6FX 1VA7A 2RQVA 1AD5A 3O5ZA 1E6GA 2J6FA 4OMQA 1RI9A 3VS1A 2YSQA 1YWOA 1KJWA 1SRMA 4HVWA 1Y0MA 1PWTA 3LH5A 1YWPA 1U3OA 2CH4W 2DA9A 1UGVA 4OMPA 1SHFA 2ROTA 1GRIA 4Y92A 5IHIA 4J9DA 1YN8A 2CSIA 2JS0A 2CUDA 1BB9A 1HD3A 1SHGA 1UTIA 2D0NA 4KRTA 4JPBW 1X2KA 4JZ3A 3VS2A 4J9EA 1CKBA 2MOXA 2YDLA 3VRYA 4JZ4A 2LZ6B 1CSKA 4LUDA 3VRZA 5EC7A 2RQRA 3PVQA 1U06A 2AZSA 2AK5A 1H3HA 4RTXA 4K11A 2EYWA 2YUQA 3KFVA 1TUCA 2L3SA 1JXOA 2M51A 2V1QA 1X27A 1RLQC 2EYYA 2HEQA 1OOTA 2EVRA 2LMJA 2BTTA 2LP5A 2DL8A 5I11A 1WXTA 2F2WA 4CC2A 2KRNA 1UG1A 1UUEA 2J7IA 1I07A 1UHCA 1PRLC 1X43A 4ZNXA 4E6RA 2O31A 5IHKA 1YCSB 1B3QA 2FG0A 1ZX6A 1AWJA 2DX1A 1XOVA 1BU1A 2DL7A 1WYXA 2EKHA 2EGEA 1E7OA 2M0YA 2DE0X 1J3TA 1KFZA 2KYMA 3VS5A 2F2XA 3IQLA 2FPDA 2A37A 2FRWA 1U5SA 2RN8A 2D8JA 1GFDA 1NG2A 2K9GA 1AWXA 1PKTA 2ABLA 1GBQA 2BZ8A 2KYBA 2KRMA 1MV3A 2DMOA 2FO0A 3TSWA 1LCKA 2OAWA 2ROLA 4J9CA 4JJDA 1H92A 2J06A 2KXCA 3M0TA 5IH2A 4DEYA 3NGPA 4HCKA 1GFCA 2SEMA 1QKXA 3EG3A 2A36A 3I5RA 1JXMA 2W10A 2LQWA 4JJBA 2KGTA 4IIOA 3FJ5A 2HSPA 5L23A 3EG0A 4ESRA 4RTUA 1OPLA 1UE9A 3I35A 2K7AA 3QWYA 1NYGA 2FPFA 1OEBA 1QWFA 1QKWA 2IIMA 1I1JA 1T0JA 2FPEA 1TG0A 2PNIA 1AZEA 2JMAA 3JV3A 3VS3A 4AFQC 1WA7A 2AZVA 1Z9QA 3M0RA 2ENMA 1W6XA 3RNJA 1GCQC 3CQTA 4OMOA 4RTZA 2YT6A 2DILA 2MCNA 2DBMA 4RTTA 1M3BA 2K79A 2A08A 1PRMC 1VYTA 2RF0A 1K1ZA 2AKLA 2YUNA 4AFSC 5I22A 2I0NA 1FMKA 2L0AA 2DRKA 1KIKA 2DL5A 4R0KA 2O9SA 1G83A 1WLPB 4AG2C 3A98A 1T3LA 4JJCA 2O9VA 1X6BA 2KR3A 3EHRA 2L3PA 2LJ0A 4J9GA 1M3AA 1NLPC 1Y57A 2JM9A 1UHFA 3NMZC 5GJVB 2GGRA 1M27C 2X3XD 3TVTA 3C0CA 4LUEA 4A63B 1H8KA 2GQIA 5FWCA 5IXBA 2KNBB 2LQNA 4AFUC 1K0SA 4J9IA 1WDXA 4CC7A 2KT1A 4QT7A 2PTKA 1X2QA 1JEGA 1NM7A 5IXFA 3R6NA 4F16A 2EGCA 2J6OA 1CKAA 3H41A 3H0HA 2C0OA 1MUZA 2J05A 2BZYA 4D8KA 3U23A 1PNJA 1AWWA 4AG1C 4HVUA 3SHWA 2KBTA 2EGAA 3EG1A 4M4ZA 1VYUA 2J6KA 1T3SA 1ZUUA 2K3BA 2JMCA 1FYNA 2OJ2A 2NWMA 1SEMA 4WCIA 2D8HA 4J9BA 1WFWA 1NEGA 2BZXA 3EG2A 1QWEA 2V1RA 1M3CA 1K9AA 4GLMA 1TUDA 3PVLA 4RTWA 1ZSGA 1BK2A 2DL3A 2RQWA 2JTEA 1UECA 2DM1A 1YP5A 3VS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFZ C;  1M8M A;  3REA B;  2VKN A;  2CRE A;  2DYB A;  2HDA A;  3TSZ A;  2E5K A;  4RTV A;  2PZ1 A;  3QWX X;  4Z88 A;  1K4U S;  1GBR A;  1RUW A;  1NLO C;  2GTO A;  4LE9 A;  1ABQ A;  3EGU A;  5FWB A;  4F14 A;  1UFF A;  2DJQ A;  4IIM A;  3VS0 A;  2OI3 A;  3EHQ A;  1V1C A;  2CT4 A;  1AVZ C;  2DNU A;  3SEM A;  3THK A;  1WI7 A;  1KSW A;  1OV3 A;  2LNH B;  1NEB A;  2L3Q A;  2ECZ A;  3GBQ A;  1RLP C;  1UDL A;  3NPF A;  3PE0 A;  1NYF A;  2EYX A;  4GBQ A;  3UA7 A;  2GNC A;  1GL5 A;  1BBZ A;  2HBW A;  2O2O A;  4RTY A;  3UAT A;  2LX7 A;  2JS2 A;  2CDT A;  1I0C A;  1MV0 B;  2QDL A;  1ABO A;  2L2P A;  4HVV A;  4Z8A A;  1WIE A;  2DLP A;  1B07 A;  1HSQ A;  1AWO A;  3I9Q A;  4DEX A;  1AEY A;  4D8D A;  1W1F A;  2RNA A;  1OPK A;  2SRC A;  2JW4 A;  2X3W D;  2VWF A;  1M30 A;  3ZL7 C;  1QCF A;  2D1X A;  1ARK A;  3I5S A;  2YUP A;  2B86 A;  2K6D A;  2HCK A;  4EIK A;  1ZLM A;  1Z9Z A;  2ED1 A;  3H0F A;  2EQI A;  1K0X A;  2JXB A;  2KEA A;  1ZBJ A;  2W0Z A;  1ZUK A;  4RUG A;  4F17 A;  2LJ1 A;  3M0S A;  1N5Z A;  2GTJ A;  1PHT A;  1QLY A;  3VS7 A;  4LN2 A;  1IO6 A;  4OMN A;  1WXB A;  2KRO A;  2NUZ A;  2LCS A;  4X1V A;  3NHN A;  2YUO A;  1T0H A;  1GCQ A;  2ED0 A;  2KXD A;  2DRM A;  2CUB A;  2VVK A;  5ECA A;  2CT3 A;  2RMO A;  2C0I A;  3RBB B;  1SSH A;  2RPN A;  1ZUY A;  1EFN A;  4OMM A;  1E6H A;  5IHN A;  2JT4 A;  1YNZ A;  2CH4 A;  4J9H A;  3UA6 A;  2RQT A;  2DL4 A;  2CSQ A;  2EPD A;  2H8H A;  2FRY A;  4OML A;  1WX6 A;  4ORZ A;  2K2M A;  2KE9 A;  2GBQ A;  1UJ0 A;  1SRL A;  2FEI A;  3UF4 A;  2KRS A;  4LNP A;  3M0Q A;  4CC4 B;  1JQQ A;  1VYV A;  1PKS A;  5FW9 A;  2JM8 A;  3VS4 A;  2O88 A;  2RQU A;  2LJ3 A;  2F2V A;  3REB B;  1AZG B;  1S1N A;  1AOJ A;  2DVJ A;  5GJW B;  4HXJ A;  2A28 A;  1JO8 A;  2C0T A;  2EW3 A;  2EYZ A;  2DF6 A;  2EBP A;  2DBK A;  5HCK A;  1X6G A;  1G2B A;  2AKK A;  1UJY A;  1K76 A;  1HJD A;  4J9F A;  2XMF A;  1GCP A;  2MIO A;  1SPK A;  1W70 A;  2KT8 A;  3H0I A;  4Z89 A;  1A0N B;  2ESW A;  2P4R A;  3M0P A;  1WXU A;  1X69 A;  1JU5 C;  4CC3 A;  3ULR B;  3M0U A;  4FSS A;  2G6F X;  1VA7 A;  2RQV A;  1AD5 A;  3O5Z A;  1E6G A;  2J6F A;  4OMQ A;  1RI9 A;  3VS1 A;  2YSQ A;  1YWO A;  1KJW A;  1SRM A;  4HVW A;  1Y0M A;  1PWT A;  3LH5 A;  1YWP A;  1U3O A;  2CH4 W;  2DA9 A;  1UGV A;  4OMP A;  1SHF A;  2ROT A;  1GRI A;  4Y92 A;  5IHI A;  4J9D A;  1YN8 A;  2CSI A;  2JS0 A;  2CUD A;  1BB9 A;  1HD3 A;  1SHG A;  1UTI A;  2D0N A;  4KRT A;  4JPB W;  1X2K A;  4JZ3 A;  3VS2 A;  4J9E A;  1CKB A;  2MOX A;  2YDL A;  3VRY A;  4JZ4 A;  2LZ6 B;  1CSK A;  4LUD A;  3VRZ A;  5EC7 A;  2RQR A;  3PVQ A;  1U06 A;  2AZS A;  2AK5 A;  1H3H A;  4RTX A;  4K11 A;  2EYW A;  2YUQ A;  3KFV A;  1TUC A;  2L3S A;  1JXO A;  2M51 A;  2V1Q A;  1X27 A;  1RLQ C;  2EYY A;  2HEQ A;  1OOT A;  2EVR A;  2LMJ A;  2BTT A;  2LP5 A;  2DL8 A;  5I11 A;  1WXT A;  2F2W A;  4CC2 A;  2KRN A;  1UG1 A;  1UUE A;  2J7I A;  1I07 A;  1UHC A;  1PRL C;  1X43 A;  4ZNX A;  4E6R A;  2O31 A;  5IHK A;  1YCS B;  1B3Q A;  2FG0 A;  1ZX6 A;  1AWJ A;  2DX1 A;  1XOV A;  1BU1 A;  2DL7 A;  1WYX A;  2EKH A;  2EGE A;  1E7O A;  2M0Y A;  2DE0 X;  1J3T A;  1KFZ A;  2KYM A;  3VS5 A;  2F2X A;  3IQL A;  2FPD A;  2A37 A;  2FRW A;  1U5S A;  2RN8 A;  2D8J A;  1GFD A;  1NG2 A;  2K9G A;  1AWX A;  1PKT A;  2ABL A;  1GBQ A;  2BZ8 A;  2KYB A;  2KRM A;  1MV3 A;  2DMO A;  2FO0 A;  3TSW A;  1LCK A;  2OAW A;  2ROL A;  4J9C A;  4JJD A;  1H92 A;  2J06 A;  2KXC A;  3M0T A;  5IH2 A;  4DEY A;  3NGP A;  4HCK A;  1GFC A;  2SEM A;  1QKX A;  3EG3 A;  2A36 A;  3I5R A;  1JXM A;  2W10 A;  2LQW A;  4JJB A;  2KGT A;  4IIO A;  3FJ5 A;  2HSP A;  5L23 A;  3EG0 A;  4ESR A;  4RTU A;  1OPL A;  1UE9 A;  3I35 A;  2K7A A;  3QWY A;  1NYG A;  2FPF A;  1OEB A;  1QWF A;  1QKW A;  2IIM A;  1I1J A;  1T0J A;  2FPE A;  1TG0 A;  2PNI A;  1AZE A;  2JMA A;  3JV3 A;  3VS3 A;  4AFQ C;  1WA7 A;  2AZV A;  1Z9Q A;  3M0R A;  2ENM A;  1W6X A;  3RNJ A;  1GCQ C;  3CQT A;  4OMO A;  4RTZ A;  2YT6 A;  2DIL A;  2MCN A;  2DBM A;  4RTT A;  1M3B A;  2K79 A;  2A08 A;  1PRM C;  1VYT A;  2RF0 A;  1K1Z A;  2AKL A;  2YUN A;  4AFS C;  5I22 A;  2I0N A;  1FMK A;  2L0A A;  2DRK A;  1KIK A;  2DL5 A;  4R0K A;  2O9S A;  1G83 A;  1WLP B;  4AG2 C;  3A98 A;  1T3L A;  4JJC A;  2O9V A;  1X6B A;  2KR3 A;  3EHR A;  2L3P A;  2LJ0 A;  4J9G A;  1M3A A;  1NLP C;  1Y57 A;  2JM9 A;  1UHF A;  3NMZ C;  5GJV B;  2GGR A;  1M27 C;  2X3X D;  3TVT A;  3C0C A;  4LUE A;  4A63 B;  1H8K A;  2GQI A;  5FWC A;  5IXB A;  2KNB B;  2LQN A;  4AFU C;  1K0S A;  4J9I A;  1WDX A;  4CC7 A;  2KT1 A;  4QT7 A;  2PTK A;  1X2Q A;  1JEG A;  1NM7 A;  5IXF A;  3R6N A;  4F16 A;  2EGC A;  2J6O A;  1CKA A;  3H41 A;  3H0H A;  2C0O A;  1MUZ A;  2J05 A;  2BZY A;  4D8K A;  3U23 A;  1PNJ A;  1AWW A;  4AG1 C;  4HVU A;  3SHW A;  2KBT A;  2EGA A;  3EG1 A;  4M4Z A;  1VYU A;  2J6K A;  1T3S A;  1ZUU A;  2K3B A;  2JMC A;  1FYN A;  2OJ2 A;  2NWM A;  1SEM A;  4WCI A;  2D8H A;  4J9B A;  1WFW A;  1NEG A;  2BZX A;  3EG2 A;  1QWE A;  2V1R A;  1M3C A;  1K9A A;  4GLM A;  1TUD A;  3PVL A;  4RTW A;  1ZSG A;  1BK2 A;  2DL3 A;  2RQW A;  2JTE A;  1UEC A;  2DM1 A;  1YP5 A;  3VS6 A; 
#chains in the Genus database with same CATH topology
 1G3Y A;  1M8M A;  3REA B;  3OS0 A;  2A0F B;  2E5K A;  4RTV A;  2LX9 A;  4XAX B;  5I2M A;  3S3N A;  4HCZ A;  1GBR A;  1EX4 A;  2KMT A;  1G3T A;  1NLO C;  3CC4 T;  4EMG A;  1IXD A;  4ELY C;  1MND A;  5IAY A;  2LQK A;  4B9W A;  3EHQ A;  4MZP A;  2CT4 A;  3PNW C;  4ME7 A;  4J6W A;  3THK A;  2WSF E;  1MHN A;  5LJ5 g;  1NEB A;  2HAX A;  1RLP C;  4IKF A;  1NYF A;  5KYX A;  3I56 Q;  3A5Z B;  2DTH A;  5HK3 A;  1YIT T;  2HBW A;  1K9M U;  1R0C B;  5J39 A;  2CDT A;  2YLB A;  4ELZ C;  4HVV A;  4Z8A A;  2P0Q A;  2DLP A;  2CZ1 B;  4UC4 A;  3I9Q A;  2X4J A;  1AEY A;  2V26 A;  4D8D A;  3MEA A;  3KBG A;  4R56 A;  2SRC A;  1M30 A;  3I5S A;  2DD5 A;  3MCA B;  4EIK A;  3CXC A;  4A4E A;  1JJ2 A;  3PFS A;  2EAY A;  4A4G A;  3QDR B;  2X51 A;  1YFN A;  3QZ5 B;  3JRZ A;  4MDX A;  4M7A G;  2LJ1 A;  1Y96 A;  1N5Z A;  4E7L A;  4DBH A;  1QLY A;  4XQ3 A;  1VQ4 T;  3EFO A;  4EMK A;  1IO6 A;  3RR6 A;  2DET A;  1UGQ B;  1BI3 A;  1QCN A;  1YJN T;  4M7D D;  4PKC C;  3CD6 Q;  3FJP A;  1UGS B;  2YUO A;  1VQP A;  2CUB A;  2YRC A;  4C8Q B;  4IUV A;  1U8R A;  2C0I A;  3OSS C;  3CCV Q;  4C92 D;  3CC4 A;  1YI2 A;  1TUG B;  5FU7 C;  4ZGD B;  3LH0 A;  1VQO Q;  2RQT A;  2DL4 A;  2H8H A;  2FRY A;  3CC2 Q;  2JTM A;  3VUB A;  2KE9 A;  1Y07 A;  4LDV A;  2P84 A;  3QJ6 A;  3MHX A;  3C94 A;  5EG2 A;  5LJ5 e;  1YIT A;  2YXY A;  3NTH A;  1VYV A;  2PUO B;  3F70 A;  2D6F A;  1YJ9 T;  2RQU A;  2JVV A;  2NUT B;  3REB B;  2Z0W A;  2DVJ A;  4C92 B;  2HD0 A;  5IN1 A;  3HRT A;  1BIA A;  1N8R R;  1YIJ Q;  4ZGE B;  3FEO A;  2BUD A;  4N4G A;  2EBP A;  2RB6 A;  2O4X B;  2DBK A;  2R5A A;  3OB9 A;  4F7U E;  2L5Q A;  1M1K C;  4IUU A;  2KT8 A;  1VQ8 Q;  4A53 A;  2VAS A;  3H0I A;  1Q86 U;  3JCM P;  3URG A;  4ZTJ A;  3UPU A;  1WXU A;  4KH1 B;  4CC3 A;  4RKU E;  4FSS A;  3MP8 A;  1YJN A;  2RJE A;  3OYL A;  3G6E T;  5DM7 R;  3OW2 P;  1RAG B;  4OMQ A;  1RI9 A;  1LOJ A;  1YWO A;  1OZ3 A;  1PWT A;  2K3Y A;  5J3B A;  1U3O A;  2QEX Q;  1M8V A;  3BE3 A;  4OMP A;  4NL3 A;  1RL2 A;  1BCM A;  1KD1 U;  1RAF B;  3LWI A;  2KSS A;  4J9D A;  3CCJ A;  5LJ5 f;  4KRT A;  2CUD A;  1SHG A;  1UTI A;  2D0N A;  2K4Y A;  2QK0 A;  2EJ9 A;  3QII A;  3A8H B;  4XTU A;  4LXC A;  4JZ3 A;  4C5I A;  2Y90 A;  1HK9 A;  4KH0 B;  2P4T A;  4LUD A;  2OTJ T;  2DPP B;  5EC7 A;  2RQR A;  5CK9 A;  1WHM A;  2AK5 A;  4YTL A;  4N0A A;  1H3H A;  3OYY A;  2EYW A;  4FT2 A;  1D1B A;  1ACM B;  3JSC A;  4ZGJ B;  2LDM A;  4ZN3 A;  3JB9 H;  3I55 T;  3QDF A;  3CMA Q;  2L3S A;  1JXO A;  2V1Q A;  3J7A F;  1RLQ C;  3OYJ A;  2DAQ A;  2K5I A;  2YRV A;  1NZ9 A;  2EYY A;  1OOT A;  2LMJ A;  4XTV A;  1QVF A;  2K3X A;  2LRQ A;  3L2Q A;  1WXT A;  1VQ7 Q;  1OZ2 A;  3RIR A;  4CC2 A;  3MO8 A;  2KRN A;  4EMH A;  1PRL C;  2IG0 A;  2E6Z A;  2KQW A;  1WJR A;  2ZCF B;  4E2F B;  3QUI A;  3V8K A;  1XOV A;  3ER0 A;  1WYX A;  2K5L A;  1E7O A;  4OB3 B;  2M0Y A;  1VQN A;  3VS5 A;  2F2X A;  1KC8 R;  5FU6 B;  2FPD A;  4ZTF A;  2A37 A;  2FRW A;  1U5S A;  2D8J A;  3TQ7 P;  2C06 A;  3RKW A;  1VQK Q;  2KYB A;  1QVG A;  4J9C A;  2MK5 A;  1LNX A;  3L42 A;  4LDU A;  4HCK A;  2W10 A;  4EPC A;  4BD3 A;  2VGN A;  2KGT A;  4IIO A;  2CZ0 B;  2QQS A;  3GPL A;  1PD0 A;  3FJ5 A;  4ESR A;  2AT1 B;  3CCU T;  4E7Z A;  1OPL A;  3JB9 F;  5KCH A;  2XDD A;  1VQ5 T;  1OEB A;  3OYE A;  2OTJ A;  2FPE A;  1TG0 A;  2PNI A;  4EMK C;  1RAD B;  2JMA A;  1V29 B;  4BY6 C;  2YHT A;  1Q82 C;  4AFQ C;  3I56 T;  5CR2 A;  4PJO D;  4ZN1 A;  3I55 A;  3LGF A;  4KGV B;  2QA4 T;  2MCN A;  1RAH B;  5KYW A;  3GF5 A;  1M3B A;  2A08 A;  2CP5 A;  1VYT A;  2E3I A;  2YUN A;  5I22 A;  3G4S A;  2L0A A;  1P92 A;  3M56 A;  1OU9 A;  3E9F A;  1G83 A;  4WF2 A;  3RDV A;  4AG2 C;  3A98 A;  2O9V A;  3SFM A;  4N4H A;  3EGX B;  1X01 A;  3EHR A;  2LJ0 A;  4J9G A;  3ZFJ A;  4M78 F;  2FZG B;  1K9M R;  1U1S A;  1NPP A;  4C8Q A;  1AT1 B;  3H9N A;  4PJO B;  2HMA A;  2RHI A;  1YCY A;  2GQI A;  1YBY A;  5GAN 4;  1I4K 1;  4J9I A;  2DZ9 A;  3EFR A;  4DOV A;  1PD1 A;  4QT7 A;  1ZSZ B;  2PTK A;  3CCR Q;  3CCV T;  5CIU A;  3R6N A;  4KGZ B;  4F16 A;  2MF2 A;  4J7I A;  3H41 A;  9ATC B;  5KYU B;  1WGS A;  4JRI A;  1MUZ A;  3CC2 T;  2QAZ A;  3OA6 A;  3RER A;  2E41 A;  2NUT A;  4D8K A;  4PJJ A;  1K73 C;  1W2B A;  2K5F A;  1C6V X;  4HVU A;  1BYM A;  4L6V 5;  4C92 A;  5KE2 A;  2ZGW A;  2EGA A;  5CQX A;  3I56 A;  1XNI A;  1T3S A;  4HT9 A;  2E4H A;  2O01 E;  3OMG A;  2O4X A;  4F7U A;  2DIQ A;  1SEM A;  2JNG A;  3OYI A;  3GP8 A;  2ATC B;  4J7F A;  2DXU A;  2BZX A;  2MAM A;  1M3C A;  1TUD A;  1ZSG A;  2RQW A;  4BI3 A;  2JTE A;  3A8M B;  2KVQ G;  1YP5 A;  1UB4 A;  2VKN A;  2DTI A;  2HDA A;  4N4I A;  2XU8 A;  1YJW Q;  3X24 B;  4JS4 A;  1VQ8 T;  3UT1 A;  2OTL Q;  2V8I A;  3X25 B;  2JJ9 A;  1ABQ A;  3EGU A;  5FWB A;  4F14 A;  4M78 C;  2DJQ A;  2ZPH B;  4IIM A;  3OBW A;  1K8A C;  3EG9 B;  2JZ2 A;  4C8Q G;  1D0Z A;  4M77 D;  3CD6 A;  1AVZ C;  4C0Z A;  5GAN 6;  4OB0 B;  3CXC P;  3PMT A;  1JJ2 P;  5LL6 S;  1KSW A;  3KUF A;  2L3Q A;  1TTH B;  1UDL A;  4Q5W A;  3CPF A;  2QQB A;  4GBQ A;  3CCV A;  3PT9 A;  2QEX T;  2RJF A;  4RTY A;  3UAT A;  2JUF A;  1VQO A;  1ABO A;  1FX7 A;  3OYM A;  3CC2 A;  4KT0 E;  5LJ5 j;  1AWO A;  4DEX A;  4CI0 C;  5D7U A;  1W1F A;  3PGG A;  1OPK A;  1PC0 A;  5GAO p;  2VWF A;  3ZL7 C;  5GAN d;  1ARK A;  1BI0 A;  1N9R A;  4OF1 A;  1Z9Z A;  3VYG A;  4F04 B;  3NFC A;  2JXB A;  3MPU B;  2GQV A;  3L2R A;  2RI2 A;  2W0Z A;  4RUG A;  5LJ5 d;  2LTO A;  4XU1 A;  1Q81 C;  1KD1 R;  2GTJ A;  4F7U G;  3CMA T;  3VS7 A;  1YIJ A;  3FRN A;  1W4S A;  5GAO m;  1JB0 E;  4X1V A;  2E10 A;  4A4F A;  4M7D F;  1T0H A;  2KXD A;  1SF9 A;  1RAI B;  1YHQ Q;  3WVD B;  2RM4 A;  4M78 B;  4BDY A;  1VQ8 A;  4J5Y A;  3PIO A;  4PJN A;  4C92 F;  5GAO r;  2PVD B;  5IHN A;  2RH2 A;  2CS7 A;  4O5V A;  1VUB A;  2D0Q B;  5GAN 5;  1B34 B;  1SRL A;  1ZA1 B;  2FEI A;  2E6N A;  4LNP A;  2QEX A;  1PM3 A;  4J8O A;  4QVC A;  2RHU A;  1VQK T;  3JCM Q;  1VQ6 Q;  1PKS A;  4JRK A;  3OS2 A;  1RAB B;  2JM8 A;  4M75 D;  2O88 A;  1JBM A;  1AZG B;  3FLG A;  1VQP T;  1AOJ A;  2FHD A;  3OYC A;  4HXJ A;  2C0T A;  1JO8 A;  3SD4 A;  2EW3 A;  1IGQ A;  3JCM W;  2EYZ A;  2DF6 A;  3VV0 A;  4C8Q C;  2HQX A;  1YI2 T;  1BI2 A;  1KHC A;  3CCM Q;  2AKK A;  2HSE B;  3P8D A;  4C5E A;  1UJY A;  1K76 A;  2F1L A;  4J9F A;  1IHW A;  2XMF A;  1LVK A;  1SPK A;  1V76 A;  3RES A;  3WVE B;  5KYN A;  4BDZ A;  2HL5 C;  2CKK A;  4VUB A;  4EDU A;  3M0P A;  3CMA A;  5GAN 7;  4A4K A;  1M2V A;  1HXD A;  1QW1 A;  3ULR B;  4D6W A;  3EGX A;  1VQL Q;  4M75 B;  2G6F X;  1DJ7 B;  2DXB A;  4KUD K;  5DLO A;  4FU6 A;  3O5Z A;  5HY6 A;  5CKH A;  1VQ7 A;  1KJW A;  1SRM A;  4M7D C;  1Y0M A;  3M4G A;  2Y4Y A;  3LH5 A;  7AT1 B;  3X28 B;  1TU0 B;  1UGV A;  3C4S A;  1SHF A;  5GAM h;  3DLM A;  5LJ3 h;  3H8Z A;  4KGX B;  3ZEH A;  4C92 C;  5HK0 A;  2JS0 A;  1ZSZ A;  1BB9 A;  1QVF P;  1M90 R;  4RG8 A;  4JPB W;  2QQR A;  1X2K A;  2LT4 A;  3VS2 A;  4J9E A;  1IRX A;  5KYU A;  1VQK A;  3VRY A;  4JZ4 A;  2LZ6 B;  4O6J A;  1U06 A;  2AZS A;  3MJX A;  1OUL A;  3VKI A;  3V7S A;  3CCR T;  2PUK B;  3GLX A;  4XK8 E;  2PVO B;  3CPW S;  1OYX A;  2M51 A;  4C8Q E;  1D09 B;  2HEQ A;  3P8H A;  3RMQ A;  2NUP B;  5I11 A;  1QVG P;  1D3B B;  5CQY A;  2F2W A;  2ZPI B;  3CCJ T;  1UUE A;  1G8X A;  1X75 C;  3JB9 J;  2JOY A;  4ZNX A;  1BU1 A;  2DL7 A;  2X4W A;  2EGE A;  2AIR B;  4M7D B;  2E70 A;  2P0K A;  5GMK m;  2DXT A;  2DE0 X;  1KFZ A;  1ZBX A;  2RA2 A;  4M7D E;  3IQL A;  2EJG A;  2VXF A;  1N9S A;  1GFD A;  1XTD A;  1NJI C;  1PKT A;  4JLI A;  3EG9 A;  2ABL A;  2BZ8 A;  1MV3 A;  3TSW A;  3HPW A;  1LCK A;  2OAW A;  3NTK A;  3A8G B;  4C92 E;  3FDR A;  2J06 A;  1TWB A;  5FLX E;  5IH2 A;  3NGP A;  3G71 Q;  3CCS Q;  4JDS A;  2M16 A;  2OTL T;  1JXM A;  5L23 A;  2HSP A;  4RTU A;  4J6X A;  3QWY A;  2EQJ A;  2FPF A;  1QWF A;  1QKW A;  1QCO A;  1ZHI A;  3QHS A;  2KK4 A;  4DQ2 A;  3PMI A;  1VQN T;  3CCR A;  2ENM A;  1VQ9 Q;  2BIV A;  3RNJ A;  3M4Y A;  5FRM A;  4OMO A;  4RTZ A;  4PJO F;  2YT6 A;  3JCM h;  2DJZ A;  4XU0 A;  3G1J A;  2PU9 B;  4RMO A;  1K1Z A;  5FU6 C;  1Q7Y U;  2L8D A;  4L5G A;  4L59 A;  2VYT A;  2DL5 A;  5AYF A;  4R0K A;  3LW5 E;  2DD4 A;  2O9S A;  3HFN A;  1T3L A;  4JJC A;  4FYW B;  2F5K A;  4QQ6 A;  1VIE A;  3UDC A;  3VYH B;  3JCM c;  2DKG A;  4M78 A;  1GXI E;  1UHF A;  3NMZ C;  1M27 C;  2QTV A;  2X3X D;  4FW2 A;  1W2B P;  4C0F A;  3PTA A;  1KQS S;  1H8K A;  5FWC A;  2KNB B;  4XTW A;  2EKO A;  1K0S A;  1KQ2 A;  4DBR A;  4CC7 A;  2KT1 A;  2XDP A;  2E1H A;  1YJW A;  2XI9 A;  1X2Q A;  2DIG A;  3AT1 B;  5GMK i;  3OYK A;  1JEG A;  1NM7 A;  2IVW A;  3G4S T;  2OTL A;  3DKM A;  5IXF A;  1B34 A;  2M02 A;  1XQH A;  2RJC A;  1R77 A;  5GAO l;  2E5Q A;  3X26 B;  3MEV A;  1FWZ A;  1IHV A;  1MMD A;  1M1K R;  2J05 A;  2QAS A;  1S72 Q;  3RKY A;  1FMW A;  2PQW A;  1AWW A;  4AG1 C;  2MYS A;  4M7A D;  2F69 A;  2X4Y A;  3R6O A;  3SHW A;  1HYO A;  3JB9 G;  1VYU A;  2J6K A;  2K3B A;  3CEY A;  1D1A A;  1FYN A;  2OJ2 A;  1VQ6 T;  4JJN K;  4PJO C;  1X6O A;  1QWE A;  2V1R A;  3CCL Q;  1MMA A;  4GLM A;  2OX7 A;  1BK2 A;  3JAM E;  1Q81 U;  1RAE B;  1ZSZ C;  2QGG A;  3CCM T;  4E7K A;  3L2V A;  3TSZ A;  1TOV A;  3ME9 A;  2PZ1 A;  2GFA A;  4Z88 A;  1K4U S;  2A3L A;  1RUW A;  4PNO A;  2GTO A;  3M55 A;  2XD0 A;  2EIF A;  1UFF A;  2ZZD A;  2XG8 D;  2YLC A;  2QDY B;  1VQL T;  3FB9 A;  2COZ A;  4Z02 A;  1V1C A;  4M78 G;  2DNU A;  5GAM g;  4C0D C;  1M90 U;  3LGL A;  5LJ3 g;  3QZ9 B;  1YHQ A;  2ECZ A;  3GBQ A;  1AHJ B;  5GMK h;  2COY A;  1I8F A;  3PE0 A;  2EYX A;  3UA7 A;  1GL5 A;  1EIF A;  1BBZ A;  5CKD A;  1BIB A;  4HA8 A;  2O2O A;  4X9D A;  2LX7 A;  2JS2 A;  1R0B G;  5GAN h;  1MV0 B;  2CZ6 B;  2L2P A;  4PL6 A;  3GIB A;  1WIE A;  4II1 A;  2FL7 A;  1B07 A;  2RNA A;  3QXE B;  4QVZ A;  1KK7 A;  4C0G A;  1WZO A;  5GAO n;  3HRS A;  5IT9 E;  2HCK A;  1ZLM A;  2ED1 A;  3H0F A;  4FYV B;  4OB1 B;  3E1S A;  4FT4 A;  3SDZ A;  1VQ6 A;  1ZBJ A;  4PJO E;  4JRP A;  1EZZ B;  1ZUK A;  3CD6 T;  2NUP A;  4BI4 A;  1M4Z A;  4FSX A;  2YRD A;  3P8B B;  2GCX A;  4LD6 A;  3QYH B;  3MP6 A;  4XTZ A;  1PHT A;  2RO0 A;  3N5B B;  4OMN A;  1WXB A;  2KRO A;  4AMC A;  2GFU A;  2H3J A;  2NUZ A;  3E9G A;  3QPH A;  1QMC A;  5CKF A;  3NHN A;  3CCM A;  1GCQ A;  4M7D A;  1VQO T;  1NPR A;  1WQ7 A;  1WJQ A;  5AT1 B;  5J26 A;  1VQ4 Q;  2CT3 A;  3HL8 A;  2RMO A;  2VXE A;  3RBB B;  1SSH A;  2RPN A;  4B6M A;  4FM4 B;  1TH7 A;  5A0D A;  3OYG A;  3OYN A;  2XIC A;  1EFN A;  4OMM A;  1E6H A;  4C0D B;  1YNZ A;  4NL2 A;  1Q86 C;  1VQL A;  3ZBD A;  2CSQ A;  1Y96 B;  4OML A;  1OI1 A;  1WX6 A;  3QKJ A;  5GAM e;  3CCE Q;  2GBQ A;  1UJ0 A;  3V8J A;  5LJ3 e;  1OX9 A;  2DFU A;  2ZAE A;  3LYI A;  1JQQ A;  1YIJ T;  5FW9 A;  3VS4 A;  4QW2 A;  5GMK l;  4M75 F;  3CCQ Q;  3G71 T;  3OW2 S;  2X35 A;  3CCS T;  1S1N A;  2QQA A;  2A28 A;  3OYB A;  1F1B B;  4WTO B;  3CBO A;  2WSE E;  4MZM A;  1IB8 A;  1YJ9 Q;  5HCK A;  2RI5 A;  1X6G A;  5CKB A;  2YWW A;  2RK2 A;  3JCM g;  1HJD A;  3C12 A;  5KE3 A;  2WSC E;  3A1P A;  3S6W A;  4KUI A;  3DLL A;  3BDU A;  4Z89 A;  3VU3 C;  2NYS A;  1VQ9 T;  2ESW A;  3M58 A;  1IRE B;  1SKU B;  2BE9 B;  1X69 A;  1JU5 C;  5GAN 2;  3M0U A;  4XTY A;  3MKD A;  3BFM A;  1VA7 A;  2RQV A;  4E7J A;  2FYK A;  1AD5 A;  1E6G A;  2J6F A;  4PJM A;  3VS1 A;  5KYY B;  4AT1 B;  1KQ1 A;  1YWP A;  2CH4 W;  1OU8 A;  3G6E Q;  1R8O B;  4B9X A;  4M7D G;  4HT8 A;  2ROT A;  5GAM f;  4Y92 A;  1NJI U;  4LDY A;  5LJ3 f;  1K73 R;  2LVM A;  4M77 B;  1UEB A;  4BAC A;  1MMN A;  1HD3 A;  2VV5 A;  4C92 G;  2XKO C;  3OMC A;  1Q7Y R;  3QJY A;  2XK0 A;  4OGE A;  2MPX C;  2MOX A;  2YDL A;  1M1K U;  3L1A A;  1CSK A;  3VRZ A;  1KG1 A;  3PVQ A;  3QO3 A;  2ZPE B;  1Q95 G;  2JN0 A;  4RTX A;  3G71 A;  1TS9 A;  1XJW B;  4GY5 A;  3CCS A;  5M9O A;  2DEQ A;  1VQ7 T;  3TEE A;  3KFV A;  4M75 C;  8ATC B;  4E7S A;  3RUX A;  3QBY A;  1X27 A;  2FB7 A;  3JCM V;  4M78 E;  3L2U A;  2HL3 A;  3OQ5 A;  1S72 T;  3JCM e;  1UG1 A;  2J7I A;  1I07 A;  4NOY A;  3C95 A;  4E6R A;  1K8A R;  2O31 A;  1VQ9 A;  3M5A A;  1YCS B;  1B3Q A;  1ZX6 A;  1AWJ A;  1FXX A;  2K57 A;  3MEU A;  2EKH A;  5DLQ E;  2R5M A;  1B7T A;  1J3T A;  1WHJ A;  3M57 A;  2XDB A;  3CBM A;  2FZC B;  3GNF B;  4BE2 A;  2RN8 A;  1NG2 A;  2K9G A;  1AWX A;  1M1G A;  1WJS A;  2DMO A;  2ROL A;  3OYF A;  1RAC B;  4JJD A;  1H92 A;  3QG1 A;  2KXC A;  2FVU A;  1OX8 A;  4DEY A;  2DXC A;  2ZPB B;  1ZA2 B;  1GFC A;  2SEM A;  3EG3 A;  2A36 A;  3I5R A;  2LQW A;  2LCL A;  4JJB A;  1SG5 A;  3EG0 A;  1UE9 A;  3I35 A;  2K7A A;  2HKN A;  2RHZ A;  5GAN g;  1Q81 R;  3CPW A;  1AZE A;  1WA7 A;  4MML A;  2RHY A;  4M75 E;  3SWN B;  3CCU Q;  2VB6 A;  3WXM B;  1GCQ C;  3CQT A;  5HKC A;  1VQ5 Q;  2DIL A;  5D6Y A;  4RTT A;  2CYZ B;  3BDL A;  1WHK A;  4PJO A;  2LT1 A;  3E19 A;  2G3R A;  1G5V A;  2K79 A;  3GNG A;  3JCM f;  2RF0 A;  5A0G A;  2AKL A;  1IGU A;  4IUP A;  1FMK A;  1KIK A;  1S72 A;  2EWN A;  2QA4 Q;  4Y28 E;  1WLP B;  1O75 A;  2WAC A;  4FL6 A;  4P5N A;  4PLL A;  5C6S A;  1N8R C;  4XU2 A;  2B8A A;  1X6B A;  2BKD N;  2L3P A;  1VQM Q;  2MI6 A;  4C8Q D;  3OS5 A;  3LWH A;  2AHJ B;  3CCL A;  2JM9 A;  2HZY A;  3G7Z A;  2H3E B;  5GJV B;  2E12 A;  2GGR A;  5KYW B;  3OYA A;  3TU4 K;  3C0C A;  5I2S A;  2E64 A;  1ZQ1 A;  5DY9 A;  4A63 B;  3MEW A;  5IXB A;  1D1C A;  2LQN A;  4AFU C;  3T9N A;  4DA4 A;  1M1F A;  2OAU A;  1Q82 U;  1WDX A;  4IUQ A;  1MGQ A;  3CME Q;  1BKB A;  3CC7 Q;  4MZT A;  1H64 1;  3PIP A;  5C0M A;  1CKA A;  3H0H A;  1WHG A;  5GMK e;  2C0O A;  2BZY A;  2VC8 A;  2D9T A;  1PNJ A;  3CCE T;  3EFS A;  5GAN e;  5CCA A;  2KBT A;  3EG1 A;  4M7A F;  4M4Z A;  4KBM B;  2DYI A;  2QG9 B;  1ZUU A;  4OVA A;  2JMC A;  3FC3 A;  4J6Y A;  2NWM A;  4DBF A;  1Y7X A;  3O8V A;  2CGH A;  4WCI A;  4J9B A;  3CCQ T;  1O9S A;  2DER A;  3HSB A;  3CXC S;  2QYZ A;  1JJ2 S;  4FCY A;  3ASK A;  1K9A A;  2I2L A;  4PJO G;  1YJW T;  1UEC A;  3GOX A;  2DM1 A;  3VS6 A;  3TCJ A;  1C1A A;  4AFZ C;  1D0X A;  1MMG A;  2CRE A;  2DYB A;  3V7R A;  2KDS A;  1PG5 B;  3JCM X;  3QWX X;  2CP0 A;  2RHX A;  1G3S A;  3M9Q A;  1KQS A;  2V8J A;  1H3Z A;  3JB9 I;  2QGF B;  4LE9 A;  4F7U B;  5KYY A;  4OB2 B;  3VS0 A;  2BE7 D;  2OI3 A;  2CP6 A;  1K73 U;  4Y91 A;  4E7I A;  3SEM A;  1WI7 A;  1OV3 A;  4M77 A;  2LNH B;  4BE0 A;  2HQH A;  1VQ4 A;  2R58 A;  3TRE A;  3NPF A;  2EQM A;  2HNI A;  2A7Y A;  2GNC A;  1KC8 C;  3OS1 A;  2XID A;  3A8O B;  2NLU A;  3S3M A;  1I5O B;  5GAM j;  1I0C A;  2QDL A;  5LJ3 j;  4BE1 A;  2DO3 A;  4LD9 K;  5GAN f;  1HSQ A;  5FU7 B;  2X3W D;  2JW4 A;  3CCE A;  1QCF A;  2D1X A;  2VGM A;  4FYX B;  2YUP A;  5GAN 8;  2B86 A;  4R55 A;  2K6D A;  4GLK A;  2X4X A;  2EQI A;  1K0X A;  2KEA A;  1LPL A;  4M7A C;  2EFI A;  5GAM d;  2DK3 A;  3SB2 A;  4E7H A;  5LJ3 d;  4F17 A;  3CCQ A;  1KHI A;  4JUV A;  3HRU A;  3M0S A;  3M54 A;  1K8A U;  1YHQ T;  4BUG A;  1JRI A;  5CO7 A;  1NJI R;  4HCB A;  3OSV A;  3M59 A;  4LN2 A;  2LCS A;  1YJ9 A;  1IZ6 A;  3CBP A;  2DVE A;  2ED0 A;  2DRM A;  1M5Q 1;  1NE8 A;  2VVK A;  5ECA A;  4OP0 A;  3J80 E;  1UGP B;  2FZK B;  1ZUY A;  4QQD A;  4QQG A;  3L2W A;  1U1T A;  6AT1 B;  2JT4 A;  2CH4 A;  3EGD B;  4J9H A;  3UA6 A;  2EPD A;  3J81 E;  3NTI A;  2RJD A;  4ORZ A;  2K2M A;  4ANJ A;  1K9M C;  3UF4 A;  2KRS A;  4LDX A;  3M0Q A;  3G6E A;  4CC4 B;  2F5T X;  4M77 G;  1WHL A;  4JS5 A;  5KCO A;  5A2Q E;  1WHH A;  2LJ3 A;  4PK4 A;  2F2V A;  2LNV A;  4ATO A;  4M75 A;  5CAI A;  5GJW B;  3E2U A;  5FRO A;  2M9U A;  3SWN A;  4M7A B;  3LLR A;  2EYQ A;  4A54 A;  3JCM J;  3JCM b;  4M7A E;  1G2B A;  1VQP Q;  5D6W A;  1GCP A;  2MIO A;  1VIF A;  1W70 A;  4C5G A;  1QP3 A;  4M77 F;  2CP7 A;  1QVF S;  4C5H A;  3CC4 Q;  1A0N B;  1QP2 A;  2P4R A;  2MMP A;  1YI2 Q;  2M1H A;  4XU3 A;  1FMV A;  1N27 A;  2LC4 A;  2YSQ A;  4HVW A;  4BB7 A;  2E3H A;  1LJO A;  4KUL A;  2DA9 A;  1YIT Q;  2ZPF B;  3VJP A;  2QXF A;  3EH2 A;  2DTO A;  4FYY B;  5FRN A;  4PFO A;  1VQM T;  1GRI A;  5LJ5 h;  3JCM d;  2EQU A;  5IHI A;  1YN8 A;  1WQW A;  2CSI A;  4LDW A;  1QVG S;  4BI8 B;  3OY9 A;  1M2V B;  5KYX B;  2CP3 A;  4MDW A;  4RCB A;  3VUZ A;  5I21 A;  2RI3 A;  1I5L A;  2DEU A;  1D3B A;  1G3W A;  4V2S A;  2QTX A;  3OW2 A;  1CKB A;  4PLI A;  4FIB A;  2HKQ B;  4X34 A;  3KXT A;  3L2Z A;  1SSF A;  3RKX A;  1TSF A;  3CME T;  4K11 A;  2YUQ A;  2COW A;  4E47 A;  3CC7 T;  3AHU A;  2ZPG B;  1TUC A;  4PJL A;  1Y71 A;  2PVG B;  4TVR A;  1YJN Q;  4JRQ A;  4M75 G;  1MNE A;  3HKS A;  2X9H A;  2EVR A;  3MP1 A;  3S3O A;  2BTT A;  2LP5 A;  5KH6 A;  2DL8 A;  1BI1 A;  1QQJ A;  1UHC A;  1X43 A;  1Q82 R;  2P0P A;  3EFO B;  4EMK B;  4OGC A;  3CCU A;  5IHK A;  4CRI A;  3HFO A;  4BY6 B;  2FG0 A;  1VQ5 A;  2DX1 A;  4M77 C;  4HKE A;  2KY9 A;  2MWO A;  3INZ A;  1N8R U;  3FIF A;  3CCJ Q;  2L89 A;  2KYM A;  1PSF A;  4X9C A;  5A0L A;  1Q7Y C;  1NBE B;  2QA4 A;  2R57 A;  4FW1 A;  3CPW P;  1KD1 C;  2JTF A;  5D6X A;  1GBQ A;  2LCC A;  2KRM A;  2FO0 A;  3HP9 A;  2KAF A;  1VQM A;  3HTR A;  3M0T A;  1M9S A;  8AT1 B;  1QKX A;  3QYG B;  1I81 A;  2E65 A;  3JB9 D;  1RI0 A;  2QQ9 A;  1WNL A;  2EQK A;  2KI7 A;  5GAO q;  1NYG A;  3BY7 A;  2IPO B;  1UGR B;  1TXQ A;  2IIM A;  1I1J A;  3OYH A;  1T0J A;  4PFZ A;  3V7C A;  1PCX A;  3CME A;  3JV3 A;  3VS3 A;  2AZV A;  1Z9Q A;  3OBY A;  3M0R A;  4N0A C;  3CC7 A;  5GMK j;  1W6X A;  2RK1 A;  3D7S B;  3RMS A;  2HQE A;  1W2B S;  2DBM A;  2GF7 A;  2VUB A;  1WPY A;  5CVI A;  1PRM C;  4MMK A;  5GAN j;  1VQN Q;  4AFS C;  2I0N A;  2LQ8 A;  2XHC A;  2DRK A;  3UWN A;  2M0O A;  3A8L B;  4QKU A;  4DBQ A;  1D0Y A;  1Q86 R;  2HBP A;  3OYD A;  4M77 E;  2KR3 A;  4OMF B;  3M53 A;  4DOW A;  4M78 D;  4C8Q F;  1N6A A;  4RCC A;  1M3A A;  3DB3 A;  1NLP C;  2V8K A;  1Y57 A;  3X20 B;  4IUT A;  2CP2 A;  2QI2 A;  2DZC A;  4HCC A;  3TVT A;  2RD1 A;  4LUE A;  4QVD A;  3HHT B;  3EH1 A;  2EJF A;  3EGD A;  1PSE A;  2OTJ Q;  2K2V A;  3SWN C;  5CKE A;  2CZ7 B;  4IUR A;  1M2O A;  4A4H A;  3I55 Q;  2EGC A;  3BW1 A;  2J6O A;  1RAA B;  1BCO A;  3DB4 A;  1KC8 U;  4JLG A;  4RG2 A;  3MET A;  3H6Z A;  3G4S Q;  3Q1J A;  3U23 A;  4XTX A;  1M90 C;  3LX7 A;  3CCL T;  1KQS P;  4F7U F;  4M7A A;  3V8L A;  5GAN 3;  3EAE A;  2D8H A;  1WFW A;  3QSU A;  1NEG A;  3EG2 A;  4PFP A;  3PVL A;  4RTW A;  1VOM A;  2Y4X A;  1OQK A;  2DL3 A;  4J83 A;  1C0M A;  2L3R A;  4NS5 A;  5L8R E;  2MWP A;  1QVP A; 
#chains in the Genus database with same CATH homology
 4AFZ C;  1M8M A;  3REA B;  2VKN A;  2CRE A;  2DYB A;  2HDA A;  3TSZ A;  2E5K A;  4RTV A;  2PZ1 A;  3QWX X;  4Z88 A;  1K4U S;  1GBR A;  1RUW A;  1NLO C;  2GTO A;  4LE9 A;  1ABQ A;  3EGU A;  5FWB A;  4F14 A;  1UFF A;  2DJQ A;  4IIM A;  3VS0 A;  2OI3 A;  3EHQ A;  1V1C A;  2CT4 A;  1AVZ C;  2DNU A;  3SEM A;  3THK A;  1WI7 A;  1KSW A;  1OV3 A;  2LNH B;  1NEB A;  2L3Q A;  2ECZ A;  3GBQ A;  1RLP C;  1UDL A;  3NPF A;  3PE0 A;  1NYF A;  2EYX A;  4GBQ A;  3UA7 A;  2GNC A;  1GL5 A;  1BBZ A;  2HBW A;  2O2O A;  4RTY A;  3UAT A;  2LX7 A;  2JS2 A;  2CDT A;  1I0C A;  1MV0 B;  2QDL A;  1ABO A;  2L2P A;  4HVV A;  4Z8A A;  1WIE A;  2DLP A;  1B07 A;  1HSQ A;  1AWO A;  3I9Q A;  4DEX A;  1AEY A;  4D8D A;  1W1F A;  2RNA A;  1OPK A;  2SRC A;  2JW4 A;  2X3W D;  2VWF A;  1M30 A;  3ZL7 C;  1QCF A;  2D1X A;  1ARK A;  3I5S A;  2YUP A;  2B86 A;  2K6D A;  2HCK A;  4EIK A;  1ZLM A;  1Z9Z A;  2ED1 A;  3H0F A;  2EQI A;  1K0X A;  2JXB A;  2KEA A;  1ZBJ A;  2W0Z A;  1ZUK A;  4RUG A;  4F17 A;  2LJ1 A;  3M0S A;  1N5Z A;  2GTJ A;  1PHT A;  1QLY A;  3VS7 A;  4LN2 A;  1IO6 A;  4OMN A;  1WXB A;  2KRO A;  2NUZ A;  2LCS A;  4X1V A;  3NHN A;  2YUO A;  1T0H A;  1GCQ A;  2ED0 A;  2KXD A;  2DRM A;  2CUB A;  2VVK A;  5ECA A;  2CT3 A;  2RMO A;  2C0I A;  3RBB B;  1SSH A;  2RPN A;  1ZUY A;  1EFN A;  4OMM A;  1E6H A;  5IHN A;  2JT4 A;  1YNZ A;  2CH4 A;  4J9H A;  3UA6 A;  2RQT A;  2DL4 A;  2CSQ A;  2EPD A;  2H8H A;  2FRY A;  4OML A;  1WX6 A;  4ORZ A;  2K2M A;  2KE9 A;  2GBQ A;  1UJ0 A;  1SRL A;  2FEI A;  3UF4 A;  2KRS A;  4LNP A;  3M0Q A;  4CC4 B;  1JQQ A;  1VYV A;  1PKS A;  5FW9 A;  2JM8 A;  3VS4 A;  2O88 A;  2RQU A;  2LJ3 A;  2F2V A;  3REB B;  1AZG B;  1S1N A;  1AOJ A;  2DVJ A;  5GJW B;  4HXJ A;  2A28 A;  1JO8 A;  2C0T A;  2EW3 A;  2EYZ A;  2DF6 A;  2EBP A;  2DBK A;  5HCK A;  1X6G A;  1G2B A;  2AKK A;  1UJY A;  1K76 A;  1HJD A;  4J9F A;  2XMF A;  1GCP A;  2MIO A;  1SPK A;  1W70 A;  2KT8 A;  3H0I A;  4Z89 A;  1A0N B;  2ESW A;  2P4R A;  3M0P A;  1WXU A;  1X69 A;  1JU5 C;  4CC3 A;  3ULR B;  3M0U A;  4FSS A;  2G6F X;  1VA7 A;  2RQV A;  1AD5 A;  3O5Z A;  1E6G A;  2J6F A;  4OMQ A;  1RI9 A;  3VS1 A;  2YSQ A;  1YWO A;  1KJW A;  1SRM A;  4HVW A;  1Y0M A;  1PWT A;  3LH5 A;  1YWP A;  1U3O A;  2CH4 W;  2DA9 A;  1UGV A;  4OMP A;  1SHF A;  2ROT A;  1GRI A;  4Y92 A;  5IHI A;  4J9D A;  1YN8 A;  2CSI A;  2JS0 A;  2CUD A;  1BB9 A;  1HD3 A;  1SHG A;  1UTI A;  2D0N A;  4KRT A;  4JPB W;  1X2K A;  4JZ3 A;  3VS2 A;  4J9E A;  1CKB A;  2MOX A;  2YDL A;  3VRY A;  4JZ4 A;  2LZ6 B;  1CSK A;  4LUD A;  3VRZ A;  5EC7 A;  2RQR A;  3PVQ A;  1U06 A;  2AZS A;  2AK5 A;  1H3H A;  4RTX A;  4K11 A;  2EYW A;  2YUQ A;  3KFV A;  1TUC A;  2L3S A;  1JXO A;  2M51 A;  2V1Q A;  1X27 A;  1RLQ C;  2EYY A;  2HEQ A;  1OOT A;  2EVR A;  2LMJ A;  2BTT A;  2LP5 A;  2DL8 A;  5I11 A;  1WXT A;  2F2W A;  4CC2 A;  2KRN A;  1UG1 A;  1UUE A;  2J7I A;  1I07 A;  1UHC A;  1PRL C;  1X43 A;  4ZNX A;  4E6R A;  2O31 A;  5IHK A;  1YCS B;  1B3Q A;  2FG0 A;  1ZX6 A;  1AWJ A;  2DX1 A;  1XOV A;  1BU1 A;  2DL7 A;  1WYX A;  2EKH A;  2EGE A;  1E7O A;  2M0Y A;  2DE0 X;  1J3T A;  1KFZ A;  2KYM A;  3VS5 A;  2F2X A;  3IQL A;  2FPD A;  2A37 A;  2FRW A;  1U5S A;  2RN8 A;  2D8J A;  1GFD A;  1NG2 A;  2K9G A;  1AWX A;  1PKT A;  2ABL A;  1GBQ A;  2BZ8 A;  2KYB A;  2KRM A;  1MV3 A;  2DMO A;  2FO0 A;  3TSW A;  1LCK A;  2OAW A;  2ROL A;  4J9C A;  4JJD A;  1H92 A;  2J06 A;  2KXC A;  3M0T A;  5IH2 A;  4DEY A;  3NGP A;  4HCK A;  1GFC A;  2SEM A;  1QKX A;  3EG3 A;  2A36 A;  3I5R A;  1JXM A;  2W10 A;  2LQW A;  4JJB A;  2KGT A;  4IIO A;  3FJ5 A;  2HSP A;  5L23 A;  3EG0 A;  4ESR A;  4RTU A;  1OPL A;  1UE9 A;  3I35 A;  2K7A A;  3QWY A;  1NYG A;  2FPF A;  1OEB A;  1QWF A;  1QKW A;  2IIM A;  1I1J A;  1T0J A;  2FPE A;  1TG0 A;  2PNI A;  1AZE A;  2JMA A;  3JV3 A;  3VS3 A;  4AFQ C;  1WA7 A;  2AZV A;  1Z9Q A;  3M0R A;  2ENM A;  1W6X A;  3RNJ A;  1GCQ C;  3CQT A;  4OMO A;  4RTZ A;  2YT6 A;  2DIL A;  2MCN A;  2DBM A;  4RTT A;  1M3B A;  2K79 A;  2A08 A;  1PRM C;  1VYT A;  2RF0 A;  1K1Z A;  2AKL A;  2YUN A;  4AFS C;  5I22 A;  2I0N A;  1FMK A;  2L0A A;  2DRK A;  1KIK A;  2DL5 A;  4R0K A;  2O9S A;  1G83 A;  1WLP B;  4AG2 C;  3A98 A;  1T3L A;  4JJC A;  2O9V A;  1X6B A;  2KR3 A;  3EHR A;  2L3P A;  2LJ0 A;  4J9G A;  1M3A A;  1NLP C;  1Y57 A;  2JM9 A;  1UHF A;  3NMZ C;  5GJV B;  2GGR A;  1M27 C;  2X3X D;  3TVT A;  3C0C A;  4LUE A;  4A63 B;  1H8K A;  2GQI A;  5FWC A;  5IXB A;  2KNB B;  2LQN A;  4AFU C;  1K0S A;  4J9I A;  1WDX A;  4CC7 A;  2KT1 A;  4QT7 A;  2PTK A;  1X2Q A;  1JEG A;  1NM7 A;  5IXF A;  3R6N A;  4F16 A;  2EGC A;  2J6O A;  1CKA A;  3H41 A;  3H0H A;  2C0O A;  1MUZ A;  2J05 A;  2BZY A;  4D8K A;  3U23 A;  1PNJ A;  1AWW A;  4AG1 C;  4HVU A;  3SHW A;  2KBT A;  2EGA A;  3EG1 A;  4M4Z A;  1VYU A;  2J6K A;  1T3S A;  1ZUU A;  2K3B A;  2JMC A;  1FYN A;  2OJ2 A;  2NWM A;  1SEM A;  4WCI A;  2D8H A;  4J9B A;  1WFW A;  1NEG A;  2BZX A;  3EG2 A;  1QWE A;  2V1R A;  1M3C A;  1K9A A;  4GLM A;  1TUD A;  3PVL A;  4RTW A;  1ZSG A;  1BK2 A;  2DL3 A;  2RQW A;  2JTE A;  1UEC A;  2DM1 A;  1YP5 A;  3VS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...